F493514
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1381 | 499 | 1359 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300005406|Ga0070703_10216051|Ga0070703_102160512 |
| Length | 190 |
| Sequence | MTPTPTTPLLADHVKQAKQAMDKSVDAVKREFSTVRTGKATTSLLDLVRVDAYGSEMPLNQVASVAAPEPKLLTIQPWDKGLLKAVEKAILASDLGLTPSNDGNLIRIPLPPLNEERRRELVKVVHKFAEEGRVAIRHARTEAISKVKKTEHVSEDEKKHTEKDVQKLHDDHLRQVDEAVKAKEAEIMEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 4 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 5 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 6 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 7 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 8 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 9 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 10 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 11 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 12 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 13 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 14 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 15 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 16 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 17 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 18 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 19 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 20 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 21 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 22 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 23 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 24 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 25 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 26 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 27 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 28 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 31 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 32 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 127 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 128 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 129 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 135 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 167 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 263 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 292 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 295 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 297 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 298 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 299 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 300 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 301 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 307 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 308 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 309 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 391 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 392 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 393 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 394 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 395 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 398 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 436 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 437 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 438 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 439 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 440 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 441 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 442 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 443 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 444 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 449 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 450 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 451 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 470 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 472 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 473 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 474 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 475 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 476 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 481 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 482 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 483 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 484 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 485 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 486 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 489 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 490 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 491 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 493 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 495 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 496 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0.43 |
| Isolates | 1.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.55 |
| Nodule | 0.07 |
| Rhizoplane | 1.81 |
| Rhizosphere | 89.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3476705 | 2162886007 | Bacteria | 2292 |
| 2 | JGI24736J21556_1008912 | 3300001904 | Bacteria | 1662 |
| 3 | JGI24752J21851_1002825 | 3300001976 | Bacteria | 2307 |
| 4 | JGI24740J21852_10035970 | 3300001979 | Bacteria | 1542 |
| 5 | JGI24739J22299_10011607 | 3300001989 | Bacteria | 3250 |
| 6 | JGI24737J22298_10002260 | 3300001990 | Bacteria | 6863 |
| 7 | JGI24735J21928_10005029 | 3300002067 | Bacteria | 4401 |
| 8 | JGI24748J21848_1007217 | 3300002074 | Bacteria | 1301 |
| 9 | rootL2_10047888 | 3300003322 | Bacteria | 2330 |
| 10 | Ga0055532_1000736 | 3300003758 | Bacteria | 11948 |
| 11 | Ga0055530_10024341 | 3300003791 | Bacteria | 1718 |
| 12 | Ga0058862_12766732 | 3300004803 | Bacteria | 1121 |
| 13 | Ga0065165_1005594 | 3300005262 | Bacteria | 6969 |
| 14 | Ga0065704_10070273 | 3300005289 | Bacteria | 42544 |
| 15 | Ga0065704_10228061 | 3300005289 | Bacteria | 1052 |
| 16 | Ga0065712_10268430 | 3300005290 | Bacteria | 921 |
| 17 | Ga0065712_10273635 | 3300005290 | Bacteria | 910 |
| 18 | Ga0065715_10208396 | 3300005293 | Bacteria | 1313 |
| 19 | Ga0065707_10156161 | 3300005295 | Bacteria | 1606 |
| 20 | Ga0065707_10184341 | 3300005295 | Bacteria | 1398 |
| 21 | Ga0065707_10514479 | 3300005295 | Bacteria | 747 |
| 22 | Ga0070658_10009041 | 3300005327 | Bacteria | 8014 |
| 23 | Ga0070658_10023796 | 3300005327 | Bacteria | 4912 |
| 24 | Ga0070658_10140495 | 3300005327 | Bacteria | 2017 |
| 25 | Ga0070658_10185935 | 3300005327 | Bacteria | 1750 |
| 26 | Ga0070676_10001338 | 3300005328 | Bacteria | 12376 |
| 27 | Ga0070683_100011534 | 3300005329 | Bacteria | 7646 |
| 28 | Ga0070683_100100523 | 3300005329 | Bacteria | 2722 |
| 29 | Ga0070690_100590120 | 3300005330 | Bacteria | 842 |
| 30 | Ga0070670_100006075 | 3300005331 | Bacteria | 10214 |
| 31 | Ga0070670_100067835 | 3300005331 | Bacteria | 3060 |
| 32 | Ga0070670_100270083 | 3300005331 | Bacteria | 1484 |
| 33 | Ga0070670_100388569 | 3300005331 | Bacteria | 1230 |
| 34 | Ga0070670_100481995 | 3300005331 | Bacteria | 1102 |
| 35 | Ga0070670_100551229 | 3300005331 | Bacteria | 1029 |
| 36 | Ga0070677_10003562 | 3300005333 | Bacteria | 5023 |
| 37 | Ga0068869_100001046 | 3300005334 | Bacteria | 16121 |
| 38 | Ga0068869_100772626 | 3300005334 | Unclassified | 824 |
| 39 | Ga0070666_10091777 | 3300005335 | Bacteria | 2087 |
| 40 | Ga0070666_10258004 | 3300005335 | Bacteria | 1235 |
| 41 | Ga0070666_10280251 | 3300005335 | Bacteria | 1185 |
| 42 | Ga0070666_10469668 | 3300005335 | Bacteria | 910 |
| 43 | Ga0070680_100000206 | 3300005336 | Bacteria | 38666 |
| 44 | Ga0070680_100005245 | 3300005336 | Bacteria | 9807 |
| 45 | Ga0070680_100043681 | 3300005336 | Bacteria | 3640 |
| 46 | Ga0070680_100055182 | 3300005336 | Bacteria | 3246 |
| 47 | Ga0070680_100081380 | 3300005336 | Bacteria | 2672 |
| 48 | Ga0070680_100123681 | 3300005336 | Bacteria | 2161 |
| 49 | Ga0070680_100767975 | 3300005336 | Bacteria | 830 |
| 50 | Ga0070680_100852438 | 3300005336 | Bacteria | 785 |
| 51 | Ga0070682_101350022 | 3300005337 | Unclassified | 608 |
| 52 | Ga0068868_100008151 | 3300005338 | Bacteria | 7498 |
| 53 | Ga0068868_100367684 | 3300005338 | Bacteria | 1235 |
| 54 | Ga0070660_100008554 | 3300005339 | Bacteria | 7166 |
| 55 | Ga0070660_100015441 | 3300005339 | Bacteria | 5515 |
| 56 | Ga0070660_100058949 | 3300005339 | Bacteria | 2977 |
| 57 | Ga0070660_100545427 | 3300005339 | Bacteria | 967 |
| 58 | Ga0070660_100862697 | 3300005339 | Bacteria | 763 |
| 59 | Ga0070689_100016069 | 3300005340 | Bacteria | 5474 |
| 60 | Ga0070689_100039876 | 3300005340 | Bacteria | 3597 |
| 61 | Ga0070689_100306229 | 3300005340 | Bacteria | 1324 |
| 62 | Ga0070691_10068913 | 3300005341 | Bacteria | 1713 |
| 63 | Ga0070691_10207304 | 3300005341 | Bacteria | 1033 |
| 64 | Ga0070687_100091666 | 3300005343 | Bacteria | 1682 |
| 65 | Ga0070687_100145220 | 3300005343 | Bacteria | 1386 |
| 66 | Ga0070661_100003226 | 3300005344 | Bacteria | 11237 |
| 67 | Ga0070661_100020303 | 3300005344 | Bacteria | 4736 |
| 68 | Ga0070661_100031136 | 3300005344 | Bacteria | 3857 |
| 69 | Ga0070661_100110416 | 3300005344 | Unclassified | 2053 |
| 70 | Ga0070661_100384462 | 3300005344 | Bacteria | 1107 |
| 71 | Ga0070661_100570307 | 3300005344 | Bacteria | 912 |
| 72 | Ga0070661_101342487 | 3300005344 | Bacteria | 600 |
| 73 | Ga0070692_10086845 | 3300005345 | Bacteria | 1694 |
| 74 | Ga0070692_10101147 | 3300005345 | Bacteria | 1580 |
| 75 | Ga0070692_10161796 | 3300005345 | Bacteria | 1283 |
| 76 | Ga0070692_10206604 | 3300005345 | Bacteria | 1153 |
| 77 | Ga0070668_100003214 | 3300005347 | Bacteria | 12037 |
| 78 | Ga0070668_100059198 | 3300005347 | Bacteria | 2965 |
| 79 | Ga0070668_100880158 | 3300005347 | Bacteria | 800 |
| 80 | Ga0070669_100003091 | 3300005353 | Bacteria | 11983 |
| 81 | Ga0070669_100004070 | 3300005353 | Bacteria | 10585 |
| 82 | Ga0070669_100005923 | 3300005353 | Bacteria | 8822 |
| 83 | Ga0070669_100006591 | 3300005353 | Bacteria | 8358 |
| 84 | Ga0070669_100647778 | 3300005353 | Bacteria | 888 |
| 85 | Ga0070675_100010460 | 3300005354 | Bacteria | 7249 |
| 86 | Ga0070675_100032603 | 3300005354 | Bacteria | 4217 |
| 87 | Ga0070675_100050984 | 3300005354 | Bacteria | 3399 |
| 88 | Ga0070675_100295667 | 3300005354 | Bacteria | 1426 |
| 89 | Ga0070675_101329155 | 3300005354 | Bacteria | 662 |
| 90 | Ga0070671_100017519 | 3300005355 | Bacteria | 5804 |
| 91 | Ga0070671_100034005 | 3300005355 | Bacteria | 4219 |
| 92 | Ga0070671_100089835 | 3300005355 | Bacteria | 2572 |
| 93 | Ga0070671_100135503 | 3300005355 | Bacteria | 2076 |
| 94 | Ga0070671_100287392 | 3300005355 | Bacteria | 1399 |
| 95 | Ga0070671_100773801 | 3300005355 | Unclassified | 835 |
| 96 | Ga0070674_100036769 | 3300005356 | Bacteria | 3289 |
| 97 | Ga0070673_100216339 | 3300005364 | Bacteria | 1656 |
| 98 | Ga0070673_100337301 | 3300005364 | Bacteria | 1335 |
| 99 | Ga0070673_100597198 | 3300005364 | Bacteria | 1007 |
| 100 | Ga0070673_101464189 | 3300005364 | Bacteria | 643 |
| 101 | Ga0070673_101464190 | 3300005364 | Unclassified | 643 |
| 102 | Ga0070688_100017268 | 3300005365 | Bacteria | 4140 |
| 103 | Ga0070659_100004329 | 3300005366 | Bacteria | 10138 |
| 104 | Ga0070659_100119172 | 3300005366 | Bacteria | 2136 |
| 105 | Ga0070659_100143173 | 3300005366 | Bacteria | 1947 |
| 106 | Ga0070659_100193879 | 3300005366 | Bacteria | 1671 |
| 107 | Ga0070659_100417976 | 3300005366 | Bacteria | 1134 |
| 108 | Ga0070667_100002812 | 3300005367 | Bacteria | 15011 |
| 109 | Ga0070667_100008633 | 3300005367 | Bacteria | 8446 |
| 110 | Ga0070667_100011180 | 3300005367 | Bacteria | 7426 |
| 111 | Ga0070667_100023300 | 3300005367 | Bacteria | 5135 |
| 112 | Ga0070667_100098366 | 3300005367 | Bacteria | 2525 |
| 113 | Ga0070667_100165741 | 3300005367 | Bacteria | 1949 |
| 114 | Ga0070703_10069069 | 3300005406 | Bacteria | 1176 |
| 115 | Ga0070703_10216051 | 3300005406 | Bacteria | 761 |
| 116 | Ga0070709_10002860 | 3300005434 | Bacteria | 9330 |
| 117 | Ga0070709_10064529 | 3300005434 | Bacteria | 2342 |
| 118 | Ga0070709_10147409 | 3300005434 | Bacteria | 1623 |
| 119 | Ga0070714_100015492 | 3300005435 | Bacteria | 6131 |
| 120 | Ga0070714_100028375 | 3300005435 | Bacteria | 4643 |
| 121 | Ga0070714_100319241 | 3300005435 | Bacteria | 1452 |
| 122 | Ga0070714_100410941 | 3300005435 | Bacteria | 1281 |
| 123 | Ga0070714_100540160 | 3300005435 | Bacteria | 1115 |
| 124 | Ga0070713_100007021 | 3300005436 | Bacteria | 7864 |
| 125 | Ga0070713_100020561 | 3300005436 | Bacteria | 5064 |
| 126 | Ga0070713_100120522 | 3300005436 | Bacteria | 2300 |
| 127 | Ga0070713_100287896 | 3300005436 | Bacteria | 1509 |
| 128 | Ga0070701_10011686 | 3300005438 | Bacteria | 3938 |
| 129 | Ga0070701_10053321 | 3300005438 | Bacteria | 2104 |
| 130 | Ga0070701_10090699 | 3300005438 | Bacteria | 1674 |
| 131 | Ga0070711_100000763 | 3300005439 | Bacteria | 16750 |
| 132 | Ga0070711_100043432 | 3300005439 | Bacteria | 3044 |
| 133 | Ga0070711_100103221 | 3300005439 | Bacteria | 2077 |
| 134 | Ga0070711_100548056 | 3300005439 | Bacteria | 959 |
| 135 | Ga0070705_100004409 | 3300005440 | Bacteria | 6855 |
| 136 | Ga0070705_100006184 | 3300005440 | Bacteria | 5862 |
| 137 | Ga0070705_100301220 | 3300005440 | Bacteria | 1149 |
| 138 | Ga0070700_100012422 | 3300005441 | Bacteria | 4752 |
| 139 | Ga0070700_100130222 | 3300005441 | Bacteria | 1697 |
| 140 | Ga0070694_100005166 | 3300005444 | Bacteria | 7875 |
| 141 | Ga0070694_100007601 | 3300005444 | Bacteria | 6614 |
| 142 | Ga0070694_100011744 | 3300005444 | Bacteria | 5428 |
| 143 | Ga0070694_100039862 | 3300005444 | Bacteria | 3129 |
| 144 | Ga0070694_100049828 | 3300005444 | Bacteria | 2821 |
| 145 | Ga0070694_100062238 | 3300005444 | Bacteria | 2549 |
| 146 | Ga0070694_100065662 | 3300005444 | Bacteria | 2487 |
| 147 | Ga0070694_100093833 | 3300005444 | Bacteria | 2110 |
| 148 | Ga0070694_100128137 | 3300005444 | Bacteria | 1830 |
| 149 | Ga0070694_100238942 | 3300005444 | Bacteria | 1370 |
| 150 | Ga0070694_100436182 | 3300005444 | Bacteria | 1032 |
| 151 | Ga0070694_101052501 | 3300005444 | Bacteria | 677 |
| 152 | Ga0070708_100003104 | 3300005445 | Bacteria | 12931 |
| 153 | Ga0070708_100023798 | 3300005445 | Bacteria | 5212 |
| 154 | Ga0070708_100045450 | 3300005445 | Bacteria | 3868 |
| 155 | Ga0070708_100263627 | 3300005445 | Bacteria | 1620 |
| 156 | Ga0070708_100603490 | 3300005445 | Bacteria | 1035 |
| 157 | Ga0070663_100098153 | 3300005455 | Bacteria | 2182 |
| 158 | Ga0070663_100168187 | 3300005455 | Bacteria | 1692 |
| 159 | Ga0070678_100119539 | 3300005456 | Bacteria | 2075 |
| 160 | Ga0070662_100000491 | 3300005457 | Bacteria | 23522 |
| 161 | Ga0070662_100079964 | 3300005457 | Bacteria | 2432 |
| 162 | Ga0070662_100092931 | 3300005457 | Bacteria | 2268 |
| 163 | Ga0070662_100478267 | 3300005457 | Unclassified | 1037 |
| 164 | Ga0070662_100583617 | 3300005457 | Bacteria | 939 |
| 165 | Ga0070681_10001510 | 3300005458 | Bacteria | 20612 |
| 166 | Ga0070681_10001743 | 3300005458 | Bacteria | 19490 |
| 167 | Ga0070681_10015442 | 3300005458 | Bacteria | 7603 |
| 168 | Ga0070681_10100356 | 3300005458 | Bacteria | 2840 |
| 169 | Ga0070681_10211006 | 3300005458 | Bacteria | 1858 |
| 170 | Ga0068867_100101141 | 3300005459 | Bacteria | 2202 |
| 171 | Ga0068867_100145152 | 3300005459 | Bacteria | 1859 |
| 172 | Ga0068867_100170171 | 3300005459 | Bacteria | 1725 |
| 173 | Ga0070685_10022699 | 3300005466 | Bacteria | 3425 |
| 174 | Ga0070685_10197847 | 3300005466 | Bacteria | 1304 |
| 175 | Ga0070706_100004050 | 3300005467 | Bacteria | 14237 |
| 176 | Ga0070706_100009104 | 3300005467 | Bacteria | 9247 |
| 177 | Ga0070706_100019882 | 3300005467 | Bacteria | 6191 |
| 178 | Ga0070706_100025904 | 3300005467 | Bacteria | 5397 |
| 179 | Ga0070706_100175207 | 3300005467 | Bacteria | 2003 |
| 180 | Ga0070706_100324018 | 3300005467 | Bacteria | 1437 |
| 181 | Ga0070706_100438411 | 3300005467 | Bacteria | 1216 |
| 182 | Ga0070706_100498172 | 3300005467 | Bacteria | 1133 |
| 183 | Ga0070707_100009027 | 3300005468 | Bacteria | 9247 |
| 184 | Ga0070707_100013395 | 3300005468 | Bacteria | 7669 |
| 185 | Ga0070707_100204293 | 3300005468 | Bacteria | 1926 |
| 186 | Ga0070707_100967413 | 3300005468 | Bacteria | 816 |
| 187 | Ga0070707_101139567 | 3300005468 | Bacteria | 746 |
| 188 | Ga0070698_100002188 | 3300005471 | Bacteria | 21703 |
| 189 | Ga0070698_100005453 | 3300005471 | Bacteria | 13895 |
| 190 | Ga0070698_100022556 | 3300005471 | Bacteria | 6584 |
| 191 | Ga0070698_100039839 | 3300005471 | Bacteria | 4833 |
| 192 | Ga0070698_100040069 | 3300005471 | Bacteria | 4817 |
| 193 | Ga0070698_100090936 | 3300005471 | Bacteria | 3035 |
| 194 | Ga0070698_100115485 | 3300005471 | Bacteria | 2649 |
| 195 | Ga0070698_100226699 | 3300005471 | Bacteria | 1802 |
| 196 | Ga0070698_100687524 | 3300005471 | Bacteria | 965 |
| 197 | Ga0070698_101145347 | 3300005471 | Bacteria | 727 |
| 198 | Ga0070699_100003425 | 3300005518 | Bacteria | 14037 |
| 199 | Ga0070699_100003978 | 3300005518 | Bacteria | 13060 |
| 200 | Ga0070699_100018956 | 3300005518 | Bacteria | 5918 |
| 201 | Ga0070699_100021866 | 3300005518 | Bacteria | 5513 |
| 202 | Ga0070699_100034681 | 3300005518 | Bacteria | 4361 |
| 203 | Ga0070699_100047467 | 3300005518 | Bacteria | 3716 |
| 204 | Ga0070699_100049321 | 3300005518 | Bacteria | 3644 |
| 205 | Ga0070699_100088760 | 3300005518 | Bacteria | 2701 |
| 206 | Ga0070699_100855094 | 3300005518 | Bacteria | 833 |
| 207 | Ga0070679_100011678 | 3300005530 | Bacteria | 8373 |
| 208 | Ga0070679_100012367 | 3300005530 | Bacteria | 8154 |
| 209 | Ga0070679_100036557 | 3300005530 | Bacteria | 4873 |
| 210 | Ga0070679_100098963 | 3300005530 | Bacteria | 2904 |
| 211 | Ga0070679_100153483 | 3300005530 | Bacteria | 2279 |
| 212 | Ga0070679_100599943 | 3300005530 | Bacteria | 1044 |
| 213 | Ga0070679_101080389 | 3300005530 | Bacteria | 747 |
| 214 | Ga0070684_100001201 | 3300005535 | Bacteria | 18615 |
| 215 | Ga0070684_100009791 | 3300005535 | Bacteria | 7568 |
| 216 | Ga0070684_100124039 | 3300005535 | Bacteria | 2325 |
| 217 | Ga0070684_100145302 | 3300005535 | Bacteria | 2146 |
| 218 | Ga0070684_100273265 | 3300005535 | Bacteria | 1547 |
| 219 | Ga0070697_100003808 | 3300005536 | Bacteria | 11589 |
| 220 | Ga0070697_100021503 | 3300005536 | Bacteria | 5111 |
| 221 | Ga0070697_100043195 | 3300005536 | Bacteria | 3648 |
| 222 | Ga0070697_100048947 | 3300005536 | Bacteria | 3428 |
| 223 | Ga0070697_100062375 | 3300005536 | Bacteria | 3042 |
| 224 | Ga0070697_100140942 | 3300005536 | Bacteria | 2028 |
| 225 | Ga0070697_100191978 | 3300005536 | Bacteria | 1734 |
| 226 | Ga0070697_100259172 | 3300005536 | Bacteria | 1488 |
| 227 | Ga0068853_100017554 | 3300005539 | Bacteria | 5906 |
| 228 | Ga0068853_100025797 | 3300005539 | Bacteria | 4933 |
| 229 | Ga0068853_100070909 | 3300005539 | Bacteria | 3034 |
| 230 | Ga0068853_100108600 | 3300005539 | Bacteria | 2462 |
| 231 | Ga0070672_100004511 | 3300005543 | Bacteria | 9115 |
| 232 | Ga0070672_100007978 | 3300005543 | Bacteria | 7234 |
| 233 | Ga0070672_100125948 | 3300005543 | Bacteria | 2101 |
| 234 | Ga0070672_100161078 | 3300005543 | Bacteria | 1862 |
| 235 | Ga0070672_100350923 | 3300005543 | Bacteria | 1257 |
| 236 | Ga0070672_100700283 | 3300005543 | Bacteria | 887 |
| 237 | Ga0070686_100000114 | 3300005544 | Bacteria | 56363 |
| 238 | Ga0070686_100088111 | 3300005544 | Bacteria | 2071 |
| 239 | Ga0070686_100104594 | 3300005544 | Bacteria | 1918 |
| 240 | Ga0070695_100000766 | 3300005545 | Bacteria | 17268 |
| 241 | Ga0070695_100022573 | 3300005545 | Bacteria | 3860 |
| 242 | Ga0070695_100027500 | 3300005545 | Bacteria | 3523 |
| 243 | Ga0070695_100080454 | 3300005545 | Bacteria | 2153 |
| 244 | Ga0070695_100116107 | 3300005545 | Bacteria | 1824 |
| 245 | Ga0070695_100388602 | 3300005545 | Bacteria | 1055 |
| 246 | Ga0070696_100000557 | 3300005546 | Bacteria | 23676 |
| 247 | Ga0070696_100002916 | 3300005546 | Bacteria | 11368 |
| 248 | Ga0070696_100028934 | 3300005546 | Bacteria | 3783 |
| 249 | Ga0070696_100033862 | 3300005546 | Bacteria | 3512 |
| 250 | Ga0070696_100053328 | 3300005546 | Bacteria | 2815 |
| 251 | Ga0070696_100096352 | 3300005546 | Bacteria | 2114 |
| 252 | Ga0070696_100133051 | 3300005546 | Bacteria | 1811 |
| 253 | Ga0070693_100039499 | 3300005547 | Bacteria | 2644 |
| 254 | Ga0070693_100049802 | 3300005547 | Bacteria | 2392 |
| 255 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 256 | Ga0070665_100009816 | 3300005548 | Bacteria | 9676 |
| 257 | Ga0070665_100074227 | 3300005548 | Bacteria | 3407 |
| 258 | Ga0070665_100254763 | 3300005548 | Bacteria | 1756 |
| 259 | Ga0070665_100606194 | 3300005548 | Bacteria | 1108 |
| 260 | Ga0070665_100720029 | 3300005548 | Bacteria | 1011 |
| 261 | Ga0070665_101096035 | 3300005548 | Bacteria | 808 |
| 262 | Ga0070704_100002995 | 3300005549 | Bacteria | 9604 |
| 263 | Ga0070704_100003240 | 3300005549 | Bacteria | 9300 |
| 264 | Ga0070704_100004453 | 3300005549 | Bacteria | 8090 |
| 265 | Ga0070704_100007933 | 3300005549 | Bacteria | 6336 |
| 266 | Ga0070704_100008264 | 3300005549 | Bacteria | 6231 |
| 267 | Ga0070704_100049260 | 3300005549 | Bacteria | 2954 |
| 268 | Ga0070704_100153674 | 3300005549 | Bacteria | 1812 |
| 269 | Ga0070704_100171632 | 3300005549 | Bacteria | 1725 |
| 270 | Ga0068855_100000416 | 3300005563 | Bacteria | 52868 |
| 271 | Ga0068855_100397026 | 3300005563 | Bacteria | 1512 |
| 272 | Ga0068855_100563239 | 3300005563 | Bacteria | 1232 |
| 273 | Ga0068855_100605530 | 3300005563 | Bacteria | 1181 |
| 274 | Ga0068855_101414225 | 3300005563 | Unclassified | 716 |
| 275 | Ga0070664_100071838 | 3300005564 | Bacteria | 2966 |
| 276 | Ga0070664_100094454 | 3300005564 | Bacteria | 2593 |
| 277 | Ga0068857_100082647 | 3300005577 | Bacteria | 2869 |
| 278 | Ga0068857_100163670 | 3300005577 | Bacteria | 2019 |
| 279 | Ga0068857_100766560 | 3300005577 | Bacteria | 920 |
| 280 | Ga0068857_100986032 | 3300005577 | Bacteria | 811 |
| 281 | Ga0068854_100042976 | 3300005578 | Bacteria | 3201 |
| 282 | Ga0068854_100046064 | 3300005578 | Bacteria | 3104 |
| 283 | Ga0068854_100065299 | 3300005578 | Bacteria | 2646 |
| 284 | Ga0068856_100088525 | 3300005614 | Bacteria | 3079 |
| 285 | Ga0068856_100196671 | 3300005614 | Bacteria | 2030 |
| 286 | Ga0068856_100477274 | 3300005614 | Bacteria | 1268 |
| 287 | Ga0070702_100005374 | 3300005615 | Bacteria | 5956 |
| 288 | Ga0070702_100132907 | 3300005615 | Bacteria | 1574 |
| 289 | Ga0070702_100223738 | 3300005615 | Bacteria | 1260 |
| 290 | Ga0068852_100006969 | 3300005616 | Bacteria | 8223 |
| 291 | Ga0068852_100055216 | 3300005616 | Bacteria | 3427 |
| 292 | Ga0068852_100157528 | 3300005616 | Bacteria | 2117 |
| 293 | Ga0068852_100211155 | 3300005616 | Bacteria | 1841 |
| 294 | Ga0068852_100526462 | 3300005616 | Bacteria | 1180 |
| 295 | Ga0068852_100552106 | 3300005616 | Bacteria | 1152 |
| 296 | Ga0068852_100663718 | 3300005616 | Bacteria | 1051 |
| 297 | Ga0068859_100011685 | 3300005617 | Bacteria | 8823 |
| 298 | Ga0068859_100015946 | 3300005617 | Bacteria | 7554 |
| 299 | Ga0068859_100084497 | 3300005617 | Bacteria | 3219 |
| 300 | Ga0068859_100088464 | 3300005617 | Bacteria | 3147 |
| 301 | Ga0068859_100235657 | 3300005617 | Bacteria | 1919 |
| 302 | Ga0068859_100424737 | 3300005617 | Bacteria | 1425 |
| 303 | Ga0068866_10024774 | 3300005718 | Bacteria | 2813 |
| 304 | Ga0068861_100001489 | 3300005719 | Bacteria | 14868 |
| 305 | Ga0068861_100265654 | 3300005719 | Bacteria | 1471 |
| 306 | Ga0068861_100292686 | 3300005719 | Bacteria | 1407 |
| 307 | Ga0068861_100609738 | 3300005719 | Bacteria | 1003 |
| 308 | Ga0068851_10005001 | 3300005834 | Bacteria | 6005 |
| 309 | Ga0068870_10109191 | 3300005840 | Bacteria | 1577 |
| 310 | Ga0068863_100014025 | 3300005841 | Bacteria | 7720 |
| 311 | Ga0068863_100279059 | 3300005841 | Bacteria | 1619 |
| 312 | Ga0068863_100538760 | 3300005841 | Bacteria | 1152 |
| 313 | Ga0068863_100661842 | 3300005841 | Bacteria | 1036 |
| 314 | Ga0068858_100028680 | 3300005842 | Bacteria | 5169 |
| 315 | Ga0068860_100036705 | 3300005843 | Bacteria | 4693 |
| 316 | Ga0068860_100196845 | 3300005843 | Bacteria | 1952 |
| 317 | Ga0068860_100239531 | 3300005843 | Bacteria | 1764 |
| 318 | Ga0068862_100000174 | 3300005844 | Bacteria | 71565 |
| 319 | Ga0068862_100050217 | 3300005844 | Bacteria | 3564 |
| 320 | Ga0068862_100050715 | 3300005844 | Bacteria | 3547 |
| 321 | Ga0068862_100059030 | 3300005844 | Bacteria | 3293 |
| 322 | Ga0068862_100080212 | 3300005844 | Bacteria | 2830 |
| 323 | Ga0068862_100336604 | 3300005844 | Bacteria | 1397 |
| 324 | Ga0068862_100768156 | 3300005844 | Bacteria | 939 |
| 325 | Ga0081539_10144261 | 3300005985 | Bacteria | 1153 |
| 326 | Ga0070717_10148234 | 3300006028 | Bacteria | 2028 |
| 327 | Ga0070717_10467355 | 3300006028 | Bacteria | 1138 |
| 328 | Ga0070717_10566197 | 3300006028 | Bacteria | 1029 |
| 329 | Ga0075363_100000282 | 3300006048 | Bacteria | 14734 |
| 330 | Ga0075432_10168757 | 3300006058 | Bacteria | 850 |
| 331 | Ga0070715_10430265 | 3300006163 | Bacteria | 740 |
| 332 | Ga0070716_100036528 | 3300006173 | Bacteria | 2709 |
| 333 | Ga0070716_100111920 | 3300006173 | Bacteria | 1693 |
| 334 | Ga0070716_100420264 | 3300006173 | Bacteria | 966 |
| 335 | Ga0070712_100019259 | 3300006175 | Bacteria | 4448 |
| 336 | Ga0070712_100027361 | 3300006175 | Bacteria | 3808 |
| 337 | Ga0070712_100028546 | 3300006175 | Bacteria | 3733 |
| 338 | Ga0075367_10509878 | 3300006178 | Unclassified | 763 |
| 339 | Ga0075366_10154093 | 3300006195 | Bacteria | 1392 |
| 340 | Ga0075366_10185062 | 3300006195 | Bacteria | 1265 |
| 341 | Ga0097621_100064685 | 3300006237 | Bacteria | 3008 |
| 342 | Ga0075370_10262191 | 3300006353 | Bacteria | 1025 |
| 343 | Ga0075370_10302140 | 3300006353 | Bacteria | 952 |
| 344 | Ga0068871_100599514 | 3300006358 | Bacteria | 1002 |
| 345 | Ga0075428_100004397 | 3300006844 | Bacteria | 15561 |
| 346 | Ga0075428_100017502 | 3300006844 | Bacteria | 7917 |
| 347 | Ga0075428_100046020 | 3300006844 | Bacteria | 4794 |
| 348 | Ga0075428_100065223 | 3300006844 | Bacteria | 3987 |
| 349 | Ga0075428_100272896 | 3300006844 | Bacteria | 1820 |
| 350 | Ga0075428_100454033 | 3300006844 | Bacteria | 1373 |
| 351 | Ga0075430_100001742 | 3300006846 | Bacteria | 17777 |
| 352 | Ga0075430_100009716 | 3300006846 | Bacteria | 8129 |
| 353 | Ga0075430_100045232 | 3300006846 | Bacteria | 3719 |
| 354 | Ga0075430_100054291 | 3300006846 | Bacteria | 3371 |
| 355 | Ga0075430_100095435 | 3300006846 | Bacteria | 2485 |
| 356 | Ga0075430_100334933 | 3300006846 | Bacteria | 1250 |
| 357 | Ga0075430_100349267 | 3300006846 | Bacteria | 1222 |
| 358 | Ga0075430_100447415 | 3300006846 | Bacteria | 1066 |
| 359 | Ga0075430_100652849 | 3300006846 | Bacteria | 867 |
| 360 | Ga0075431_100011703 | 3300006847 | Bacteria | 8851 |
| 361 | Ga0075431_100023932 | 3300006847 | Bacteria | 6252 |
| 362 | Ga0075431_100157152 | 3300006847 | Bacteria | 2339 |
| 363 | Ga0075431_100172718 | 3300006847 | Bacteria | 2221 |
| 364 | Ga0075431_100392137 | 3300006847 | Bacteria | 1391 |
| 365 | Ga0075431_100465403 | 3300006847 | Bacteria | 1259 |
| 366 | Ga0075431_100581859 | 3300006847 | Bacteria | 1105 |
| 367 | Ga0075431_100670104 | 3300006847 | Bacteria | 1017 |
| 368 | Ga0075433_10002006 | 3300006852 | Bacteria | 15334 |
| 369 | Ga0075433_10019290 | 3300006852 | Bacteria | 5680 |
| 370 | Ga0075433_10084032 | 3300006852 | Bacteria | 2810 |
| 371 | Ga0075433_10096250 | 3300006852 | Bacteria | 2620 |
| 372 | Ga0075433_10102622 | 3300006852 | Bacteria | 2533 |
| 373 | Ga0075433_10107444 | 3300006852 | Bacteria | 2474 |
| 374 | Ga0075433_10235052 | 3300006852 | Bacteria | 1627 |
| 375 | Ga0075433_10249971 | 3300006852 | Bacteria | 1573 |
| 376 | Ga0075433_10279999 | 3300006852 | Bacteria | 1477 |
| 377 | Ga0075433_10320685 | 3300006852 | Bacteria | 1371 |
| 378 | Ga0075434_100001715 | 3300006871 | Bacteria | 18779 |
| 379 | Ga0075434_100009189 | 3300006871 | Bacteria | 9212 |
| 380 | Ga0075434_100015325 | 3300006871 | Bacteria | 7347 |
| 381 | Ga0075434_100025733 | 3300006871 | Bacteria | 5760 |
| 382 | Ga0075434_100045126 | 3300006871 | Bacteria | 4372 |
| 383 | Ga0075434_100047773 | 3300006871 | Bacteria | 4246 |
| 384 | Ga0075434_100059833 | 3300006871 | Bacteria | 3788 |
| 385 | Ga0075434_100122155 | 3300006871 | Bacteria | 2620 |
| 386 | Ga0075434_100156563 | 3300006871 | Bacteria | 2297 |
| 387 | Ga0075434_100170357 | 3300006871 | Bacteria | 2197 |
| 388 | Ga0075434_100209120 | 3300006871 | Bacteria | 1971 |
| 389 | Ga0075434_100522052 | 3300006871 | Bacteria | 1208 |
| 390 | Ga0075434_100570052 | 3300006871 | Bacteria | 1151 |
| 391 | Ga0075429_100006449 | 3300006880 | Bacteria | 10159 |
| 392 | Ga0075429_100010632 | 3300006880 | Bacteria | 7962 |
| 393 | Ga0075429_100085461 | 3300006880 | Bacteria | 2750 |
| 394 | Ga0075429_100112884 | 3300006880 | Bacteria | 2375 |
| 395 | Ga0075429_100205912 | 3300006880 | Bacteria | 1724 |
| 396 | Ga0068865_100004706 | 3300006881 | Bacteria | 8247 |
| 397 | Ga0075436_100003907 | 3300006914 | Bacteria | 10211 |
| 398 | Ga0075436_100006600 | 3300006914 | Bacteria | 7950 |
| 399 | Ga0075436_100015422 | 3300006914 | Bacteria | 5232 |
| 400 | Ga0075436_100034721 | 3300006914 | Bacteria | 3478 |
| 401 | Ga0075436_100145059 | 3300006914 | Bacteria | 1669 |
| 402 | Ga0075436_100159040 | 3300006914 | Unclassified | 1592 |
| 403 | Ga0075436_100182347 | 3300006914 | Bacteria | 1484 |
| 404 | Ga0075436_100360317 | 3300006914 | Bacteria | 1049 |
| 405 | Ga0075436_100507516 | 3300006914 | Bacteria | 882 |
| 406 | Ga0097620_100011685 | 3300006931 | Bacteria | 8823 |
| 407 | Ga0097620_100015946 | 3300006931 | Bacteria | 7554 |
| 408 | Ga0097620_100084495 | 3300006931 | Bacteria | 3219 |
| 409 | Ga0097620_100088462 | 3300006931 | Bacteria | 3147 |
| 410 | Ga0097620_100235656 | 3300006931 | Bacteria | 1919 |
| 411 | Ga0097620_100424727 | 3300006931 | Bacteria | 1425 |
| 412 | Ga0075435_100005046 | 3300007076 | Bacteria | 9170 |
| 413 | Ga0075435_100013658 | 3300007076 | Bacteria | 6050 |
| 414 | Ga0075435_100090136 | 3300007076 | Bacteria | 2529 |
| 415 | Ga0075435_100114637 | 3300007076 | Bacteria | 2243 |
| 416 | Ga0075435_100272701 | 3300007076 | Bacteria | 1443 |
| 417 | Ga0075435_100283510 | 3300007076 | Bacteria | 1414 |
| 418 | Ga0075435_100592094 | 3300007076 | Bacteria | 961 |
| 419 | Ga0075435_101069852 | 3300007076 | Bacteria | 705 |
| 420 | Ga0099794_10000062 | 3300007265 | Bacteria | 41045 |
| 421 | Ga0099794_10247155 | 3300007265 | Bacteria | 920 |
| 422 | Ga0099794_10286798 | 3300007265 | Bacteria | 852 |
| 423 | Ga0105251_10202031 | 3300009011 | Bacteria | 895 |
| 424 | Ga0105250_10119118 | 3300009092 | Bacteria | 1084 |
| 425 | Ga0105240_10000096 | 3300009093 | Bacteria | 179543 |
| 426 | Ga0105240_10003506 | 3300009093 | Bacteria | 24336 |
| 427 | Ga0105240_10031807 | 3300009093 | Bacteria | 6836 |
| 428 | Ga0105240_10084049 | 3300009093 | Bacteria | 3904 |
| 429 | Ga0105240_10160871 | 3300009093 | Bacteria | 2667 |
| 430 | Ga0105240_10170312 | 3300009093 | Bacteria | 2580 |
| 431 | Ga0105240_10598589 | 3300009093 | Bacteria | 1214 |
| 432 | Ga0111539_10149686 | 3300009094 | Bacteria | 2732 |
| 433 | Ga0111539_10633362 | 3300009094 | Bacteria | 1245 |
| 434 | Ga0111539_11167040 | 3300009094 | Bacteria | 895 |
| 435 | Ga0105245_10080445 | 3300009098 | Bacteria | 2977 |
| 436 | Ga0105245_10602813 | 3300009098 | Bacteria | 1125 |
| 437 | Ga0105245_11456042 | 3300009098 | Bacteria | 735 |
| 438 | Ga0114129_10038312 | 3300009147 | Bacteria | 6763 |
| 439 | Ga0114129_10241792 | 3300009147 | Bacteria | 2426 |
| 440 | Ga0114129_10334606 | 3300009147 | Bacteria | 2009 |
| 441 | Ga0114129_10424428 | 3300009147 | Bacteria | 1748 |
| 442 | Ga0114129_11270524 | 3300009147 | Bacteria | 914 |
| 443 | Ga0114129_11727715 | 3300009147 | Bacteria | 763 |
| 444 | Ga0105243_10258773 | 3300009148 | Bacteria | 1557 |
| 445 | Ga0105241_10009703 | 3300009174 | Bacteria | 7074 |
| 446 | Ga0105241_10247520 | 3300009174 | Bacteria | 1510 |
| 447 | Ga0105242_10048006 | 3300009176 | Bacteria | 3468 |
| 448 | Ga0105242_10473717 | 3300009176 | Bacteria | 1185 |
| 449 | Ga0105242_11197584 | 3300009176 | Bacteria | 779 |
| 450 | Ga0105248_10015120 | 3300009177 | Bacteria | 8500 |
| 451 | Ga0105248_10163851 | 3300009177 | Bacteria | 2507 |
| 452 | Ga0105248_10167669 | 3300009177 | Bacteria | 2475 |
| 453 | Ga0105238_10000271 | 3300009551 | Bacteria | 58086 |
| 454 | Ga0105238_10467858 | 3300009551 | Bacteria | 1259 |
| 455 | Ga0105249_10000202 | 3300009553 | Bacteria | 68134 |
| 456 | Ga0105249_10001114 | 3300009553 | Bacteria | 23884 |
| 457 | Ga0105249_10104817 | 3300009553 | Bacteria | 2665 |
| 458 | Ga0105249_10805792 | 3300009553 | Bacteria | 1003 |
| 459 | Ga0105239_10058708 | 3300010375 | Bacteria | 4222 |
| 460 | Ga0157373_10002032 | 3300013100 | Bacteria | 15326 |
| 461 | Ga0157373_10059108 | 3300013100 | Bacteria | 2717 |
| 462 | Ga0157373_10503986 | 3300013100 | Bacteria | 875 |
| 463 | Ga0157371_10020775 | 3300013102 | Bacteria | 4830 |
| 464 | Ga0157371_10022797 | 3300013102 | Bacteria | 4580 |
| 465 | Ga0157371_10024497 | 3300013102 | Bacteria | 4406 |
| 466 | Ga0157371_10028167 | 3300013102 | Bacteria | 4070 |
| 467 | Ga0157371_10726890 | 3300013102 | Bacteria | 744 |
| 468 | Ga0157371_10853337 | 3300013102 | Bacteria | 688 |
| 469 | Ga0157370_10001252 | 3300013104 | Bacteria | 31705 |
| 470 | Ga0157370_10027603 | 3300013104 | Bacteria | 5597 |
| 471 | Ga0157370_10037747 | 3300013104 | Bacteria | 4679 |
| 472 | Ga0157370_10057063 | 3300013104 | Bacteria | 3715 |
| 473 | Ga0157370_10447669 | 3300013104 | Bacteria | 1187 |
| 474 | Ga0157370_10693496 | 3300013104 | Bacteria | 930 |
| 475 | Ga0157370_11018516 | 3300013104 | Bacteria | 749 |
| 476 | Ga0157369_10020822 | 3300013105 | Bacteria | 7330 |
| 477 | Ga0157369_10027155 | 3300013105 | Bacteria | 6347 |
| 478 | Ga0157369_10196094 | 3300013105 | Bacteria | 2121 |
| 479 | Ga0157369_10197649 | 3300013105 | Bacteria | 2111 |
| 480 | Ga0157369_10216120 | 3300013105 | Bacteria | 2008 |
| 481 | Ga0157369_10497639 | 3300013105 | Bacteria | 1261 |
| 482 | Ga0157369_11222477 | 3300013105 | Bacteria | 767 |
| 483 | Ga0157374_10190375 | 3300013296 | Bacteria | 2007 |
| 484 | Ga0157374_10242300 | 3300013296 | Bacteria | 1773 |
| 485 | Ga0157374_10446678 | 3300013296 | Bacteria | 1294 |
| 486 | Ga0157378_10009314 | 3300013297 | Bacteria | 8553 |
| 487 | Ga0157378_10013994 | 3300013297 | Bacteria | 7022 |
| 488 | Ga0157378_10081901 | 3300013297 | Bacteria | 2918 |
| 489 | Ga0157378_10168495 | 3300013297 | Bacteria | 2052 |
| 490 | Ga0157378_11514332 | 3300013297 | Bacteria | 715 |
| 491 | Ga0163162_10001006 | 3300013306 | Bacteria | 26204 |
| 492 | Ga0163162_10017746 | 3300013306 | Bacteria | 6963 |
| 493 | Ga0163162_10172950 | 3300013306 | Bacteria | 2284 |
| 494 | Ga0163162_10207369 | 3300013306 | Bacteria | 2089 |
| 495 | Ga0157372_10005157 | 3300013307 | Bacteria | 13888 |
| 496 | Ga0157372_10017987 | 3300013307 | Bacteria | 7595 |
| 497 | Ga0157372_10021493 | 3300013307 | Bacteria | 6972 |
| 498 | Ga0157372_10022214 | 3300013307 | Bacteria | 6863 |
| 499 | Ga0157372_10029768 | 3300013307 | Bacteria | 5967 |
| 500 | Ga0157372_10031639 | 3300013307 | Bacteria | 5793 |
| 501 | Ga0157372_10074672 | 3300013307 | Bacteria | 3824 |
| 502 | Ga0157372_10091516 | 3300013307 | Bacteria | 3459 |
| 503 | Ga0157372_10133341 | 3300013307 | Bacteria | 2860 |
| 504 | Ga0157372_10934055 | 3300013307 | Bacteria | 1006 |
| 505 | Ga0157372_11130858 | 3300013307 | Bacteria | 906 |
| 506 | Ga0157372_11705928 | 3300013307 | Bacteria | 725 |
| 507 | Ga0157375_10001559 | 3300013308 | Bacteria | 19743 |
| 508 | Ga0157375_10015258 | 3300013308 | Bacteria | 6875 |
| 509 | Ga0157375_10088154 | 3300013308 | Bacteria | 3157 |
| 510 | Ga0157375_10163344 | 3300013308 | Bacteria | 2370 |
| 511 | Ga0157375_11467913 | 3300013308 | Bacteria | 804 |
| 512 | Ga0163163_10010270 | 3300014325 | Bacteria | 8413 |
| 513 | Ga0157380_10293396 | 3300014326 | Bacteria | 1494 |
| 514 | Ga0157380_10692446 | 3300014326 | Bacteria | 1023 |
| 515 | Ga0182008_10119759 | 3300014497 | Bacteria | 1308 |
| 516 | Ga0157377_10009821 | 3300014745 | Bacteria | 4714 |
| 517 | Ga0157377_10010160 | 3300014745 | Bacteria | 4646 |
| 518 | Ga0157377_10118108 | 3300014745 | Bacteria | 1603 |
| 519 | Ga0157379_10003141 | 3300014968 | Bacteria | 13974 |
| 520 | Ga0182007_10023256 | 3300015262 | Bacteria | 2180 |
| 521 | Ga0163161_10056221 | 3300017792 | Bacteria | 2858 |
| 522 | Ga0163161_10266881 | 3300017792 | Bacteria | 1338 |
| 523 | Ga0163161_10356819 | 3300017792 | Bacteria | 1163 |
| 524 | Ga0206353_11560936 | 3300020082 | Bacteria | 1130 |
| 525 | Ga0213876_10199902 | 3300021384 | Unclassified | 1062 |
| 526 | Ga0213876_10200344 | 3300021384 | Bacteria | 1061 |
| 527 | Ga0209147_100053 | 3300025229 | Bacteria | 267615 |
| 528 | Ga0209050_1000119 | 3300025298 | Bacteria | 200661 |
| 529 | Ga0207697_10006428 | 3300025315 | Bacteria | 5322 |
| 530 | Ga0207697_10216301 | 3300025315 | Bacteria | 845 |
| 531 | Ga0207656_10025908 | 3300025321 | Bacteria | 2386 |
| 532 | Ga0207696_1015285 | 3300025711 | Bacteria | 2606 |
| 533 | Ga0207713_1003677 | 3300025735 | Bacteria | 10316 |
| 534 | Ga0207653_10000258 | 3300025885 | Bacteria | 33505 |
| 535 | Ga0207653_10003351 | 3300025885 | Bacteria | 5056 |
| 536 | Ga0207653_10093059 | 3300025885 | Bacteria | 1058 |
| 537 | Ga0207682_10005680 | 3300025893 | Bacteria | 5063 |
| 538 | Ga0207642_10062229 | 3300025899 | Bacteria | 1739 |
| 539 | Ga0207688_10017583 | 3300025901 | Bacteria | 3888 |
| 540 | Ga0207688_10077248 | 3300025901 | Bacteria | 1897 |
| 541 | Ga0207680_10071119 | 3300025903 | Bacteria | 2156 |
| 542 | Ga0207680_10273093 | 3300025903 | Bacteria | 1173 |
| 543 | Ga0207680_10354407 | 3300025903 | Bacteria | 1031 |
| 544 | Ga0207680_10744120 | 3300025903 | Bacteria | 703 |
| 545 | Ga0207647_10011032 | 3300025904 | Bacteria | 6355 |
| 546 | Ga0207647_10089925 | 3300025904 | Bacteria | 1832 |
| 547 | Ga0207647_10195785 | 3300025904 | Bacteria | 1170 |
| 548 | Ga0207647_10278603 | 3300025904 | Bacteria | 955 |
| 549 | Ga0207699_10004506 | 3300025906 | Bacteria | 6656 |
| 550 | Ga0207699_10113348 | 3300025906 | Bacteria | 1742 |
| 551 | Ga0207699_10141848 | 3300025906 | Bacteria | 1580 |
| 552 | Ga0207645_10000267 | 3300025907 | Bacteria | 43141 |
| 553 | Ga0207645_10099225 | 3300025907 | Bacteria | 1878 |
| 554 | Ga0207645_10116122 | 3300025907 | Bacteria | 1735 |
| 555 | Ga0207645_10278586 | 3300025907 | Bacteria | 1110 |
| 556 | Ga0207643_10032681 | 3300025908 | Bacteria | 2907 |
| 557 | Ga0207643_10040135 | 3300025908 | Bacteria | 2634 |
| 558 | Ga0207705_10019571 | 3300025909 | Bacteria | 4839 |
| 559 | Ga0207705_10021651 | 3300025909 | Bacteria | 4587 |
| 560 | Ga0207705_10090304 | 3300025909 | Bacteria | 2242 |
| 561 | Ga0207705_10191650 | 3300025909 | Bacteria | 1546 |
| 562 | Ga0207705_10331411 | 3300025909 | Bacteria | 1171 |
| 563 | Ga0207705_10455854 | 3300025909 | Bacteria | 992 |
| 564 | Ga0207684_10012758 | 3300025910 | Bacteria | 7288 |
| 565 | Ga0207684_10025200 | 3300025910 | Bacteria | 5069 |
| 566 | Ga0207684_10138245 | 3300025910 | Bacteria | 2093 |
| 567 | Ga0207684_10180151 | 3300025910 | Bacteria | 1822 |
| 568 | Ga0207684_10265564 | 3300025910 | Bacteria | 1481 |
| 569 | Ga0207654_10019437 | 3300025911 | Bacteria | 3585 |
| 570 | Ga0207707_10000375 | 3300025912 | Bacteria | 46714 |
| 571 | Ga0207707_10009397 | 3300025912 | Bacteria | 8482 |
| 572 | Ga0207707_10011934 | 3300025912 | Bacteria | 7559 |
| 573 | Ga0207707_10015521 | 3300025912 | Bacteria | 6635 |
| 574 | Ga0207707_10190165 | 3300025912 | Bacteria | 1791 |
| 575 | Ga0207695_10000836 | 3300025913 | Bacteria | 56759 |
| 576 | Ga0207695_10001648 | 3300025913 | Bacteria | 35974 |
| 577 | Ga0207695_10014275 | 3300025913 | Bacteria | 9420 |
| 578 | Ga0207695_10024557 | 3300025913 | Bacteria | 6775 |
| 579 | Ga0207695_10094850 | 3300025913 | Bacteria | 2990 |
| 580 | Ga0207695_10277877 | 3300025913 | Bacteria | 1569 |
| 581 | Ga0207693_10011202 | 3300025915 | Bacteria | 7257 |
| 582 | Ga0207693_10029290 | 3300025915 | Bacteria | 4350 |
| 583 | Ga0207663_10000529 | 3300025916 | Bacteria | 16741 |
| 584 | Ga0207663_10226994 | 3300025916 | Bacteria | 1362 |
| 585 | Ga0207663_10394237 | 3300025916 | Bacteria | 1057 |
| 586 | Ga0207660_10001140 | 3300025917 | Bacteria | 17723 |
| 587 | Ga0207660_10007084 | 3300025917 | Bacteria | 7262 |
| 588 | Ga0207660_10053829 | 3300025917 | Bacteria | 2870 |
| 589 | Ga0207660_10082765 | 3300025917 | Bacteria | 2362 |
| 590 | Ga0207660_10083349 | 3300025917 | Bacteria | 2354 |
| 591 | Ga0207660_10216079 | 3300025917 | Bacteria | 1503 |
| 592 | Ga0207660_10495624 | 3300025917 | Bacteria | 991 |
| 593 | Ga0207662_10002655 | 3300025918 | Bacteria | 9021 |
| 594 | Ga0207662_10072737 | 3300025918 | Bacteria | 2084 |
| 595 | Ga0207662_10088607 | 3300025918 | Bacteria | 1900 |
| 596 | Ga0207662_10109756 | 3300025918 | Bacteria | 1719 |
| 597 | Ga0207662_10382781 | 3300025918 | Bacteria | 951 |
| 598 | Ga0207657_10017502 | 3300025919 | Bacteria | 6868 |
| 599 | Ga0207657_10036203 | 3300025919 | Bacteria | 4419 |
| 600 | Ga0207657_10069520 | 3300025919 | Bacteria | 2987 |
| 601 | Ga0207657_10209574 | 3300025919 | Bacteria | 1564 |
| 602 | Ga0207657_10295898 | 3300025919 | Bacteria | 1283 |
| 603 | Ga0207649_10002039 | 3300025920 | Bacteria | 11487 |
| 604 | Ga0207649_10018576 | 3300025920 | Bacteria | 3957 |
| 605 | Ga0207649_10024692 | 3300025920 | Bacteria | 3497 |
| 606 | Ga0207649_10050746 | 3300025920 | Bacteria | 2567 |
| 607 | Ga0207649_10430301 | 3300025920 | Bacteria | 993 |
| 608 | Ga0207649_10589554 | 3300025920 | Bacteria | 854 |
| 609 | Ga0207652_10000654 | 3300025921 | Bacteria | 34071 |
| 610 | Ga0207652_10014383 | 3300025921 | Bacteria | 6411 |
| 611 | Ga0207652_10024992 | 3300025921 | Bacteria | 4961 |
| 612 | Ga0207652_10053269 | 3300025921 | Bacteria | 3475 |
| 613 | Ga0207652_10094773 | 3300025921 | Bacteria | 2629 |
| 614 | Ga0207652_10646304 | 3300025921 | Bacteria | 946 |
| 615 | Ga0207646_10003953 | 3300025922 | Bacteria | 16440 |
| 616 | Ga0207646_10015549 | 3300025922 | Bacteria | 7184 |
| 617 | Ga0207646_10041894 | 3300025922 | Bacteria | 4114 |
| 618 | Ga0207646_10090461 | 3300025922 | Bacteria | 2740 |
| 619 | Ga0207646_10320785 | 3300025922 | Bacteria | 1400 |
| 620 | Ga0207646_10349292 | 3300025922 | Bacteria | 1336 |
| 621 | Ga0207646_10664212 | 3300025922 | Bacteria | 933 |
| 622 | Ga0207681_10000125 | 3300025923 | Bacteria | 62866 |
| 623 | Ga0207681_10000517 | 3300025923 | Bacteria | 26784 |
| 624 | Ga0207681_10001950 | 3300025923 | Bacteria | 13243 |
| 625 | Ga0207681_10012624 | 3300025923 | Bacteria | 5215 |
| 626 | Ga0207681_10023961 | 3300025923 | Bacteria | 3911 |
| 627 | Ga0207681_10025964 | 3300025923 | Bacteria | 3774 |
| 628 | Ga0207694_10000007 | 3300025924 | Bacteria | 595422 |
| 629 | Ga0207694_10137033 | 3300025924 | Bacteria | 1967 |
| 630 | Ga0207694_10207136 | 3300025924 | Bacteria | 1597 |
| 631 | Ga0207650_10004192 | 3300025925 | Bacteria | 9851 |
| 632 | Ga0207650_10012785 | 3300025925 | Bacteria | 5800 |
| 633 | Ga0207650_10146857 | 3300025925 | Bacteria | 1858 |
| 634 | Ga0207650_10170586 | 3300025925 | Bacteria | 1729 |
| 635 | Ga0207650_10260460 | 3300025925 | Bacteria | 1407 |
| 636 | Ga0207659_10007491 | 3300025926 | Bacteria | 6716 |
| 637 | Ga0207659_10010032 | 3300025926 | Bacteria | 5933 |
| 638 | Ga0207659_10249185 | 3300025926 | Bacteria | 1440 |
| 639 | Ga0207659_10264237 | 3300025926 | Bacteria | 1401 |
| 640 | Ga0207659_10638810 | 3300025926 | Bacteria | 909 |
| 641 | Ga0207700_10015427 | 3300025928 | Bacteria | 5041 |
| 642 | Ga0207700_10017835 | 3300025928 | Bacteria | 4751 |
| 643 | Ga0207700_10185280 | 3300025928 | Bacteria | 1746 |
| 644 | Ga0207700_10456489 | 3300025928 | Bacteria | 1127 |
| 645 | Ga0207664_10004982 | 3300025929 | Bacteria | 9030 |
| 646 | Ga0207664_10030378 | 3300025929 | Bacteria | 4126 |
| 647 | Ga0207664_10554073 | 3300025929 | Bacteria | 1032 |
| 648 | Ga0207644_10000963 | 3300025931 | Bacteria | 18367 |
| 649 | Ga0207644_10217026 | 3300025931 | Bacteria | 1514 |
| 650 | Ga0207644_10303045 | 3300025931 | Bacteria | 1288 |
| 651 | Ga0207644_10461967 | 3300025931 | Bacteria | 1044 |
| 652 | Ga0207644_10686546 | 3300025931 | Bacteria | 853 |
| 653 | Ga0207690_10013028 | 3300025932 | Bacteria | 4987 |
| 654 | Ga0207690_10039887 | 3300025932 | Bacteria | 3066 |
| 655 | Ga0207690_10122555 | 3300025932 | Bacteria | 1891 |
| 656 | Ga0207690_10200131 | 3300025932 | Bacteria | 1516 |
| 657 | Ga0207706_10001815 | 3300025933 | Bacteria | 20961 |
| 658 | Ga0207706_10009804 | 3300025933 | Bacteria | 8789 |
| 659 | Ga0207706_10053461 | 3300025933 | Bacteria | 3565 |
| 660 | Ga0207686_10170536 | 3300025934 | Bacteria | 1534 |
| 661 | Ga0207686_10972708 | 3300025934 | Unclassified | 688 |
| 662 | Ga0207670_10005395 | 3300025936 | Bacteria | 7014 |
| 663 | Ga0207670_10052770 | 3300025936 | Bacteria | 2735 |
| 664 | Ga0207669_10004857 | 3300025937 | Bacteria | 5967 |
| 665 | Ga0207669_10118463 | 3300025937 | Bacteria | 1792 |
| 666 | Ga0207669_10267180 | 3300025937 | Bacteria | 1283 |
| 667 | Ga0207704_10023799 | 3300025938 | Bacteria | 3308 |
| 668 | Ga0207704_10295297 | 3300025938 | Bacteria | 1239 |
| 669 | Ga0207665_10002787 | 3300025939 | Bacteria | 11713 |
| 670 | Ga0207665_10020492 | 3300025939 | Bacteria | 4345 |
| 671 | Ga0207665_10179007 | 3300025939 | Bacteria | 1535 |
| 672 | Ga0207665_10301077 | 3300025939 | Bacteria | 1198 |
| 673 | Ga0207691_10000124 | 3300025940 | Bacteria | 69879 |
| 674 | Ga0207691_10002376 | 3300025940 | Bacteria | 18427 |
| 675 | Ga0207691_10024319 | 3300025940 | Bacteria | 5696 |
| 676 | Ga0207691_10029402 | 3300025940 | Bacteria | 5140 |
| 677 | Ga0207691_10050359 | 3300025940 | Bacteria | 3813 |
| 678 | Ga0207691_10102660 | 3300025940 | Bacteria | 2550 |
| 679 | Ga0207711_10064544 | 3300025941 | Bacteria | 3163 |
| 680 | Ga0207711_10313947 | 3300025941 | Bacteria | 1447 |
| 681 | Ga0207711_10470439 | 3300025941 | Bacteria | 1171 |
| 682 | Ga0207689_10003772 | 3300025942 | Bacteria | 13806 |
| 683 | Ga0207689_10148077 | 3300025942 | Bacteria | 1934 |
| 684 | Ga0207689_10301407 | 3300025942 | Bacteria | 1328 |
| 685 | Ga0207661_10001425 | 3300025944 | Bacteria | 16121 |
| 686 | Ga0207661_10024729 | 3300025944 | Bacteria | 4555 |
| 687 | Ga0207661_10025863 | 3300025944 | Bacteria | 4466 |
| 688 | Ga0207661_10051100 | 3300025944 | Bacteria | 3297 |
| 689 | Ga0207661_10316802 | 3300025944 | Bacteria | 1401 |
| 690 | Ga0207661_10460918 | 3300025944 | Bacteria | 1158 |
| 691 | Ga0207679_10000700 | 3300025945 | Bacteria | 22406 |
| 692 | Ga0207679_10066173 | 3300025945 | Bacteria | 2707 |
| 693 | Ga0207679_10466594 | 3300025945 | Bacteria | 1122 |
| 694 | Ga0207679_10549962 | 3300025945 | Bacteria | 1036 |
| 695 | Ga0207667_10000504 | 3300025949 | Bacteria | 51526 |
| 696 | Ga0207667_10008688 | 3300025949 | Bacteria | 12037 |
| 697 | Ga0207667_10044658 | 3300025949 | Bacteria | 4695 |
| 698 | Ga0207667_10072664 | 3300025949 | Bacteria | 3575 |
| 699 | Ga0207651_10043339 | 3300025960 | Bacteria | 3002 |
| 700 | Ga0207651_10144382 | 3300025960 | Bacteria | 1843 |
| 701 | Ga0207712_10000387 | 3300025961 | Bacteria | 38262 |
| 702 | Ga0207712_10069399 | 3300025961 | Bacteria | 2529 |
| 703 | Ga0207668_10133724 | 3300025972 | Bacteria | 1897 |
| 704 | Ga0207668_10894767 | 3300025972 | Bacteria | 790 |
| 705 | Ga0207640_10000561 | 3300025981 | Bacteria | 22237 |
| 706 | Ga0207640_10044900 | 3300025981 | Bacteria | 2834 |
| 707 | Ga0207640_10046019 | 3300025981 | Bacteria | 2805 |
| 708 | Ga0207640_10158005 | 3300025981 | Bacteria | 1674 |
| 709 | Ga0207640_10248226 | 3300025981 | Bacteria | 1380 |
| 710 | Ga0207640_10753501 | 3300025981 | Bacteria | 840 |
| 711 | Ga0207658_10005272 | 3300025986 | Bacteria | 8895 |
| 712 | Ga0207658_10043202 | 3300025986 | Bacteria | 3275 |
| 713 | Ga0207658_10081105 | 3300025986 | Bacteria | 2487 |
| 714 | Ga0207658_10095677 | 3300025986 | Bacteria | 2314 |
| 715 | Ga0207658_10109338 | 3300025986 | Bacteria | 2182 |
| 716 | Ga0207658_11102789 | 3300025986 | Bacteria | 725 |
| 717 | Ga0207658_11513617 | 3300025986 | Bacteria | 614 |
| 718 | Ga0207677_10002595 | 3300026023 | Bacteria | 9498 |
| 719 | Ga0207703_10007697 | 3300026035 | Bacteria | 8533 |
| 720 | Ga0207703_10182157 | 3300026035 | Bacteria | 1854 |
| 721 | Ga0207639_10001537 | 3300026041 | Bacteria | 15493 |
| 722 | Ga0207639_10010259 | 3300026041 | Bacteria | 6483 |
| 723 | Ga0207639_10180893 | 3300026041 | Bacteria | 1793 |
| 724 | Ga0207639_11302081 | 3300026041 | Bacteria | 682 |
| 725 | Ga0207678_10011844 | 3300026067 | Bacteria | 7657 |
| 726 | Ga0207678_10113768 | 3300026067 | Bacteria | 2309 |
| 727 | Ga0207678_10752091 | 3300026067 | Bacteria | 859 |
| 728 | Ga0207708_10021285 | 3300026075 | Bacteria | 4889 |
| 729 | Ga0207708_10022116 | 3300026075 | Bacteria | 4802 |
| 730 | Ga0207708_10079877 | 3300026075 | Bacteria | 2513 |
| 731 | Ga0207702_10153614 | 3300026078 | Bacteria | 2096 |
| 732 | Ga0207702_10156142 | 3300026078 | Bacteria | 2080 |
| 733 | Ga0207702_10171250 | 3300026078 | Bacteria | 1991 |
| 734 | Ga0207702_11274774 | 3300026078 | Bacteria | 729 |
| 735 | Ga0207641_10337289 | 3300026088 | Bacteria | 1433 |
| 736 | Ga0207641_10536993 | 3300026088 | Bacteria | 1139 |
| 737 | Ga0207648_10009133 | 3300026089 | Bacteria | 9529 |
| 738 | Ga0207648_10068867 | 3300026089 | Bacteria | 3084 |
| 739 | Ga0207648_10293499 | 3300026089 | Bacteria | 1456 |
| 740 | Ga0207648_10738413 | 3300026089 | Bacteria | 914 |
| 741 | Ga0207676_10075904 | 3300026095 | Bacteria | 2713 |
| 742 | Ga0207676_10327430 | 3300026095 | Bacteria | 1409 |
| 743 | Ga0207674_10005101 | 3300026116 | Bacteria | 15678 |
| 744 | Ga0207674_10038342 | 3300026116 | Bacteria | 4974 |
| 745 | Ga0207674_10042932 | 3300026116 | Bacteria | 4665 |
| 746 | Ga0207674_10574035 | 3300026116 | Bacteria | 1089 |
| 747 | Ga0207675_100000073 | 3300026118 | Bacteria | 76959 |
| 748 | Ga0207675_100158343 | 3300026118 | Bacteria | 2159 |
| 749 | Ga0207675_100312684 | 3300026118 | Bacteria | 1532 |
| 750 | Ga0207675_100718510 | 3300026118 | Bacteria | 1009 |
| 751 | Ga0207675_100794296 | 3300026118 | Bacteria | 959 |
| 752 | Ga0207683_10160292 | 3300026121 | Bacteria | 2033 |
| 753 | Ga0207683_10267080 | 3300026121 | Bacteria | 1563 |
| 754 | Ga0207683_10950559 | 3300026121 | Bacteria | 798 |
| 755 | Ga0207698_10022884 | 3300026142 | Bacteria | 4355 |
| 756 | Ga0207698_10026876 | 3300026142 | Bacteria | 4077 |
| 757 | Ga0207698_10049238 | 3300026142 | Bacteria | 3206 |
| 758 | Ga0207698_10132163 | 3300026142 | Bacteria | 2135 |
| 759 | Ga0207698_10256870 | 3300026142 | Bacteria | 1603 |
| 760 | Ga0207698_10264203 | 3300026142 | Bacteria | 1583 |
| 761 | Ga0207698_10286733 | 3300026142 | Bacteria | 1526 |
| 762 | Ga0207698_10582448 | 3300026142 | Bacteria | 1101 |
| 763 | Ga0207698_10968950 | 3300026142 | Bacteria | 860 |
| 764 | Ga0207698_10986605 | 3300026142 | Bacteria | 853 |
| 765 | Ga0209588_1001748 | 3300027671 | Bacteria | 5755 |
| 766 | Ga0207428_10043467 | 3300027907 | Bacteria | 3628 |
| 767 | Ga0207428_10251403 | 3300027907 | Bacteria | 1318 |
| 768 | Ga0207428_10298601 | 3300027907 | Bacteria | 1192 |
| 769 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 770 | Ga0268266_10209518 | 3300028379 | Bacteria | 1787 |
| 771 | Ga0268266_10575708 | 3300028379 | Bacteria | 1080 |
| 772 | Ga0268266_10725514 | 3300028379 | Bacteria | 958 |
| 773 | Ga0268266_10796202 | 3300028379 | Bacteria | 913 |
| 774 | Ga0268265_10000317 | 3300028380 | Bacteria | 53095 |
| 775 | Ga0268265_10011944 | 3300028380 | Bacteria | 5875 |
| 776 | Ga0268265_10013830 | 3300028380 | Bacteria | 5493 |
| 777 | Ga0268265_10136214 | 3300028380 | Bacteria | 2049 |
| 778 | Ga0268264_10009384 | 3300028381 | Bacteria | 8099 |
| 779 | Ga0268264_10030217 | 3300028381 | Bacteria | 4441 |
| 780 | Ga0268264_10122888 | 3300028381 | Bacteria | 2290 |
| 781 | Ga0265318_10012857 | 3300028577 | Bacteria | 3550 |
| 782 | Ga0307517_10016351 | 3300028786 | Bacteria | 9759 |
| 783 | Ga0307517_10033670 | 3300028786 | Bacteria | 5872 |
| 784 | Ga0265330_10125862 | 3300031235 | Bacteria | 1091 |
| 785 | Ga0265332_10042857 | 3300031238 | Bacteria | 1955 |
| 786 | Ga0265339_10164758 | 3300031249 | Bacteria | 1113 |
| 787 | Ga0265331_10141666 | 3300031250 | Bacteria | 1093 |
| 788 | Ga0265316_10090223 | 3300031344 | Bacteria | 2338 |
| 789 | Ga0307513_10111590 | 3300031456 | Bacteria | 2727 |
| 790 | Ga0307408_100009821 | 3300031548 | Bacteria | 6307 |
| 791 | Ga0307408_100034024 | 3300031548 | Bacteria | 3565 |
| 792 | Ga0307408_100136555 | 3300031548 | Bacteria | 1919 |
| 793 | Ga0307408_100243875 | 3300031548 | Bacteria | 1478 |
| 794 | Ga0307408_100254937 | 3300031548 | Bacteria | 1449 |
| 795 | Ga0307408_100268737 | 3300031548 | Bacteria | 1415 |
| 796 | Ga0307408_100479616 | 3300031548 | Bacteria | 1085 |
| 797 | Ga0307408_101236386 | 3300031548 | Bacteria | 698 |
| 798 | Ga0316579_10163426 | 3300031691 | Unclassified | 1076 |
| 799 | Ga0265314_10285958 | 3300031711 | Bacteria | 931 |
| 800 | Ga0265342_10028392 | 3300031712 | Bacteria | 3486 |
| 801 | Ga0316576_10269855 | 3300031727 | Bacteria | 1275 |
| 802 | Ga0307405_10000218 | 3300031731 | Bacteria | 20640 |
| 803 | Ga0307405_10001167 | 3300031731 | Bacteria | 10812 |
| 804 | Ga0307405_10006163 | 3300031731 | Bacteria | 5874 |
| 805 | Ga0307405_10196779 | 3300031731 | Bacteria | 1460 |
| 806 | Ga0307405_10239598 | 3300031731 | Bacteria | 1343 |
| 807 | Ga0307405_10249526 | 3300031731 | Bacteria | 1320 |
| 808 | Ga0307405_10527914 | 3300031731 | Bacteria | 951 |
| 809 | Ga0307405_10536923 | 3300031731 | Bacteria | 944 |
| 810 | Ga0307405_10568266 | 3300031731 | Bacteria | 920 |
| 811 | Ga0307413_10000688 | 3300031824 | Bacteria | 11542 |
| 812 | Ga0307413_10012087 | 3300031824 | Bacteria | 4279 |
| 813 | Ga0307413_10015903 | 3300031824 | Bacteria | 3869 |
| 814 | Ga0307413_10056419 | 3300031824 | Bacteria | 2396 |
| 815 | Ga0307413_10069582 | 3300031824 | Bacteria | 2209 |
| 816 | Ga0307413_10101886 | 3300031824 | Bacteria | 1899 |
| 817 | Ga0307413_10175339 | 3300031824 | Bacteria | 1522 |
| 818 | Ga0307413_10243718 | 3300031824 | Bacteria | 1329 |
| 819 | Ga0307413_10602636 | 3300031824 | Bacteria | 899 |
| 820 | Ga0307410_10002272 | 3300031852 | Bacteria | 9207 |
| 821 | Ga0307410_10002390 | 3300031852 | Bacteria | 9056 |
| 822 | Ga0307410_10047756 | 3300031852 | Bacteria | 2863 |
| 823 | Ga0307410_10115080 | 3300031852 | Bacteria | 1952 |
| 824 | Ga0307410_10132424 | 3300031852 | Bacteria | 1833 |
| 825 | Ga0307410_10206885 | 3300031852 | Bacteria | 1501 |
| 826 | Ga0307410_10250217 | 3300031852 | Bacteria | 1377 |
| 827 | Ga0307410_10262838 | 3300031852 | Bacteria | 1346 |
| 828 | Ga0307410_10497493 | 3300031852 | Bacteria | 1002 |
| 829 | Ga0307410_10813110 | 3300031852 | Bacteria | 796 |
| 830 | Ga0307406_10005499 | 3300031901 | Bacteria | 6934 |
| 831 | Ga0307406_10010733 | 3300031901 | Bacteria | 5176 |
| 832 | Ga0307406_10020447 | 3300031901 | Bacteria | 3898 |
| 833 | Ga0307406_10027312 | 3300031901 | Bacteria | 3438 |
| 834 | Ga0307406_10074775 | 3300031901 | Bacteria | 2232 |
| 835 | Ga0307406_10665288 | 3300031901 | Bacteria | 866 |
| 836 | Ga0307407_10001188 | 3300031903 | Bacteria | 9197 |
| 837 | Ga0307407_10003414 | 3300031903 | Bacteria | 6506 |
| 838 | Ga0307407_10012118 | 3300031903 | Bacteria | 4133 |
| 839 | Ga0307407_10298697 | 3300031903 | Bacteria | 1122 |
| 840 | Ga0307407_10313344 | 3300031903 | Bacteria | 1098 |
| 841 | Ga0307407_10689269 | 3300031903 | Bacteria | 768 |
| 842 | Ga0307412_10013680 | 3300031911 | Bacteria | 4766 |
| 843 | Ga0307412_10054281 | 3300031911 | Bacteria | 2659 |
| 844 | Ga0307412_10068016 | 3300031911 | Bacteria | 2421 |
| 845 | Ga0307412_10154854 | 3300031911 | Bacteria | 1695 |
| 846 | Ga0307412_10165327 | 3300031911 | Bacteria | 1649 |
| 847 | Ga0307412_10256254 | 3300031911 | Bacteria | 1361 |
| 848 | Ga0307412_10267337 | 3300031911 | Bacteria | 1336 |
| 849 | Ga0307412_10538666 | 3300031911 | Bacteria | 978 |
| 850 | Ga0307409_100002960 | 3300031995 | Bacteria | 9043 |
| 851 | Ga0307409_100006362 | 3300031995 | Bacteria | 6930 |
| 852 | Ga0307409_100047713 | 3300031995 | Bacteria | 3253 |
| 853 | Ga0307409_100561431 | 3300031995 | Bacteria | 1122 |
| 854 | Ga0307409_100583169 | 3300031995 | Bacteria | 1103 |
| 855 | Ga0307409_100718902 | 3300031995 | Bacteria | 1000 |
| 856 | Ga0307409_100910479 | 3300031995 | Bacteria | 894 |
| 857 | Ga0307409_101032041 | 3300031995 | Bacteria | 841 |
| 858 | Ga0307409_101355372 | 3300031995 | Bacteria | 737 |
| 859 | Ga0307416_100000558 | 3300032002 | Bacteria | 19016 |
| 860 | Ga0307416_100005562 | 3300032002 | Bacteria | 7759 |
| 861 | Ga0307416_100024697 | 3300032002 | Bacteria | 4392 |
| 862 | Ga0307416_100138514 | 3300032002 | Bacteria | 2207 |
| 863 | Ga0307416_100191072 | 3300032002 | Bacteria | 1931 |
| 864 | Ga0307416_100358158 | 3300032002 | Bacteria | 1480 |
| 865 | Ga0307416_100506417 | 3300032002 | Bacteria | 1273 |
| 866 | Ga0307416_100520118 | 3300032002 | Bacteria | 1258 |
| 867 | Ga0307416_100585750 | 3300032002 | Bacteria | 1193 |
| 868 | Ga0307416_101063088 | 3300032002 | Bacteria | 913 |
| 869 | Ga0307416_101158283 | 3300032002 | Bacteria | 878 |
| 870 | Ga0307414_10002216 | 3300032004 | Bacteria | 10133 |
| 871 | Ga0307414_10018739 | 3300032004 | Bacteria | 4270 |
| 872 | Ga0307414_10020825 | 3300032004 | Bacteria | 4096 |
| 873 | Ga0307414_10025283 | 3300032004 | Bacteria | 3801 |
| 874 | Ga0307414_10070923 | 3300032004 | Bacteria | 2511 |
| 875 | Ga0307414_10073604 | 3300032004 | Bacteria | 2472 |
| 876 | Ga0307414_10151109 | 3300032004 | Bacteria | 1832 |
| 877 | Ga0307414_10488708 | 3300032004 | Bacteria | 1087 |
| 878 | Ga0307414_10720647 | 3300032004 | Bacteria | 904 |
| 879 | Ga0307411_10000106 | 3300032005 | Bacteria | 26146 |
| 880 | Ga0307411_10000758 | 3300032005 | Bacteria | 11921 |
| 881 | Ga0307411_10004491 | 3300032005 | Bacteria | 6692 |
| 882 | Ga0307411_10058012 | 3300032005 | Bacteria | 2560 |
| 883 | Ga0307411_10082023 | 3300032005 | Bacteria | 2222 |
| 884 | Ga0307411_10094333 | 3300032005 | Bacteria | 2098 |
| 885 | Ga0307411_10129842 | 3300032005 | Bacteria | 1840 |
| 886 | Ga0307411_10199209 | 3300032005 | Bacteria | 1536 |
| 887 | Ga0307411_10252838 | 3300032005 | Bacteria | 1387 |
| 888 | Ga0307415_100011835 | 3300032126 | Bacteria | 5015 |
| 889 | Ga0307415_100110120 | 3300032126 | Bacteria | 2041 |
| 890 | Ga0307415_100214214 | 3300032126 | Bacteria | 1539 |
| 891 | Ga0307415_100401813 | 3300032126 | Bacteria | 1170 |
| 892 | Ga0307415_100404413 | 3300032126 | Bacteria | 1166 |
| 893 | Ga0316583_10024650 | 3300032133 | Bacteria | 2148 |
| 894 | Ga0316593_10009543 | 3300032168 | Bacteria | 2745 |
| 895 | Ga0307510_10002311 | 3300033180 | Bacteria | 21551 |
| 896 | Ga0316588_1135970 | 3300033528 | Unclassified | 627 |
| 897 | Ga0373930_0030647 | 3300034816 | Bacteria | 1105 |
| 898 | Ga0373958_0034955 | 3300034819 | Bacteria | 1004 |
| 899 | Ga0373926_0009877 | 3300035083 | Bacteria | 3192 |
| 900 | Ga0373934_0000166 | 3300035086 | Bacteria | 24039 |
| 901 | Ga0373944_0006824 | 3300035089 | Bacteria | 3043 |
| 902 | Ga0373923_0015436 | 3300035111 | Bacteria | 2884 |
| 903 | Ga0373953_0005021 | 3300035117 | Bacteria | 4263 |
| 904 | Ga0373956_0000183 | 3300035119 | Bacteria | 23812 |
| 905 | Ga0373943_0001415 | 3300035170 | Bacteria | 10819 |
| 906 | Ga0373943_0017073 | 3300035170 | Bacteria | 3319 |
| 907 | Ga0373946_0002897 | 3300035171 | Bacteria | 6085 |
| 908 | Ga0373955_0000753 | 3300035172 | Bacteria | 13899 |
| 909 | Ga0373924_0007550 | 3300035410 | Bacteria | 3930 |
| 910 | Ga0373935_0005704 | 3300035692 | Bacteria | 7350 |
| 911 | Ga0373935_0175156 | 3300035692 | Unclassified | 1469 |
| 912 | Ga0373927_0021535 | 3300035695 | Bacteria | 4225 |
| 913 | Ga0373933_0000131 | 3300035724 | Bacteria | 47471 |
| 914 | Ga0373947_0001610 | 3300035725 | Bacteria | 13849 |
| 915 | Ga0373937_0000512 | 3300036401 | Bacteria | 35027 |
| 916 | Ga0373937_0911175 | 3300036401 | Unclassified | 828 |
| 917 | Ga0316582_0155203 | 3300036647 | Bacteria | 1549 |
| 918 | Ga0316582_0158614 | 3300036647 | Bacteria | 1532 |
| 919 | Ga0316582_0555736 | 3300036647 | Bacteria | 791 |
| 920 | Ga0373925_0003211 | 3300037068 | Bacteria | 12781 |
| 921 | Ga0373925_0131580 | 3300037068 | Bacteria | 1951 |
| 922 | Ga0395899_0187269 | 3300037312 | Bacteria | 1450 |
| 923 | Ga0395900_0162022 | 3300037418 | Bacteria | 2281 |
| 924 | Ga0395898_0152291 | 3300037466 | Bacteria | 2212 |
| 925 | Ga0395898_0609773 | 3300037466 | Bacteria | 1034 |
| 926 | Ga0395905_0002689 | 3300037471 | Bacteria | 19495 |
| 927 | Ga0395905_0358540 | 3300037471 | Bacteria | 1351 |
| 928 | Ga0436364_0647371 | 3300037853 | Bacteria | 3943 |
| 929 | Ga0395901_0364573 | 3300038443 | Bacteria | 1489 |
| 930 | Ga0395901_0701191 | 3300038443 | Bacteria | 1010 |
| 931 | Ga0395901_1016363 | 3300038443 | Bacteria | 804 |
| 932 | Ga0242420_001481 | 3300038996 | Bacteria | 3137 |
| 933 | Ga0400489_51950 | 3300039093 | Bacteria | 1135 |
| 934 | Ga0436365_0143962 | 3300039437 | Bacteria | 1061 |
| 935 | Ga0436365_0479744 | 3300039437 | Bacteria | 662 |
| 936 | Ga0436365_1821459 | 3300039437 | Bacteria | 3719 |
| 937 | Ga0439439_0011221 | 3300041406 | Bacteria | 2153 |
| 938 | Ga0451802_1617087 | 3300041460 | Bacteria | 610 |
| 939 | Ga0451839_0303675 | 3300041496 | Bacteria | 1076 |
| 940 | Ga0451839_1201838 | 3300041496 | Bacteria | 761 |
| 941 | Ga0439448_0064085 | 3300042005 | Bacteria | 1218 |
| 942 | Ga0450912_007828 | 3300042116 | Bacteria | 876 |
| 943 | Ga0450923_018708 | 3300042125 | Bacteria | 1328 |
| 944 | Ga0439446_0096860 | 3300042156 | Bacteria | 929 |
| 945 | Ga0439446_0108724 | 3300042156 | Bacteria | 883 |
| 946 | Ga0439444_0015838 | 3300042437 | Bacteria | 1277 |
| 947 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 948 | Ga0451577_0071378 | 3300042876 | Bacteria | 3097 |
| 949 | Ga0451577_0208209 | 3300042876 | Bacteria | 1766 |
| 950 | Ga0451577_0611274 | 3300042876 | Bacteria | 989 |
| 951 | Ga0466969_0040961 | 3300044656 | Bacteria | 2319 |
| 952 | Ga0453683_0091147 | 3300044673 | Bacteria | 1911 |
| 953 | Ga0453683_0122524 | 3300044673 | Bacteria | 1637 |
| 954 | Ga0453683_0154459 | 3300044673 | Bacteria | 1451 |
| 955 | Ga0453683_0194666 | 3300044673 | Bacteria | 1287 |
| 956 | Ga0453683_0249604 | 3300044673 | Bacteria | 1131 |
| 957 | Ga0453683_0378458 | 3300044673 | Bacteria | 911 |
| 958 | Ga0466961_0001485 | 3300044693 | Bacteria | 14575 |
| 959 | Ga0466957_0680759 | 3300044842 | Bacteria | 725 |
| 960 | Ga0466957_0808530 | 3300044842 | Bacteria | 666 |
| 961 | Ga0466959_0254615 | 3300045049 | Bacteria | 1210 |
| 962 | Ga0451576_0005609 | 3300045051 | Bacteria | 15677 |
| 963 | Ga0451576_0014051 | 3300045051 | Bacteria | 8921 |
| 964 | Ga0451576_0024084 | 3300045051 | Bacteria | 6578 |
| 965 | Ga0451576_0033100 | 3300045051 | Bacteria | 5495 |
| 966 | Ga0451576_0116219 | 3300045051 | Bacteria | 2785 |
| 967 | Ga0451576_0164712 | 3300045051 | Bacteria | 2313 |
| 968 | Ga0451576_0235878 | 3300045051 | Bacteria | 1911 |
| 969 | Ga0451576_0286223 | 3300045051 | Bacteria | 1723 |
| 970 | Ga0451576_0308237 | 3300045051 | Bacteria | 1656 |
| 971 | Ga0451576_0411948 | 3300045051 | Bacteria | 1417 |
| 972 | Ga0451576_0437646 | 3300045051 | Bacteria | 1372 |
| 973 | Ga0451576_1004544 | 3300045051 | Bacteria | 874 |
| 974 | Ga0466958_0350601 | 3300045836 | Bacteria | 950 |
| 975 | Ga0466967_0041154 | 3300045976 | Bacteria | 3982 |
| 976 | Ga0466967_0423507 | 3300045976 | Bacteria | 1298 |
| 977 | Ga0495617_003809 | 3300046452 | Bacteria | 5578 |
| 978 | Ga0495617_034525 | 3300046452 | Bacteria | 1698 |
| 979 | Ga0495617_077577 | 3300046452 | Bacteria | 1090 |
| 980 | Ga0495627_000615 | 3300046453 | Bacteria | 28285 |
| 981 | Ga0495592_0001194 | 3300046454 | Bacteria | 18032 |
| 982 | Ga0495603_0001831 | 3300046455 | Bacteria | 12545 |
| 983 | Ga0495629_0037844 | 3300046459 | Bacteria | 3400 |
| 984 | Ga0495629_0226023 | 3300046459 | Bacteria | 1290 |
| 985 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 986 | Ga0495638_0177218 | 3300046460 | Bacteria | 1219 |
| 987 | Ga0495638_0252754 | 3300046460 | Bacteria | 971 |
| 988 | Ga0495641_0194832 | 3300046461 | Bacteria | 908 |
| 989 | Ga0495651_0000098 | 3300046462 | Bacteria | 63881 |
| 990 | Ga0495653_0000168 | 3300046463 | Bacteria | 54127 |
| 991 | Ga0495650_0000670 | 3300046471 | Bacteria | 44598 |
| 992 | Ga0495580_0005634 | 3300046472 | Bacteria | 10300 |
| 993 | Ga0495580_0079783 | 3300046472 | Bacteria | 2282 |
| 994 | Ga0495582_0000694 | 3300046473 | Bacteria | 18567 |
| 995 | Ga0495639_0000412 | 3300046475 | Bacteria | 20413 |
| 996 | Ga0495639_0054369 | 3300046475 | Bacteria | 1825 |
| 997 | Ga0495639_0162507 | 3300046475 | Bacteria | 1081 |
| 998 | Ga0495639_0356119 | 3300046475 | Unclassified | 735 |
| 999 | Ga0495584_0069479 | 3300046491 | Bacteria | 1770 |
| 1000 | Ga0495585_0426236 | 3300046492 | Bacteria | 637 |
| 1001 | Ga0495596_0001277 | 3300046500 | Bacteria | 14545 |
| 1002 | Ga0495596_0010224 | 3300046500 | Bacteria | 4094 |
| 1003 | Ga0495596_0028255 | 3300046500 | Bacteria | 2253 |
| 1004 | Ga0495596_0272443 | 3300046500 | Bacteria | 657 |
| 1005 | Ga0495607_0120354 | 3300046501 | Bacteria | 1379 |
| 1006 | Ga0495607_0208425 | 3300046501 | Bacteria | 963 |
| 1007 | Ga0495583_0000038 | 3300046506 | Bacteria | 243395 |
| 1008 | Ga0495583_0002196 | 3300046506 | Bacteria | 17335 |
| 1009 | Ga0495583_0004381 | 3300046506 | Bacteria | 10147 |
| 1010 | Ga0495583_0039917 | 3300046506 | Bacteria | 2208 |
| 1011 | Ga0495583_0061344 | 3300046506 | Bacteria | 1678 |
| 1012 | Ga0495583_0108756 | 3300046506 | Bacteria | 1176 |
| 1013 | Ga0495606_0069957 | 3300046507 | Bacteria | 2215 |
| 1014 | Ga0495608_0003342 | 3300046511 | Bacteria | 11466 |
| 1015 | Ga0495610_0000280 | 3300046512 | Bacteria | 53046 |
| 1016 | Ga0495610_0001450 | 3300046512 | Bacteria | 20950 |
| 1017 | Ga0495616_0000040 | 3300046513 | Bacteria | 122596 |
| 1018 | Ga0495616_0122665 | 3300046513 | Bacteria | 1198 |
| 1019 | Ga0495618_0099010 | 3300046514 | Unclassified | 1866 |
| 1020 | Ga0495628_0000991 | 3300046516 | Bacteria | 25951 |
| 1021 | Ga0495630_0028854 | 3300046517 | Bacteria | 4124 |
| 1022 | Ga0495630_0059253 | 3300046517 | Bacteria | 2872 |
| 1023 | Ga0495630_0188832 | 3300046517 | Bacteria | 1572 |
| 1024 | Ga0495631_0083146 | 3300046518 | Bacteria | 1380 |
| 1025 | Ga0495632_0008232 | 3300046519 | Bacteria | 6430 |
| 1026 | Ga0495632_0012016 | 3300046519 | Bacteria | 5015 |
| 1027 | Ga0495637_0024958 | 3300046520 | Bacteria | 2700 |
| 1028 | Ga0495643_0000024 | 3300046522 | Bacteria | 282193 |
| 1029 | Ga0495643_0003604 | 3300046522 | Bacteria | 11255 |
| 1030 | Ga0495643_0006598 | 3300046522 | Bacteria | 7626 |
| 1031 | Ga0495643_0009295 | 3300046522 | Bacteria | 6121 |
| 1032 | Ga0495643_0010333 | 3300046522 | Bacteria | 5747 |
| 1033 | Ga0495643_0043554 | 3300046522 | Bacteria | 2442 |
| 1034 | Ga0495643_0158021 | 3300046522 | Bacteria | 1117 |
| 1035 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 1036 | Ga0495648_0002055 | 3300046524 | Bacteria | 19074 |
| 1037 | Ga0495648_0037338 | 3300046524 | Bacteria | 3123 |
| 1038 | Ga0495663_0105672 | 3300046525 | Bacteria | 931 |
| 1039 | Ga0495666_0093790 | 3300046526 | Bacteria | 1416 |
| 1040 | Ga0495642_0117854 | 3300046528 | Bacteria | 1138 |
| 1041 | Ga0495642_0138682 | 3300046528 | Bacteria | 1049 |
| 1042 | Ga0495652_0000694 | 3300046529 | Bacteria | 39080 |
| 1043 | Ga0495665_0000916 | 3300046531 | Bacteria | 15543 |
| 1044 | Ga0495665_0109111 | 3300046531 | Unclassified | 1452 |
| 1045 | Ga0495640_0530831 | 3300046533 | Unclassified | 714 |
| 1046 | Ga0495586_0235721 | 3300046535 | Bacteria | 1042 |
| 1047 | Ga0495587_0000628 | 3300046536 | Bacteria | 23752 |
| 1048 | Ga0495598_0007061 | 3300046537 | Bacteria | 2560 |
| 1049 | Ga0495609_0003753 | 3300046538 | Bacteria | 8568 |
| 1050 | Ga0495609_0169291 | 3300046538 | Bacteria | 923 |
| 1051 | Ga0495621_0178660 | 3300046539 | Bacteria | 846 |
| 1052 | Ga0495645_0000106 | 3300046543 | Bacteria | 57528 |
| 1053 | Ga0495622_0008547 | 3300046557 | Bacteria | 4744 |
| 1054 | Ga0495622_0121061 | 3300046557 | Bacteria | 1195 |
| 1055 | Ga0495633_0067542 | 3300046558 | Bacteria | 1669 |
| 1056 | Ga0495667_0000431 | 3300046559 | Bacteria | 26897 |
| 1057 | Ga0495656_0032053 | 3300046615 | Bacteria | 2136 |
| 1058 | Ga0495668_0001117 | 3300046616 | Bacteria | 27675 |
| 1059 | Ga0495668_0006518 | 3300046616 | Bacteria | 7634 |
| 1060 | Ga0495668_0097369 | 3300046616 | Bacteria | 1610 |
| 1061 | Ga0495611_0021891 | 3300046648 | Bacteria | 2763 |
| 1062 | Ga0495625_0007661 | 3300046660 | Bacteria | 9359 |
| 1063 | Ga0495625_0010831 | 3300046660 | Bacteria | 7501 |
| 1064 | Ga0495625_0038178 | 3300046660 | Bacteria | 3517 |
| 1065 | Ga0495635_0000344 | 3300046663 | Bacteria | 29638 |
| 1066 | Ga0495588_0005262 | 3300046674 | Bacteria | 5751 |
| 1067 | Ga0495657_0001006 | 3300046675 | Bacteria | 24822 |
| 1068 | Ga0495599_0000150 | 3300046678 | Bacteria | 45637 |
| 1069 | Ga0495623_0000597 | 3300046679 | Bacteria | 24122 |
| 1070 | Ga0495646_0001072 | 3300046680 | Bacteria | 15888 |
| 1071 | Ga0495647_0070788 | 3300046681 | Bacteria | 1396 |
| 1072 | Ga0495647_0140762 | 3300046681 | Bacteria | 1028 |
| 1073 | Ga0495647_0176939 | 3300046681 | Bacteria | 927 |
| 1074 | Ga0495658_0000829 | 3300046683 | Bacteria | 16573 |
| 1075 | Ga0495658_0263008 | 3300046683 | Bacteria | 1086 |
| 1076 | Ga0495669_0162452 | 3300046684 | Bacteria | 1060 |
| 1077 | Ga0495670_0093770 | 3300046691 | Bacteria | 1539 |
| 1078 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 1079 | Ga0495671_0140005 | 3300046692 | Bacteria | 1179 |
| 1080 | Ga0495649_0143183 | 3300046694 | Bacteria | 1257 |
| 1081 | Ga0495600_0000156 | 3300046809 | Bacteria | 39196 |
| 1082 | Ga0495600_0002857 | 3300046809 | Bacteria | 10053 |
| 1083 | Ga0495581_0001381 | 3300047315 | Bacteria | 13446 |
| 1084 | Ga0495581_0357140 | 3300047315 | Bacteria | 853 |
| 1085 | Ga0495604_0000519 | 3300047317 | Bacteria | 33907 |
| 1086 | Ga0495674_0009525 | 3300047319 | Bacteria | 9227 |
| 1087 | Ga0495680_0042318 | 3300047322 | Bacteria | 3616 |
| 1088 | Ga0495683_0006512 | 3300047323 | Bacteria | 6379 |
| 1089 | Ga0495675_0003427 | 3300047444 | Bacteria | 9552 |
| 1090 | Ga0495677_0072950 | 3300047445 | Bacteria | 1280 |
| 1091 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 1092 | Ga0495681_0000110 | 3300047470 | Bacteria | 70960 |
| 1093 | Ga0495681_0012381 | 3300047470 | Bacteria | 5016 |
| 1094 | Ga0495681_0084255 | 3300047470 | Bacteria | 1414 |
| 1095 | Ga0495684_0000216 | 3300047471 | Bacteria | 44631 |
| 1096 | Ga0495686_0025735 | 3300047472 | Bacteria | 3855 |
| 1097 | Ga0495686_0036162 | 3300047472 | Bacteria | 3170 |
| 1098 | Ga0495593_0001785 | 3300047673 | Bacteria | 12750 |
| 1099 | Ga0495593_0168665 | 3300047673 | Bacteria | 1104 |
| 1100 | Ga0495602_0002360 | 3300048088 | Bacteria | 19106 |
| 1101 | Ga0495614_0012061 | 3300048089 | Bacteria | 3795 |
| 1102 | Ga0495626_0002997 | 3300048091 | Bacteria | 11187 |
| 1103 | Ga0496100_0065575 | 3300048903 | Bacteria | 2406 |
| 1104 | Ga0496100_0388923 | 3300048903 | Bacteria | 1060 |
| 1105 | Ga0496101_0010381 | 3300048904 | Bacteria | 6149 |
| 1106 | Ga0496101_0037387 | 3300048904 | Bacteria | 3444 |
| 1107 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 1108 | Ga0496102_0000452 | 3300048905 | Bacteria | 46768 |
| 1109 | Ga0496102_0207163 | 3300048905 | Bacteria | 1849 |
| 1110 | Ga0496102_1062306 | 3300048905 | Bacteria | 730 |
| 1111 | Ga0496103_0000095 | 3300048906 | Bacteria | 98260 |
| 1112 | Ga0496103_0000518 | 3300048906 | Bacteria | 31718 |
| 1113 | Ga0496104_0000060 | 3300048907 | Bacteria | 117966 |
| 1114 | Ga0496104_0052117 | 3300048907 | Bacteria | 3864 |
| 1115 | Ga0496105_0000122 | 3300048908 | Bacteria | 52475 |
| 1116 | Ga0496106_0311509 | 3300048909 | Bacteria | 1263 |
| 1117 | Ga0496107_0253564 | 3300048910 | Bacteria | 1309 |
| 1118 | Ga0496109_0084360 | 3300048912 | Bacteria | 2931 |
| 1119 | Ga0496112_0492901 | 3300048915 | Bacteria | 1161 |
| 1120 | Ga0496113_0040834 | 3300048916 | Bacteria | 3420 |
| 1121 | Ga0496113_0209281 | 3300048916 | Bacteria | 1552 |
| 1122 | Ga0496113_0851735 | 3300048916 | Bacteria | 722 |
| 1123 | Ga0496114_0032385 | 3300048917 | Bacteria | 4303 |
| 1124 | Ga0496114_0156191 | 3300048917 | Bacteria | 1981 |
| 1125 | Ga0496114_1014845 | 3300048917 | Bacteria | 713 |
| 1126 | Ga0496115_0000230 | 3300048918 | Bacteria | 50872 |
| 1127 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 1128 | Ga0496116_0022284 | 3300048919 | Bacteria | 4751 |
| 1129 | Ga0496116_0109884 | 3300048919 | Bacteria | 1623 |
| 1130 | Ga0496117_0000885 | 3300048920 | Bacteria | 46146 |
| 1131 | Ga0496117_0003116 | 3300048920 | Bacteria | 19798 |
| 1132 | Ga0496117_0111026 | 3300048920 | Bacteria | 1708 |
| 1133 | Ga0496118_0000144 | 3300048921 | Bacteria | 124411 |
| 1134 | Ga0496118_0002769 | 3300048921 | Bacteria | 22965 |
| 1135 | Ga0496118_0155393 | 3300048921 | Bacteria | 1424 |
| 1136 | Ga0496119_0000222 | 3300048922 | Bacteria | 79824 |
| 1137 | Ga0496119_0017296 | 3300048922 | Bacteria | 5429 |
| 1138 | Ga0496120_0001728 | 3300048923 | Bacteria | 24842 |
| 1139 | Ga0496120_0184298 | 3300048923 | Bacteria | 1022 |
| 1140 | Ga0496121_0000295 | 3300048924 | Bacteria | 103239 |
| 1141 | Ga0496121_0000681 | 3300048924 | Bacteria | 63345 |
| 1142 | Ga0496121_0002209 | 3300048924 | Bacteria | 30388 |
| 1143 | Ga0496121_0324839 | 3300048924 | Bacteria | 1034 |
| 1144 | Ga0496122_0001902 | 3300048925 | Bacteria | 31581 |
| 1145 | Ga0496122_0018297 | 3300048925 | Bacteria | 6485 |
| 1146 | Ga0496123_0003060 | 3300048926 | Bacteria | 19222 |
| 1147 | Ga0496123_0081359 | 3300048926 | Bacteria | 1968 |
| 1148 | Ga0496123_0106643 | 3300048926 | Bacteria | 1613 |
| 1149 | Ga0496124_0000683 | 3300048927 | Bacteria | 55788 |
| 1150 | Ga0496124_0001019 | 3300048927 | Bacteria | 44416 |
| 1151 | Ga0496124_0004374 | 3300048927 | Bacteria | 16529 |
| 1152 | Ga0496124_0011492 | 3300048927 | Bacteria | 8845 |
| 1153 | Ga0496125_0022675 | 3300048928 | Bacteria | 5823 |
| 1154 | Ga0496125_0023499 | 3300048928 | Bacteria | 5689 |
| 1155 | Ga0496125_0085179 | 3300048928 | Bacteria | 2396 |
| 1156 | Ga0496125_0180598 | 3300048928 | Bacteria | 1406 |
| 1157 | Ga0496125_0394095 | 3300048928 | Bacteria | 811 |
| 1158 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 1159 | Ga0496126_0000294 | 3300048929 | Bacteria | 106327 |
| 1160 | Ga0496126_0001756 | 3300048929 | Bacteria | 32069 |
| 1161 | Ga0496126_0028161 | 3300048929 | Bacteria | 5357 |
| 1162 | Ga0495678_037828 | 3300049459 | Bacteria | 1957 |
| 1163 | Ga0495682_0278892 | 3300049460 | Bacteria | 590 |
| 1164 | Ga0501033_0148431 | 3300049570 | Bacteria | 1693 |
| 1165 | Ga0501033_0420282 | 3300049570 | Bacteria | 931 |
| 1166 | Ga0501034_0205917 | 3300049571 | Bacteria | 1924 |
| 1167 | Ga0501036_0131146 | 3300049572 | Bacteria | 2116 |
| 1168 | Ga0501036_0717434 | 3300049572 | Bacteria | 826 |
| 1169 | Ga0501038_0040818 | 3300049574 | Bacteria | 4049 |
| 1170 | Ga0501038_0160538 | 3300049574 | Bacteria | 1827 |
| 1171 | Ga0501040_0011434 | 3300049576 | Bacteria | 5812 |
| 1172 | Ga0501040_0349794 | 3300049576 | Bacteria | 1059 |
| 1173 | Ga0501041_0074500 | 3300049577 | Bacteria | 2086 |
| 1174 | Ga0501042_0523373 | 3300049578 | Bacteria | 861 |
| 1175 | Ga0501046_0499865 | 3300049580 | Bacteria | 871 |
| 1176 | Ga0501046_0773466 | 3300049580 | Bacteria | 674 |
| 1177 | Ga0501047_0049597 | 3300049581 | Bacteria | 4053 |
| 1178 | Ga0501048_0078360 | 3300049582 | Bacteria | 2332 |
| 1179 | Ga0501048_0384830 | 3300049582 | Bacteria | 1002 |
| 1180 | Ga0501067_0002587 | 3300049583 | Bacteria | 9997 |
| 1181 | Ga0501067_0007341 | 3300049583 | Bacteria | 6124 |
| 1182 | Ga0501067_0272501 | 3300049583 | Bacteria | 942 |
| 1183 | Ga0501068_0009565 | 3300049584 | Bacteria | 5428 |
| 1184 | Ga0501069_0068679 | 3300049585 | Bacteria | 1983 |
| 1185 | Ga0501069_0091690 | 3300049585 | Bacteria | 1718 |
| 1186 | Ga0501070_0010086 | 3300049586 | Bacteria | 7994 |
| 1187 | Ga0501070_0018920 | 3300049586 | Bacteria | 5777 |
| 1188 | Ga0501070_0027735 | 3300049586 | Bacteria | 4751 |
| 1189 | Ga0501071_0037770 | 3300049587 | Bacteria | 3449 |
| 1190 | Ga0501071_0486449 | 3300049587 | Bacteria | 946 |
| 1191 | Ga0501072_0069103 | 3300049588 | Bacteria | 2789 |
| 1192 | Ga0501072_0104051 | 3300049588 | Bacteria | 2257 |
| 1193 | Ga0501073_0000699 | 3300049589 | Bacteria | 23637 |
| 1194 | Ga0501073_0079560 | 3300049589 | Bacteria | 2281 |
| 1195 | Ga0501073_0560125 | 3300049589 | Bacteria | 790 |
| 1196 | Ga0501074_0018819 | 3300049590 | Bacteria | 5016 |
| 1197 | Ga0501074_0216128 | 3300049590 | Bacteria | 1365 |
| 1198 | Ga0501075_0117832 | 3300049591 | Bacteria | 2019 |
| 1199 | Ga0501075_0241150 | 3300049591 | Bacteria | 1378 |
| 1200 | Ga0501076_0013971 | 3300049592 | Bacteria | 6032 |
| 1201 | Ga0501076_0364913 | 3300049592 | Bacteria | 1186 |
| 1202 | Ga0501077_0013893 | 3300049593 | Bacteria | 5048 |
| 1203 | Ga0501077_0313608 | 3300049593 | Bacteria | 1000 |
| 1204 | Ga0501198_053201 | 3300049649 | Bacteria | 726 |
| 1205 | Ga0501239_021921 | 3300049672 | Bacteria | 790 |
| 1206 | Ga0501239_032088 | 3300049672 | Bacteria | 694 |
| 1207 | Ga0501242_019155 | 3300049674 | Bacteria | 873 |
| 1208 | Ga0501243_000868 | 3300049675 | Bacteria | 4213 |
| 1209 | Ga0501249_052454 | 3300049679 | Bacteria | 937 |
| 1210 | Ga0501256_007484 | 3300049685 | Bacteria | 1003 |
| 1211 | Ga0501257_021569 | 3300049686 | Bacteria | 1520 |
| 1212 | Ga0501258_015862 | 3300049687 | Bacteria | 847 |
| 1213 | Ga0501259_019257 | 3300049688 | Bacteria | 1200 |
| 1214 | Ga0501234_013329 | 3300049707 | Unclassified | 1290 |
| 1215 | Ga0501080_0017347 | 3300049742 | Bacteria | 6656 |
| 1216 | Ga0501080_0035643 | 3300049742 | Bacteria | 4643 |
| 1217 | Ga0501080_0205592 | 3300049742 | Bacteria | 1806 |
| 1218 | Ga0501080_0772936 | 3300049742 | Bacteria | 844 |
| 1219 | Ga0501080_0930910 | 3300049742 | Bacteria | 756 |
| 1220 | Ga0501081_0008481 | 3300049743 | Bacteria | 6680 |
| 1221 | Ga0501081_0126430 | 3300049743 | Bacteria | 1824 |
| 1222 | Ga0501083_0155109 | 3300049744 | Bacteria | 1499 |
| 1223 | Ga0501083_0241184 | 3300049744 | Bacteria | 1177 |
| 1224 | Ga0501241_003688 | 3300049758 | Bacteria | 2888 |
| 1225 | Ga0501268_023134 | 3300049765 | Bacteria | 1077 |
| 1226 | Ga0501268_039691 | 3300049765 | Bacteria | 882 |
| 1227 | Ga0501279_038112 | 3300049775 | Bacteria | 730 |
| 1228 | Ga0501035_0054536 | 3300049822 | Bacteria | 3572 |
| 1229 | Ga0501045_0109752 | 3300049824 | Bacteria | 2045 |
| 1230 | Ga0501045_0325217 | 3300049824 | Bacteria | 1144 |
| 1231 | nmdc:mga03n38_656455_c1 | 3300050490 | Bacteria | 601 |
| 1232 | nmdc:mga0k408_137697_c1 | 3300050493 | Bacteria | 1451 |
| 1233 | nmdc:mga0k408_32421_c1 | 3300050493 | Bacteria | 2985 |
| 1234 | nmdc:mga07m45_242839_c1 | 3300050496 | Bacteria | 1048 |
| 1235 | nmdc:mga07m45_318841_c1 | 3300050496 | Bacteria | 903 |
| 1236 | nmdc:mga05p37_106348_c1 | 3300050507 | Bacteria | 3452 |
| 1237 | nmdc:mga05p37_238495_c1 | 3300050507 | Bacteria | 2188 |
| 1238 | nmdc:mga05p37_258866_c1 | 3300050507 | Bacteria | 2083 |
| 1239 | nmdc:mga05p37_281510_c1 | 3300050507 | Bacteria | 1983 |
| 1240 | nmdc:mga05p37_454546_c1 | 3300050507 | Bacteria | 1481 |
| 1241 | nmdc:mga05p37_47795_c1 | 3300050507 | Bacteria | 5262 |
| 1242 | nmdc:mga05p37_608385_c1 | 3300050507 | Bacteria | 1232 |
| 1243 | nmdc:mga05p37_999832_c1 | 3300050507 | Bacteria | 889 |
| 1244 | nmdc:mga09592_211828_c1 | 3300050508 | Bacteria | 1679 |
| 1245 | nmdc:mga09592_217202_c1 | 3300050508 | Bacteria | 1657 |
| 1246 | nmdc:mga09592_341055_c1 | 3300050508 | Bacteria | 1297 |
| 1247 | nmdc:mga09592_436827_c1 | 3300050508 | Bacteria | 1130 |
| 1248 | nmdc:mga09592_51799_c1 | 3300050508 | Bacteria | 3463 |
| 1249 | nmdc:mga09592_59608_c1 | 3300050508 | Bacteria | 3227 |
| 1250 | nmdc:mga0qj67_143145_c1 | 3300050509 | Bacteria | 1939 |
| 1251 | nmdc:mga0qj67_45376_c1 | 3300050509 | Bacteria | 3468 |
| 1252 | nmdc:mga0qj67_82037_c1 | 3300050509 | Bacteria | 2586 |
| 1253 | nmdc:mga0qj67_86238_c1 | 3300050509 | Bacteria | 2519 |
| 1254 | nmdc:mga0qj67_981014_c1 | 3300050509 | Bacteria | 663 |
| 1255 | nmdc:mga06r32_127682_c1 | 3300050510 | Bacteria | 2512 |
| 1256 | nmdc:mga06r32_148749_c1 | 3300050510 | Bacteria | 2320 |
| 1257 | nmdc:mga06r32_1559200_c1 | 3300050510 | Bacteria | 600 |
| 1258 | nmdc:mga06r32_159464_c1 | 3300050510 | Bacteria | 2238 |
| 1259 | nmdc:mga06r32_26098_c1 | 3300050510 | Bacteria | 5443 |
| 1260 | nmdc:mga06r32_303452_c1 | 3300050510 | Bacteria | 1582 |
| 1261 | nmdc:mga06r32_313984_c1 | 3300050510 | Bacteria | 1553 |
| 1262 | nmdc:mga06r32_32791_c1 | 3300050510 | Bacteria | 4890 |
| 1263 | nmdc:mga06r32_357944_c1 | 3300050510 | Bacteria | 1444 |
| 1264 | nmdc:mga06r32_39284_c1 | 3300050510 | Bacteria | 4490 |
| 1265 | nmdc:mga08y16_542106_c1 | 3300050511 | Bacteria | 1178 |
| 1266 | nmdc:mga08y16_67181_c1 | 3300050511 | Bacteria | 3740 |
| 1267 | nmdc:mga08y16_83386_c1 | 3300050511 | Bacteria | 3331 |
| 1268 | nmdc:mga0n895_114290_c1 | 3300050512 | Bacteria | 2718 |
| 1269 | nmdc:mga0n895_1190322_c1 | 3300050512 | Bacteria | 736 |
| 1270 | nmdc:mga0n895_1574_c1 | 3300050512 | Bacteria | 17176 |
| 1271 | nmdc:mga0n895_17899_c1 | 3300050512 | Bacteria | 6545 |
| 1272 | nmdc:mga0n895_1919_c1 | 3300050512 | Bacteria | 15927 |
| 1273 | nmdc:mga0n895_227436_c1 | 3300050512 | Bacteria | 1894 |
| 1274 | nmdc:mga0n895_2307_c1 | 3300050512 | Bacteria | 14848 |
| 1275 | nmdc:mga0n895_23905_c1 | 3300050512 | Bacteria | 5751 |
| 1276 | nmdc:mga0n895_2537_c1 | 3300050512 | Bacteria | 14302 |
| 1277 | nmdc:mga0n895_3125_c1 | 3300050512 | Bacteria | 13200 |
| 1278 | nmdc:mga0n895_35737_c1 | 3300050512 | Bacteria | 4793 |
| 1279 | nmdc:mga0n895_470111_c1 | 3300050512 | Bacteria | 1268 |
| 1280 | nmdc:mga0n895_572583_c1 | 3300050512 | Bacteria | 1134 |
| 1281 | nmdc:mga0n895_6624_c1 | 3300050512 | Bacteria | 9864 |
| 1282 | nmdc:mga0rr50_101881_c1 | 3300050513 | Bacteria | 2258 |
| 1283 | nmdc:mga0rr50_106710_c1 | 3300050513 | Bacteria | 2210 |
| 1284 | nmdc:mga0rr50_108757_c1 | 3300050513 | Bacteria | 2191 |
| 1285 | nmdc:mga0rr50_133632_c1 | 3300050513 | Bacteria | 1989 |
| 1286 | nmdc:mga0rr50_3714_c1 | 3300050513 | Bacteria | 8843 |
| 1287 | nmdc:mga0rr50_38425_c1 | 3300050513 | Bacteria | 3464 |
| 1288 | nmdc:mga0rr50_409360_c1 | 3300050513 | Bacteria | 1146 |
| 1289 | nmdc:mga0rr50_481079_c1 | 3300050513 | Bacteria | 1055 |
| 1290 | nmdc:mga0rr50_55370_c1 | 3300050513 | Bacteria | 2959 |
| 1291 | nmdc:mga0rr50_643070_c1 | 3300050513 | Bacteria | 905 |
| 1292 | nmdc:mga0rr50_783307_c1 | 3300050513 | Bacteria | 814 |
| 1293 | nmdc:mga0rr50_87720_c1 | 3300050513 | Bacteria | 2416 |
| 1294 | nmdc:mga08x19_11535_c1 | 3300050514 | Bacteria | 5319 |
| 1295 | nmdc:mga08x19_149006_c1 | 3300050514 | Bacteria | 1583 |
| 1296 | nmdc:mga08x19_2911_c1 | 3300050514 | Bacteria | 10296 |
| 1297 | nmdc:mga08x19_372281_c1 | 3300050514 | Bacteria | 1000 |
| 1298 | nmdc:mga08x19_416786_c1 | 3300050514 | Bacteria | 943 |
| 1299 | nmdc:mga08x19_569815_c1 | 3300050514 | Bacteria | 802 |
| 1300 | nmdc:mga08x19_61281_c1 | 3300050514 | Bacteria | 2438 |
| 1301 | nmdc:mga0a205_115969_c1 | 3300050515 | Bacteria | 2577 |
| 1302 | nmdc:mga0a205_14814_c1 | 3300050515 | Bacteria | 7275 |
| 1303 | nmdc:mga0a205_152270_c1 | 3300050515 | Bacteria | 2212 |
| 1304 | nmdc:mga0a205_169260_c1 | 3300050515 | Bacteria | 2081 |
| 1305 | nmdc:mga0a205_32015_c2 | 3300050515 | Bacteria | 3703 |
| 1306 | nmdc:mga0a205_446766_c1 | 3300050515 | Bacteria | 1153 |
| 1307 | nmdc:mga0a205_46322_c1 | 3300050515 | Bacteria | 4194 |
| 1308 | nmdc:mga0a205_53423_c1 | 3300050515 | Bacteria | 3900 |
| 1309 | nmdc:mga0a205_582_c1 | 3300050515 | Bacteria | 28885 |
| 1310 | nmdc:mga0a205_591774_c1 | 3300050515 | Bacteria | 963 |
| 1311 | nmdc:mga0a205_61953_c1 | 3300050515 | Bacteria | 3614 |
| 1312 | nmdc:mga0sz30_83042_c1 | 3300050516 | Bacteria | 1388 |
| 1313 | Ga0495601_0003853 | 3300053077 | Bacteria | 8636 |
| 1314 | Ga0495612_0000349 | 3300053078 | Bacteria | 18632 |
| 1315 | Ga0495619_0282889 | 3300053085 | Bacteria | 1149 |
| 1316 | Ga0500643_007503 | 3300053087 | Bacteria | 4384 |
| 1317 | Ga0500644_0213975 | 3300053088 | Bacteria | 801 |
| 1318 | Ga0500647_0049787 | 3300053091 | Bacteria | 2015 |
| 1319 | Ga0500594_0000002 | 3300053118 | Bacteria | 916890 |
| 1320 | Ga0500594_0105277 | 3300053118 | Bacteria | 872 |
| 1321 | Ga0500595_001822 | 3300053119 | Bacteria | 11037 |
| 1322 | Ga0500595_037368 | 3300053119 | Bacteria | 1584 |
| 1323 | Ga0500607_000130 | 3300053121 | Bacteria | 61720 |
| 1324 | Ga0500608_007240 | 3300053122 | Bacteria | 4577 |
| 1325 | Ga0500608_140924 | 3300053122 | Bacteria | 1069 |
| 1326 | Ga0500618_002979 | 3300053125 | Bacteria | 6042 |
| 1327 | Ga0500642_0004589 | 3300053130 | Bacteria | 4347 |
| 1328 | Ga0500559_0002365 | 3300053136 | Bacteria | 9829 |
| 1329 | Ga0500559_0007163 | 3300053136 | Bacteria | 4968 |
| 1330 | Ga0500559_0182535 | 3300053136 | Bacteria | 988 |
| 1331 | Ga0500564_002596 | 3300053138 | Bacteria | 6735 |
| 1332 | Ga0500573_0098653 | 3300053140 | Bacteria | 1645 |
| 1333 | Ga0500590_058642 | 3300053148 | Bacteria | 1939 |
| 1334 | Ga0500590_059403 | 3300053148 | Bacteria | 1924 |
| 1335 | Ga0500604_0010676 | 3300053151 | Bacteria | 2460 |
| 1336 | Ga0500619_003163 | 3300053154 | Bacteria | 3321 |
| 1337 | Ga0500622_0004558 | 3300053156 | Bacteria | 8640 |
| 1338 | Ga0500624_000212 | 3300053157 | Bacteria | 21975 |
| 1339 | Ga0500627_0001009 | 3300053158 | Bacteria | 7670 |
| 1340 | Ga0500636_0001430 | 3300053177 | Bacteria | 13006 |
| 1341 | Ga0500636_0021652 | 3300053177 | Bacteria | 3806 |
| 1342 | Ga0500637_0000205 | 3300053178 | Bacteria | 21975 |
| 1343 | Ga0500637_0003185 | 3300053178 | Bacteria | 7513 |
| 1344 | Ga0500567_058259 | 3300053723 | Bacteria | 1739 |
| 1345 | Ga0500625_000041 | 3300053729 | Bacteria | 35224 |
| 1346 | Ga0500645_004991 | 3300053730 | Bacteria | 4973 |
| 1347 | Ga0500596_004593 | 3300053735 | Bacteria | 2516 |
| 1348 | Ga0501084_0008141 | 3300054114 | Bacteria | 8641 |
| 1349 | Ga0501084_0171973 | 3300054114 | Bacteria | 1829 |
| 1350 | Ga0590071_005592 | 3300059421 | Bacteria | 3022 |
| 1351 | Ga0590071_030642 | 3300059421 | Bacteria | 1281 |
| 1352 | Ga0590075_056282 | 3300059424 | Bacteria | 1011 |
| 1353 | Ga0587088_017668 | 3300059508 | Bacteria | 1151 |
| 1354 | Ga0587128_041835 | 3300059630 | Bacteria | 804 |
| 1355 | Ga0501082_0035130 | 3300060353 | Bacteria | 4320 |
| 1356 | Ga0501082_0075923 | 3300060353 | Bacteria | 2896 |
| 1357 | Ga0501082_0253021 | 3300060353 | Bacteria | 1533 |
| 1358 | Ga0530510_0492103 | 3300061734 | Bacteria | 929 |
| 1359 | Ga0530510_0663459 | 3300061734 | Bacteria | 794 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036647 | Ga0316582_0155203 | Ga0316582_0155203_469_1026 | 135 |
| 2 | 3300045051 | Ga0451576_0437646 | Ga0451576_0437646_397_909 | 139 |
| 3 | 3300032168 | Ga0316593_10009543 | Ga0316593_100095433 | 141 |
| 4 | iso_pu_bacteria | 2895880812 | 2895883296 | 144 |
| 5 | 3300005289 | Ga0065704_10228061 | Ga0065704_102280612 | 145 |
| 6 | 3300005330 | Ga0070690_100590120 | Ga0070690_1005901202 | 145 |
| 7 | 3300005334 | Ga0068869_100001046 | Ga0068869_10000104610 | 145 |
| 8 | 3300005338 | Ga0068868_100008151 | Ga0068868_1000081513 | 145 |
| 9 | 3300005339 | Ga0070660_100008554 | Ga0070660_1000085548 | 145 |
| 10 | 3300005353 | Ga0070669_100005923 | Ga0070669_1000059233 | 145 |
| 11 | 3300005354 | Ga0070675_100010460 | Ga0070675_1000104603 | 145 |
| 12 | 3300005367 | Ga0070667_100011180 | Ga0070667_1000111802 | 145 |
| 13 | 3300005440 | Ga0070705_100006184 | Ga0070705_1000061844 | 145 |
| 14 | 3300005444 | Ga0070694_100011744 | Ga0070694_1000117442 | 145 |
| 15 | 3300005444 | Ga0070694_100039862 | Ga0070694_1000398624 | 145 |
| 16 | 3300005471 | Ga0070698_100115485 | Ga0070698_1001154851 | 145 |
| 17 | 3300005518 | Ga0070699_100018956 | Ga0070699_1000189564 | 145 |
| 18 | 3300005535 | Ga0070684_100009791 | Ga0070684_1000097912 | 145 |
| 19 | 3300005536 | Ga0070697_100021503 | Ga0070697_1000215034 | 145 |
| 20 | 3300005536 | Ga0070697_100043195 | Ga0070697_1000431955 | 145 |
| 21 | 3300005543 | Ga0070672_100004511 | Ga0070672_1000045117 | 145 |
| 22 | 3300005543 | Ga0070672_100350923 | Ga0070672_1003509232 | 145 |
| 23 | 3300005544 | Ga0070686_100088111 | Ga0070686_1000881112 | 145 |
| 24 | 3300005577 | Ga0068857_100163670 | Ga0068857_1001636703 | 145 |
| 25 | 3300005578 | Ga0068854_100065299 | Ga0068854_1000652993 | 145 |
| 26 | 3300005616 | Ga0068852_100006969 | Ga0068852_1000069699 | 145 |
| 27 | 3300005617 | Ga0068859_100011685 | Ga0068859_1000116859 | 145 |
| 28 | 3300005719 | Ga0068861_100001489 | Ga0068861_10000148910 | 145 |
| 29 | 3300005834 | Ga0068851_10005001 | Ga0068851_100050012 | 145 |
| 30 | 3300005841 | Ga0068863_100014025 | Ga0068863_1000140257 | 145 |
| 31 | 3300005842 | Ga0068858_100028680 | Ga0068858_1000286802 | 145 |
| 32 | 3300005843 | Ga0068860_100239531 | Ga0068860_1002395312 | 145 |
| 33 | 3300005844 | Ga0068862_100050715 | Ga0068862_1000507153 | 145 |
| 34 | 3300006237 | Ga0097621_100064685 | Ga0097621_1000646852 | 145 |
| 35 | 3300006844 | Ga0075428_100046020 | Ga0075428_1000460204 | 145 |
| 36 | 3300006846 | Ga0075430_100447415 | Ga0075430_1004474152 | 145 |
| 37 | 3300006852 | Ga0075433_10107444 | Ga0075433_101074443 | 145 |
| 38 | 3300006852 | Ga0075433_10235052 | Ga0075433_102350522 | 145 |
| 39 | 3300006871 | Ga0075434_100001715 | Ga0075434_10000171516 | 145 |
| 40 | 3300006871 | Ga0075434_100015325 | Ga0075434_1000153257 | 145 |
| 41 | 3300006880 | Ga0075429_100112884 | Ga0075429_1001128842 | 145 |
| 42 | 3300006881 | Ga0068865_100004706 | Ga0068865_1000047063 | 145 |
| 43 | 3300006931 | Ga0097620_100011685 | Ga0097620_1000116859 | 145 |
| 44 | 3300007265 | Ga0099794_10000062 | Ga0099794_1000006230 | 145 |
| 45 | 3300009093 | Ga0105240_10598589 | Ga0105240_105985892 | 145 |
| 46 | 3300009098 | Ga0105245_10080445 | Ga0105245_100804454 | 145 |
| 47 | 3300009147 | Ga0114129_11270524 | Ga0114129_112705242 | 145 |
| 48 | 3300009176 | Ga0105242_11197584 | Ga0105242_111975842 | 145 |
| 49 | 3300009177 | Ga0105248_10015120 | Ga0105248_100151204 | 145 |
| 50 | 3300009553 | Ga0105249_10001114 | Ga0105249_1000111423 | 145 |
| 51 | 3300010375 | Ga0105239_10058708 | Ga0105239_100587082 | 145 |
| 52 | 3300013102 | Ga0157371_10022797 | Ga0157371_100227976 | 145 |
| 53 | 3300013105 | Ga0157369_10497639 | Ga0157369_104976391 | 145 |
| 54 | 3300013306 | Ga0163162_10001006 | Ga0163162_1000100623 | 145 |
| 55 | 3300013307 | Ga0157372_10091516 | Ga0157372_100915163 | 145 |
| 56 | 3300013308 | Ga0157375_10015258 | Ga0157375_100152585 | 145 |
| 57 | 3300014325 | Ga0163163_10010270 | Ga0163163_100102708 | 145 |
| 58 | 3300014326 | Ga0157380_10293396 | Ga0157380_102933962 | 145 |
| 59 | 3300014745 | Ga0157377_10009821 | Ga0157377_100098213 | 145 |
| 60 | 3300014968 | Ga0157379_10003141 | Ga0157379_1000314113 | 145 |
| 61 | 3300015262 | Ga0182007_10023256 | Ga0182007_100232563 | 145 |
| 62 | 3300017792 | Ga0163161_10356819 | Ga0163161_103568192 | 145 |
| 63 | 3300025315 | Ga0207697_10006428 | Ga0207697_100064283 | 145 |
| 64 | 3300025321 | Ga0207656_10025908 | Ga0207656_100259083 | 145 |
| 65 | 3300025893 | Ga0207682_10005680 | Ga0207682_100056803 | 145 |
| 66 | 3300025904 | Ga0207647_10195785 | Ga0207647_101957852 | 145 |
| 67 | 3300025907 | Ga0207645_10000267 | Ga0207645_1000026731 | 145 |
| 68 | 3300025917 | Ga0207660_10083349 | Ga0207660_100833492 | 145 |
| 69 | 3300025918 | Ga0207662_10002655 | Ga0207662_1000265510 | 145 |
| 70 | 3300025919 | Ga0207657_10017502 | Ga0207657_100175022 | 145 |
| 71 | 3300025920 | Ga0207649_10024692 | Ga0207649_100246924 | 145 |
| 72 | 3300025923 | Ga0207681_10001950 | Ga0207681_1000195013 | 145 |
| 73 | 3300025925 | Ga0207650_10004192 | Ga0207650_100041927 | 145 |
| 74 | 3300025926 | Ga0207659_10007491 | Ga0207659_100074912 | 145 |
| 75 | 3300025926 | Ga0207659_10264237 | Ga0207659_102642372 | 145 |
| 76 | 3300025932 | Ga0207690_10013028 | Ga0207690_100130286 | 145 |
| 77 | 3300025933 | Ga0207706_10009804 | Ga0207706_100098043 | 145 |
| 78 | 3300025936 | Ga0207670_10052770 | Ga0207670_100527704 | 145 |
| 79 | 3300025940 | Ga0207691_10000124 | Ga0207691_1000012430 | 145 |
| 80 | 3300025940 | Ga0207691_10102660 | Ga0207691_101026602 | 145 |
| 81 | 3300025941 | Ga0207711_10313947 | Ga0207711_103139472 | 145 |
| 82 | 3300025942 | Ga0207689_10003772 | Ga0207689_1000377211 | 145 |
| 83 | 3300025944 | Ga0207661_10051100 | Ga0207661_100511004 | 145 |
| 84 | 3300025945 | Ga0207679_10000700 | Ga0207679_100007008 | 145 |
| 85 | 3300025949 | Ga0207667_10044658 | Ga0207667_100446585 | 145 |
| 86 | 3300025961 | Ga0207712_10069399 | Ga0207712_100693993 | 145 |
| 87 | 3300025981 | Ga0207640_10046019 | Ga0207640_100460193 | 145 |
| 88 | 3300025986 | Ga0207658_10095677 | Ga0207658_100956773 | 145 |
| 89 | 3300026023 | Ga0207677_10002595 | Ga0207677_100025959 | 145 |
| 90 | 3300026035 | Ga0207703_10007697 | Ga0207703_100076978 | 145 |
| 91 | 3300026041 | Ga0207639_10010259 | Ga0207639_100102597 | 145 |
| 92 | 3300026075 | Ga0207708_10021285 | Ga0207708_100212855 | 145 |
| 93 | 3300026088 | Ga0207641_10337289 | Ga0207641_103372892 | 145 |
| 94 | 3300026095 | Ga0207676_10327430 | Ga0207676_103274303 | 145 |
| 95 | 3300026116 | Ga0207674_10005101 | Ga0207674_1000510110 | 145 |
| 96 | 3300026118 | Ga0207675_100000073 | Ga0207675_10000007364 | 145 |
| 97 | 3300026142 | Ga0207698_10022884 | Ga0207698_100228841 | 145 |
| 98 | 3300028380 | Ga0268265_10011944 | Ga0268265_100119442 | 145 |
| 99 | 3300028381 | Ga0268264_10030217 | Ga0268264_100302173 | 145 |
| 100 | 3300035170 | Ga0373943_0017073 | Ga0373943_0017073_289_801 | 145 |
| 101 | 3300036401 | Ga0373937_0911175 | Ga0373937_0911175_10_522 | 145 |
| 102 | 3300037471 | Ga0395905_0358540 | Ga0395905_0358540_110_622 | 145 |
| 103 | 3300038443 | Ga0395901_1016363 | Ga0395901_1016363_280_792 | 145 |
| 104 | 3300041460 | Ga0451802_1617087 | Ga0451802_1617087_75_587 | 145 |
| 105 | 3300042005 | Ga0439448_0064085 | Ga0439448_0064085_566_1078 | 145 |
| 106 | 3300042876 | Ga0451577_0611274 | Ga0451577_0611274_461_973 | 145 |
| 107 | 3300045051 | Ga0451576_1004544 | Ga0451576_1004544_120_632 | 145 |
| 108 | 3300046459 | Ga0495629_0226023 | Ga0495629_0226023_438_950 | 145 |
| 109 | 3300046528 | Ga0495642_0117854 | Ga0495642_0117854_273_785 | 145 |
| 110 | 3300046681 | Ga0495647_0140762 | Ga0495647_0140762_170_682 | 145 |
| 111 | 3300046683 | Ga0495658_0263008 | Ga0495658_0263008_147_659 | 145 |
| 112 | 3300047315 | Ga0495581_0357140 | Ga0495581_0357140_222_734 | 145 |
| 113 | 3300048909 | Ga0496106_0311509 | Ga0496106_0311509_717_1229 | 145 |
| 114 | 3300048912 | Ga0496109_0084360 | Ga0496109_0084360_1778_2290 | 145 |
| 115 | 3300048917 | Ga0496114_1014845 | Ga0496114_1014845_27_539 | 145 |
| 116 | 3300049570 | Ga0501033_0148431 | Ga0501033_0148431_506_1018 | 145 |
| 117 | 3300049570 | Ga0501033_0420282 | Ga0501033_0420282_402_914 | 145 |
| 118 | 3300049572 | Ga0501036_0131146 | Ga0501036_0131146_1493_2005 | 145 |
| 119 | 3300049574 | Ga0501038_0160538 | Ga0501038_0160538_23_535 | 145 |
| 120 | 3300049576 | Ga0501040_0011434 | Ga0501040_0011434_1080_1592 | 145 |
| 121 | 3300049580 | Ga0501046_0499865 | Ga0501046_0499865_198_710 | 145 |
| 122 | 3300049582 | Ga0501048_0078360 | Ga0501048_0078360_73_585 | 145 |
| 123 | 3300049588 | Ga0501072_0069103 | Ga0501072_0069103_107_619 | 145 |
| 124 | 3300049592 | Ga0501076_0013971 | Ga0501076_0013971_4369_4881 | 145 |
| 125 | 3300049593 | Ga0501077_0313608 | Ga0501077_0313608_460_972 | 145 |
| 126 | 3300049742 | Ga0501080_0930910 | Ga0501080_0930910_87_599 | 145 |
| 127 | 3300050507 | nmdc:mga05p37_106348_c1 | nmdc:mga05p37_106348_c1_967_1479 | 145 |
| 128 | 3300050508 | nmdc:mga09592_51799_c1 | nmdc:mga09592_51799_c1_1294_1806 | 145 |
| 129 | 3300050510 | nmdc:mga06r32_313984_c1 | nmdc:mga06r32_313984_c1_575_1087 | 145 |
| 130 | 3300050510 | nmdc:mga06r32_39284_c1 | nmdc:mga06r32_39284_c1_608_1120 | 145 |
| 131 | 3300050512 | nmdc:mga0n895_1190322_c1 | nmdc:mga0n895_1190322_c1_210_722 | 145 |
| 132 | 3300050512 | nmdc:mga0n895_1919_c1 | nmdc:mga0n895_1919_c1_6613_7125 | 145 |
| 133 | 3300050512 | nmdc:mga0n895_2307_c1 | nmdc:mga0n895_2307_c1_11590_12102 | 145 |
| 134 | 3300050512 | nmdc:mga0n895_572583_c1 | nmdc:mga0n895_572583_c1_471_983 | 145 |
| 135 | 3300050513 | nmdc:mga0rr50_481079_c1 | nmdc:mga0rr50_481079_c1_312_824 | 145 |
| 136 | 3300050515 | nmdc:mga0a205_14814_c1 | nmdc:mga0a205_14814_c1_4246_4758 | 145 |
| 137 | 3300050515 | nmdc:mga0a205_53423_c1 | nmdc:mga0a205_53423_c1_1284_1796 | 145 |
| 138 | 3300053118 | Ga0500594_0000002 | Ga0500594_0000002_830023_830571 | 145 |
| 139 | 3300054114 | Ga0501084_0171973 | Ga0501084_0171973_557_1069 | 145 |
| 140 | 3300060353 | Ga0501082_0075923 | Ga0501082_0075923_2296_2808 | 145 |
| 141 | 3300061734 | Ga0530510_0492103 | Ga0530510_0492103_367_879 | 145 |
| 142 | 3300006914 | Ga0075436_100507516 | Ga0075436_1005075162 | 146 |
| 143 | 3300053125 | Ga0500618_002979 | Ga0500618_002979_4948_5511 | 146 |
| 144 | 3300032133 | Ga0316583_10024650 | Ga0316583_100246502 | 147 |
| 145 | 3300003758 | Ga0055532_1000736 | Ga0055532_100073614 | 148 |
| 146 | 3300006195 | Ga0075366_10154093 | Ga0075366_101540932 | 148 |
| 147 | 3300025229 | Ga0209147_100053 | Ga0209147_100053102 | 148 |
| 148 | 3300047673 | Ga0495593_0168665 | Ga0495593_0168665_489_1040 | 148 |
| 149 | 3300049649 | Ga0501198_053201 | Ga0501198_053201_138_659 | 148 |
| 150 | 3300050490 | nmdc:mga03n38_656455_c1 | nmdc:mga03n38_656455_c1_11_532 | 148 |
| 151 | 3300050493 | nmdc:mga0k408_137697_c1 | nmdc:mga0k408_137697_c1_122_679 | 148 |
| 152 | 3300005436 | Ga0070713_100120522 | Ga0070713_1001205222 | 149 |
| 153 | 3300025928 | Ga0207700_10185280 | Ga0207700_101852802 | 149 |
| 154 | 3300050512 | nmdc:mga0n895_23905_c1 | nmdc:mga0n895_23905_c1_2219_2785 | 149 |
| 155 | 3300050513 | nmdc:mga0rr50_783307_c1 | nmdc:mga0rr50_783307_c1_11_535 | 149 |
| 156 | 3300050515 | nmdc:mga0a205_115969_c1 | nmdc:mga0a205_115969_c1_1124_1690 | 149 |
| 157 | 3300005341 | Ga0070691_10068913 | Ga0070691_100689131 | 150 |
| 158 | 3300006852 | Ga0075433_10096250 | Ga0075433_100962504 | 150 |
| 159 | 3300006871 | Ga0075434_100009189 | Ga0075434_10000918910 | 150 |
| 160 | 3300006871 | Ga0075434_100122155 | Ga0075434_1001221554 | 150 |
| 161 | 3300006914 | Ga0075436_100145059 | Ga0075436_1001450593 | 150 |
| 162 | 3300007076 | Ga0075435_100005046 | Ga0075435_1000050467 | 150 |
| 163 | 3300045051 | Ga0451576_0014051 | Ga0451576_0014051_1696_2265 | 150 |
| 164 | 3300049571 | Ga0501034_0205917 | Ga0501034_0205917_294_851 | 150 |
| 165 | 3300050512 | nmdc:mga0n895_1574_c1 | nmdc:mga0n895_1574_c1_8942_9511 | 150 |
| 166 | 3300050513 | nmdc:mga0rr50_55370_c1 | nmdc:mga0rr50_55370_c1_511_1080 | 150 |
| 167 | 3300050514 | nmdc:mga08x19_372281_c1 | nmdc:mga08x19_372281_c1_312_881 | 150 |
| 168 | 3300005548 | Ga0070665_100720029 | Ga0070665_1007200291 | 151 |
| 169 | 3300006846 | Ga0075430_100001742 | Ga0075430_10000174215 | 151 |
| 170 | 3300037466 | Ga0395898_0152291 | Ga0395898_0152291_1076_1636 | 151 |
| 171 | 3300038443 | Ga0395901_0364573 | Ga0395901_0364573_409_969 | 151 |
| 172 | 3300042156 | Ga0439446_0096860 | Ga0439446_0096860_299_838 | 151 |
| 173 | 3300050512 | nmdc:mga0n895_227436_c1 | nmdc:mga0n895_227436_c1_290_859 | 151 |
| 174 | 3300050515 | nmdc:mga0a205_46322_c1 | nmdc:mga0a205_46322_c1_973_1542 | 151 |
| 175 | 3300005466 | Ga0070685_10197847 | Ga0070685_101978472 | 152 |
| 176 | 3300042156 | Ga0439446_0108724 | Ga0439446_0108724_138_692 | 152 |
| 177 | 3300048924 | Ga0496121_0002209 | Ga0496121_0002209_25208_25765 | 152 |
| 178 | 3300048927 | Ga0496124_0011492 | Ga0496124_0011492_752_1309 | 152 |
| 179 | 3300050508 | nmdc:mga09592_341055_c1 | nmdc:mga09592_341055_c1_130_693 | 152 |
| 180 | 3300050509 | nmdc:mga0qj67_45376_c1 | nmdc:mga0qj67_45376_c1_1013_1576 | 152 |
| 181 | 3300050510 | nmdc:mga06r32_159464_c1 | nmdc:mga06r32_159464_c1_17_550 | 152 |
| 182 | 3300025904 | Ga0207647_10278603 | Ga0207647_102786032 | 153 |
| 183 | 3300031824 | Ga0307413_10069582 | Ga0307413_100695822 | 153 |
| 184 | 3300032004 | Ga0307414_10018739 | Ga0307414_100187394 | 153 |
| 185 | 3300032005 | Ga0307411_10094333 | Ga0307411_100943333 | 153 |
| 186 | 3300039437 | Ga0436365_0479744 | Ga0436365_0479744_37_576 | 153 |
| 187 | 3300046492 | Ga0495585_0426236 | Ga0495585_0426236_40_594 | 153 |
| 188 | 3300005434 | Ga0070709_10064529 | Ga0070709_100645293 | 154 |
| 189 | 3300005444 | Ga0070694_100128137 | Ga0070694_1001281372 | 154 |
| 190 | 3300005445 | Ga0070708_100003104 | Ga0070708_10000310410 | 154 |
| 191 | 3300005445 | Ga0070708_100045450 | Ga0070708_1000454504 | 154 |
| 192 | 3300005467 | Ga0070706_100019882 | Ga0070706_1000198828 | 154 |
| 193 | 3300005467 | Ga0070706_100438411 | Ga0070706_1004384112 | 154 |
| 194 | 3300005468 | Ga0070707_100204293 | Ga0070707_1002042932 | 154 |
| 195 | 3300005468 | Ga0070707_100967413 | Ga0070707_1009674131 | 154 |
| 196 | 3300005471 | Ga0070698_100002188 | Ga0070698_10000218812 | 154 |
| 197 | 3300005536 | Ga0070697_100140942 | Ga0070697_1001409423 | 154 |
| 198 | 3300005536 | Ga0070697_100191978 | Ga0070697_1001919783 | 154 |
| 199 | 3300005545 | Ga0070695_100388602 | Ga0070695_1003886021 | 154 |
| 200 | 3300006846 | Ga0075430_100349267 | Ga0075430_1003492672 | 154 |
| 201 | 3300006847 | Ga0075431_100023932 | Ga0075431_1000239323 | 154 |
| 202 | 3300006852 | Ga0075433_10019290 | Ga0075433_100192905 | 154 |
| 203 | 3300006852 | Ga0075433_10320685 | Ga0075433_103206852 | 154 |
| 204 | 3300006871 | Ga0075434_100059833 | Ga0075434_1000598334 | 154 |
| 205 | 3300006871 | Ga0075434_100156563 | Ga0075434_1001565632 | 154 |
| 206 | 3300006880 | Ga0075429_100006449 | Ga0075429_10000644910 | 154 |
| 207 | 3300006914 | Ga0075436_100003907 | Ga0075436_1000039078 | 154 |
| 208 | 3300006914 | Ga0075436_100360317 | Ga0075436_1003603172 | 154 |
| 209 | 3300007076 | Ga0075435_100283510 | Ga0075435_1002835101 | 154 |
| 210 | 3300009147 | Ga0114129_10334606 | Ga0114129_103346062 | 154 |
| 211 | 3300009147 | Ga0114129_10424428 | Ga0114129_104244282 | 154 |
| 212 | 3300013307 | Ga0157372_10934055 | Ga0157372_109340552 | 154 |
| 213 | 3300017792 | Ga0163161_10266881 | Ga0163161_102668812 | 154 |
| 214 | 3300025910 | Ga0207684_10265564 | Ga0207684_102655642 | 154 |
| 215 | 3300025916 | Ga0207663_10226994 | Ga0207663_102269942 | 154 |
| 216 | 3300025922 | Ga0207646_10664212 | Ga0207646_106642122 | 154 |
| 217 | 3300031995 | Ga0307409_100718902 | Ga0307409_1007189022 | 154 |
| 218 | 3300038996 | Ga0242420_001481 | Ga0242420_001481_2418_2969 | 154 |
| 219 | 3300042876 | Ga0451577_0071378 | Ga0451577_0071378_1677_2228 | 154 |
| 220 | 3300044673 | Ga0453683_0249604 | Ga0453683_0249604_11_562 | 154 |
| 221 | 3300045051 | Ga0451576_0033100 | Ga0451576_0033100_786_1337 | 154 |
| 222 | 3300045051 | Ga0451576_0116219 | Ga0451576_0116219_1076_1627 | 154 |
| 223 | 3300045051 | Ga0451576_0286223 | Ga0451576_0286223_938_1489 | 154 |
| 224 | 3300045051 | Ga0451576_0411948 | Ga0451576_0411948_114_665 | 154 |
| 225 | 3300046472 | Ga0495580_0079783 | Ga0495580_0079783_240_794 | 154 |
| 226 | 3300046517 | Ga0495630_0188832 | Ga0495630_0188832_700_1251 | 154 |
| 227 | 3300046526 | Ga0495666_0093790 | Ga0495666_0093790_130_681 | 154 |
| 228 | 3300046535 | Ga0495586_0235721 | Ga0495586_0235721_242_793 | 154 |
| 229 | 3300049591 | Ga0501075_0117832 | Ga0501075_0117832_205_756 | 154 |
| 230 | 3300049742 | Ga0501080_0772936 | Ga0501080_0772936_250_798 | 154 |
| 231 | 3300050507 | nmdc:mga05p37_47795_c1 | nmdc:mga05p37_47795_c1_3005_3556 | 154 |
| 232 | 3300050508 | nmdc:mga09592_217202_c1 | nmdc:mga09592_217202_c1_505_1056 | 154 |
| 233 | 3300050510 | nmdc:mga06r32_26098_c1 | nmdc:mga06r32_26098_c1_3364_3915 | 154 |
| 234 | 3300050512 | nmdc:mga0n895_3125_c1 | nmdc:mga0n895_3125_c1_4122_4673 | 154 |
| 235 | 3300050513 | nmdc:mga0rr50_101881_c1 | nmdc:mga0rr50_101881_c1_1122_1673 | 154 |
| 236 | 3300050514 | nmdc:mga08x19_416786_c1 | nmdc:mga08x19_416786_c1_151_702 | 154 |
| 237 | 3300050515 | nmdc:mga0a205_32015_c2 | nmdc:mga0a205_32015_c2_1350_1901 | 154 |
| 238 | 3300050515 | nmdc:mga0a205_446766_c1 | nmdc:mga0a205_446766_c1_277_828 | 154 |
| 239 | 3300005295 | Ga0065707_10156161 | Ga0065707_101561613 | 155 |
| 240 | 3300005343 | Ga0070687_100145220 | Ga0070687_1001452202 | 155 |
| 241 | 3300005345 | Ga0070692_10206604 | Ga0070692_102066042 | 155 |
| 242 | 3300005406 | Ga0070703_10216051 | Ga0070703_102160512 | 155 |
| 243 | 3300005434 | Ga0070709_10002860 | Ga0070709_100028606 | 155 |
| 244 | 3300005434 | Ga0070709_10147409 | Ga0070709_101474092 | 155 |
| 245 | 3300005435 | Ga0070714_100028375 | Ga0070714_1000283751 | 155 |
| 246 | 3300005435 | Ga0070714_100319241 | Ga0070714_1003192412 | 155 |
| 247 | 3300005436 | Ga0070713_100287896 | Ga0070713_1002878962 | 155 |
| 248 | 3300005439 | Ga0070711_100000763 | Ga0070711_1000007638 | 155 |
| 249 | 3300005439 | Ga0070711_100043432 | Ga0070711_1000434322 | 155 |
| 250 | 3300005440 | Ga0070705_100004409 | Ga0070705_1000044097 | 155 |
| 251 | 3300005440 | Ga0070705_100301220 | Ga0070705_1003012202 | 155 |
| 252 | 3300005444 | Ga0070694_100049828 | Ga0070694_1000498284 | 155 |
| 253 | 3300005444 | Ga0070694_100065662 | Ga0070694_1000656624 | 155 |
| 254 | 3300005444 | Ga0070694_100436182 | Ga0070694_1004361821 | 155 |
| 255 | 3300005444 | Ga0070694_101052501 | Ga0070694_1010525011 | 155 |
| 256 | 3300005467 | Ga0070706_100025904 | Ga0070706_1000259045 | 155 |
| 257 | 3300005467 | Ga0070706_100498172 | Ga0070706_1004981721 | 155 |
| 258 | 3300005468 | Ga0070707_101139567 | Ga0070707_1011395671 | 155 |
| 259 | 3300005471 | Ga0070698_100090936 | Ga0070698_1000909362 | 155 |
| 260 | 3300005471 | Ga0070698_100226699 | Ga0070698_1002266993 | 155 |
| 261 | 3300005518 | Ga0070699_100088760 | Ga0070699_1000887602 | 155 |
| 262 | 3300005536 | Ga0070697_100062375 | Ga0070697_1000623752 | 155 |
| 263 | 3300005545 | Ga0070695_100000766 | Ga0070695_10000076616 | 155 |
| 264 | 3300005545 | Ga0070695_100080454 | Ga0070695_1000804543 | 155 |
| 265 | 3300005545 | Ga0070695_100116107 | Ga0070695_1001161071 | 155 |
| 266 | 3300005546 | Ga0070696_100028934 | Ga0070696_1000289343 | 155 |
| 267 | 3300005546 | Ga0070696_100033862 | Ga0070696_1000338624 | 155 |
| 268 | 3300005546 | Ga0070696_100133051 | Ga0070696_1001330512 | 155 |
| 269 | 3300005549 | Ga0070704_100004453 | Ga0070704_1000044536 | 155 |
| 270 | 3300005549 | Ga0070704_100007933 | Ga0070704_1000079333 | 155 |
| 271 | 3300005549 | Ga0070704_100049260 | Ga0070704_1000492603 | 155 |
| 272 | 3300005549 | Ga0070704_100171632 | Ga0070704_1001716322 | 155 |
| 273 | 3300006028 | Ga0070717_10148234 | Ga0070717_101482341 | 155 |
| 274 | 3300006173 | Ga0070716_100036528 | Ga0070716_1000365282 | 155 |
| 275 | 3300006173 | Ga0070716_100111920 | Ga0070716_1001119202 | 155 |
| 276 | 3300006175 | Ga0070712_100027361 | Ga0070712_1000273614 | 155 |
| 277 | 3300006844 | Ga0075428_100454033 | Ga0075428_1004540332 | 155 |
| 278 | 3300006847 | Ga0075431_100157152 | Ga0075431_1001571523 | 155 |
| 279 | 3300006852 | Ga0075433_10002006 | Ga0075433_1000200612 | 155 |
| 280 | 3300006852 | Ga0075433_10279999 | Ga0075433_102799992 | 155 |
| 281 | 3300006871 | Ga0075434_100047773 | Ga0075434_1000477733 | 155 |
| 282 | 3300006871 | Ga0075434_100170357 | Ga0075434_1001703572 | 155 |
| 283 | 3300006871 | Ga0075434_100209120 | Ga0075434_1002091203 | 155 |
| 284 | 3300006914 | Ga0075436_100015422 | Ga0075436_1000154227 | 155 |
| 285 | 3300006914 | Ga0075436_100034721 | Ga0075436_1000347213 | 155 |
| 286 | 3300007076 | Ga0075435_100592094 | Ga0075435_1005920942 | 155 |
| 287 | 3300007076 | Ga0075435_101069852 | Ga0075435_1010698522 | 155 |
| 288 | 3300007265 | Ga0099794_10247155 | Ga0099794_102471552 | 155 |
| 289 | 3300009147 | Ga0114129_10241792 | Ga0114129_102417922 | 155 |
| 290 | 3300009147 | Ga0114129_11727715 | Ga0114129_117277152 | 155 |
| 291 | 3300013308 | Ga0157375_10001559 | Ga0157375_1000155916 | 155 |
| 292 | 3300025885 | Ga0207653_10003351 | Ga0207653_100033517 | 155 |
| 293 | 3300025885 | Ga0207653_10093059 | Ga0207653_100930592 | 155 |
| 294 | 3300025906 | Ga0207699_10004506 | Ga0207699_100045063 | 155 |
| 295 | 3300025906 | Ga0207699_10113348 | Ga0207699_101133482 | 155 |
| 296 | 3300025910 | Ga0207684_10012758 | Ga0207684_100127585 | 155 |
| 297 | 3300025910 | Ga0207684_10025200 | Ga0207684_100252008 | 155 |
| 298 | 3300025915 | Ga0207693_10011202 | Ga0207693_100112024 | 155 |
| 299 | 3300025916 | Ga0207663_10000529 | Ga0207663_100005298 | 155 |
| 300 | 3300025916 | Ga0207663_10394237 | Ga0207663_103942372 | 155 |
| 301 | 3300025922 | Ga0207646_10003953 | Ga0207646_1000395311 | 155 |
| 302 | 3300025922 | Ga0207646_10041894 | Ga0207646_100418944 | 155 |
| 303 | 3300025922 | Ga0207646_10320785 | Ga0207646_103207852 | 155 |
| 304 | 3300025928 | Ga0207700_10015427 | Ga0207700_100154274 | 155 |
| 305 | 3300025929 | Ga0207664_10004982 | Ga0207664_100049822 | 155 |
| 306 | 3300025939 | Ga0207665_10002787 | Ga0207665_1000278712 | 155 |
| 307 | 3300025939 | Ga0207665_10020492 | Ga0207665_100204925 | 155 |
| 308 | 3300025939 | Ga0207665_10179007 | Ga0207665_101790072 | 155 |
| 309 | 3300026142 | Ga0207698_10968950 | Ga0207698_109689502 | 155 |
| 310 | 3300031548 | Ga0307408_100268737 | Ga0307408_1002687371 | 155 |
| 311 | 3300031711 | Ga0265314_10285958 | Ga0265314_102859582 | 155 |
| 312 | 3300031731 | Ga0307405_10196779 | Ga0307405_101967792 | 155 |
| 313 | 3300031824 | Ga0307413_10012087 | Ga0307413_100120874 | 155 |
| 314 | 3300031852 | Ga0307410_10132424 | Ga0307410_101324242 | 155 |
| 315 | 3300031901 | Ga0307406_10074775 | Ga0307406_100747751 | 155 |
| 316 | 3300031995 | Ga0307409_101032041 | Ga0307409_1010320412 | 155 |
| 317 | 3300032004 | Ga0307414_10073604 | Ga0307414_100736044 | 155 |
| 318 | 3300037068 | Ga0373925_0131580 | Ga0373925_0131580_378_929 | 155 |
| 319 | 3300044673 | Ga0453683_0091147 | Ga0453683_0091147_601_1167 | 155 |
| 320 | 3300045049 | Ga0466959_0254615 | Ga0466959_0254615_171_722 | 155 |
| 321 | 3300045051 | Ga0451576_0235878 | Ga0451576_0235878_683_1240 | 155 |
| 322 | 3300045976 | Ga0466967_0423507 | Ga0466967_0423507_648_1199 | 155 |
| 323 | 3300049765 | Ga0501268_023134 | Ga0501268_023134_159_710 | 155 |
| 324 | 3300050507 | nmdc:mga05p37_281510_c1 | nmdc:mga05p37_281510_c1_861_1418 | 155 |
| 325 | 3300050507 | nmdc:mga05p37_608385_c1 | nmdc:mga05p37_608385_c1_126_683 | 155 |
| 326 | 3300050507 | nmdc:mga05p37_999832_c1 | nmdc:mga05p37_999832_c1_200_772 | 155 |
| 327 | 3300050510 | nmdc:mga06r32_357944_c1 | nmdc:mga06r32_357944_c1_41_598 | 155 |
| 328 | 3300050512 | nmdc:mga0n895_114290_c1 | nmdc:mga0n895_114290_c1_2069_2641 | 155 |
| 329 | 3300050512 | nmdc:mga0n895_6624_c1 | nmdc:mga0n895_6624_c1_6568_7134 | 155 |
| 330 | 3300050513 | nmdc:mga0rr50_106710_c1 | nmdc:mga0rr50_106710_c1_287_847 | 155 |
| 331 | 3300050513 | nmdc:mga0rr50_108757_c1 | nmdc:mga0rr50_108757_c1_287_859 | 155 |
| 332 | 3300050514 | nmdc:mga08x19_11535_c1 | nmdc:mga08x19_11535_c1_1698_2255 | 155 |
| 333 | 3300050514 | nmdc:mga08x19_2911_c1 | nmdc:mga08x19_2911_c1_5748_6308 | 155 |
| 334 | 3300050514 | nmdc:mga08x19_569815_c1 | nmdc:mga08x19_569815_c1_59_625 | 155 |
| 335 | 3300050515 | nmdc:mga0a205_152270_c1 | nmdc:mga0a205_152270_c1_1006_1578 | 155 |
| 336 | 3300050515 | nmdc:mga0a205_582_c1 | nmdc:mga0a205_582_c1_20557_21123 | 155 |
| 337 | 3300050515 | nmdc:mga0a205_591774_c1 | nmdc:mga0a205_591774_c1_22_579 | 155 |
| 338 | 3300053148 | Ga0500590_059403 | Ga0500590_059403_1147_1707 | 155 |
| 339 | 3300003322 | rootL2_10047888 | rootL2_100478883 | 156 |
| 340 | 3300004803 | Ga0058862_12766732 | Ga0058862_127667322 | 156 |
| 341 | 3300005290 | Ga0065712_10273635 | Ga0065712_102736352 | 156 |
| 342 | 3300005293 | Ga0065715_10208396 | Ga0065715_102083962 | 156 |
| 343 | 3300005295 | Ga0065707_10184341 | Ga0065707_101843412 | 156 |
| 344 | 3300005295 | Ga0065707_10514479 | Ga0065707_105144791 | 156 |
| 345 | 3300005327 | Ga0070658_10009041 | Ga0070658_100090413 | 156 |
| 346 | 3300005327 | Ga0070658_10023796 | Ga0070658_100237962 | 156 |
| 347 | 3300005328 | Ga0070676_10001338 | Ga0070676_100013383 | 156 |
| 348 | 3300005329 | Ga0070683_100011534 | Ga0070683_1000115342 | 156 |
| 349 | 3300005329 | Ga0070683_100100523 | Ga0070683_1001005233 | 156 |
| 350 | 3300005331 | Ga0070670_100006075 | Ga0070670_1000060754 | 156 |
| 351 | 3300005331 | Ga0070670_100481995 | Ga0070670_1004819951 | 156 |
| 352 | 3300005331 | Ga0070670_100551229 | Ga0070670_1005512291 | 156 |
| 353 | 3300005333 | Ga0070677_10003562 | Ga0070677_100035627 | 156 |
| 354 | 3300005334 | Ga0068869_100772626 | Ga0068869_1007726261 | 156 |
| 355 | 3300005335 | Ga0070666_10091777 | Ga0070666_100917773 | 156 |
| 356 | 3300005335 | Ga0070666_10280251 | Ga0070666_102802512 | 156 |
| 357 | 3300005335 | Ga0070666_10469668 | Ga0070666_104696682 | 156 |
| 358 | 3300005336 | Ga0070680_100005245 | Ga0070680_10000524510 | 156 |
| 359 | 3300005336 | Ga0070680_100043681 | Ga0070680_1000436815 | 156 |
| 360 | 3300005336 | Ga0070680_100055182 | Ga0070680_1000551822 | 156 |
| 361 | 3300005336 | Ga0070680_100081380 | Ga0070680_1000813802 | 156 |
| 362 | 3300005336 | Ga0070680_100767975 | Ga0070680_1007679751 | 156 |
| 363 | 3300005336 | Ga0070680_100852438 | Ga0070680_1008524381 | 156 |
| 364 | 3300005337 | Ga0070682_101350022 | Ga0070682_1013500221 | 156 |
| 365 | 3300005339 | Ga0070660_100015441 | Ga0070660_1000154413 | 156 |
| 366 | 3300005339 | Ga0070660_100058949 | Ga0070660_1000589492 | 156 |
| 367 | 3300005339 | Ga0070660_100545427 | Ga0070660_1005454272 | 156 |
| 368 | 3300005339 | Ga0070660_100862697 | Ga0070660_1008626971 | 156 |
| 369 | 3300005340 | Ga0070689_100016069 | Ga0070689_1000160692 | 156 |
| 370 | 3300005340 | Ga0070689_100039876 | Ga0070689_1000398763 | 156 |
| 371 | 3300005341 | Ga0070691_10207304 | Ga0070691_102073042 | 156 |
| 372 | 3300005344 | Ga0070661_100003226 | Ga0070661_10000322610 | 156 |
| 373 | 3300005344 | Ga0070661_100020303 | Ga0070661_1000203033 | 156 |
| 374 | 3300005344 | Ga0070661_100031136 | Ga0070661_1000311364 | 156 |
| 375 | 3300005344 | Ga0070661_100110416 | Ga0070661_1001104163 | 156 |
| 376 | 3300005344 | Ga0070661_100570307 | Ga0070661_1005703072 | 156 |
| 377 | 3300005344 | Ga0070661_101342487 | Ga0070661_1013424871 | 156 |
| 378 | 3300005345 | Ga0070692_10086845 | Ga0070692_100868451 | 156 |
| 379 | 3300005345 | Ga0070692_10101147 | Ga0070692_101011472 | 156 |
| 380 | 3300005345 | Ga0070692_10161796 | Ga0070692_101617962 | 156 |
| 381 | 3300005347 | Ga0070668_100003214 | Ga0070668_1000032144 | 156 |
| 382 | 3300005347 | Ga0070668_100059198 | Ga0070668_1000591983 | 156 |
| 383 | 3300005353 | Ga0070669_100003091 | Ga0070669_1000030913 | 156 |
| 384 | 3300005353 | Ga0070669_100006591 | Ga0070669_1000065914 | 156 |
| 385 | 3300005353 | Ga0070669_100647778 | Ga0070669_1006477781 | 156 |
| 386 | 3300005354 | Ga0070675_100032603 | Ga0070675_1000326034 | 156 |
| 387 | 3300005354 | Ga0070675_100050984 | Ga0070675_1000509844 | 156 |
| 388 | 3300005354 | Ga0070675_101329155 | Ga0070675_1013291551 | 156 |
| 389 | 3300005355 | Ga0070671_100017519 | Ga0070671_1000175192 | 156 |
| 390 | 3300005355 | Ga0070671_100287392 | Ga0070671_1002873922 | 156 |
| 391 | 3300005355 | Ga0070671_100773801 | Ga0070671_1007738012 | 156 |
| 392 | 3300005364 | Ga0070673_100216339 | Ga0070673_1002163392 | 156 |
| 393 | 3300005364 | Ga0070673_100337301 | Ga0070673_1003373012 | 156 |
| 394 | 3300005364 | Ga0070673_101464189 | Ga0070673_1014641891 | 156 |
| 395 | 3300005364 | Ga0070673_101464190 | Ga0070673_1014641901 | 156 |
| 396 | 3300005365 | Ga0070688_100017268 | Ga0070688_1000172684 | 156 |
| 397 | 3300005366 | Ga0070659_100004329 | Ga0070659_1000043293 | 156 |
| 398 | 3300005366 | Ga0070659_100119172 | Ga0070659_1001191721 | 156 |
| 399 | 3300005366 | Ga0070659_100143173 | Ga0070659_1001431732 | 156 |
| 400 | 3300005366 | Ga0070659_100193879 | Ga0070659_1001938792 | 156 |
| 401 | 3300005366 | Ga0070659_100417976 | Ga0070659_1004179762 | 156 |
| 402 | 3300005367 | Ga0070667_100023300 | Ga0070667_1000233006 | 156 |
| 403 | 3300005367 | Ga0070667_100165741 | Ga0070667_1001657413 | 156 |
| 404 | 3300005406 | Ga0070703_10069069 | Ga0070703_100690692 | 156 |
| 405 | 3300005435 | Ga0070714_100015492 | Ga0070714_1000154924 | 156 |
| 406 | 3300005435 | Ga0070714_100540160 | Ga0070714_1005401602 | 156 |
| 407 | 3300005436 | Ga0070713_100020561 | Ga0070713_1000205613 | 156 |
| 408 | 3300005438 | Ga0070701_10011686 | Ga0070701_100116864 | 156 |
| 409 | 3300005438 | Ga0070701_10053321 | Ga0070701_100533213 | 156 |
| 410 | 3300005438 | Ga0070701_10090699 | Ga0070701_100906992 | 156 |
| 411 | 3300005439 | Ga0070711_100103221 | Ga0070711_1001032213 | 156 |
| 412 | 3300005439 | Ga0070711_100548056 | Ga0070711_1005480562 | 156 |
| 413 | 3300005441 | Ga0070700_100012422 | Ga0070700_1000124225 | 156 |
| 414 | 3300005441 | Ga0070700_100130222 | Ga0070700_1001302222 | 156 |
| 415 | 3300005444 | Ga0070694_100005166 | Ga0070694_1000051665 | 156 |
| 416 | 3300005444 | Ga0070694_100007601 | Ga0070694_1000076014 | 156 |
| 417 | 3300005444 | Ga0070694_100062238 | Ga0070694_1000622382 | 156 |
| 418 | 3300005444 | Ga0070694_100093833 | Ga0070694_1000938332 | 156 |
| 419 | 3300005444 | Ga0070694_100238942 | Ga0070694_1002389421 | 156 |
| 420 | 3300005445 | Ga0070708_100023798 | Ga0070708_1000237984 | 156 |
| 421 | 3300005445 | Ga0070708_100263627 | Ga0070708_1002636272 | 156 |
| 422 | 3300005445 | Ga0070708_100603490 | Ga0070708_1006034901 | 156 |
| 423 | 3300005456 | Ga0070678_100119539 | Ga0070678_1001195393 | 156 |
| 424 | 3300005457 | Ga0070662_100079964 | Ga0070662_1000799643 | 156 |
| 425 | 3300005457 | Ga0070662_100478267 | Ga0070662_1004782672 | 156 |
| 426 | 3300005457 | Ga0070662_100583617 | Ga0070662_1005836172 | 156 |
| 427 | 3300005458 | Ga0070681_10001510 | Ga0070681_100015109 | 156 |
| 428 | 3300005458 | Ga0070681_10001743 | Ga0070681_100017436 | 156 |
| 429 | 3300005458 | Ga0070681_10015442 | Ga0070681_100154425 | 156 |
| 430 | 3300005458 | Ga0070681_10100356 | Ga0070681_101003563 | 156 |
| 431 | 3300005458 | Ga0070681_10211006 | Ga0070681_102110062 | 156 |
| 432 | 3300005459 | Ga0068867_100101141 | Ga0068867_1001011413 | 156 |
| 433 | 3300005459 | Ga0068867_100145152 | Ga0068867_1001451522 | 156 |
| 434 | 3300005459 | Ga0068867_100170171 | Ga0068867_1001701712 | 156 |
| 435 | 3300005466 | Ga0070685_10022699 | Ga0070685_100226992 | 156 |
| 436 | 3300005467 | Ga0070706_100004050 | Ga0070706_10000405011 | 156 |
| 437 | 3300005467 | Ga0070706_100009104 | Ga0070706_1000091046 | 156 |
| 438 | 3300005467 | Ga0070706_100175207 | Ga0070706_1001752072 | 156 |
| 439 | 3300005467 | Ga0070706_100324018 | Ga0070706_1003240182 | 156 |
| 440 | 3300005468 | Ga0070707_100009027 | Ga0070707_1000090273 | 156 |
| 441 | 3300005468 | Ga0070707_100013395 | Ga0070707_10001339510 | 156 |
| 442 | 3300005471 | Ga0070698_100005453 | Ga0070698_1000054536 | 156 |
| 443 | 3300005471 | Ga0070698_100022556 | Ga0070698_1000225563 | 156 |
| 444 | 3300005471 | Ga0070698_100040069 | Ga0070698_1000400692 | 156 |
| 445 | 3300005471 | Ga0070698_101145347 | Ga0070698_1011453471 | 156 |
| 446 | 3300005518 | Ga0070699_100003425 | Ga0070699_10000342512 | 156 |
| 447 | 3300005518 | Ga0070699_100003978 | Ga0070699_1000039783 | 156 |
| 448 | 3300005518 | Ga0070699_100021866 | Ga0070699_1000218665 | 156 |
| 449 | 3300005518 | Ga0070699_100034681 | Ga0070699_1000346814 | 156 |
| 450 | 3300005518 | Ga0070699_100047467 | Ga0070699_1000474673 | 156 |
| 451 | 3300005518 | Ga0070699_100049321 | Ga0070699_1000493214 | 156 |
| 452 | 3300005518 | Ga0070699_100855094 | Ga0070699_1008550941 | 156 |
| 453 | 3300005530 | Ga0070679_100011678 | Ga0070679_1000116789 | 156 |
| 454 | 3300005530 | Ga0070679_100012367 | Ga0070679_1000123677 | 156 |
| 455 | 3300005530 | Ga0070679_100036557 | Ga0070679_1000365575 | 156 |
| 456 | 3300005530 | Ga0070679_100153483 | Ga0070679_1001534832 | 156 |
| 457 | 3300005530 | Ga0070679_100599943 | Ga0070679_1005999432 | 156 |
| 458 | 3300005530 | Ga0070679_101080389 | Ga0070679_1010803891 | 156 |
| 459 | 3300005535 | Ga0070684_100001201 | Ga0070684_1000012019 | 156 |
| 460 | 3300005535 | Ga0070684_100124039 | Ga0070684_1001240392 | 156 |
| 461 | 3300005535 | Ga0070684_100145302 | Ga0070684_1001453021 | 156 |
| 462 | 3300005535 | Ga0070684_100273265 | Ga0070684_1002732652 | 156 |
| 463 | 3300005536 | Ga0070697_100003808 | Ga0070697_1000038085 | 156 |
| 464 | 3300005536 | Ga0070697_100048947 | Ga0070697_1000489474 | 156 |
| 465 | 3300005536 | Ga0070697_100259172 | Ga0070697_1002591722 | 156 |
| 466 | 3300005539 | Ga0068853_100025797 | Ga0068853_1000257977 | 156 |
| 467 | 3300005539 | Ga0068853_100070909 | Ga0068853_1000709094 | 156 |
| 468 | 3300005543 | Ga0070672_100007978 | Ga0070672_1000079786 | 156 |
| 469 | 3300005543 | Ga0070672_100125948 | Ga0070672_1001259482 | 156 |
| 470 | 3300005543 | Ga0070672_100161078 | Ga0070672_1001610782 | 156 |
| 471 | 3300005544 | Ga0070686_100104594 | Ga0070686_1001045943 | 156 |
| 472 | 3300005545 | Ga0070695_100022573 | Ga0070695_1000225735 | 156 |
| 473 | 3300005545 | Ga0070695_100027500 | Ga0070695_1000275004 | 156 |
| 474 | 3300005546 | Ga0070696_100000557 | Ga0070696_1000005578 | 156 |
| 475 | 3300005546 | Ga0070696_100002916 | Ga0070696_1000029167 | 156 |
| 476 | 3300005546 | Ga0070696_100053328 | Ga0070696_1000533284 | 156 |
| 477 | 3300005546 | Ga0070696_100096352 | Ga0070696_1000963523 | 156 |
| 478 | 3300005547 | Ga0070693_100039499 | Ga0070693_1000394993 | 156 |
| 479 | 3300005547 | Ga0070693_100049802 | Ga0070693_1000498022 | 156 |
| 480 | 3300005548 | Ga0070665_100074227 | Ga0070665_1000742273 | 156 |
| 481 | 3300005548 | Ga0070665_101096035 | Ga0070665_1010960351 | 156 |
| 482 | 3300005549 | Ga0070704_100002995 | Ga0070704_1000029956 | 156 |
| 483 | 3300005549 | Ga0070704_100003240 | Ga0070704_1000032401 | 156 |
| 484 | 3300005549 | Ga0070704_100008264 | Ga0070704_1000082643 | 156 |
| 485 | 3300005549 | Ga0070704_100153674 | Ga0070704_1001536742 | 156 |
| 486 | 3300005563 | Ga0068855_100397026 | Ga0068855_1003970262 | 156 |
| 487 | 3300005563 | Ga0068855_100563239 | Ga0068855_1005632392 | 156 |
| 488 | 3300005563 | Ga0068855_100605530 | Ga0068855_1006055302 | 156 |
| 489 | 3300005563 | Ga0068855_101414225 | Ga0068855_1014142251 | 156 |
| 490 | 3300005564 | Ga0070664_100071838 | Ga0070664_1000718383 | 156 |
| 491 | 3300005564 | Ga0070664_100094454 | Ga0070664_1000944543 | 156 |
| 492 | 3300005577 | Ga0068857_100766560 | Ga0068857_1007665602 | 156 |
| 493 | 3300005578 | Ga0068854_100042976 | Ga0068854_1000429763 | 156 |
| 494 | 3300005614 | Ga0068856_100196671 | Ga0068856_1001966712 | 156 |
| 495 | 3300005614 | Ga0068856_100477274 | Ga0068856_1004772742 | 156 |
| 496 | 3300005615 | Ga0070702_100005374 | Ga0070702_1000053744 | 156 |
| 497 | 3300005615 | Ga0070702_100223738 | Ga0070702_1002237382 | 156 |
| 498 | 3300005616 | Ga0068852_100055216 | Ga0068852_1000552165 | 156 |
| 499 | 3300005616 | Ga0068852_100663718 | Ga0068852_1006637182 | 156 |
| 500 | 3300005617 | Ga0068859_100015946 | Ga0068859_1000159469 | 156 |
| 501 | 3300005617 | Ga0068859_100084497 | Ga0068859_1000844973 | 156 |
| 502 | 3300005617 | Ga0068859_100235657 | Ga0068859_1002356572 | 156 |
| 503 | 3300005617 | Ga0068859_100424737 | Ga0068859_1004247372 | 156 |
| 504 | 3300005718 | Ga0068866_10024774 | Ga0068866_100247743 | 156 |
| 505 | 3300005719 | Ga0068861_100265654 | Ga0068861_1002656542 | 156 |
| 506 | 3300005719 | Ga0068861_100609738 | Ga0068861_1006097382 | 156 |
| 507 | 3300005840 | Ga0068870_10109191 | Ga0068870_101091913 | 156 |
| 508 | 3300005841 | Ga0068863_100538760 | Ga0068863_1005387602 | 156 |
| 509 | 3300005843 | Ga0068860_100196845 | Ga0068860_1001968453 | 156 |
| 510 | 3300005844 | Ga0068862_100000174 | Ga0068862_10000017411 | 156 |
| 511 | 3300005844 | Ga0068862_100059030 | Ga0068862_1000590304 | 156 |
| 512 | 3300005844 | Ga0068862_100080212 | Ga0068862_1000802123 | 156 |
| 513 | 3300005844 | Ga0068862_100336604 | Ga0068862_1003366042 | 156 |
| 514 | 3300005844 | Ga0068862_100768156 | Ga0068862_1007681562 | 156 |
| 515 | 3300005985 | Ga0081539_10144261 | Ga0081539_101442612 | 156 |
| 516 | 3300006028 | Ga0070717_10467355 | Ga0070717_104673551 | 156 |
| 517 | 3300006028 | Ga0070717_10566197 | Ga0070717_105661972 | 156 |
| 518 | 3300006058 | Ga0075432_10168757 | Ga0075432_101687572 | 156 |
| 519 | 3300006163 | Ga0070715_10430265 | Ga0070715_104302652 | 156 |
| 520 | 3300006175 | Ga0070712_100019259 | Ga0070712_1000192595 | 156 |
| 521 | 3300006175 | Ga0070712_100028546 | Ga0070712_1000285462 | 156 |
| 522 | 3300006178 | Ga0075367_10509878 | Ga0075367_105098781 | 156 |
| 523 | 3300006358 | Ga0068871_100599514 | Ga0068871_1005995142 | 156 |
| 524 | 3300006844 | Ga0075428_100004397 | Ga0075428_10000439711 | 156 |
| 525 | 3300006844 | Ga0075428_100017502 | Ga0075428_1000175024 | 156 |
| 526 | 3300006844 | Ga0075428_100065223 | Ga0075428_1000652232 | 156 |
| 527 | 3300006844 | Ga0075428_100272896 | Ga0075428_1002728962 | 156 |
| 528 | 3300006846 | Ga0075430_100009716 | Ga0075430_10000971610 | 156 |
| 529 | 3300006846 | Ga0075430_100045232 | Ga0075430_1000452323 | 156 |
| 530 | 3300006846 | Ga0075430_100054291 | Ga0075430_1000542913 | 156 |
| 531 | 3300006846 | Ga0075430_100095435 | Ga0075430_1000954352 | 156 |
| 532 | 3300006846 | Ga0075430_100334933 | Ga0075430_1003349332 | 156 |
| 533 | 3300006846 | Ga0075430_100652849 | Ga0075430_1006528492 | 156 |
| 534 | 3300006847 | Ga0075431_100011703 | Ga0075431_1000117037 | 156 |
| 535 | 3300006847 | Ga0075431_100172718 | Ga0075431_1001727183 | 156 |
| 536 | 3300006847 | Ga0075431_100392137 | Ga0075431_1003921372 | 156 |
| 537 | 3300006847 | Ga0075431_100465403 | Ga0075431_1004654032 | 156 |
| 538 | 3300006847 | Ga0075431_100581859 | Ga0075431_1005818593 | 156 |
| 539 | 3300006847 | Ga0075431_100670104 | Ga0075431_1006701042 | 156 |
| 540 | 3300006852 | Ga0075433_10084032 | Ga0075433_100840322 | 156 |
| 541 | 3300006852 | Ga0075433_10102622 | Ga0075433_101026224 | 156 |
| 542 | 3300006852 | Ga0075433_10249971 | Ga0075433_102499713 | 156 |
| 543 | 3300006871 | Ga0075434_100025733 | Ga0075434_1000257333 | 156 |
| 544 | 3300006871 | Ga0075434_100045126 | Ga0075434_1000451264 | 156 |
| 545 | 3300006871 | Ga0075434_100522052 | Ga0075434_1005220522 | 156 |
| 546 | 3300006871 | Ga0075434_100570052 | Ga0075434_1005700522 | 156 |
| 547 | 3300006880 | Ga0075429_100010632 | Ga0075429_1000106329 | 156 |
| 548 | 3300006880 | Ga0075429_100085461 | Ga0075429_1000854614 | 156 |
| 549 | 3300006880 | Ga0075429_100205912 | Ga0075429_1002059123 | 156 |
| 550 | 3300006914 | Ga0075436_100006600 | Ga0075436_1000066003 | 156 |
| 551 | 3300006914 | Ga0075436_100159040 | Ga0075436_1001590402 | 156 |
| 552 | 3300006914 | Ga0075436_100182347 | Ga0075436_1001823472 | 156 |
| 553 | 3300006931 | Ga0097620_100015946 | Ga0097620_1000159469 | 156 |
| 554 | 3300006931 | Ga0097620_100084495 | Ga0097620_1000844953 | 156 |
| 555 | 3300006931 | Ga0097620_100235656 | Ga0097620_1002356562 | 156 |
| 556 | 3300006931 | Ga0097620_100424727 | Ga0097620_1004247272 | 156 |
| 557 | 3300007076 | Ga0075435_100013658 | Ga0075435_1000136583 | 156 |
| 558 | 3300007076 | Ga0075435_100090136 | Ga0075435_1000901363 | 156 |
| 559 | 3300007076 | Ga0075435_100114637 | Ga0075435_1001146372 | 156 |
| 560 | 3300007076 | Ga0075435_100272701 | Ga0075435_1002727012 | 156 |
| 561 | 3300007265 | Ga0099794_10286798 | Ga0099794_102867982 | 156 |
| 562 | 3300009093 | Ga0105240_10003506 | Ga0105240_1000350623 | 156 |
| 563 | 3300009093 | Ga0105240_10031807 | Ga0105240_100318074 | 156 |
| 564 | 3300009093 | Ga0105240_10084049 | Ga0105240_100840494 | 156 |
| 565 | 3300009093 | Ga0105240_10170312 | Ga0105240_101703122 | 156 |
| 566 | 3300009094 | Ga0111539_10149686 | Ga0111539_101496862 | 156 |
| 567 | 3300009094 | Ga0111539_10633362 | Ga0111539_106333622 | 156 |
| 568 | 3300009094 | Ga0111539_11167040 | Ga0111539_111670402 | 156 |
| 569 | 3300009098 | Ga0105245_10602813 | Ga0105245_106028132 | 156 |
| 570 | 3300009098 | Ga0105245_11456042 | Ga0105245_114560422 | 156 |
| 571 | 3300009147 | Ga0114129_10038312 | Ga0114129_100383123 | 156 |
| 572 | 3300009148 | Ga0105243_10258773 | Ga0105243_102587732 | 156 |
| 573 | 3300009174 | Ga0105241_10009703 | Ga0105241_100097033 | 156 |
| 574 | 3300009176 | Ga0105242_10048006 | Ga0105242_100480062 | 156 |
| 575 | 3300009177 | Ga0105248_10167669 | Ga0105248_101676693 | 156 |
| 576 | 3300009551 | Ga0105238_10467858 | Ga0105238_104678582 | 156 |
| 577 | 3300009553 | Ga0105249_10000202 | Ga0105249_1000020242 | 156 |
| 578 | 3300009553 | Ga0105249_10104817 | Ga0105249_101048173 | 156 |
| 579 | 3300009553 | Ga0105249_10805792 | Ga0105249_108057922 | 156 |
| 580 | 3300013100 | Ga0157373_10002032 | Ga0157373_100020322 | 156 |
| 581 | 3300013100 | Ga0157373_10059108 | Ga0157373_100591082 | 156 |
| 582 | 3300013100 | Ga0157373_10503986 | Ga0157373_105039862 | 156 |
| 583 | 3300013102 | Ga0157371_10024497 | Ga0157371_100244974 | 156 |
| 584 | 3300013102 | Ga0157371_10028167 | Ga0157371_100281674 | 156 |
| 585 | 3300013102 | Ga0157371_10726890 | Ga0157371_107268902 | 156 |
| 586 | 3300013102 | Ga0157371_10853337 | Ga0157371_108533371 | 156 |
| 587 | 3300013104 | Ga0157370_10001252 | Ga0157370_1000125225 | 156 |
| 588 | 3300013104 | Ga0157370_10027603 | Ga0157370_100276032 | 156 |
| 589 | 3300013104 | Ga0157370_10037747 | Ga0157370_100377474 | 156 |
| 590 | 3300013104 | Ga0157370_10057063 | Ga0157370_100570634 | 156 |
| 591 | 3300013104 | Ga0157370_10447669 | Ga0157370_104476692 | 156 |
| 592 | 3300013104 | Ga0157370_10693496 | Ga0157370_106934962 | 156 |
| 593 | 3300013104 | Ga0157370_11018516 | Ga0157370_110185162 | 156 |
| 594 | 3300013105 | Ga0157369_10020822 | Ga0157369_100208226 | 156 |
| 595 | 3300013105 | Ga0157369_10027155 | Ga0157369_100271554 | 156 |
| 596 | 3300013105 | Ga0157369_10196094 | Ga0157369_101960943 | 156 |
| 597 | 3300013105 | Ga0157369_10216120 | Ga0157369_102161202 | 156 |
| 598 | 3300013296 | Ga0157374_10190375 | Ga0157374_101903753 | 156 |
| 599 | 3300013296 | Ga0157374_10446678 | Ga0157374_104466782 | 156 |
| 600 | 3300013297 | Ga0157378_10009314 | Ga0157378_100093148 | 156 |
| 601 | 3300013297 | Ga0157378_10168495 | Ga0157378_101684953 | 156 |
| 602 | 3300013297 | Ga0157378_11514332 | Ga0157378_115143322 | 156 |
| 603 | 3300013306 | Ga0163162_10172950 | Ga0163162_101729502 | 156 |
| 604 | 3300013307 | Ga0157372_10005157 | Ga0157372_100051578 | 156 |
| 605 | 3300013307 | Ga0157372_10017987 | Ga0157372_100179877 | 156 |
| 606 | 3300013307 | Ga0157372_10021493 | Ga0157372_100214935 | 156 |
| 607 | 3300013307 | Ga0157372_10022214 | Ga0157372_100222145 | 156 |
| 608 | 3300013307 | Ga0157372_10029768 | Ga0157372_100297684 | 156 |
| 609 | 3300013307 | Ga0157372_10031639 | Ga0157372_100316395 | 156 |
| 610 | 3300013307 | Ga0157372_10074672 | Ga0157372_100746723 | 156 |
| 611 | 3300013307 | Ga0157372_10133341 | Ga0157372_101333411 | 156 |
| 612 | 3300013307 | Ga0157372_11705928 | Ga0157372_117059281 | 156 |
| 613 | 3300013308 | Ga0157375_10088154 | Ga0157375_100881543 | 156 |
| 614 | 3300013308 | Ga0157375_10163344 | Ga0157375_101633442 | 156 |
| 615 | 3300013308 | Ga0157375_11467913 | Ga0157375_114679131 | 156 |
| 616 | 3300014326 | Ga0157380_10692446 | Ga0157380_106924462 | 156 |
| 617 | 3300014497 | Ga0182008_10119759 | Ga0182008_101197592 | 156 |
| 618 | 3300014745 | Ga0157377_10010160 | Ga0157377_100101604 | 156 |
| 619 | 3300014745 | Ga0157377_10118108 | Ga0157377_101181082 | 156 |
| 620 | 3300020082 | Ga0206353_11560936 | Ga0206353_115609362 | 156 |
| 621 | 3300021384 | Ga0213876_10200344 | Ga0213876_102003442 | 156 |
| 622 | 3300025885 | Ga0207653_10000258 | Ga0207653_100002582 | 156 |
| 623 | 3300025899 | Ga0207642_10062229 | Ga0207642_100622292 | 156 |
| 624 | 3300025901 | Ga0207688_10017583 | Ga0207688_100175833 | 156 |
| 625 | 3300025903 | Ga0207680_10273093 | Ga0207680_102730932 | 156 |
| 626 | 3300025903 | Ga0207680_10354407 | Ga0207680_103544071 | 156 |
| 627 | 3300025903 | Ga0207680_10744120 | Ga0207680_107441201 | 156 |
| 628 | 3300025904 | Ga0207647_10089925 | Ga0207647_100899252 | 156 |
| 629 | 3300025906 | Ga0207699_10141848 | Ga0207699_101418482 | 156 |
| 630 | 3300025907 | Ga0207645_10099225 | Ga0207645_100992252 | 156 |
| 631 | 3300025908 | Ga0207643_10032681 | Ga0207643_100326812 | 156 |
| 632 | 3300025908 | Ga0207643_10040135 | Ga0207643_100401353 | 156 |
| 633 | 3300025909 | Ga0207705_10021651 | Ga0207705_100216513 | 156 |
| 634 | 3300025909 | Ga0207705_10090304 | Ga0207705_100903042 | 156 |
| 635 | 3300025909 | Ga0207705_10191650 | Ga0207705_101916501 | 156 |
| 636 | 3300025909 | Ga0207705_10455854 | Ga0207705_104558542 | 156 |
| 637 | 3300025910 | Ga0207684_10138245 | Ga0207684_101382452 | 156 |
| 638 | 3300025910 | Ga0207684_10180151 | Ga0207684_101801512 | 156 |
| 639 | 3300025911 | Ga0207654_10019437 | Ga0207654_100194374 | 156 |
| 640 | 3300025912 | Ga0207707_10000375 | Ga0207707_1000037518 | 156 |
| 641 | 3300025912 | Ga0207707_10009397 | Ga0207707_100093973 | 156 |
| 642 | 3300025912 | Ga0207707_10011934 | Ga0207707_100119348 | 156 |
| 643 | 3300025912 | Ga0207707_10015521 | Ga0207707_100155216 | 156 |
| 644 | 3300025912 | Ga0207707_10190165 | Ga0207707_101901652 | 156 |
| 645 | 3300025913 | Ga0207695_10001648 | Ga0207695_1000164831 | 156 |
| 646 | 3300025913 | Ga0207695_10024557 | Ga0207695_100245575 | 156 |
| 647 | 3300025913 | Ga0207695_10094850 | Ga0207695_100948502 | 156 |
| 648 | 3300025913 | Ga0207695_10277877 | Ga0207695_102778772 | 156 |
| 649 | 3300025915 | Ga0207693_10029290 | Ga0207693_100292903 | 156 |
| 650 | 3300025917 | Ga0207660_10001140 | Ga0207660_100011405 | 156 |
| 651 | 3300025917 | Ga0207660_10007084 | Ga0207660_100070845 | 156 |
| 652 | 3300025917 | Ga0207660_10053829 | Ga0207660_100538293 | 156 |
| 653 | 3300025917 | Ga0207660_10082765 | Ga0207660_100827653 | 156 |
| 654 | 3300025917 | Ga0207660_10495624 | Ga0207660_104956242 | 156 |
| 655 | 3300025918 | Ga0207662_10088607 | Ga0207662_100886073 | 156 |
| 656 | 3300025918 | Ga0207662_10382781 | Ga0207662_103827812 | 156 |
| 657 | 3300025919 | Ga0207657_10036203 | Ga0207657_100362034 | 156 |
| 658 | 3300025919 | Ga0207657_10209574 | Ga0207657_102095742 | 156 |
| 659 | 3300025919 | Ga0207657_10295898 | Ga0207657_102958982 | 156 |
| 660 | 3300025920 | Ga0207649_10002039 | Ga0207649_100020396 | 156 |
| 661 | 3300025920 | Ga0207649_10018576 | Ga0207649_100185762 | 156 |
| 662 | 3300025920 | Ga0207649_10050746 | Ga0207649_100507463 | 156 |
| 663 | 3300025920 | Ga0207649_10589554 | Ga0207649_105895542 | 156 |
| 664 | 3300025921 | Ga0207652_10000654 | Ga0207652_1000065415 | 156 |
| 665 | 3300025921 | Ga0207652_10014383 | Ga0207652_100143838 | 156 |
| 666 | 3300025921 | Ga0207652_10024992 | Ga0207652_100249925 | 156 |
| 667 | 3300025921 | Ga0207652_10053269 | Ga0207652_100532693 | 156 |
| 668 | 3300025921 | Ga0207652_10646304 | Ga0207652_106463042 | 156 |
| 669 | 3300025922 | Ga0207646_10015549 | Ga0207646_100155493 | 156 |
| 670 | 3300025922 | Ga0207646_10090461 | Ga0207646_100904612 | 156 |
| 671 | 3300025922 | Ga0207646_10349292 | Ga0207646_103492922 | 156 |
| 672 | 3300025923 | Ga0207681_10000517 | Ga0207681_100005175 | 156 |
| 673 | 3300025923 | Ga0207681_10012624 | Ga0207681_100126243 | 156 |
| 674 | 3300025923 | Ga0207681_10023961 | Ga0207681_100239614 | 156 |
| 675 | 3300025923 | Ga0207681_10025964 | Ga0207681_100259644 | 156 |
| 676 | 3300025924 | Ga0207694_10137033 | Ga0207694_101370332 | 156 |
| 677 | 3300025925 | Ga0207650_10012785 | Ga0207650_100127852 | 156 |
| 678 | 3300025925 | Ga0207650_10170586 | Ga0207650_101705862 | 156 |
| 679 | 3300025926 | Ga0207659_10010032 | Ga0207659_100100324 | 156 |
| 680 | 3300025926 | Ga0207659_10249185 | Ga0207659_102491852 | 156 |
| 681 | 3300025926 | Ga0207659_10638810 | Ga0207659_106388102 | 156 |
| 682 | 3300025928 | Ga0207700_10017835 | Ga0207700_100178352 | 156 |
| 683 | 3300025928 | Ga0207700_10456489 | Ga0207700_104564892 | 156 |
| 684 | 3300025929 | Ga0207664_10030378 | Ga0207664_100303786 | 156 |
| 685 | 3300025929 | Ga0207664_10554073 | Ga0207664_105540732 | 156 |
| 686 | 3300025931 | Ga0207644_10217026 | Ga0207644_102170262 | 156 |
| 687 | 3300025931 | Ga0207644_10461967 | Ga0207644_104619672 | 156 |
| 688 | 3300025931 | Ga0207644_10686546 | Ga0207644_106865462 | 156 |
| 689 | 3300025932 | Ga0207690_10039887 | Ga0207690_100398873 | 156 |
| 690 | 3300025932 | Ga0207690_10122555 | Ga0207690_101225553 | 156 |
| 691 | 3300025932 | Ga0207690_10200131 | Ga0207690_102001313 | 156 |
| 692 | 3300025934 | Ga0207686_10170536 | Ga0207686_101705362 | 156 |
| 693 | 3300025934 | Ga0207686_10972708 | Ga0207686_109727082 | 156 |
| 694 | 3300025936 | Ga0207670_10005395 | Ga0207670_100053955 | 156 |
| 695 | 3300025937 | Ga0207669_10118463 | Ga0207669_101184632 | 156 |
| 696 | 3300025937 | Ga0207669_10267180 | Ga0207669_102671802 | 156 |
| 697 | 3300025938 | Ga0207704_10023799 | Ga0207704_100237993 | 156 |
| 698 | 3300025938 | Ga0207704_10295297 | Ga0207704_102952972 | 156 |
| 699 | 3300025940 | Ga0207691_10002376 | Ga0207691_1000237617 | 156 |
| 700 | 3300025940 | Ga0207691_10024319 | Ga0207691_100243194 | 156 |
| 701 | 3300025940 | Ga0207691_10029402 | Ga0207691_100294025 | 156 |
| 702 | 3300025941 | Ga0207711_10064544 | Ga0207711_100645444 | 156 |
| 703 | 3300025942 | Ga0207689_10148077 | Ga0207689_101480772 | 156 |
| 704 | 3300025942 | Ga0207689_10301407 | Ga0207689_103014072 | 156 |
| 705 | 3300025944 | Ga0207661_10001425 | Ga0207661_1000142510 | 156 |
| 706 | 3300025944 | Ga0207661_10024729 | Ga0207661_100247295 | 156 |
| 707 | 3300025944 | Ga0207661_10025863 | Ga0207661_100258636 | 156 |
| 708 | 3300025944 | Ga0207661_10316802 | Ga0207661_103168023 | 156 |
| 709 | 3300025944 | Ga0207661_10460918 | Ga0207661_104609181 | 156 |
| 710 | 3300025945 | Ga0207679_10066173 | Ga0207679_100661732 | 156 |
| 711 | 3300025945 | Ga0207679_10466594 | Ga0207679_104665942 | 156 |
| 712 | 3300025945 | Ga0207679_10549962 | Ga0207679_105499622 | 156 |
| 713 | 3300025949 | Ga0207667_10008688 | Ga0207667_100086889 | 156 |
| 714 | 3300025949 | Ga0207667_10072664 | Ga0207667_100726644 | 156 |
| 715 | 3300025960 | Ga0207651_10043339 | Ga0207651_100433394 | 156 |
| 716 | 3300025960 | Ga0207651_10144382 | Ga0207651_101443822 | 156 |
| 717 | 3300025961 | Ga0207712_10000387 | Ga0207712_1000038720 | 156 |
| 718 | 3300025972 | Ga0207668_10133724 | Ga0207668_101337243 | 156 |
| 719 | 3300025981 | Ga0207640_10000561 | Ga0207640_1000056111 | 156 |
| 720 | 3300025981 | Ga0207640_10248226 | Ga0207640_102482262 | 156 |
| 721 | 3300025981 | Ga0207640_10753501 | Ga0207640_107535012 | 156 |
| 722 | 3300025986 | Ga0207658_10081105 | Ga0207658_100811051 | 156 |
| 723 | 3300025986 | Ga0207658_10109338 | Ga0207658_101093383 | 156 |
| 724 | 3300025986 | Ga0207658_11102789 | Ga0207658_111027891 | 156 |
| 725 | 3300026035 | Ga0207703_10182157 | Ga0207703_101821572 | 156 |
| 726 | 3300026041 | Ga0207639_10180893 | Ga0207639_101808932 | 156 |
| 727 | 3300026067 | Ga0207678_10752091 | Ga0207678_107520912 | 156 |
| 728 | 3300026075 | Ga0207708_10022116 | Ga0207708_100221165 | 156 |
| 729 | 3300026075 | Ga0207708_10079877 | Ga0207708_100798772 | 156 |
| 730 | 3300026078 | Ga0207702_10153614 | Ga0207702_101536142 | 156 |
| 731 | 3300026078 | Ga0207702_10156142 | Ga0207702_101561422 | 156 |
| 732 | 3300026078 | Ga0207702_11274774 | Ga0207702_112747741 | 156 |
| 733 | 3300026089 | Ga0207648_10009133 | Ga0207648_100091333 | 156 |
| 734 | 3300026089 | Ga0207648_10068867 | Ga0207648_100688672 | 156 |
| 735 | 3300026089 | Ga0207648_10293499 | Ga0207648_102934992 | 156 |
| 736 | 3300026089 | Ga0207648_10738413 | Ga0207648_107384132 | 156 |
| 737 | 3300026095 | Ga0207676_10075904 | Ga0207676_100759044 | 156 |
| 738 | 3300026116 | Ga0207674_10038342 | Ga0207674_100383422 | 156 |
| 739 | 3300026118 | Ga0207675_100158343 | Ga0207675_1001583432 | 156 |
| 740 | 3300026118 | Ga0207675_100312684 | Ga0207675_1003126842 | 156 |
| 741 | 3300026118 | Ga0207675_100718510 | Ga0207675_1007185102 | 156 |
| 742 | 3300026121 | Ga0207683_10267080 | Ga0207683_102670803 | 156 |
| 743 | 3300026121 | Ga0207683_10950559 | Ga0207683_109505591 | 156 |
| 744 | 3300026142 | Ga0207698_10026876 | Ga0207698_100268763 | 156 |
| 745 | 3300026142 | Ga0207698_10049238 | Ga0207698_100492384 | 156 |
| 746 | 3300026142 | Ga0207698_10256870 | Ga0207698_102568702 | 156 |
| 747 | 3300026142 | Ga0207698_10582448 | Ga0207698_105824482 | 156 |
| 748 | 3300026142 | Ga0207698_10986605 | Ga0207698_109866052 | 156 |
| 749 | 3300027671 | Ga0209588_1001748 | Ga0209588_10017482 | 156 |
| 750 | 3300027907 | Ga0207428_10043467 | Ga0207428_100434674 | 156 |
| 751 | 3300027907 | Ga0207428_10251403 | Ga0207428_102514032 | 156 |
| 752 | 3300027907 | Ga0207428_10298601 | Ga0207428_102986012 | 156 |
| 753 | 3300028379 | Ga0268266_10575708 | Ga0268266_105757082 | 156 |
| 754 | 3300028379 | Ga0268266_10796202 | Ga0268266_107962022 | 156 |
| 755 | 3300028380 | Ga0268265_10000317 | Ga0268265_1000031730 | 156 |
| 756 | 3300028380 | Ga0268265_10013830 | Ga0268265_100138302 | 156 |
| 757 | 3300028380 | Ga0268265_10136214 | Ga0268265_101362142 | 156 |
| 758 | 3300028381 | Ga0268264_10122888 | Ga0268264_101228883 | 156 |
| 759 | 3300031548 | Ga0307408_100009821 | Ga0307408_1000098215 | 156 |
| 760 | 3300031548 | Ga0307408_100034024 | Ga0307408_1000340242 | 156 |
| 761 | 3300031548 | Ga0307408_100136555 | Ga0307408_1001365552 | 156 |
| 762 | 3300031548 | Ga0307408_100243875 | Ga0307408_1002438752 | 156 |
| 763 | 3300031548 | Ga0307408_100479616 | Ga0307408_1004796162 | 156 |
| 764 | 3300031691 | Ga0316579_10163426 | Ga0316579_101634262 | 156 |
| 765 | 3300031731 | Ga0307405_10000218 | Ga0307405_1000021812 | 156 |
| 766 | 3300031731 | Ga0307405_10001167 | Ga0307405_100011679 | 156 |
| 767 | 3300031731 | Ga0307405_10006163 | Ga0307405_100061633 | 156 |
| 768 | 3300031731 | Ga0307405_10239598 | Ga0307405_102395982 | 156 |
| 769 | 3300031731 | Ga0307405_10249526 | Ga0307405_102495262 | 156 |
| 770 | 3300031731 | Ga0307405_10527914 | Ga0307405_105279142 | 156 |
| 771 | 3300031731 | Ga0307405_10536923 | Ga0307405_105369232 | 156 |
| 772 | 3300031824 | Ga0307413_10000688 | Ga0307413_1000068810 | 156 |
| 773 | 3300031824 | Ga0307413_10015903 | Ga0307413_100159035 | 156 |
| 774 | 3300031824 | Ga0307413_10056419 | Ga0307413_100564192 | 156 |
| 775 | 3300031824 | Ga0307413_10101886 | Ga0307413_101018862 | 156 |
| 776 | 3300031824 | Ga0307413_10175339 | Ga0307413_101753392 | 156 |
| 777 | 3300031824 | Ga0307413_10243718 | Ga0307413_102437182 | 156 |
| 778 | 3300031824 | Ga0307413_10602636 | Ga0307413_106026362 | 156 |
| 779 | 3300031852 | Ga0307410_10002272 | Ga0307410_100022722 | 156 |
| 780 | 3300031852 | Ga0307410_10002390 | Ga0307410_100023909 | 156 |
| 781 | 3300031852 | Ga0307410_10047756 | Ga0307410_100477562 | 156 |
| 782 | 3300031852 | Ga0307410_10206885 | Ga0307410_102068852 | 156 |
| 783 | 3300031852 | Ga0307410_10250217 | Ga0307410_102502172 | 156 |
| 784 | 3300031852 | Ga0307410_10262838 | Ga0307410_102628382 | 156 |
| 785 | 3300031852 | Ga0307410_10497493 | Ga0307410_104974932 | 156 |
| 786 | 3300031852 | Ga0307410_10813110 | Ga0307410_108131102 | 156 |
| 787 | 3300031901 | Ga0307406_10005499 | Ga0307406_100054997 | 156 |
| 788 | 3300031901 | Ga0307406_10010733 | Ga0307406_100107334 | 156 |
| 789 | 3300031901 | Ga0307406_10020447 | Ga0307406_100204473 | 156 |
| 790 | 3300031901 | Ga0307406_10027312 | Ga0307406_100273124 | 156 |
| 791 | 3300031901 | Ga0307406_10665288 | Ga0307406_106652882 | 156 |
| 792 | 3300031903 | Ga0307407_10001188 | Ga0307407_100011883 | 156 |
| 793 | 3300031903 | Ga0307407_10003414 | Ga0307407_100034142 | 156 |
| 794 | 3300031903 | Ga0307407_10012118 | Ga0307407_100121184 | 156 |
| 795 | 3300031903 | Ga0307407_10298697 | Ga0307407_102986972 | 156 |
| 796 | 3300031903 | Ga0307407_10689269 | Ga0307407_106892692 | 156 |
| 797 | 3300031911 | Ga0307412_10013680 | Ga0307412_100136804 | 156 |
| 798 | 3300031911 | Ga0307412_10054281 | Ga0307412_100542812 | 156 |
| 799 | 3300031911 | Ga0307412_10154854 | Ga0307412_101548543 | 156 |
| 800 | 3300031911 | Ga0307412_10165327 | Ga0307412_101653273 | 156 |
| 801 | 3300031995 | Ga0307409_100002960 | Ga0307409_1000029603 | 156 |
| 802 | 3300031995 | Ga0307409_100006362 | Ga0307409_1000063625 | 156 |
| 803 | 3300031995 | Ga0307409_100047713 | Ga0307409_1000477132 | 156 |
| 804 | 3300031995 | Ga0307409_100561431 | Ga0307409_1005614311 | 156 |
| 805 | 3300031995 | Ga0307409_100583169 | Ga0307409_1005831692 | 156 |
| 806 | 3300031995 | Ga0307409_100910479 | Ga0307409_1009104792 | 156 |
| 807 | 3300031995 | Ga0307409_101355372 | Ga0307409_1013553721 | 156 |
| 808 | 3300032002 | Ga0307416_100000558 | Ga0307416_1000005587 | 156 |
| 809 | 3300032002 | Ga0307416_100005562 | Ga0307416_1000055622 | 156 |
| 810 | 3300032002 | Ga0307416_100024697 | Ga0307416_1000246972 | 156 |
| 811 | 3300032002 | Ga0307416_100138514 | Ga0307416_1001385142 | 156 |
| 812 | 3300032002 | Ga0307416_100191072 | Ga0307416_1001910723 | 156 |
| 813 | 3300032002 | Ga0307416_100358158 | Ga0307416_1003581582 | 156 |
| 814 | 3300032002 | Ga0307416_100506417 | Ga0307416_1005064172 | 156 |
| 815 | 3300032002 | Ga0307416_100520118 | Ga0307416_1005201182 | 156 |
| 816 | 3300032002 | Ga0307416_100585750 | Ga0307416_1005857501 | 156 |
| 817 | 3300032004 | Ga0307414_10002216 | Ga0307414_1000221611 | 156 |
| 818 | 3300032004 | Ga0307414_10020825 | Ga0307414_100208252 | 156 |
| 819 | 3300032004 | Ga0307414_10025283 | Ga0307414_100252833 | 156 |
| 820 | 3300032004 | Ga0307414_10070923 | Ga0307414_100709232 | 156 |
| 821 | 3300032004 | Ga0307414_10151109 | Ga0307414_101511092 | 156 |
| 822 | 3300032004 | Ga0307414_10720647 | Ga0307414_107206472 | 156 |
| 823 | 3300032005 | Ga0307411_10000106 | Ga0307411_100001065 | 156 |
| 824 | 3300032005 | Ga0307411_10000758 | Ga0307411_1000075810 | 156 |
| 825 | 3300032005 | Ga0307411_10004491 | Ga0307411_100044919 | 156 |
| 826 | 3300032005 | Ga0307411_10058012 | Ga0307411_100580124 | 156 |
| 827 | 3300032005 | Ga0307411_10082023 | Ga0307411_100820232 | 156 |
| 828 | 3300032005 | Ga0307411_10129842 | Ga0307411_101298422 | 156 |
| 829 | 3300032005 | Ga0307411_10199209 | Ga0307411_101992092 | 156 |
| 830 | 3300032126 | Ga0307415_100011835 | Ga0307415_1000118354 | 156 |
| 831 | 3300032126 | Ga0307415_100110120 | Ga0307415_1001101203 | 156 |
| 832 | 3300032126 | Ga0307415_100214214 | Ga0307415_1002142141 | 156 |
| 833 | 3300032126 | Ga0307415_100401813 | Ga0307415_1004018132 | 156 |
| 834 | 3300032126 | Ga0307415_100404413 | Ga0307415_1004044132 | 156 |
| 835 | 3300034819 | Ga0373958_0034955 | Ga0373958_0034955_324_878 | 156 |
| 836 | 3300035083 | Ga0373926_0009877 | Ga0373926_0009877_58_612 | 156 |
| 837 | 3300035086 | Ga0373934_0000166 | Ga0373934_0000166_6505_7059 | 156 |
| 838 | 3300035089 | Ga0373944_0006824 | Ga0373944_0006824_320_874 | 156 |
| 839 | 3300035111 | Ga0373923_0015436 | Ga0373923_0015436_1029_1583 | 156 |
| 840 | 3300035117 | Ga0373953_0005021 | Ga0373953_0005021_3142_3696 | 156 |
| 841 | 3300035119 | Ga0373956_0000183 | Ga0373956_0000183_21373_21927 | 156 |
| 842 | 3300035170 | Ga0373943_0001415 | Ga0373943_0001415_6755_7309 | 156 |
| 843 | 3300035171 | Ga0373946_0002897 | Ga0373946_0002897_3470_4024 | 156 |
| 844 | 3300035172 | Ga0373955_0000753 | Ga0373955_0000753_9490_10044 | 156 |
| 845 | 3300035410 | Ga0373924_0007550 | Ga0373924_0007550_639_1193 | 156 |
| 846 | 3300035692 | Ga0373935_0005704 | Ga0373935_0005704_3242_3796 | 156 |
| 847 | 3300035692 | Ga0373935_0175156 | Ga0373935_0175156_546_1100 | 156 |
| 848 | 3300035695 | Ga0373927_0021535 | Ga0373927_0021535_2713_3267 | 156 |
| 849 | 3300035724 | Ga0373933_0000131 | Ga0373933_0000131_40273_40827 | 156 |
| 850 | 3300035725 | Ga0373947_0001610 | Ga0373947_0001610_11906_12460 | 156 |
| 851 | 3300036401 | Ga0373937_0000512 | Ga0373937_0000512_26184_26738 | 156 |
| 852 | 3300036647 | Ga0316582_0158614 | Ga0316582_0158614_664_1221 | 156 |
| 853 | 3300037068 | Ga0373925_0003211 | Ga0373925_0003211_8741_9295 | 156 |
| 854 | 3300039093 | Ga0400489_51950 | Ga0400489_51950_520_1017 | 156 |
| 855 | 3300039437 | Ga0436365_0143962 | Ga0436365_0143962_378_932 | 156 |
| 856 | 3300041406 | Ga0439439_0011221 | Ga0439439_0011221_79_633 | 156 |
| 857 | 3300041496 | Ga0451839_0303675 | Ga0451839_0303675_259_813 | 156 |
| 858 | 3300041496 | Ga0451839_1201838 | Ga0451839_1201838_81_644 | 156 |
| 859 | 3300042125 | Ga0450923_018708 | Ga0450923_018708_494_1048 | 156 |
| 860 | 3300042437 | Ga0439444_0015838 | Ga0439444_0015838_244_798 | 156 |
| 861 | 3300042876 | Ga0451577_0000016 | Ga0451577_0000016_279349_279903 | 156 |
| 862 | 3300042876 | Ga0451577_0208209 | Ga0451577_0208209_89_658 | 156 |
| 863 | 3300044673 | Ga0453683_0122524 | Ga0453683_0122524_953_1507 | 156 |
| 864 | 3300044673 | Ga0453683_0154459 | Ga0453683_0154459_206_775 | 156 |
| 865 | 3300044673 | Ga0453683_0378458 | Ga0453683_0378458_126_680 | 156 |
| 866 | 3300044842 | Ga0466957_0680759 | Ga0466957_0680759_16_570 | 156 |
| 867 | 3300044842 | Ga0466957_0808530 | Ga0466957_0808530_23_577 | 156 |
| 868 | 3300045051 | Ga0451576_0005609 | Ga0451576_0005609_12874_13443 | 156 |
| 869 | 3300045051 | Ga0451576_0024084 | Ga0451576_0024084_4207_4776 | 156 |
| 870 | 3300045051 | Ga0451576_0164712 | Ga0451576_0164712_341_910 | 156 |
| 871 | 3300045051 | Ga0451576_0308237 | Ga0451576_0308237_615_1169 | 156 |
| 872 | 3300045836 | Ga0466958_0350601 | Ga0466958_0350601_189_743 | 156 |
| 873 | 3300045976 | Ga0466967_0041154 | Ga0466967_0041154_1798_2352 | 156 |
| 874 | 3300046454 | Ga0495592_0001194 | Ga0495592_0001194_8021_8575 | 156 |
| 875 | 3300046455 | Ga0495603_0001831 | Ga0495603_0001831_8471_9025 | 156 |
| 876 | 3300046459 | Ga0495629_0037844 | Ga0495629_0037844_596_1150 | 156 |
| 877 | 3300046461 | Ga0495641_0194832 | Ga0495641_0194832_132_686 | 156 |
| 878 | 3300046462 | Ga0495651_0000098 | Ga0495651_0000098_56176_56730 | 156 |
| 879 | 3300046463 | Ga0495653_0000168 | Ga0495653_0000168_46930_47484 | 156 |
| 880 | 3300046472 | Ga0495580_0005634 | Ga0495580_0005634_8538_9092 | 156 |
| 881 | 3300046473 | Ga0495582_0000694 | Ga0495582_0000694_5668_6222 | 156 |
| 882 | 3300046475 | Ga0495639_0000412 | Ga0495639_0000412_944_1498 | 156 |
| 883 | 3300046475 | Ga0495639_0356119 | Ga0495639_0356119_62_616 | 156 |
| 884 | 3300046500 | Ga0495596_0272443 | Ga0495596_0272443_16_570 | 156 |
| 885 | 3300046511 | Ga0495608_0003342 | Ga0495608_0003342_7514_8068 | 156 |
| 886 | 3300046514 | Ga0495618_0099010 | Ga0495618_0099010_19_573 | 156 |
| 887 | 3300046516 | Ga0495628_0000991 | Ga0495628_0000991_17968_18522 | 156 |
| 888 | 3300046517 | Ga0495630_0028854 | Ga0495630_0028854_3384_3938 | 156 |
| 889 | 3300046517 | Ga0495630_0059253 | Ga0495630_0059253_870_1424 | 156 |
| 890 | 3300046525 | Ga0495663_0105672 | Ga0495663_0105672_228_782 | 156 |
| 891 | 3300046529 | Ga0495652_0000694 | Ga0495652_0000694_29654_30208 | 156 |
| 892 | 3300046531 | Ga0495665_0000916 | Ga0495665_0000916_4198_4752 | 156 |
| 893 | 3300046531 | Ga0495665_0109111 | Ga0495665_0109111_153_707 | 156 |
| 894 | 3300046533 | Ga0495640_0530831 | Ga0495640_0530831_102_656 | 156 |
| 895 | 3300046536 | Ga0495587_0000628 | Ga0495587_0000628_9870_10424 | 156 |
| 896 | 3300046537 | Ga0495598_0007061 | Ga0495598_0007061_1632_2201 | 156 |
| 897 | 3300046538 | Ga0495609_0169291 | Ga0495609_0169291_155_724 | 156 |
| 898 | 3300046539 | Ga0495621_0178660 | Ga0495621_0178660_162_731 | 156 |
| 899 | 3300046543 | Ga0495645_0000106 | Ga0495645_0000106_41438_41992 | 156 |
| 900 | 3300046557 | Ga0495622_0121061 | Ga0495622_0121061_99_653 | 156 |
| 901 | 3300046559 | Ga0495667_0000431 | Ga0495667_0000431_9589_10143 | 156 |
| 902 | 3300046615 | Ga0495656_0032053 | Ga0495656_0032053_906_1475 | 156 |
| 903 | 3300046663 | Ga0495635_0000344 | Ga0495635_0000344_24593_25147 | 156 |
| 904 | 3300046674 | Ga0495588_0005262 | Ga0495588_0005262_1612_2166 | 156 |
| 905 | 3300046675 | Ga0495657_0001006 | Ga0495657_0001006_22281_22835 | 156 |
| 906 | 3300046678 | Ga0495599_0000150 | Ga0495599_0000150_34016_34570 | 156 |
| 907 | 3300046679 | Ga0495623_0000597 | Ga0495623_0000597_667_1221 | 156 |
| 908 | 3300046680 | Ga0495646_0001072 | Ga0495646_0001072_2740_3294 | 156 |
| 909 | 3300046681 | Ga0495647_0070788 | Ga0495647_0070788_301_855 | 156 |
| 910 | 3300046683 | Ga0495658_0000829 | Ga0495658_0000829_12144_12698 | 156 |
| 911 | 3300046684 | Ga0495669_0162452 | Ga0495669_0162452_452_1006 | 156 |
| 912 | 3300046809 | Ga0495600_0000156 | Ga0495600_0000156_17795_18349 | 156 |
| 913 | 3300047315 | Ga0495581_0001381 | Ga0495581_0001381_12368_12922 | 156 |
| 914 | 3300047317 | Ga0495604_0000519 | Ga0495604_0000519_25923_26477 | 156 |
| 915 | 3300047319 | Ga0495674_0009525 | Ga0495674_0009525_3421_3975 | 156 |
| 916 | 3300047322 | Ga0495680_0042318 | Ga0495680_0042318_2300_2854 | 156 |
| 917 | 3300047444 | Ga0495675_0003427 | Ga0495675_0003427_7577_8131 | 156 |
| 918 | 3300047471 | Ga0495684_0000216 | Ga0495684_0000216_37248_37802 | 156 |
| 919 | 3300047673 | Ga0495593_0001785 | Ga0495593_0001785_7247_7801 | 156 |
| 920 | 3300048088 | Ga0495602_0002360 | Ga0495602_0002360_14363_14917 | 156 |
| 921 | 3300048089 | Ga0495614_0012061 | Ga0495614_0012061_1630_2184 | 156 |
| 922 | 3300048903 | Ga0496100_0388923 | Ga0496100_0388923_467_1021 | 156 |
| 923 | 3300048904 | Ga0496101_0037387 | Ga0496101_0037387_1284_1838 | 156 |
| 924 | 3300048905 | Ga0496102_0207163 | Ga0496102_0207163_1066_1620 | 156 |
| 925 | 3300048915 | Ga0496112_0492901 | Ga0496112_0492901_421_975 | 156 |
| 926 | 3300048916 | Ga0496113_0851735 | Ga0496113_0851735_21_575 | 156 |
| 927 | 3300048917 | Ga0496114_0156191 | Ga0496114_0156191_250_804 | 156 |
| 928 | 3300049574 | Ga0501038_0040818 | Ga0501038_0040818_98_652 | 156 |
| 929 | 3300049576 | Ga0501040_0349794 | Ga0501040_0349794_95_649 | 156 |
| 930 | 3300049580 | Ga0501046_0773466 | Ga0501046_0773466_100_654 | 156 |
| 931 | 3300049581 | Ga0501047_0049597 | Ga0501047_0049597_3352_3906 | 156 |
| 932 | 3300049582 | Ga0501048_0384830 | Ga0501048_0384830_193_747 | 156 |
| 933 | 3300049583 | Ga0501067_0002587 | Ga0501067_0002587_4276_4830 | 156 |
| 934 | 3300049583 | Ga0501067_0007341 | Ga0501067_0007341_2068_2622 | 156 |
| 935 | 3300049583 | Ga0501067_0272501 | Ga0501067_0272501_46_600 | 156 |
| 936 | 3300049584 | Ga0501068_0009565 | Ga0501068_0009565_2520_3074 | 156 |
| 937 | 3300049585 | Ga0501069_0068679 | Ga0501069_0068679_1281_1835 | 156 |
| 938 | 3300049585 | Ga0501069_0091690 | Ga0501069_0091690_1118_1672 | 156 |
| 939 | 3300049586 | Ga0501070_0010086 | Ga0501070_0010086_430_984 | 156 |
| 940 | 3300049586 | Ga0501070_0018920 | Ga0501070_0018920_2516_3070 | 156 |
| 941 | 3300049586 | Ga0501070_0027735 | Ga0501070_0027735_3111_3665 | 156 |
| 942 | 3300049587 | Ga0501071_0037770 | Ga0501071_0037770_226_780 | 156 |
| 943 | 3300049588 | Ga0501072_0104051 | Ga0501072_0104051_397_951 | 156 |
| 944 | 3300049589 | Ga0501073_0000699 | Ga0501073_0000699_21187_21741 | 156 |
| 945 | 3300049589 | Ga0501073_0079560 | Ga0501073_0079560_1106_1669 | 156 |
| 946 | 3300049590 | Ga0501074_0018819 | Ga0501074_0018819_1944_2498 | 156 |
| 947 | 3300049590 | Ga0501074_0216128 | Ga0501074_0216128_274_828 | 156 |
| 948 | 3300049593 | Ga0501077_0013893 | Ga0501077_0013893_1018_1581 | 156 |
| 949 | 3300049672 | Ga0501239_021921 | Ga0501239_021921_114_668 | 156 |
| 950 | 3300049672 | Ga0501239_032088 | Ga0501239_032088_112_666 | 156 |
| 951 | 3300049675 | Ga0501243_000868 | Ga0501243_000868_294_848 | 156 |
| 952 | 3300049679 | Ga0501249_052454 | Ga0501249_052454_72_626 | 156 |
| 953 | 3300049685 | Ga0501256_007484 | Ga0501256_007484_418_972 | 156 |
| 954 | 3300049686 | Ga0501257_021569 | Ga0501257_021569_628_1182 | 156 |
| 955 | 3300049687 | Ga0501258_015862 | Ga0501258_015862_279_833 | 156 |
| 956 | 3300049688 | Ga0501259_019257 | Ga0501259_019257_158_712 | 156 |
| 957 | 3300049707 | Ga0501234_013329 | Ga0501234_013329_294_848 | 156 |
| 958 | 3300049742 | Ga0501080_0017347 | Ga0501080_0017347_4360_4914 | 156 |
| 959 | 3300049742 | Ga0501080_0035643 | Ga0501080_0035643_2191_2745 | 156 |
| 960 | 3300049742 | Ga0501080_0205592 | Ga0501080_0205592_704_1258 | 156 |
| 961 | 3300049743 | Ga0501081_0008481 | Ga0501081_0008481_599_1153 | 156 |
| 962 | 3300049744 | Ga0501083_0155109 | Ga0501083_0155109_358_912 | 156 |
| 963 | 3300049744 | Ga0501083_0241184 | Ga0501083_0241184_285_839 | 156 |
| 964 | 3300049765 | Ga0501268_039691 | Ga0501268_039691_172_726 | 156 |
| 965 | 3300049775 | Ga0501279_038112 | Ga0501279_038112_78_632 | 156 |
| 966 | 3300049822 | Ga0501035_0054536 | Ga0501035_0054536_445_999 | 156 |
| 967 | 3300049824 | Ga0501045_0325217 | Ga0501045_0325217_100_654 | 156 |
| 968 | 3300050507 | nmdc:mga05p37_238495_c1 | nmdc:mga05p37_238495_c1_692_1246 | 156 |
| 969 | 3300050507 | nmdc:mga05p37_258866_c1 | nmdc:mga05p37_258866_c1_46_600 | 156 |
| 970 | 3300050507 | nmdc:mga05p37_454546_c1 | nmdc:mga05p37_454546_c1_666_1220 | 156 |
| 971 | 3300050508 | nmdc:mga09592_211828_c1 | nmdc:mga09592_211828_c1_618_1172 | 156 |
| 972 | 3300050508 | nmdc:mga09592_436827_c1 | nmdc:mga09592_436827_c1_298_852 | 156 |
| 973 | 3300050508 | nmdc:mga09592_59608_c1 | nmdc:mga09592_59608_c1_1698_2252 | 156 |
| 974 | 3300050509 | nmdc:mga0qj67_143145_c1 | nmdc:mga0qj67_143145_c1_635_1189 | 156 |
| 975 | 3300050509 | nmdc:mga0qj67_82037_c1 | nmdc:mga0qj67_82037_c1_1441_1995 | 156 |
| 976 | 3300050509 | nmdc:mga0qj67_86238_c1 | nmdc:mga0qj67_86238_c1_322_876 | 156 |
| 977 | 3300050509 | nmdc:mga0qj67_981014_c1 | nmdc:mga0qj67_981014_c1_84_638 | 156 |
| 978 | 3300050510 | nmdc:mga06r32_127682_c1 | nmdc:mga06r32_127682_c1_222_776 | 156 |
| 979 | 3300050510 | nmdc:mga06r32_148749_c1 | nmdc:mga06r32_148749_c1_455_1009 | 156 |
| 980 | 3300050510 | nmdc:mga06r32_1559200_c1 | nmdc:mga06r32_1559200_c1_10_579 | 156 |
| 981 | 3300050510 | nmdc:mga06r32_303452_c1 | nmdc:mga06r32_303452_c1_531_1085 | 156 |
| 982 | 3300050510 | nmdc:mga06r32_32791_c1 | nmdc:mga06r32_32791_c1_223_777 | 156 |
| 983 | 3300050511 | nmdc:mga08y16_542106_c1 | nmdc:mga08y16_542106_c1_289_843 | 156 |
| 984 | 3300050511 | nmdc:mga08y16_67181_c1 | nmdc:mga08y16_67181_c1_2634_3188 | 156 |
| 985 | 3300050511 | nmdc:mga08y16_83386_c1 | nmdc:mga08y16_83386_c1_1872_2435 | 156 |
| 986 | 3300050512 | nmdc:mga0n895_17899_c1 | nmdc:mga0n895_17899_c1_5138_5692 | 156 |
| 987 | 3300050512 | nmdc:mga0n895_2537_c1 | nmdc:mga0n895_2537_c1_990_1559 | 156 |
| 988 | 3300050512 | nmdc:mga0n895_35737_c1 | nmdc:mga0n895_35737_c1_2962_3531 | 156 |
| 989 | 3300050512 | nmdc:mga0n895_470111_c1 | nmdc:mga0n895_470111_c1_486_1040 | 156 |
| 990 | 3300050513 | nmdc:mga0rr50_133632_c1 | nmdc:mga0rr50_133632_c1_579_1133 | 156 |
| 991 | 3300050513 | nmdc:mga0rr50_3714_c1 | nmdc:mga0rr50_3714_c1_5988_6557 | 156 |
| 992 | 3300050513 | nmdc:mga0rr50_38425_c1 | nmdc:mga0rr50_38425_c1_737_1306 | 156 |
| 993 | 3300050513 | nmdc:mga0rr50_409360_c1 | nmdc:mga0rr50_409360_c1_404_973 | 156 |
| 994 | 3300050513 | nmdc:mga0rr50_643070_c1 | nmdc:mga0rr50_643070_c1_172_741 | 156 |
| 995 | 3300050513 | nmdc:mga0rr50_87720_c1 | nmdc:mga0rr50_87720_c1_1330_1899 | 156 |
| 996 | 3300050514 | nmdc:mga08x19_149006_c1 | nmdc:mga08x19_149006_c1_590_1159 | 156 |
| 997 | 3300050514 | nmdc:mga08x19_61281_c1 | nmdc:mga08x19_61281_c1_421_990 | 156 |
| 998 | 3300050515 | nmdc:mga0a205_169260_c1 | nmdc:mga0a205_169260_c1_273_842 | 156 |
| 999 | 3300050515 | nmdc:mga0a205_61953_c1 | nmdc:mga0a205_61953_c1_2056_2625 | 156 |
| 1000 | 3300053077 | Ga0495601_0003853 | Ga0495601_0003853_2548_3102 | 156 |
| 1001 | 3300053078 | Ga0495612_0000349 | Ga0495612_0000349_16517_17071 | 156 |
| 1002 | 3300053085 | Ga0495619_0282889 | Ga0495619_0282889_45_599 | 156 |
| 1003 | 3300054114 | Ga0501084_0008141 | Ga0501084_0008141_5553_6107 | 156 |
| 1004 | 3300059421 | Ga0590071_005592 | Ga0590071_005592_38_592 | 156 |
| 1005 | 3300059421 | Ga0590071_030642 | Ga0590071_030642_438_1001 | 156 |
| 1006 | 3300059424 | Ga0590075_056282 | Ga0590075_056282_374_928 | 156 |
| 1007 | 3300060353 | Ga0501082_0035130 | Ga0501082_0035130_1225_1779 | 156 |
| 1008 | 3300060353 | Ga0501082_0253021 | Ga0501082_0253021_478_1032 | 156 |
| 1009 | iso_pu_bacteria | 2510917021 | 2511126159 | 156 |
| 1010 | iso_pu_bacteria | 2510917027 | 2511180735 | 156 |
| 1011 | iso_pu_bacteria | 2512564013 | 2512636941 | 156 |
| 1012 | iso_pu_bacteria | 2643221588 | 2643949666 | 156 |
| 1013 | iso_pu_bacteria | 2738541275 | 2738712527 | 156 |
| 1014 | iso_pu_bacteria | 2738541301 | 2738850951 | 156 |
| 1015 | iso_pu_bacteria | 2738541304 | 2738866681 | 156 |
| 1016 | iso_pu_bacteria | 2738543022 | 2739299198 | 156 |
| 1017 | iso_pu_bacteria | 2738543033 | 2739360877 | 156 |
| 1018 | iso_pu_bacteria | 2739367664 | 2739650416 | 156 |
| 1019 | iso_pu_bacteria | 2739367865 | 2740028889 | 156 |
| 1020 | iso_pu_bacteria | 2818991438 | 2819552694 | 156 |
| 1021 | iso_pu_bacteria | 2857465823 | 2857466785 | 156 |
| 1022 | iso_pu_bacteria | 2857591370 | 2857592785 | 156 |
| 1023 | iso_pu_bacteria | 2915597211 | 2915602126 | 156 |
| 1024 | iso_pu_bacteria | 2915606848 | 2915610996 | 156 |
| 1025 | iso_pu_bacteria | 2928100450 | 2928103835 | 156 |
| 1026 | iso_pu_bacteria | 2928959182 | 2928961764 | 156 |
| 1027 | iso_pu_bacteria | 2929183550 | 2929187223 | 156 |
| 1028 | 3300005340 | Ga0070689_100306229 | Ga0070689_1003062292 | 157 |
| 1029 | 3300005343 | Ga0070687_100091666 | Ga0070687_1000916661 | 157 |
| 1030 | 3300005457 | Ga0070662_100000491 | Ga0070662_10000049111 | 157 |
| 1031 | 3300005471 | Ga0070698_100039839 | Ga0070698_1000398392 | 157 |
| 1032 | 3300005544 | Ga0070686_100000114 | Ga0070686_10000011452 | 157 |
| 1033 | 3300005615 | Ga0070702_100132907 | Ga0070702_1001329072 | 157 |
| 1034 | 3300005719 | Ga0068861_100292686 | Ga0068861_1002926861 | 157 |
| 1035 | 3300009093 | Ga0105240_10000096 | Ga0105240_10000096119 | 157 |
| 1036 | 3300009174 | Ga0105241_10247520 | Ga0105241_102475202 | 157 |
| 1037 | 3300009551 | Ga0105238_10000271 | Ga0105238_1000027114 | 157 |
| 1038 | 3300013296 | Ga0157374_10242300 | Ga0157374_102423002 | 157 |
| 1039 | 3300021384 | Ga0213876_10199902 | Ga0213876_101999021 | 157 |
| 1040 | 3300025913 | Ga0207695_10000836 | Ga0207695_1000083651 | 157 |
| 1041 | 3300025918 | Ga0207662_10072737 | Ga0207662_100727371 | 157 |
| 1042 | 3300025924 | Ga0207694_10000007 | Ga0207694_10000007449 | 157 |
| 1043 | 3300025933 | Ga0207706_10001815 | Ga0207706_1000181513 | 157 |
| 1044 | 3300025972 | Ga0207668_10894767 | Ga0207668_108947671 | 157 |
| 1045 | 3300026118 | Ga0207675_100794296 | Ga0207675_1007942961 | 157 |
| 1046 | 3300031548 | Ga0307408_100254937 | Ga0307408_1002549372 | 157 |
| 1047 | 3300031548 | Ga0307408_101236386 | Ga0307408_1012363861 | 157 |
| 1048 | 3300031852 | Ga0307410_10115080 | Ga0307410_101150803 | 157 |
| 1049 | 3300031903 | Ga0307407_10313344 | Ga0307407_103133442 | 157 |
| 1050 | 3300031911 | Ga0307412_10068016 | Ga0307412_100680163 | 157 |
| 1051 | 3300031911 | Ga0307412_10256254 | Ga0307412_102562541 | 157 |
| 1052 | 3300032002 | Ga0307416_101158283 | Ga0307416_1011582831 | 157 |
| 1053 | 3300034816 | Ga0373930_0030647 | Ga0373930_0030647_335_886 | 157 |
| 1054 | 3300037853 | Ga0436364_0647371 | Ga0436364_0647371_2783_3334 | 157 |
| 1055 | 3300039437 | Ga0436365_1821459 | Ga0436365_1821459_2711_3265 | 157 |
| 1056 | 3300044656 | Ga0466969_0040961 | Ga0466969_0040961_1283_1837 | 157 |
| 1057 | 3300044673 | Ga0453683_0194666 | Ga0453683_0194666_466_1020 | 157 |
| 1058 | 3300044693 | Ga0466961_0001485 | Ga0466961_0001485_12106_12660 | 157 |
| 1059 | 3300046522 | Ga0495643_0000024 | Ga0495643_0000024_226664_227215 | 157 |
| 1060 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_43442_43999 | 157 |
| 1061 | 3300048920 | Ga0496117_0111026 | Ga0496117_0111026_506_1063 | 157 |
| 1062 | 3300048921 | Ga0496118_0155393 | Ga0496118_0155393_428_985 | 157 |
| 1063 | 3300048925 | Ga0496122_0001902 | Ga0496122_0001902_29090_29647 | 157 |
| 1064 | 3300048926 | Ga0496123_0003060 | Ga0496123_0003060_4631_5188 | 157 |
| 1065 | 3300048927 | Ga0496124_0004374 | Ga0496124_0004374_8740_9297 | 157 |
| 1066 | 3300048928 | Ga0496125_0394095 | Ga0496125_0394095_220_777 | 157 |
| 1067 | 3300048929 | Ga0496126_0000084 | Ga0496126_0000084_190005_190562 | 157 |
| 1068 | 3300049577 | Ga0501041_0074500 | Ga0501041_0074500_530_1087 | 157 |
| 1069 | 3300049578 | Ga0501042_0523373 | Ga0501042_0523373_281_838 | 157 |
| 1070 | 3300049587 | Ga0501071_0486449 | Ga0501071_0486449_56_613 | 157 |
| 1071 | 3300049589 | Ga0501073_0560125 | Ga0501073_0560125_47_604 | 157 |
| 1072 | 3300049591 | Ga0501075_0241150 | Ga0501075_0241150_686_1243 | 157 |
| 1073 | 3300049592 | Ga0501076_0364913 | Ga0501076_0364913_227_784 | 157 |
| 1074 | 3300049743 | Ga0501081_0126430 | Ga0501081_0126430_885_1442 | 157 |
| 1075 | 3300049824 | Ga0501045_0109752 | Ga0501045_0109752_1241_1798 | 157 |
| 1076 | iso_pu_bacteria | 2848297114 | 2848298527 | 157 |
| 1077 | 3300003791 | Ga0055530_10024341 | Ga0055530_100243412 | 158 |
| 1078 | 3300005290 | Ga0065712_10268430 | Ga0065712_102684301 | 158 |
| 1079 | 3300005331 | Ga0070670_100270083 | Ga0070670_1002700831 | 158 |
| 1080 | 3300005364 | Ga0070673_100597198 | Ga0070673_1005971982 | 158 |
| 1081 | 3300005543 | Ga0070672_100700283 | Ga0070672_1007002832 | 158 |
| 1082 | 3300025298 | Ga0209050_1000119 | Ga0209050_1000119111 | 158 |
| 1083 | 3300025907 | Ga0207645_10278586 | Ga0207645_102785862 | 158 |
| 1084 | 3300025940 | Ga0207691_10050359 | Ga0207691_100503593 | 158 |
| 1085 | 3300025941 | Ga0207711_10470439 | Ga0207711_104704392 | 158 |
| 1086 | 3300025986 | Ga0207658_11513617 | Ga0207658_115136171 | 158 |
| 1087 | 3300031727 | Ga0316576_10269855 | Ga0316576_102698552 | 158 |
| 1088 | 3300033528 | Ga0316588_1135970 | Ga0316588_11359701 | 158 |
| 1089 | 3300036647 | Ga0316582_0555736 | Ga0316582_0555736_180_737 | 158 |
| 1090 | 3300046475 | Ga0495639_0162507 | Ga0495639_0162507_144_701 | 158 |
| 1091 | 3300046681 | Ga0495647_0176939 | Ga0495647_0176939_124_684 | 158 |
| 1092 | 3300053118 | Ga0500594_0105277 | Ga0500594_0105277_162_719 | 158 |
| 1093 | 3300053122 | Ga0500608_007240 | Ga0500608_007240_3169_3726 | 158 |
| 1094 | 3300053136 | Ga0500559_0182535 | Ga0500559_0182535_138_695 | 158 |
| 1095 | 3300053138 | Ga0500564_002596 | Ga0500564_002596_4217_4774 | 158 |
| 1096 | 3300053140 | Ga0500573_0098653 | Ga0500573_0098653_163_720 | 158 |
| 1097 | 3300053723 | Ga0500567_058259 | Ga0500567_058259_303_860 | 158 |
| 1098 | 3300053729 | Ga0500625_000041 | Ga0500625_000041_2409_2966 | 158 |
| 1099 | iso_pu_bacteria | 2919138771 | 2919139931 | 158 |
| 1100 | 3300002067 | JGI24735J21928_10005029 | JGI24735J21928_100050293 | 159 |
| 1101 | 3300005327 | Ga0070658_10140495 | Ga0070658_101404953 | 159 |
| 1102 | 3300005327 | Ga0070658_10185935 | Ga0070658_101859353 | 159 |
| 1103 | 3300005336 | Ga0070680_100123681 | Ga0070680_1001236813 | 159 |
| 1104 | 3300005338 | Ga0068868_100367684 | Ga0068868_1003676842 | 159 |
| 1105 | 3300005344 | Ga0070661_100384462 | Ga0070661_1003844622 | 159 |
| 1106 | 3300005435 | Ga0070714_100410941 | Ga0070714_1004109412 | 159 |
| 1107 | 3300005455 | Ga0070663_100098153 | Ga0070663_1000981533 | 159 |
| 1108 | 3300005455 | Ga0070663_100168187 | Ga0070663_1001681872 | 159 |
| 1109 | 3300005530 | Ga0070679_100098963 | Ga0070679_1000989632 | 159 |
| 1110 | 3300005539 | Ga0068853_100108600 | Ga0068853_1001086004 | 159 |
| 1111 | 3300005563 | Ga0068855_100000416 | Ga0068855_10000041641 | 159 |
| 1112 | 3300005614 | Ga0068856_100088525 | Ga0068856_1000885253 | 159 |
| 1113 | 3300009093 | Ga0105240_10160871 | Ga0105240_101608714 | 159 |
| 1114 | 3300013105 | Ga0157369_10197649 | Ga0157369_101976492 | 159 |
| 1115 | 3300013105 | Ga0157369_11222477 | Ga0157369_112224772 | 159 |
| 1116 | 3300013307 | Ga0157372_11130858 | Ga0157372_111308582 | 159 |
| 1117 | 3300025904 | Ga0207647_10011032 | Ga0207647_100110322 | 159 |
| 1118 | 3300025909 | Ga0207705_10019571 | Ga0207705_100195715 | 159 |
| 1119 | 3300025909 | Ga0207705_10331411 | Ga0207705_103314112 | 159 |
| 1120 | 3300025913 | Ga0207695_10014275 | Ga0207695_100142758 | 159 |
| 1121 | 3300025917 | Ga0207660_10216079 | Ga0207660_102160792 | 159 |
| 1122 | 3300025919 | Ga0207657_10069520 | Ga0207657_100695202 | 159 |
| 1123 | 3300025920 | Ga0207649_10430301 | Ga0207649_104303011 | 159 |
| 1124 | 3300025921 | Ga0207652_10094773 | Ga0207652_100947732 | 159 |
| 1125 | 3300025924 | Ga0207694_10207136 | Ga0207694_102071362 | 159 |
| 1126 | 3300025949 | Ga0207667_10000504 | Ga0207667_100005043 | 159 |
| 1127 | 3300025981 | Ga0207640_10158005 | Ga0207640_101580052 | 159 |
| 1128 | 3300026041 | Ga0207639_11302081 | Ga0207639_113020812 | 159 |
| 1129 | 3300026067 | Ga0207678_10011844 | Ga0207678_100118444 | 159 |
| 1130 | 3300026067 | Ga0207678_10113768 | Ga0207678_101137682 | 159 |
| 1131 | 3300026078 | Ga0207702_10171250 | Ga0207702_101712503 | 159 |
| 1132 | 3300032005 | Ga0307411_10252838 | Ga0307411_102528382 | 159 |
| 1133 | 2162886007 | SwRhRL2b_contig_3476705 | SwRhRL2b_0675.00001680 | 160 |
| 1134 | 3300001904 | JGI24736J21556_1008912 | JGI24736J21556_10089122 | 160 |
| 1135 | 3300001976 | JGI24752J21851_1002825 | JGI24752J21851_10028252 | 160 |
| 1136 | 3300001979 | JGI24740J21852_10035970 | JGI24740J21852_100359702 | 160 |
| 1137 | 3300001989 | JGI24739J22299_10011607 | JGI24739J22299_100116073 | 160 |
| 1138 | 3300001990 | JGI24737J22298_10002260 | JGI24737J22298_100022605 | 160 |
| 1139 | 3300002074 | JGI24748J21848_1007217 | JGI24748J21848_10072172 | 160 |
| 1140 | 3300005262 | Ga0065165_1005594 | Ga0065165_10055942 | 160 |
| 1141 | 3300005289 | Ga0065704_10070273 | Ga0065704_1007027344 | 160 |
| 1142 | 3300005331 | Ga0070670_100067835 | Ga0070670_1000678353 | 160 |
| 1143 | 3300005331 | Ga0070670_100388569 | Ga0070670_1003885692 | 160 |
| 1144 | 3300005335 | Ga0070666_10258004 | Ga0070666_102580042 | 160 |
| 1145 | 3300005336 | Ga0070680_100000206 | Ga0070680_10000020610 | 160 |
| 1146 | 3300005347 | Ga0070668_100880158 | Ga0070668_1008801582 | 160 |
| 1147 | 3300005353 | Ga0070669_100004070 | Ga0070669_1000040707 | 160 |
| 1148 | 3300005354 | Ga0070675_100295667 | Ga0070675_1002956672 | 160 |
| 1149 | 3300005355 | Ga0070671_100034005 | Ga0070671_1000340053 | 160 |
| 1150 | 3300005355 | Ga0070671_100089835 | Ga0070671_1000898353 | 160 |
| 1151 | 3300005355 | Ga0070671_100135503 | Ga0070671_1001355032 | 160 |
| 1152 | 3300005356 | Ga0070674_100036769 | Ga0070674_1000367692 | 160 |
| 1153 | 3300005367 | Ga0070667_100002812 | Ga0070667_1000028125 | 160 |
| 1154 | 3300005367 | Ga0070667_100008633 | Ga0070667_1000086336 | 160 |
| 1155 | 3300005367 | Ga0070667_100098366 | Ga0070667_1000983662 | 160 |
| 1156 | 3300005436 | Ga0070713_100007021 | Ga0070713_1000070215 | 160 |
| 1157 | 3300005457 | Ga0070662_100092931 | Ga0070662_1000929312 | 160 |
| 1158 | 3300005471 | Ga0070698_100687524 | Ga0070698_1006875241 | 160 |
| 1159 | 3300005539 | Ga0068853_100017554 | Ga0068853_1000175547 | 160 |
| 1160 | 3300005548 | Ga0070665_100000086 | Ga0070665_100000086101 | 160 |
| 1161 | 3300005548 | Ga0070665_100009816 | Ga0070665_10000981611 | 160 |
| 1162 | 3300005548 | Ga0070665_100254763 | Ga0070665_1002547632 | 160 |
| 1163 | 3300005548 | Ga0070665_100606194 | Ga0070665_1006061942 | 160 |
| 1164 | 3300005577 | Ga0068857_100082647 | Ga0068857_1000826473 | 160 |
| 1165 | 3300005577 | Ga0068857_100986032 | Ga0068857_1009860322 | 160 |
| 1166 | 3300005578 | Ga0068854_100046064 | Ga0068854_1000460642 | 160 |
| 1167 | 3300005616 | Ga0068852_100157528 | Ga0068852_1001575283 | 160 |
| 1168 | 3300005616 | Ga0068852_100211155 | Ga0068852_1002111552 | 160 |
| 1169 | 3300005616 | Ga0068852_100526462 | Ga0068852_1005264622 | 160 |
| 1170 | 3300005616 | Ga0068852_100552106 | Ga0068852_1005521061 | 160 |
| 1171 | 3300005617 | Ga0068859_100088464 | Ga0068859_1000884642 | 160 |
| 1172 | 3300005841 | Ga0068863_100279059 | Ga0068863_1002790593 | 160 |
| 1173 | 3300005841 | Ga0068863_100661842 | Ga0068863_1006618422 | 160 |
| 1174 | 3300005843 | Ga0068860_100036705 | Ga0068860_1000367054 | 160 |
| 1175 | 3300005844 | Ga0068862_100050217 | Ga0068862_1000502174 | 160 |
| 1176 | 3300006048 | Ga0075363_100000282 | Ga0075363_1000002825 | 160 |
| 1177 | 3300006173 | Ga0070716_100420264 | Ga0070716_1004202642 | 160 |
| 1178 | 3300006195 | Ga0075366_10185062 | Ga0075366_101850622 | 160 |
| 1179 | 3300006353 | Ga0075370_10262191 | Ga0075370_102621912 | 160 |
| 1180 | 3300006353 | Ga0075370_10302140 | Ga0075370_103021402 | 160 |
| 1181 | 3300006931 | Ga0097620_100088462 | Ga0097620_1000884622 | 160 |
| 1182 | 3300009011 | Ga0105251_10202031 | Ga0105251_102020312 | 160 |
| 1183 | 3300009092 | Ga0105250_10119118 | Ga0105250_101191182 | 160 |
| 1184 | 3300009176 | Ga0105242_10473717 | Ga0105242_104737172 | 160 |
| 1185 | 3300009177 | Ga0105248_10163851 | Ga0105248_101638514 | 160 |
| 1186 | 3300013102 | Ga0157371_10020775 | Ga0157371_100207755 | 160 |
| 1187 | 3300013297 | Ga0157378_10013994 | Ga0157378_100139947 | 160 |
| 1188 | 3300013297 | Ga0157378_10081901 | Ga0157378_100819013 | 160 |
| 1189 | 3300013306 | Ga0163162_10017746 | Ga0163162_100177466 | 160 |
| 1190 | 3300013306 | Ga0163162_10207369 | Ga0163162_102073692 | 160 |
| 1191 | 3300017792 | Ga0163161_10056221 | Ga0163161_100562213 | 160 |
| 1192 | 3300025315 | Ga0207697_10216301 | Ga0207697_102163012 | 160 |
| 1193 | 3300025711 | Ga0207696_1015285 | Ga0207696_10152853 | 160 |
| 1194 | 3300025735 | Ga0207713_1003677 | Ga0207713_10036776 | 160 |
| 1195 | 3300025901 | Ga0207688_10077248 | Ga0207688_100772482 | 160 |
| 1196 | 3300025903 | Ga0207680_10071119 | Ga0207680_100711192 | 160 |
| 1197 | 3300025907 | Ga0207645_10116122 | Ga0207645_101161222 | 160 |
| 1198 | 3300025918 | Ga0207662_10109756 | Ga0207662_101097563 | 160 |
| 1199 | 3300025923 | Ga0207681_10000125 | Ga0207681_1000012514 | 160 |
| 1200 | 3300025925 | Ga0207650_10146857 | Ga0207650_101468573 | 160 |
| 1201 | 3300025925 | Ga0207650_10260460 | Ga0207650_102604602 | 160 |
| 1202 | 3300025931 | Ga0207644_10000963 | Ga0207644_1000096320 | 160 |
| 1203 | 3300025931 | Ga0207644_10303045 | Ga0207644_103030451 | 160 |
| 1204 | 3300025933 | Ga0207706_10053461 | Ga0207706_100534614 | 160 |
| 1205 | 3300025937 | Ga0207669_10004857 | Ga0207669_100048573 | 160 |
| 1206 | 3300025939 | Ga0207665_10301077 | Ga0207665_103010772 | 160 |
| 1207 | 3300025981 | Ga0207640_10044900 | Ga0207640_100449003 | 160 |
| 1208 | 3300025986 | Ga0207658_10005272 | Ga0207658_100052723 | 160 |
| 1209 | 3300025986 | Ga0207658_10043202 | Ga0207658_100432022 | 160 |
| 1210 | 3300026041 | Ga0207639_10001537 | Ga0207639_100015375 | 160 |
| 1211 | 3300026088 | Ga0207641_10536993 | Ga0207641_105369932 | 160 |
| 1212 | 3300026116 | Ga0207674_10042932 | Ga0207674_100429323 | 160 |
| 1213 | 3300026116 | Ga0207674_10574035 | Ga0207674_105740352 | 160 |
| 1214 | 3300026121 | Ga0207683_10160292 | Ga0207683_101602923 | 160 |
| 1215 | 3300026142 | Ga0207698_10132163 | Ga0207698_101321633 | 160 |
| 1216 | 3300026142 | Ga0207698_10264203 | Ga0207698_102642032 | 160 |
| 1217 | 3300026142 | Ga0207698_10286733 | Ga0207698_102867332 | 160 |
| 1218 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022459 | 160 |
| 1219 | 3300028379 | Ga0268266_10209518 | Ga0268266_102095182 | 160 |
| 1220 | 3300028379 | Ga0268266_10725514 | Ga0268266_107255142 | 160 |
| 1221 | 3300028381 | Ga0268264_10009384 | Ga0268264_100093844 | 160 |
| 1222 | 3300028577 | Ga0265318_10012857 | Ga0265318_100128572 | 160 |
| 1223 | 3300028786 | Ga0307517_10016351 | Ga0307517_100163514 | 160 |
| 1224 | 3300028786 | Ga0307517_10033670 | Ga0307517_100336704 | 160 |
| 1225 | 3300031235 | Ga0265330_10125862 | Ga0265330_101258622 | 160 |
| 1226 | 3300031238 | Ga0265332_10042857 | Ga0265332_100428572 | 160 |
| 1227 | 3300031249 | Ga0265339_10164758 | Ga0265339_101647581 | 160 |
| 1228 | 3300031250 | Ga0265331_10141666 | Ga0265331_101416661 | 160 |
| 1229 | 3300031344 | Ga0265316_10090223 | Ga0265316_100902232 | 160 |
| 1230 | 3300031456 | Ga0307513_10111590 | Ga0307513_101115901 | 160 |
| 1231 | 3300031712 | Ga0265342_10028392 | Ga0265342_100283924 | 160 |
| 1232 | 3300031731 | Ga0307405_10568266 | Ga0307405_105682661 | 160 |
| 1233 | 3300031911 | Ga0307412_10267337 | Ga0307412_102673371 | 160 |
| 1234 | 3300031911 | Ga0307412_10538666 | Ga0307412_105386662 | 160 |
| 1235 | 3300032002 | Ga0307416_101063088 | Ga0307416_1010630882 | 160 |
| 1236 | 3300032004 | Ga0307414_10488708 | Ga0307414_104887082 | 160 |
| 1237 | 3300033180 | Ga0307510_10002311 | Ga0307510_1000231125 | 160 |
| 1238 | 3300037312 | Ga0395899_0187269 | Ga0395899_0187269_160_720 | 160 |
| 1239 | 3300037418 | Ga0395900_0162022 | Ga0395900_0162022_1115_1675 | 160 |
| 1240 | 3300037466 | Ga0395898_0609773 | Ga0395898_0609773_300_860 | 160 |
| 1241 | 3300037471 | Ga0395905_0002689 | Ga0395905_0002689_3727_4287 | 160 |
| 1242 | 3300038443 | Ga0395901_0701191 | Ga0395901_0701191_376_936 | 160 |
| 1243 | 3300042116 | Ga0450912_007828 | Ga0450912_007828_75_632 | 160 |
| 1244 | 3300046452 | Ga0495617_003809 | Ga0495617_003809_4062_4619 | 160 |
| 1245 | 3300046452 | Ga0495617_034525 | Ga0495617_034525_867_1424 | 160 |
| 1246 | 3300046452 | Ga0495617_077577 | Ga0495617_077577_259_816 | 160 |
| 1247 | 3300046453 | Ga0495627_000615 | Ga0495627_000615_22314_22871 | 160 |
| 1248 | 3300046460 | Ga0495638_0000051 | Ga0495638_0000051_132912_133469 | 160 |
| 1249 | 3300046460 | Ga0495638_0177218 | Ga0495638_0177218_324_881 | 160 |
| 1250 | 3300046460 | Ga0495638_0252754 | Ga0495638_0252754_123_680 | 160 |
| 1251 | 3300046471 | Ga0495650_0000670 | Ga0495650_0000670_2337_2894 | 160 |
| 1252 | 3300046475 | Ga0495639_0054369 | Ga0495639_0054369_379_936 | 160 |
| 1253 | 3300046491 | Ga0495584_0069479 | Ga0495584_0069479_168_725 | 160 |
| 1254 | 3300046500 | Ga0495596_0001277 | Ga0495596_0001277_4559_5116 | 160 |
| 1255 | 3300046500 | Ga0495596_0010224 | Ga0495596_0010224_3038_3595 | 160 |
| 1256 | 3300046500 | Ga0495596_0028255 | Ga0495596_0028255_1465_2022 | 160 |
| 1257 | 3300046501 | Ga0495607_0120354 | Ga0495607_0120354_459_1016 | 160 |
| 1258 | 3300046501 | Ga0495607_0208425 | Ga0495607_0208425_129_686 | 160 |
| 1259 | 3300046506 | Ga0495583_0000038 | Ga0495583_0000038_240533_241093 | 160 |
| 1260 | 3300046506 | Ga0495583_0002196 | Ga0495583_0002196_6180_6737 | 160 |
| 1261 | 3300046506 | Ga0495583_0004381 | Ga0495583_0004381_1729_2286 | 160 |
| 1262 | 3300046506 | Ga0495583_0039917 | Ga0495583_0039917_824_1381 | 160 |
| 1263 | 3300046506 | Ga0495583_0061344 | Ga0495583_0061344_541_1098 | 160 |
| 1264 | 3300046506 | Ga0495583_0108756 | Ga0495583_0108756_56_613 | 160 |
| 1265 | 3300046507 | Ga0495606_0069957 | Ga0495606_0069957_312_869 | 160 |
| 1266 | 3300046512 | Ga0495610_0000280 | Ga0495610_0000280_43764_44321 | 160 |
| 1267 | 3300046512 | Ga0495610_0001450 | Ga0495610_0001450_8647_9204 | 160 |
| 1268 | 3300046513 | Ga0495616_0000040 | Ga0495616_0000040_74223_74780 | 160 |
| 1269 | 3300046513 | Ga0495616_0122665 | Ga0495616_0122665_148_705 | 160 |
| 1270 | 3300046518 | Ga0495631_0083146 | Ga0495631_0083146_786_1343 | 160 |
| 1271 | 3300046519 | Ga0495632_0008232 | Ga0495632_0008232_2256_2813 | 160 |
| 1272 | 3300046519 | Ga0495632_0012016 | Ga0495632_0012016_2796_3353 | 160 |
| 1273 | 3300046520 | Ga0495637_0024958 | Ga0495637_0024958_256_813 | 160 |
| 1274 | 3300046522 | Ga0495643_0003604 | Ga0495643_0003604_698_1255 | 160 |
| 1275 | 3300046522 | Ga0495643_0006598 | Ga0495643_0006598_2387_2944 | 160 |
| 1276 | 3300046522 | Ga0495643_0009295 | Ga0495643_0009295_5216_5773 | 160 |
| 1277 | 3300046522 | Ga0495643_0010333 | Ga0495643_0010333_1691_2248 | 160 |
| 1278 | 3300046522 | Ga0495643_0043554 | Ga0495643_0043554_858_1415 | 160 |
| 1279 | 3300046522 | Ga0495643_0158021 | Ga0495643_0158021_49_606 | 160 |
| 1280 | 3300046524 | Ga0495648_0000032 | Ga0495648_0000032_72515_73072 | 160 |
| 1281 | 3300046524 | Ga0495648_0002055 | Ga0495648_0002055_2106_2663 | 160 |
| 1282 | 3300046524 | Ga0495648_0037338 | Ga0495648_0037338_728_1285 | 160 |
| 1283 | 3300046528 | Ga0495642_0138682 | Ga0495642_0138682_220_777 | 160 |
| 1284 | 3300046538 | Ga0495609_0003753 | Ga0495609_0003753_4312_4869 | 160 |
| 1285 | 3300046557 | Ga0495622_0008547 | Ga0495622_0008547_1650_2207 | 160 |
| 1286 | 3300046558 | Ga0495633_0067542 | Ga0495633_0067542_967_1524 | 160 |
| 1287 | 3300046616 | Ga0495668_0001117 | Ga0495668_0001117_20755_21312 | 160 |
| 1288 | 3300046616 | Ga0495668_0006518 | Ga0495668_0006518_4526_5083 | 160 |
| 1289 | 3300046616 | Ga0495668_0097369 | Ga0495668_0097369_58_615 | 160 |
| 1290 | 3300046648 | Ga0495611_0021891 | Ga0495611_0021891_1061_1618 | 160 |
| 1291 | 3300046660 | Ga0495625_0007661 | Ga0495625_0007661_6294_6851 | 160 |
| 1292 | 3300046660 | Ga0495625_0010831 | Ga0495625_0010831_4920_5477 | 160 |
| 1293 | 3300046660 | Ga0495625_0038178 | Ga0495625_0038178_2042_2599 | 160 |
| 1294 | 3300046691 | Ga0495670_0093770 | Ga0495670_0093770_412_969 | 160 |
| 1295 | 3300046692 | Ga0495671_0000020 | Ga0495671_0000020_132284_132841 | 160 |
| 1296 | 3300046692 | Ga0495671_0140005 | Ga0495671_0140005_12_569 | 160 |
| 1297 | 3300046694 | Ga0495649_0143183 | Ga0495649_0143183_97_654 | 160 |
| 1298 | 3300046809 | Ga0495600_0002857 | Ga0495600_0002857_8268_8825 | 160 |
| 1299 | 3300047323 | Ga0495683_0006512 | Ga0495683_0006512_2156_2713 | 160 |
| 1300 | 3300047445 | Ga0495677_0072950 | Ga0495677_0072950_596_1153 | 160 |
| 1301 | 3300047469 | Ga0495673_0000076 | Ga0495673_0000076_72632_73189 | 160 |
| 1302 | 3300047470 | Ga0495681_0000110 | Ga0495681_0000110_48118_48675 | 160 |
| 1303 | 3300047470 | Ga0495681_0012381 | Ga0495681_0012381_2308_2865 | 160 |
| 1304 | 3300047470 | Ga0495681_0084255 | Ga0495681_0084255_52_609 | 160 |
| 1305 | 3300047472 | Ga0495686_0025735 | Ga0495686_0025735_260_817 | 160 |
| 1306 | 3300047472 | Ga0495686_0036162 | Ga0495686_0036162_80_637 | 160 |
| 1307 | 3300048091 | Ga0495626_0002997 | Ga0495626_0002997_4849_5406 | 160 |
| 1308 | 3300048903 | Ga0496100_0065575 | Ga0496100_0065575_1094_1651 | 160 |
| 1309 | 3300048904 | Ga0496101_0010381 | Ga0496101_0010381_1388_1945 | 160 |
| 1310 | 3300048905 | Ga0496102_0000106 | Ga0496102_0000106_25940_26497 | 160 |
| 1311 | 3300048905 | Ga0496102_0000452 | Ga0496102_0000452_45323_45880 | 160 |
| 1312 | 3300048905 | Ga0496102_1062306 | Ga0496102_1062306_146_703 | 160 |
| 1313 | 3300048906 | Ga0496103_0000095 | Ga0496103_0000095_77532_78089 | 160 |
| 1314 | 3300048906 | Ga0496103_0000518 | Ga0496103_0000518_2394_2951 | 160 |
| 1315 | 3300048907 | Ga0496104_0000060 | Ga0496104_0000060_62439_62996 | 160 |
| 1316 | 3300048907 | Ga0496104_0052117 | Ga0496104_0052117_631_1188 | 160 |
| 1317 | 3300048908 | Ga0496105_0000122 | Ga0496105_0000122_14621_15178 | 160 |
| 1318 | 3300048910 | Ga0496107_0253564 | Ga0496107_0253564_394_951 | 160 |
| 1319 | 3300048916 | Ga0496113_0040834 | Ga0496113_0040834_1957_2514 | 160 |
| 1320 | 3300048916 | Ga0496113_0209281 | Ga0496113_0209281_779_1336 | 160 |
| 1321 | 3300048917 | Ga0496114_0032385 | Ga0496114_0032385_2814_3371 | 160 |
| 1322 | 3300048918 | Ga0496115_0000230 | Ga0496115_0000230_5765_6322 | 160 |
| 1323 | 3300048919 | Ga0496116_0022284 | Ga0496116_0022284_231_788 | 160 |
| 1324 | 3300048919 | Ga0496116_0109884 | Ga0496116_0109884_572_1129 | 160 |
| 1325 | 3300048920 | Ga0496117_0000885 | Ga0496117_0000885_865_1422 | 160 |
| 1326 | 3300048920 | Ga0496117_0003116 | Ga0496117_0003116_15789_16346 | 160 |
| 1327 | 3300048921 | Ga0496118_0000144 | Ga0496118_0000144_121134_121691 | 160 |
| 1328 | 3300048921 | Ga0496118_0002769 | Ga0496118_0002769_11480_12037 | 160 |
| 1329 | 3300048922 | Ga0496119_0000222 | Ga0496119_0000222_53079_53636 | 160 |
| 1330 | 3300048922 | Ga0496119_0017296 | Ga0496119_0017296_627_1184 | 160 |
| 1331 | 3300048923 | Ga0496120_0001728 | Ga0496120_0001728_22723_23280 | 160 |
| 1332 | 3300048923 | Ga0496120_0184298 | Ga0496120_0184298_241_798 | 160 |
| 1333 | 3300048924 | Ga0496121_0000295 | Ga0496121_0000295_73780_74337 | 160 |
| 1334 | 3300048924 | Ga0496121_0000681 | Ga0496121_0000681_59566_60123 | 160 |
| 1335 | 3300048924 | Ga0496121_0324839 | Ga0496121_0324839_88_645 | 160 |
| 1336 | 3300048925 | Ga0496122_0018297 | Ga0496122_0018297_2231_2788 | 160 |
| 1337 | 3300048926 | Ga0496123_0081359 | Ga0496123_0081359_650_1207 | 160 |
| 1338 | 3300048926 | Ga0496123_0106643 | Ga0496123_0106643_220_777 | 160 |
| 1339 | 3300048927 | Ga0496124_0000683 | Ga0496124_0000683_2533_3090 | 160 |
| 1340 | 3300048927 | Ga0496124_0001019 | Ga0496124_0001019_11254_11811 | 160 |
| 1341 | 3300048928 | Ga0496125_0022675 | Ga0496125_0022675_2755_3312 | 160 |
| 1342 | 3300048928 | Ga0496125_0023499 | Ga0496125_0023499_5077_5634 | 160 |
| 1343 | 3300048928 | Ga0496125_0085179 | Ga0496125_0085179_517_1074 | 160 |
| 1344 | 3300048928 | Ga0496125_0180598 | Ga0496125_0180598_762_1319 | 160 |
| 1345 | 3300048929 | Ga0496126_0000294 | Ga0496126_0000294_14381_14938 | 160 |
| 1346 | 3300048929 | Ga0496126_0001756 | Ga0496126_0001756_28840_29397 | 160 |
| 1347 | 3300048929 | Ga0496126_0028161 | Ga0496126_0028161_2879_3436 | 160 |
| 1348 | 3300049459 | Ga0495678_037828 | Ga0495678_037828_1250_1807 | 160 |
| 1349 | 3300049460 | Ga0495682_0278892 | Ga0495682_0278892_20_577 | 160 |
| 1350 | 3300049572 | Ga0501036_0717434 | Ga0501036_0717434_35_592 | 160 |
| 1351 | 3300049674 | Ga0501242_019155 | Ga0501242_019155_245_808 | 160 |
| 1352 | 3300049758 | Ga0501241_003688 | Ga0501241_003688_1518_2075 | 160 |
| 1353 | 3300050493 | nmdc:mga0k408_32421_c1 | nmdc:mga0k408_32421_c1_1656_2213 | 160 |
| 1354 | 3300050496 | nmdc:mga07m45_242839_c1 | nmdc:mga07m45_242839_c1_216_773 | 160 |
| 1355 | 3300050496 | nmdc:mga07m45_318841_c1 | nmdc:mga07m45_318841_c1_273_839 | 160 |
| 1356 | 3300050516 | nmdc:mga0sz30_83042_c1 | nmdc:mga0sz30_83042_c1_507_1064 | 160 |
| 1357 | 3300053087 | Ga0500643_007503 | Ga0500643_007503_2217_2774 | 160 |
| 1358 | 3300053088 | Ga0500644_0213975 | Ga0500644_0213975_234_791 | 160 |
| 1359 | 3300053091 | Ga0500647_0049787 | Ga0500647_0049787_794_1351 | 160 |
| 1360 | 3300053119 | Ga0500595_001822 | Ga0500595_001822_8156_8713 | 160 |
| 1361 | 3300053119 | Ga0500595_037368 | Ga0500595_037368_1012_1569 | 160 |
| 1362 | 3300053121 | Ga0500607_000130 | Ga0500607_000130_2444_3001 | 160 |
| 1363 | 3300053122 | Ga0500608_140924 | Ga0500608_140924_467_1024 | 160 |
| 1364 | 3300053130 | Ga0500642_0004589 | Ga0500642_0004589_1659_2216 | 160 |
| 1365 | 3300053136 | Ga0500559_0002365 | Ga0500559_0002365_1951_2508 | 160 |
| 1366 | 3300053136 | Ga0500559_0007163 | Ga0500559_0007163_733_1290 | 160 |
| 1367 | 3300053148 | Ga0500590_058642 | Ga0500590_058642_533_1090 | 160 |
| 1368 | 3300053151 | Ga0500604_0010676 | Ga0500604_0010676_1105_1662 | 160 |
| 1369 | 3300053154 | Ga0500619_003163 | Ga0500619_003163_616_1173 | 160 |
| 1370 | 3300053156 | Ga0500622_0004558 | Ga0500622_0004558_2483_3040 | 160 |
| 1371 | 3300053157 | Ga0500624_000212 | Ga0500624_000212_20641_21198 | 160 |
| 1372 | 3300053158 | Ga0500627_0001009 | Ga0500627_0001009_2539_3096 | 160 |
| 1373 | 3300053177 | Ga0500636_0001430 | Ga0500636_0001430_2335_2892 | 160 |
| 1374 | 3300053177 | Ga0500636_0021652 | Ga0500636_0021652_1340_1903 | 160 |
| 1375 | 3300053178 | Ga0500637_0000205 | Ga0500637_0000205_778_1335 | 160 |
| 1376 | 3300053178 | Ga0500637_0003185 | Ga0500637_0003185_4560_5117 | 160 |
| 1377 | 3300053730 | Ga0500645_004991 | Ga0500645_004991_1848_2405 | 160 |
| 1378 | 3300053735 | Ga0500596_004593 | Ga0500596_004593_766_1323 | 160 |
| 1379 | 3300059508 | Ga0587088_017668 | Ga0587088_017668_91_648 | 160 |
| 1380 | 3300059630 | Ga0587128_041835 | Ga0587128_041835_79_636 | 160 |
| 1381 | 3300061734 | Ga0530510_0663459 | Ga0530510_0663459_194_757 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar