F493514

General Info

Members Datasets Scaffolds Average Seq Length
1381 499 1359 181

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10216051|Ga0070703_102160512
Length 190
Sequence MTPTPTTPLLADHVKQAKQAMDKSVDAVKREFSTVRTGKATTSLLDLVRVDAYGSEMPLNQVASVAAPEPKLLTIQPWDKGLLKAVEKAILASDLGLTPSNDGNLIRIPLPPLNEERRRELVKVVHKFAEEGRVAIRHARTEAISKVKKTEHVSEDEKKHTEKDVQKLHDDHLRQVDEAVKAKEAEIMEI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
4 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
7 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
8 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
9 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
10 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
11 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
12 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
13 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
14 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
15 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
16 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
17 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
18 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
19 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
20 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
21 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
22 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
23 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
263 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
267 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
274 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
275 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
276 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
292 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
295 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
296 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
297 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
298 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
299 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
300 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
301 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
308 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
312 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
325 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
332 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
333 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
339 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
342 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
343 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
344 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
345 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
346 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
347 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
348 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
349 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
352 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
353 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
354 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
355 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
356 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
359 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
360 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
363 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
364 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
365 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
369 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
370 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
371 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
372 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
375 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
376 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
377 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
378 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
379 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
380 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
381 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
382 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
383 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
384 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
385 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
388 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
389 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
390 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
391 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
392 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
393 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
394 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
395 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
413 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
414 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
425 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
426 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
427 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
428 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
429 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
430 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
431 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
432 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
433 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
434 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
435 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
436 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
437 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
438 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
439 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
440 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
441 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
442 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
443 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
444 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
449 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
450 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
451 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
453 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
454 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
463 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
464 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
465 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
466 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
467 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
468 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
469 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
470 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
471 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
472 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
473 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
474 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
475 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
476 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
477 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
480 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
481 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
482 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
483 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
484 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
485 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
486 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
487 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
488 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
489 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
490 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
493 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
494 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
495 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
496 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
499 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.43
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.55
Nodule 0.07
Rhizoplane 1.81
Rhizosphere 89.93
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3476705 2162886007 Bacteria 2292
2 JGI24736J21556_1008912 3300001904 Bacteria 1662
3 JGI24752J21851_1002825 3300001976 Bacteria 2307
4 JGI24740J21852_10035970 3300001979 Bacteria 1542
5 JGI24739J22299_10011607 3300001989 Bacteria 3250
6 JGI24737J22298_10002260 3300001990 Bacteria 6863
7 JGI24735J21928_10005029 3300002067 Bacteria 4401
8 JGI24748J21848_1007217 3300002074 Bacteria 1301
9 rootL2_10047888 3300003322 Bacteria 2330
10 Ga0055532_1000736 3300003758 Bacteria 11948
11 Ga0055530_10024341 3300003791 Bacteria 1718
12 Ga0058862_12766732 3300004803 Bacteria 1121
13 Ga0065165_1005594 3300005262 Bacteria 6969
14 Ga0065704_10070273 3300005289 Bacteria 42544
15 Ga0065704_10228061 3300005289 Bacteria 1052
16 Ga0065712_10268430 3300005290 Bacteria 921
17 Ga0065712_10273635 3300005290 Bacteria 910
18 Ga0065715_10208396 3300005293 Bacteria 1313
19 Ga0065707_10156161 3300005295 Bacteria 1606
20 Ga0065707_10184341 3300005295 Bacteria 1398
21 Ga0065707_10514479 3300005295 Bacteria 747
22 Ga0070658_10009041 3300005327 Bacteria 8014
23 Ga0070658_10023796 3300005327 Bacteria 4912
24 Ga0070658_10140495 3300005327 Bacteria 2017
25 Ga0070658_10185935 3300005327 Bacteria 1750
26 Ga0070676_10001338 3300005328 Bacteria 12376
27 Ga0070683_100011534 3300005329 Bacteria 7646
28 Ga0070683_100100523 3300005329 Bacteria 2722
29 Ga0070690_100590120 3300005330 Bacteria 842
30 Ga0070670_100006075 3300005331 Bacteria 10214
31 Ga0070670_100067835 3300005331 Bacteria 3060
32 Ga0070670_100270083 3300005331 Bacteria 1484
33 Ga0070670_100388569 3300005331 Bacteria 1230
34 Ga0070670_100481995 3300005331 Bacteria 1102
35 Ga0070670_100551229 3300005331 Bacteria 1029
36 Ga0070677_10003562 3300005333 Bacteria 5023
37 Ga0068869_100001046 3300005334 Bacteria 16121
38 Ga0068869_100772626 3300005334 Unclassified 824
39 Ga0070666_10091777 3300005335 Bacteria 2087
40 Ga0070666_10258004 3300005335 Bacteria 1235
41 Ga0070666_10280251 3300005335 Bacteria 1185
42 Ga0070666_10469668 3300005335 Bacteria 910
43 Ga0070680_100000206 3300005336 Bacteria 38666
44 Ga0070680_100005245 3300005336 Bacteria 9807
45 Ga0070680_100043681 3300005336 Bacteria 3640
46 Ga0070680_100055182 3300005336 Bacteria 3246
47 Ga0070680_100081380 3300005336 Bacteria 2672
48 Ga0070680_100123681 3300005336 Bacteria 2161
49 Ga0070680_100767975 3300005336 Bacteria 830
50 Ga0070680_100852438 3300005336 Bacteria 785
51 Ga0070682_101350022 3300005337 Unclassified 608
52 Ga0068868_100008151 3300005338 Bacteria 7498
53 Ga0068868_100367684 3300005338 Bacteria 1235
54 Ga0070660_100008554 3300005339 Bacteria 7166
55 Ga0070660_100015441 3300005339 Bacteria 5515
56 Ga0070660_100058949 3300005339 Bacteria 2977
57 Ga0070660_100545427 3300005339 Bacteria 967
58 Ga0070660_100862697 3300005339 Bacteria 763
59 Ga0070689_100016069 3300005340 Bacteria 5474
60 Ga0070689_100039876 3300005340 Bacteria 3597
61 Ga0070689_100306229 3300005340 Bacteria 1324
62 Ga0070691_10068913 3300005341 Bacteria 1713
63 Ga0070691_10207304 3300005341 Bacteria 1033
64 Ga0070687_100091666 3300005343 Bacteria 1682
65 Ga0070687_100145220 3300005343 Bacteria 1386
66 Ga0070661_100003226 3300005344 Bacteria 11237
67 Ga0070661_100020303 3300005344 Bacteria 4736
68 Ga0070661_100031136 3300005344 Bacteria 3857
69 Ga0070661_100110416 3300005344 Unclassified 2053
70 Ga0070661_100384462 3300005344 Bacteria 1107
71 Ga0070661_100570307 3300005344 Bacteria 912
72 Ga0070661_101342487 3300005344 Bacteria 600
73 Ga0070692_10086845 3300005345 Bacteria 1694
74 Ga0070692_10101147 3300005345 Bacteria 1580
75 Ga0070692_10161796 3300005345 Bacteria 1283
76 Ga0070692_10206604 3300005345 Bacteria 1153
77 Ga0070668_100003214 3300005347 Bacteria 12037
78 Ga0070668_100059198 3300005347 Bacteria 2965
79 Ga0070668_100880158 3300005347 Bacteria 800
80 Ga0070669_100003091 3300005353 Bacteria 11983
81 Ga0070669_100004070 3300005353 Bacteria 10585
82 Ga0070669_100005923 3300005353 Bacteria 8822
83 Ga0070669_100006591 3300005353 Bacteria 8358
84 Ga0070669_100647778 3300005353 Bacteria 888
85 Ga0070675_100010460 3300005354 Bacteria 7249
86 Ga0070675_100032603 3300005354 Bacteria 4217
87 Ga0070675_100050984 3300005354 Bacteria 3399
88 Ga0070675_100295667 3300005354 Bacteria 1426
89 Ga0070675_101329155 3300005354 Bacteria 662
90 Ga0070671_100017519 3300005355 Bacteria 5804
91 Ga0070671_100034005 3300005355 Bacteria 4219
92 Ga0070671_100089835 3300005355 Bacteria 2572
93 Ga0070671_100135503 3300005355 Bacteria 2076
94 Ga0070671_100287392 3300005355 Bacteria 1399
95 Ga0070671_100773801 3300005355 Unclassified 835
96 Ga0070674_100036769 3300005356 Bacteria 3289
97 Ga0070673_100216339 3300005364 Bacteria 1656
98 Ga0070673_100337301 3300005364 Bacteria 1335
99 Ga0070673_100597198 3300005364 Bacteria 1007
100 Ga0070673_101464189 3300005364 Bacteria 643
101 Ga0070673_101464190 3300005364 Unclassified 643
102 Ga0070688_100017268 3300005365 Bacteria 4140
103 Ga0070659_100004329 3300005366 Bacteria 10138
104 Ga0070659_100119172 3300005366 Bacteria 2136
105 Ga0070659_100143173 3300005366 Bacteria 1947
106 Ga0070659_100193879 3300005366 Bacteria 1671
107 Ga0070659_100417976 3300005366 Bacteria 1134
108 Ga0070667_100002812 3300005367 Bacteria 15011
109 Ga0070667_100008633 3300005367 Bacteria 8446
110 Ga0070667_100011180 3300005367 Bacteria 7426
111 Ga0070667_100023300 3300005367 Bacteria 5135
112 Ga0070667_100098366 3300005367 Bacteria 2525
113 Ga0070667_100165741 3300005367 Bacteria 1949
114 Ga0070703_10069069 3300005406 Bacteria 1176
115 Ga0070703_10216051 3300005406 Bacteria 761
116 Ga0070709_10002860 3300005434 Bacteria 9330
117 Ga0070709_10064529 3300005434 Bacteria 2342
118 Ga0070709_10147409 3300005434 Bacteria 1623
119 Ga0070714_100015492 3300005435 Bacteria 6131
120 Ga0070714_100028375 3300005435 Bacteria 4643
121 Ga0070714_100319241 3300005435 Bacteria 1452
122 Ga0070714_100410941 3300005435 Bacteria 1281
123 Ga0070714_100540160 3300005435 Bacteria 1115
124 Ga0070713_100007021 3300005436 Bacteria 7864
125 Ga0070713_100020561 3300005436 Bacteria 5064
126 Ga0070713_100120522 3300005436 Bacteria 2300
127 Ga0070713_100287896 3300005436 Bacteria 1509
128 Ga0070701_10011686 3300005438 Bacteria 3938
129 Ga0070701_10053321 3300005438 Bacteria 2104
130 Ga0070701_10090699 3300005438 Bacteria 1674
131 Ga0070711_100000763 3300005439 Bacteria 16750
132 Ga0070711_100043432 3300005439 Bacteria 3044
133 Ga0070711_100103221 3300005439 Bacteria 2077
134 Ga0070711_100548056 3300005439 Bacteria 959
135 Ga0070705_100004409 3300005440 Bacteria 6855
136 Ga0070705_100006184 3300005440 Bacteria 5862
137 Ga0070705_100301220 3300005440 Bacteria 1149
138 Ga0070700_100012422 3300005441 Bacteria 4752
139 Ga0070700_100130222 3300005441 Bacteria 1697
140 Ga0070694_100005166 3300005444 Bacteria 7875
141 Ga0070694_100007601 3300005444 Bacteria 6614
142 Ga0070694_100011744 3300005444 Bacteria 5428
143 Ga0070694_100039862 3300005444 Bacteria 3129
144 Ga0070694_100049828 3300005444 Bacteria 2821
145 Ga0070694_100062238 3300005444 Bacteria 2549
146 Ga0070694_100065662 3300005444 Bacteria 2487
147 Ga0070694_100093833 3300005444 Bacteria 2110
148 Ga0070694_100128137 3300005444 Bacteria 1830
149 Ga0070694_100238942 3300005444 Bacteria 1370
150 Ga0070694_100436182 3300005444 Bacteria 1032
151 Ga0070694_101052501 3300005444 Bacteria 677
152 Ga0070708_100003104 3300005445 Bacteria 12931
153 Ga0070708_100023798 3300005445 Bacteria 5212
154 Ga0070708_100045450 3300005445 Bacteria 3868
155 Ga0070708_100263627 3300005445 Bacteria 1620
156 Ga0070708_100603490 3300005445 Bacteria 1035
157 Ga0070663_100098153 3300005455 Bacteria 2182
158 Ga0070663_100168187 3300005455 Bacteria 1692
159 Ga0070678_100119539 3300005456 Bacteria 2075
160 Ga0070662_100000491 3300005457 Bacteria 23522
161 Ga0070662_100079964 3300005457 Bacteria 2432
162 Ga0070662_100092931 3300005457 Bacteria 2268
163 Ga0070662_100478267 3300005457 Unclassified 1037
164 Ga0070662_100583617 3300005457 Bacteria 939
165 Ga0070681_10001510 3300005458 Bacteria 20612
166 Ga0070681_10001743 3300005458 Bacteria 19490
167 Ga0070681_10015442 3300005458 Bacteria 7603
168 Ga0070681_10100356 3300005458 Bacteria 2840
169 Ga0070681_10211006 3300005458 Bacteria 1858
170 Ga0068867_100101141 3300005459 Bacteria 2202
171 Ga0068867_100145152 3300005459 Bacteria 1859
172 Ga0068867_100170171 3300005459 Bacteria 1725
173 Ga0070685_10022699 3300005466 Bacteria 3425
174 Ga0070685_10197847 3300005466 Bacteria 1304
175 Ga0070706_100004050 3300005467 Bacteria 14237
176 Ga0070706_100009104 3300005467 Bacteria 9247
177 Ga0070706_100019882 3300005467 Bacteria 6191
178 Ga0070706_100025904 3300005467 Bacteria 5397
179 Ga0070706_100175207 3300005467 Bacteria 2003
180 Ga0070706_100324018 3300005467 Bacteria 1437
181 Ga0070706_100438411 3300005467 Bacteria 1216
182 Ga0070706_100498172 3300005467 Bacteria 1133
183 Ga0070707_100009027 3300005468 Bacteria 9247
184 Ga0070707_100013395 3300005468 Bacteria 7669
185 Ga0070707_100204293 3300005468 Bacteria 1926
186 Ga0070707_100967413 3300005468 Bacteria 816
187 Ga0070707_101139567 3300005468 Bacteria 746
188 Ga0070698_100002188 3300005471 Bacteria 21703
189 Ga0070698_100005453 3300005471 Bacteria 13895
190 Ga0070698_100022556 3300005471 Bacteria 6584
191 Ga0070698_100039839 3300005471 Bacteria 4833
192 Ga0070698_100040069 3300005471 Bacteria 4817
193 Ga0070698_100090936 3300005471 Bacteria 3035
194 Ga0070698_100115485 3300005471 Bacteria 2649
195 Ga0070698_100226699 3300005471 Bacteria 1802
196 Ga0070698_100687524 3300005471 Bacteria 965
197 Ga0070698_101145347 3300005471 Bacteria 727
198 Ga0070699_100003425 3300005518 Bacteria 14037
199 Ga0070699_100003978 3300005518 Bacteria 13060
200 Ga0070699_100018956 3300005518 Bacteria 5918
201 Ga0070699_100021866 3300005518 Bacteria 5513
202 Ga0070699_100034681 3300005518 Bacteria 4361
203 Ga0070699_100047467 3300005518 Bacteria 3716
204 Ga0070699_100049321 3300005518 Bacteria 3644
205 Ga0070699_100088760 3300005518 Bacteria 2701
206 Ga0070699_100855094 3300005518 Bacteria 833
207 Ga0070679_100011678 3300005530 Bacteria 8373
208 Ga0070679_100012367 3300005530 Bacteria 8154
209 Ga0070679_100036557 3300005530 Bacteria 4873
210 Ga0070679_100098963 3300005530 Bacteria 2904
211 Ga0070679_100153483 3300005530 Bacteria 2279
212 Ga0070679_100599943 3300005530 Bacteria 1044
213 Ga0070679_101080389 3300005530 Bacteria 747
214 Ga0070684_100001201 3300005535 Bacteria 18615
215 Ga0070684_100009791 3300005535 Bacteria 7568
216 Ga0070684_100124039 3300005535 Bacteria 2325
217 Ga0070684_100145302 3300005535 Bacteria 2146
218 Ga0070684_100273265 3300005535 Bacteria 1547
219 Ga0070697_100003808 3300005536 Bacteria 11589
220 Ga0070697_100021503 3300005536 Bacteria 5111
221 Ga0070697_100043195 3300005536 Bacteria 3648
222 Ga0070697_100048947 3300005536 Bacteria 3428
223 Ga0070697_100062375 3300005536 Bacteria 3042
224 Ga0070697_100140942 3300005536 Bacteria 2028
225 Ga0070697_100191978 3300005536 Bacteria 1734
226 Ga0070697_100259172 3300005536 Bacteria 1488
227 Ga0068853_100017554 3300005539 Bacteria 5906
228 Ga0068853_100025797 3300005539 Bacteria 4933
229 Ga0068853_100070909 3300005539 Bacteria 3034
230 Ga0068853_100108600 3300005539 Bacteria 2462
231 Ga0070672_100004511 3300005543 Bacteria 9115
232 Ga0070672_100007978 3300005543 Bacteria 7234
233 Ga0070672_100125948 3300005543 Bacteria 2101
234 Ga0070672_100161078 3300005543 Bacteria 1862
235 Ga0070672_100350923 3300005543 Bacteria 1257
236 Ga0070672_100700283 3300005543 Bacteria 887
237 Ga0070686_100000114 3300005544 Bacteria 56363
238 Ga0070686_100088111 3300005544 Bacteria 2071
239 Ga0070686_100104594 3300005544 Bacteria 1918
240 Ga0070695_100000766 3300005545 Bacteria 17268
241 Ga0070695_100022573 3300005545 Bacteria 3860
242 Ga0070695_100027500 3300005545 Bacteria 3523
243 Ga0070695_100080454 3300005545 Bacteria 2153
244 Ga0070695_100116107 3300005545 Bacteria 1824
245 Ga0070695_100388602 3300005545 Bacteria 1055
246 Ga0070696_100000557 3300005546 Bacteria 23676
247 Ga0070696_100002916 3300005546 Bacteria 11368
248 Ga0070696_100028934 3300005546 Bacteria 3783
249 Ga0070696_100033862 3300005546 Bacteria 3512
250 Ga0070696_100053328 3300005546 Bacteria 2815
251 Ga0070696_100096352 3300005546 Bacteria 2114
252 Ga0070696_100133051 3300005546 Bacteria 1811
253 Ga0070693_100039499 3300005547 Bacteria 2644
254 Ga0070693_100049802 3300005547 Bacteria 2392
255 Ga0070665_100000086 3300005548 Bacteria 178229
256 Ga0070665_100009816 3300005548 Bacteria 9676
257 Ga0070665_100074227 3300005548 Bacteria 3407
258 Ga0070665_100254763 3300005548 Bacteria 1756
259 Ga0070665_100606194 3300005548 Bacteria 1108
260 Ga0070665_100720029 3300005548 Bacteria 1011
261 Ga0070665_101096035 3300005548 Bacteria 808
262 Ga0070704_100002995 3300005549 Bacteria 9604
263 Ga0070704_100003240 3300005549 Bacteria 9300
264 Ga0070704_100004453 3300005549 Bacteria 8090
265 Ga0070704_100007933 3300005549 Bacteria 6336
266 Ga0070704_100008264 3300005549 Bacteria 6231
267 Ga0070704_100049260 3300005549 Bacteria 2954
268 Ga0070704_100153674 3300005549 Bacteria 1812
269 Ga0070704_100171632 3300005549 Bacteria 1725
270 Ga0068855_100000416 3300005563 Bacteria 52868
271 Ga0068855_100397026 3300005563 Bacteria 1512
272 Ga0068855_100563239 3300005563 Bacteria 1232
273 Ga0068855_100605530 3300005563 Bacteria 1181
274 Ga0068855_101414225 3300005563 Unclassified 716
275 Ga0070664_100071838 3300005564 Bacteria 2966
276 Ga0070664_100094454 3300005564 Bacteria 2593
277 Ga0068857_100082647 3300005577 Bacteria 2869
278 Ga0068857_100163670 3300005577 Bacteria 2019
279 Ga0068857_100766560 3300005577 Bacteria 920
280 Ga0068857_100986032 3300005577 Bacteria 811
281 Ga0068854_100042976 3300005578 Bacteria 3201
282 Ga0068854_100046064 3300005578 Bacteria 3104
283 Ga0068854_100065299 3300005578 Bacteria 2646
284 Ga0068856_100088525 3300005614 Bacteria 3079
285 Ga0068856_100196671 3300005614 Bacteria 2030
286 Ga0068856_100477274 3300005614 Bacteria 1268
287 Ga0070702_100005374 3300005615 Bacteria 5956
288 Ga0070702_100132907 3300005615 Bacteria 1574
289 Ga0070702_100223738 3300005615 Bacteria 1260
290 Ga0068852_100006969 3300005616 Bacteria 8223
291 Ga0068852_100055216 3300005616 Bacteria 3427
292 Ga0068852_100157528 3300005616 Bacteria 2117
293 Ga0068852_100211155 3300005616 Bacteria 1841
294 Ga0068852_100526462 3300005616 Bacteria 1180
295 Ga0068852_100552106 3300005616 Bacteria 1152
296 Ga0068852_100663718 3300005616 Bacteria 1051
297 Ga0068859_100011685 3300005617 Bacteria 8823
298 Ga0068859_100015946 3300005617 Bacteria 7554
299 Ga0068859_100084497 3300005617 Bacteria 3219
300 Ga0068859_100088464 3300005617 Bacteria 3147
301 Ga0068859_100235657 3300005617 Bacteria 1919
302 Ga0068859_100424737 3300005617 Bacteria 1425
303 Ga0068866_10024774 3300005718 Bacteria 2813
304 Ga0068861_100001489 3300005719 Bacteria 14868
305 Ga0068861_100265654 3300005719 Bacteria 1471
306 Ga0068861_100292686 3300005719 Bacteria 1407
307 Ga0068861_100609738 3300005719 Bacteria 1003
308 Ga0068851_10005001 3300005834 Bacteria 6005
309 Ga0068870_10109191 3300005840 Bacteria 1577
310 Ga0068863_100014025 3300005841 Bacteria 7720
311 Ga0068863_100279059 3300005841 Bacteria 1619
312 Ga0068863_100538760 3300005841 Bacteria 1152
313 Ga0068863_100661842 3300005841 Bacteria 1036
314 Ga0068858_100028680 3300005842 Bacteria 5169
315 Ga0068860_100036705 3300005843 Bacteria 4693
316 Ga0068860_100196845 3300005843 Bacteria 1952
317 Ga0068860_100239531 3300005843 Bacteria 1764
318 Ga0068862_100000174 3300005844 Bacteria 71565
319 Ga0068862_100050217 3300005844 Bacteria 3564
320 Ga0068862_100050715 3300005844 Bacteria 3547
321 Ga0068862_100059030 3300005844 Bacteria 3293
322 Ga0068862_100080212 3300005844 Bacteria 2830
323 Ga0068862_100336604 3300005844 Bacteria 1397
324 Ga0068862_100768156 3300005844 Bacteria 939
325 Ga0081539_10144261 3300005985 Bacteria 1153
326 Ga0070717_10148234 3300006028 Bacteria 2028
327 Ga0070717_10467355 3300006028 Bacteria 1138
328 Ga0070717_10566197 3300006028 Bacteria 1029
329 Ga0075363_100000282 3300006048 Bacteria 14734
330 Ga0075432_10168757 3300006058 Bacteria 850
331 Ga0070715_10430265 3300006163 Bacteria 740
332 Ga0070716_100036528 3300006173 Bacteria 2709
333 Ga0070716_100111920 3300006173 Bacteria 1693
334 Ga0070716_100420264 3300006173 Bacteria 966
335 Ga0070712_100019259 3300006175 Bacteria 4448
336 Ga0070712_100027361 3300006175 Bacteria 3808
337 Ga0070712_100028546 3300006175 Bacteria 3733
338 Ga0075367_10509878 3300006178 Unclassified 763
339 Ga0075366_10154093 3300006195 Bacteria 1392
340 Ga0075366_10185062 3300006195 Bacteria 1265
341 Ga0097621_100064685 3300006237 Bacteria 3008
342 Ga0075370_10262191 3300006353 Bacteria 1025
343 Ga0075370_10302140 3300006353 Bacteria 952
344 Ga0068871_100599514 3300006358 Bacteria 1002
345 Ga0075428_100004397 3300006844 Bacteria 15561
346 Ga0075428_100017502 3300006844 Bacteria 7917
347 Ga0075428_100046020 3300006844 Bacteria 4794
348 Ga0075428_100065223 3300006844 Bacteria 3987
349 Ga0075428_100272896 3300006844 Bacteria 1820
350 Ga0075428_100454033 3300006844 Bacteria 1373
351 Ga0075430_100001742 3300006846 Bacteria 17777
352 Ga0075430_100009716 3300006846 Bacteria 8129
353 Ga0075430_100045232 3300006846 Bacteria 3719
354 Ga0075430_100054291 3300006846 Bacteria 3371
355 Ga0075430_100095435 3300006846 Bacteria 2485
356 Ga0075430_100334933 3300006846 Bacteria 1250
357 Ga0075430_100349267 3300006846 Bacteria 1222
358 Ga0075430_100447415 3300006846 Bacteria 1066
359 Ga0075430_100652849 3300006846 Bacteria 867
360 Ga0075431_100011703 3300006847 Bacteria 8851
361 Ga0075431_100023932 3300006847 Bacteria 6252
362 Ga0075431_100157152 3300006847 Bacteria 2339
363 Ga0075431_100172718 3300006847 Bacteria 2221
364 Ga0075431_100392137 3300006847 Bacteria 1391
365 Ga0075431_100465403 3300006847 Bacteria 1259
366 Ga0075431_100581859 3300006847 Bacteria 1105
367 Ga0075431_100670104 3300006847 Bacteria 1017
368 Ga0075433_10002006 3300006852 Bacteria 15334
369 Ga0075433_10019290 3300006852 Bacteria 5680
370 Ga0075433_10084032 3300006852 Bacteria 2810
371 Ga0075433_10096250 3300006852 Bacteria 2620
372 Ga0075433_10102622 3300006852 Bacteria 2533
373 Ga0075433_10107444 3300006852 Bacteria 2474
374 Ga0075433_10235052 3300006852 Bacteria 1627
375 Ga0075433_10249971 3300006852 Bacteria 1573
376 Ga0075433_10279999 3300006852 Bacteria 1477
377 Ga0075433_10320685 3300006852 Bacteria 1371
378 Ga0075434_100001715 3300006871 Bacteria 18779
379 Ga0075434_100009189 3300006871 Bacteria 9212
380 Ga0075434_100015325 3300006871 Bacteria 7347
381 Ga0075434_100025733 3300006871 Bacteria 5760
382 Ga0075434_100045126 3300006871 Bacteria 4372
383 Ga0075434_100047773 3300006871 Bacteria 4246
384 Ga0075434_100059833 3300006871 Bacteria 3788
385 Ga0075434_100122155 3300006871 Bacteria 2620
386 Ga0075434_100156563 3300006871 Bacteria 2297
387 Ga0075434_100170357 3300006871 Bacteria 2197
388 Ga0075434_100209120 3300006871 Bacteria 1971
389 Ga0075434_100522052 3300006871 Bacteria 1208
390 Ga0075434_100570052 3300006871 Bacteria 1151
391 Ga0075429_100006449 3300006880 Bacteria 10159
392 Ga0075429_100010632 3300006880 Bacteria 7962
393 Ga0075429_100085461 3300006880 Bacteria 2750
394 Ga0075429_100112884 3300006880 Bacteria 2375
395 Ga0075429_100205912 3300006880 Bacteria 1724
396 Ga0068865_100004706 3300006881 Bacteria 8247
397 Ga0075436_100003907 3300006914 Bacteria 10211
398 Ga0075436_100006600 3300006914 Bacteria 7950
399 Ga0075436_100015422 3300006914 Bacteria 5232
400 Ga0075436_100034721 3300006914 Bacteria 3478
401 Ga0075436_100145059 3300006914 Bacteria 1669
402 Ga0075436_100159040 3300006914 Unclassified 1592
403 Ga0075436_100182347 3300006914 Bacteria 1484
404 Ga0075436_100360317 3300006914 Bacteria 1049
405 Ga0075436_100507516 3300006914 Bacteria 882
406 Ga0097620_100011685 3300006931 Bacteria 8823
407 Ga0097620_100015946 3300006931 Bacteria 7554
408 Ga0097620_100084495 3300006931 Bacteria 3219
409 Ga0097620_100088462 3300006931 Bacteria 3147
410 Ga0097620_100235656 3300006931 Bacteria 1919
411 Ga0097620_100424727 3300006931 Bacteria 1425
412 Ga0075435_100005046 3300007076 Bacteria 9170
413 Ga0075435_100013658 3300007076 Bacteria 6050
414 Ga0075435_100090136 3300007076 Bacteria 2529
415 Ga0075435_100114637 3300007076 Bacteria 2243
416 Ga0075435_100272701 3300007076 Bacteria 1443
417 Ga0075435_100283510 3300007076 Bacteria 1414
418 Ga0075435_100592094 3300007076 Bacteria 961
419 Ga0075435_101069852 3300007076 Bacteria 705
420 Ga0099794_10000062 3300007265 Bacteria 41045
421 Ga0099794_10247155 3300007265 Bacteria 920
422 Ga0099794_10286798 3300007265 Bacteria 852
423 Ga0105251_10202031 3300009011 Bacteria 895
424 Ga0105250_10119118 3300009092 Bacteria 1084
425 Ga0105240_10000096 3300009093 Bacteria 179543
426 Ga0105240_10003506 3300009093 Bacteria 24336
427 Ga0105240_10031807 3300009093 Bacteria 6836
428 Ga0105240_10084049 3300009093 Bacteria 3904
429 Ga0105240_10160871 3300009093 Bacteria 2667
430 Ga0105240_10170312 3300009093 Bacteria 2580
431 Ga0105240_10598589 3300009093 Bacteria 1214
432 Ga0111539_10149686 3300009094 Bacteria 2732
433 Ga0111539_10633362 3300009094 Bacteria 1245
434 Ga0111539_11167040 3300009094 Bacteria 895
435 Ga0105245_10080445 3300009098 Bacteria 2977
436 Ga0105245_10602813 3300009098 Bacteria 1125
437 Ga0105245_11456042 3300009098 Bacteria 735
438 Ga0114129_10038312 3300009147 Bacteria 6763
439 Ga0114129_10241792 3300009147 Bacteria 2426
440 Ga0114129_10334606 3300009147 Bacteria 2009
441 Ga0114129_10424428 3300009147 Bacteria 1748
442 Ga0114129_11270524 3300009147 Bacteria 914
443 Ga0114129_11727715 3300009147 Bacteria 763
444 Ga0105243_10258773 3300009148 Bacteria 1557
445 Ga0105241_10009703 3300009174 Bacteria 7074
446 Ga0105241_10247520 3300009174 Bacteria 1510
447 Ga0105242_10048006 3300009176 Bacteria 3468
448 Ga0105242_10473717 3300009176 Bacteria 1185
449 Ga0105242_11197584 3300009176 Bacteria 779
450 Ga0105248_10015120 3300009177 Bacteria 8500
451 Ga0105248_10163851 3300009177 Bacteria 2507
452 Ga0105248_10167669 3300009177 Bacteria 2475
453 Ga0105238_10000271 3300009551 Bacteria 58086
454 Ga0105238_10467858 3300009551 Bacteria 1259
455 Ga0105249_10000202 3300009553 Bacteria 68134
456 Ga0105249_10001114 3300009553 Bacteria 23884
457 Ga0105249_10104817 3300009553 Bacteria 2665
458 Ga0105249_10805792 3300009553 Bacteria 1003
459 Ga0105239_10058708 3300010375 Bacteria 4222
460 Ga0157373_10002032 3300013100 Bacteria 15326
461 Ga0157373_10059108 3300013100 Bacteria 2717
462 Ga0157373_10503986 3300013100 Bacteria 875
463 Ga0157371_10020775 3300013102 Bacteria 4830
464 Ga0157371_10022797 3300013102 Bacteria 4580
465 Ga0157371_10024497 3300013102 Bacteria 4406
466 Ga0157371_10028167 3300013102 Bacteria 4070
467 Ga0157371_10726890 3300013102 Bacteria 744
468 Ga0157371_10853337 3300013102 Bacteria 688
469 Ga0157370_10001252 3300013104 Bacteria 31705
470 Ga0157370_10027603 3300013104 Bacteria 5597
471 Ga0157370_10037747 3300013104 Bacteria 4679
472 Ga0157370_10057063 3300013104 Bacteria 3715
473 Ga0157370_10447669 3300013104 Bacteria 1187
474 Ga0157370_10693496 3300013104 Bacteria 930
475 Ga0157370_11018516 3300013104 Bacteria 749
476 Ga0157369_10020822 3300013105 Bacteria 7330
477 Ga0157369_10027155 3300013105 Bacteria 6347
478 Ga0157369_10196094 3300013105 Bacteria 2121
479 Ga0157369_10197649 3300013105 Bacteria 2111
480 Ga0157369_10216120 3300013105 Bacteria 2008
481 Ga0157369_10497639 3300013105 Bacteria 1261
482 Ga0157369_11222477 3300013105 Bacteria 767
483 Ga0157374_10190375 3300013296 Bacteria 2007
484 Ga0157374_10242300 3300013296 Bacteria 1773
485 Ga0157374_10446678 3300013296 Bacteria 1294
486 Ga0157378_10009314 3300013297 Bacteria 8553
487 Ga0157378_10013994 3300013297 Bacteria 7022
488 Ga0157378_10081901 3300013297 Bacteria 2918
489 Ga0157378_10168495 3300013297 Bacteria 2052
490 Ga0157378_11514332 3300013297 Bacteria 715
491 Ga0163162_10001006 3300013306 Bacteria 26204
492 Ga0163162_10017746 3300013306 Bacteria 6963
493 Ga0163162_10172950 3300013306 Bacteria 2284
494 Ga0163162_10207369 3300013306 Bacteria 2089
495 Ga0157372_10005157 3300013307 Bacteria 13888
496 Ga0157372_10017987 3300013307 Bacteria 7595
497 Ga0157372_10021493 3300013307 Bacteria 6972
498 Ga0157372_10022214 3300013307 Bacteria 6863
499 Ga0157372_10029768 3300013307 Bacteria 5967
500 Ga0157372_10031639 3300013307 Bacteria 5793
501 Ga0157372_10074672 3300013307 Bacteria 3824
502 Ga0157372_10091516 3300013307 Bacteria 3459
503 Ga0157372_10133341 3300013307 Bacteria 2860
504 Ga0157372_10934055 3300013307 Bacteria 1006
505 Ga0157372_11130858 3300013307 Bacteria 906
506 Ga0157372_11705928 3300013307 Bacteria 725
507 Ga0157375_10001559 3300013308 Bacteria 19743
508 Ga0157375_10015258 3300013308 Bacteria 6875
509 Ga0157375_10088154 3300013308 Bacteria 3157
510 Ga0157375_10163344 3300013308 Bacteria 2370
511 Ga0157375_11467913 3300013308 Bacteria 804
512 Ga0163163_10010270 3300014325 Bacteria 8413
513 Ga0157380_10293396 3300014326 Bacteria 1494
514 Ga0157380_10692446 3300014326 Bacteria 1023
515 Ga0182008_10119759 3300014497 Bacteria 1308
516 Ga0157377_10009821 3300014745 Bacteria 4714
517 Ga0157377_10010160 3300014745 Bacteria 4646
518 Ga0157377_10118108 3300014745 Bacteria 1603
519 Ga0157379_10003141 3300014968 Bacteria 13974
520 Ga0182007_10023256 3300015262 Bacteria 2180
521 Ga0163161_10056221 3300017792 Bacteria 2858
522 Ga0163161_10266881 3300017792 Bacteria 1338
523 Ga0163161_10356819 3300017792 Bacteria 1163
524 Ga0206353_11560936 3300020082 Bacteria 1130
525 Ga0213876_10199902 3300021384 Unclassified 1062
526 Ga0213876_10200344 3300021384 Bacteria 1061
527 Ga0209147_100053 3300025229 Bacteria 267615
528 Ga0209050_1000119 3300025298 Bacteria 200661
529 Ga0207697_10006428 3300025315 Bacteria 5322
530 Ga0207697_10216301 3300025315 Bacteria 845
531 Ga0207656_10025908 3300025321 Bacteria 2386
532 Ga0207696_1015285 3300025711 Bacteria 2606
533 Ga0207713_1003677 3300025735 Bacteria 10316
534 Ga0207653_10000258 3300025885 Bacteria 33505
535 Ga0207653_10003351 3300025885 Bacteria 5056
536 Ga0207653_10093059 3300025885 Bacteria 1058
537 Ga0207682_10005680 3300025893 Bacteria 5063
538 Ga0207642_10062229 3300025899 Bacteria 1739
539 Ga0207688_10017583 3300025901 Bacteria 3888
540 Ga0207688_10077248 3300025901 Bacteria 1897
541 Ga0207680_10071119 3300025903 Bacteria 2156
542 Ga0207680_10273093 3300025903 Bacteria 1173
543 Ga0207680_10354407 3300025903 Bacteria 1031
544 Ga0207680_10744120 3300025903 Bacteria 703
545 Ga0207647_10011032 3300025904 Bacteria 6355
546 Ga0207647_10089925 3300025904 Bacteria 1832
547 Ga0207647_10195785 3300025904 Bacteria 1170
548 Ga0207647_10278603 3300025904 Bacteria 955
549 Ga0207699_10004506 3300025906 Bacteria 6656
550 Ga0207699_10113348 3300025906 Bacteria 1742
551 Ga0207699_10141848 3300025906 Bacteria 1580
552 Ga0207645_10000267 3300025907 Bacteria 43141
553 Ga0207645_10099225 3300025907 Bacteria 1878
554 Ga0207645_10116122 3300025907 Bacteria 1735
555 Ga0207645_10278586 3300025907 Bacteria 1110
556 Ga0207643_10032681 3300025908 Bacteria 2907
557 Ga0207643_10040135 3300025908 Bacteria 2634
558 Ga0207705_10019571 3300025909 Bacteria 4839
559 Ga0207705_10021651 3300025909 Bacteria 4587
560 Ga0207705_10090304 3300025909 Bacteria 2242
561 Ga0207705_10191650 3300025909 Bacteria 1546
562 Ga0207705_10331411 3300025909 Bacteria 1171
563 Ga0207705_10455854 3300025909 Bacteria 992
564 Ga0207684_10012758 3300025910 Bacteria 7288
565 Ga0207684_10025200 3300025910 Bacteria 5069
566 Ga0207684_10138245 3300025910 Bacteria 2093
567 Ga0207684_10180151 3300025910 Bacteria 1822
568 Ga0207684_10265564 3300025910 Bacteria 1481
569 Ga0207654_10019437 3300025911 Bacteria 3585
570 Ga0207707_10000375 3300025912 Bacteria 46714
571 Ga0207707_10009397 3300025912 Bacteria 8482
572 Ga0207707_10011934 3300025912 Bacteria 7559
573 Ga0207707_10015521 3300025912 Bacteria 6635
574 Ga0207707_10190165 3300025912 Bacteria 1791
575 Ga0207695_10000836 3300025913 Bacteria 56759
576 Ga0207695_10001648 3300025913 Bacteria 35974
577 Ga0207695_10014275 3300025913 Bacteria 9420
578 Ga0207695_10024557 3300025913 Bacteria 6775
579 Ga0207695_10094850 3300025913 Bacteria 2990
580 Ga0207695_10277877 3300025913 Bacteria 1569
581 Ga0207693_10011202 3300025915 Bacteria 7257
582 Ga0207693_10029290 3300025915 Bacteria 4350
583 Ga0207663_10000529 3300025916 Bacteria 16741
584 Ga0207663_10226994 3300025916 Bacteria 1362
585 Ga0207663_10394237 3300025916 Bacteria 1057
586 Ga0207660_10001140 3300025917 Bacteria 17723
587 Ga0207660_10007084 3300025917 Bacteria 7262
588 Ga0207660_10053829 3300025917 Bacteria 2870
589 Ga0207660_10082765 3300025917 Bacteria 2362
590 Ga0207660_10083349 3300025917 Bacteria 2354
591 Ga0207660_10216079 3300025917 Bacteria 1503
592 Ga0207660_10495624 3300025917 Bacteria 991
593 Ga0207662_10002655 3300025918 Bacteria 9021
594 Ga0207662_10072737 3300025918 Bacteria 2084
595 Ga0207662_10088607 3300025918 Bacteria 1900
596 Ga0207662_10109756 3300025918 Bacteria 1719
597 Ga0207662_10382781 3300025918 Bacteria 951
598 Ga0207657_10017502 3300025919 Bacteria 6868
599 Ga0207657_10036203 3300025919 Bacteria 4419
600 Ga0207657_10069520 3300025919 Bacteria 2987
601 Ga0207657_10209574 3300025919 Bacteria 1564
602 Ga0207657_10295898 3300025919 Bacteria 1283
603 Ga0207649_10002039 3300025920 Bacteria 11487
604 Ga0207649_10018576 3300025920 Bacteria 3957
605 Ga0207649_10024692 3300025920 Bacteria 3497
606 Ga0207649_10050746 3300025920 Bacteria 2567
607 Ga0207649_10430301 3300025920 Bacteria 993
608 Ga0207649_10589554 3300025920 Bacteria 854
609 Ga0207652_10000654 3300025921 Bacteria 34071
610 Ga0207652_10014383 3300025921 Bacteria 6411
611 Ga0207652_10024992 3300025921 Bacteria 4961
612 Ga0207652_10053269 3300025921 Bacteria 3475
613 Ga0207652_10094773 3300025921 Bacteria 2629
614 Ga0207652_10646304 3300025921 Bacteria 946
615 Ga0207646_10003953 3300025922 Bacteria 16440
616 Ga0207646_10015549 3300025922 Bacteria 7184
617 Ga0207646_10041894 3300025922 Bacteria 4114
618 Ga0207646_10090461 3300025922 Bacteria 2740
619 Ga0207646_10320785 3300025922 Bacteria 1400
620 Ga0207646_10349292 3300025922 Bacteria 1336
621 Ga0207646_10664212 3300025922 Bacteria 933
622 Ga0207681_10000125 3300025923 Bacteria 62866
623 Ga0207681_10000517 3300025923 Bacteria 26784
624 Ga0207681_10001950 3300025923 Bacteria 13243
625 Ga0207681_10012624 3300025923 Bacteria 5215
626 Ga0207681_10023961 3300025923 Bacteria 3911
627 Ga0207681_10025964 3300025923 Bacteria 3774
628 Ga0207694_10000007 3300025924 Bacteria 595422
629 Ga0207694_10137033 3300025924 Bacteria 1967
630 Ga0207694_10207136 3300025924 Bacteria 1597
631 Ga0207650_10004192 3300025925 Bacteria 9851
632 Ga0207650_10012785 3300025925 Bacteria 5800
633 Ga0207650_10146857 3300025925 Bacteria 1858
634 Ga0207650_10170586 3300025925 Bacteria 1729
635 Ga0207650_10260460 3300025925 Bacteria 1407
636 Ga0207659_10007491 3300025926 Bacteria 6716
637 Ga0207659_10010032 3300025926 Bacteria 5933
638 Ga0207659_10249185 3300025926 Bacteria 1440
639 Ga0207659_10264237 3300025926 Bacteria 1401
640 Ga0207659_10638810 3300025926 Bacteria 909
641 Ga0207700_10015427 3300025928 Bacteria 5041
642 Ga0207700_10017835 3300025928 Bacteria 4751
643 Ga0207700_10185280 3300025928 Bacteria 1746
644 Ga0207700_10456489 3300025928 Bacteria 1127
645 Ga0207664_10004982 3300025929 Bacteria 9030
646 Ga0207664_10030378 3300025929 Bacteria 4126
647 Ga0207664_10554073 3300025929 Bacteria 1032
648 Ga0207644_10000963 3300025931 Bacteria 18367
649 Ga0207644_10217026 3300025931 Bacteria 1514
650 Ga0207644_10303045 3300025931 Bacteria 1288
651 Ga0207644_10461967 3300025931 Bacteria 1044
652 Ga0207644_10686546 3300025931 Bacteria 853
653 Ga0207690_10013028 3300025932 Bacteria 4987
654 Ga0207690_10039887 3300025932 Bacteria 3066
655 Ga0207690_10122555 3300025932 Bacteria 1891
656 Ga0207690_10200131 3300025932 Bacteria 1516
657 Ga0207706_10001815 3300025933 Bacteria 20961
658 Ga0207706_10009804 3300025933 Bacteria 8789
659 Ga0207706_10053461 3300025933 Bacteria 3565
660 Ga0207686_10170536 3300025934 Bacteria 1534
661 Ga0207686_10972708 3300025934 Unclassified 688
662 Ga0207670_10005395 3300025936 Bacteria 7014
663 Ga0207670_10052770 3300025936 Bacteria 2735
664 Ga0207669_10004857 3300025937 Bacteria 5967
665 Ga0207669_10118463 3300025937 Bacteria 1792
666 Ga0207669_10267180 3300025937 Bacteria 1283
667 Ga0207704_10023799 3300025938 Bacteria 3308
668 Ga0207704_10295297 3300025938 Bacteria 1239
669 Ga0207665_10002787 3300025939 Bacteria 11713
670 Ga0207665_10020492 3300025939 Bacteria 4345
671 Ga0207665_10179007 3300025939 Bacteria 1535
672 Ga0207665_10301077 3300025939 Bacteria 1198
673 Ga0207691_10000124 3300025940 Bacteria 69879
674 Ga0207691_10002376 3300025940 Bacteria 18427
675 Ga0207691_10024319 3300025940 Bacteria 5696
676 Ga0207691_10029402 3300025940 Bacteria 5140
677 Ga0207691_10050359 3300025940 Bacteria 3813
678 Ga0207691_10102660 3300025940 Bacteria 2550
679 Ga0207711_10064544 3300025941 Bacteria 3163
680 Ga0207711_10313947 3300025941 Bacteria 1447
681 Ga0207711_10470439 3300025941 Bacteria 1171
682 Ga0207689_10003772 3300025942 Bacteria 13806
683 Ga0207689_10148077 3300025942 Bacteria 1934
684 Ga0207689_10301407 3300025942 Bacteria 1328
685 Ga0207661_10001425 3300025944 Bacteria 16121
686 Ga0207661_10024729 3300025944 Bacteria 4555
687 Ga0207661_10025863 3300025944 Bacteria 4466
688 Ga0207661_10051100 3300025944 Bacteria 3297
689 Ga0207661_10316802 3300025944 Bacteria 1401
690 Ga0207661_10460918 3300025944 Bacteria 1158
691 Ga0207679_10000700 3300025945 Bacteria 22406
692 Ga0207679_10066173 3300025945 Bacteria 2707
693 Ga0207679_10466594 3300025945 Bacteria 1122
694 Ga0207679_10549962 3300025945 Bacteria 1036
695 Ga0207667_10000504 3300025949 Bacteria 51526
696 Ga0207667_10008688 3300025949 Bacteria 12037
697 Ga0207667_10044658 3300025949 Bacteria 4695
698 Ga0207667_10072664 3300025949 Bacteria 3575
699 Ga0207651_10043339 3300025960 Bacteria 3002
700 Ga0207651_10144382 3300025960 Bacteria 1843
701 Ga0207712_10000387 3300025961 Bacteria 38262
702 Ga0207712_10069399 3300025961 Bacteria 2529
703 Ga0207668_10133724 3300025972 Bacteria 1897
704 Ga0207668_10894767 3300025972 Bacteria 790
705 Ga0207640_10000561 3300025981 Bacteria 22237
706 Ga0207640_10044900 3300025981 Bacteria 2834
707 Ga0207640_10046019 3300025981 Bacteria 2805
708 Ga0207640_10158005 3300025981 Bacteria 1674
709 Ga0207640_10248226 3300025981 Bacteria 1380
710 Ga0207640_10753501 3300025981 Bacteria 840
711 Ga0207658_10005272 3300025986 Bacteria 8895
712 Ga0207658_10043202 3300025986 Bacteria 3275
713 Ga0207658_10081105 3300025986 Bacteria 2487
714 Ga0207658_10095677 3300025986 Bacteria 2314
715 Ga0207658_10109338 3300025986 Bacteria 2182
716 Ga0207658_11102789 3300025986 Bacteria 725
717 Ga0207658_11513617 3300025986 Bacteria 614
718 Ga0207677_10002595 3300026023 Bacteria 9498
719 Ga0207703_10007697 3300026035 Bacteria 8533
720 Ga0207703_10182157 3300026035 Bacteria 1854
721 Ga0207639_10001537 3300026041 Bacteria 15493
722 Ga0207639_10010259 3300026041 Bacteria 6483
723 Ga0207639_10180893 3300026041 Bacteria 1793
724 Ga0207639_11302081 3300026041 Bacteria 682
725 Ga0207678_10011844 3300026067 Bacteria 7657
726 Ga0207678_10113768 3300026067 Bacteria 2309
727 Ga0207678_10752091 3300026067 Bacteria 859
728 Ga0207708_10021285 3300026075 Bacteria 4889
729 Ga0207708_10022116 3300026075 Bacteria 4802
730 Ga0207708_10079877 3300026075 Bacteria 2513
731 Ga0207702_10153614 3300026078 Bacteria 2096
732 Ga0207702_10156142 3300026078 Bacteria 2080
733 Ga0207702_10171250 3300026078 Bacteria 1991
734 Ga0207702_11274774 3300026078 Bacteria 729
735 Ga0207641_10337289 3300026088 Bacteria 1433
736 Ga0207641_10536993 3300026088 Bacteria 1139
737 Ga0207648_10009133 3300026089 Bacteria 9529
738 Ga0207648_10068867 3300026089 Bacteria 3084
739 Ga0207648_10293499 3300026089 Bacteria 1456
740 Ga0207648_10738413 3300026089 Bacteria 914
741 Ga0207676_10075904 3300026095 Bacteria 2713
742 Ga0207676_10327430 3300026095 Bacteria 1409
743 Ga0207674_10005101 3300026116 Bacteria 15678
744 Ga0207674_10038342 3300026116 Bacteria 4974
745 Ga0207674_10042932 3300026116 Bacteria 4665
746 Ga0207674_10574035 3300026116 Bacteria 1089
747 Ga0207675_100000073 3300026118 Bacteria 76959
748 Ga0207675_100158343 3300026118 Bacteria 2159
749 Ga0207675_100312684 3300026118 Bacteria 1532
750 Ga0207675_100718510 3300026118 Bacteria 1009
751 Ga0207675_100794296 3300026118 Bacteria 959
752 Ga0207683_10160292 3300026121 Bacteria 2033
753 Ga0207683_10267080 3300026121 Bacteria 1563
754 Ga0207683_10950559 3300026121 Bacteria 798
755 Ga0207698_10022884 3300026142 Bacteria 4355
756 Ga0207698_10026876 3300026142 Bacteria 4077
757 Ga0207698_10049238 3300026142 Bacteria 3206
758 Ga0207698_10132163 3300026142 Bacteria 2135
759 Ga0207698_10256870 3300026142 Bacteria 1603
760 Ga0207698_10264203 3300026142 Bacteria 1583
761 Ga0207698_10286733 3300026142 Bacteria 1526
762 Ga0207698_10582448 3300026142 Bacteria 1101
763 Ga0207698_10968950 3300026142 Bacteria 860
764 Ga0207698_10986605 3300026142 Bacteria 853
765 Ga0209588_1001748 3300027671 Bacteria 5755
766 Ga0207428_10043467 3300027907 Bacteria 3628
767 Ga0207428_10251403 3300027907 Bacteria 1318
768 Ga0207428_10298601 3300027907 Bacteria 1192
769 Ga0268266_10000002 3300028379 Bacteria 3059047
770 Ga0268266_10209518 3300028379 Bacteria 1787
771 Ga0268266_10575708 3300028379 Bacteria 1080
772 Ga0268266_10725514 3300028379 Bacteria 958
773 Ga0268266_10796202 3300028379 Bacteria 913
774 Ga0268265_10000317 3300028380 Bacteria 53095
775 Ga0268265_10011944 3300028380 Bacteria 5875
776 Ga0268265_10013830 3300028380 Bacteria 5493
777 Ga0268265_10136214 3300028380 Bacteria 2049
778 Ga0268264_10009384 3300028381 Bacteria 8099
779 Ga0268264_10030217 3300028381 Bacteria 4441
780 Ga0268264_10122888 3300028381 Bacteria 2290
781 Ga0265318_10012857 3300028577 Bacteria 3550
782 Ga0307517_10016351 3300028786 Bacteria 9759
783 Ga0307517_10033670 3300028786 Bacteria 5872
784 Ga0265330_10125862 3300031235 Bacteria 1091
785 Ga0265332_10042857 3300031238 Bacteria 1955
786 Ga0265339_10164758 3300031249 Bacteria 1113
787 Ga0265331_10141666 3300031250 Bacteria 1093
788 Ga0265316_10090223 3300031344 Bacteria 2338
789 Ga0307513_10111590 3300031456 Bacteria 2727
790 Ga0307408_100009821 3300031548 Bacteria 6307
791 Ga0307408_100034024 3300031548 Bacteria 3565
792 Ga0307408_100136555 3300031548 Bacteria 1919
793 Ga0307408_100243875 3300031548 Bacteria 1478
794 Ga0307408_100254937 3300031548 Bacteria 1449
795 Ga0307408_100268737 3300031548 Bacteria 1415
796 Ga0307408_100479616 3300031548 Bacteria 1085
797 Ga0307408_101236386 3300031548 Bacteria 698
798 Ga0316579_10163426 3300031691 Unclassified 1076
799 Ga0265314_10285958 3300031711 Bacteria 931
800 Ga0265342_10028392 3300031712 Bacteria 3486
801 Ga0316576_10269855 3300031727 Bacteria 1275
802 Ga0307405_10000218 3300031731 Bacteria 20640
803 Ga0307405_10001167 3300031731 Bacteria 10812
804 Ga0307405_10006163 3300031731 Bacteria 5874
805 Ga0307405_10196779 3300031731 Bacteria 1460
806 Ga0307405_10239598 3300031731 Bacteria 1343
807 Ga0307405_10249526 3300031731 Bacteria 1320
808 Ga0307405_10527914 3300031731 Bacteria 951
809 Ga0307405_10536923 3300031731 Bacteria 944
810 Ga0307405_10568266 3300031731 Bacteria 920
811 Ga0307413_10000688 3300031824 Bacteria 11542
812 Ga0307413_10012087 3300031824 Bacteria 4279
813 Ga0307413_10015903 3300031824 Bacteria 3869
814 Ga0307413_10056419 3300031824 Bacteria 2396
815 Ga0307413_10069582 3300031824 Bacteria 2209
816 Ga0307413_10101886 3300031824 Bacteria 1899
817 Ga0307413_10175339 3300031824 Bacteria 1522
818 Ga0307413_10243718 3300031824 Bacteria 1329
819 Ga0307413_10602636 3300031824 Bacteria 899
820 Ga0307410_10002272 3300031852 Bacteria 9207
821 Ga0307410_10002390 3300031852 Bacteria 9056
822 Ga0307410_10047756 3300031852 Bacteria 2863
823 Ga0307410_10115080 3300031852 Bacteria 1952
824 Ga0307410_10132424 3300031852 Bacteria 1833
825 Ga0307410_10206885 3300031852 Bacteria 1501
826 Ga0307410_10250217 3300031852 Bacteria 1377
827 Ga0307410_10262838 3300031852 Bacteria 1346
828 Ga0307410_10497493 3300031852 Bacteria 1002
829 Ga0307410_10813110 3300031852 Bacteria 796
830 Ga0307406_10005499 3300031901 Bacteria 6934
831 Ga0307406_10010733 3300031901 Bacteria 5176
832 Ga0307406_10020447 3300031901 Bacteria 3898
833 Ga0307406_10027312 3300031901 Bacteria 3438
834 Ga0307406_10074775 3300031901 Bacteria 2232
835 Ga0307406_10665288 3300031901 Bacteria 866
836 Ga0307407_10001188 3300031903 Bacteria 9197
837 Ga0307407_10003414 3300031903 Bacteria 6506
838 Ga0307407_10012118 3300031903 Bacteria 4133
839 Ga0307407_10298697 3300031903 Bacteria 1122
840 Ga0307407_10313344 3300031903 Bacteria 1098
841 Ga0307407_10689269 3300031903 Bacteria 768
842 Ga0307412_10013680 3300031911 Bacteria 4766
843 Ga0307412_10054281 3300031911 Bacteria 2659
844 Ga0307412_10068016 3300031911 Bacteria 2421
845 Ga0307412_10154854 3300031911 Bacteria 1695
846 Ga0307412_10165327 3300031911 Bacteria 1649
847 Ga0307412_10256254 3300031911 Bacteria 1361
848 Ga0307412_10267337 3300031911 Bacteria 1336
849 Ga0307412_10538666 3300031911 Bacteria 978
850 Ga0307409_100002960 3300031995 Bacteria 9043
851 Ga0307409_100006362 3300031995 Bacteria 6930
852 Ga0307409_100047713 3300031995 Bacteria 3253
853 Ga0307409_100561431 3300031995 Bacteria 1122
854 Ga0307409_100583169 3300031995 Bacteria 1103
855 Ga0307409_100718902 3300031995 Bacteria 1000
856 Ga0307409_100910479 3300031995 Bacteria 894
857 Ga0307409_101032041 3300031995 Bacteria 841
858 Ga0307409_101355372 3300031995 Bacteria 737
859 Ga0307416_100000558 3300032002 Bacteria 19016
860 Ga0307416_100005562 3300032002 Bacteria 7759
861 Ga0307416_100024697 3300032002 Bacteria 4392
862 Ga0307416_100138514 3300032002 Bacteria 2207
863 Ga0307416_100191072 3300032002 Bacteria 1931
864 Ga0307416_100358158 3300032002 Bacteria 1480
865 Ga0307416_100506417 3300032002 Bacteria 1273
866 Ga0307416_100520118 3300032002 Bacteria 1258
867 Ga0307416_100585750 3300032002 Bacteria 1193
868 Ga0307416_101063088 3300032002 Bacteria 913
869 Ga0307416_101158283 3300032002 Bacteria 878
870 Ga0307414_10002216 3300032004 Bacteria 10133
871 Ga0307414_10018739 3300032004 Bacteria 4270
872 Ga0307414_10020825 3300032004 Bacteria 4096
873 Ga0307414_10025283 3300032004 Bacteria 3801
874 Ga0307414_10070923 3300032004 Bacteria 2511
875 Ga0307414_10073604 3300032004 Bacteria 2472
876 Ga0307414_10151109 3300032004 Bacteria 1832
877 Ga0307414_10488708 3300032004 Bacteria 1087
878 Ga0307414_10720647 3300032004 Bacteria 904
879 Ga0307411_10000106 3300032005 Bacteria 26146
880 Ga0307411_10000758 3300032005 Bacteria 11921
881 Ga0307411_10004491 3300032005 Bacteria 6692
882 Ga0307411_10058012 3300032005 Bacteria 2560
883 Ga0307411_10082023 3300032005 Bacteria 2222
884 Ga0307411_10094333 3300032005 Bacteria 2098
885 Ga0307411_10129842 3300032005 Bacteria 1840
886 Ga0307411_10199209 3300032005 Bacteria 1536
887 Ga0307411_10252838 3300032005 Bacteria 1387
888 Ga0307415_100011835 3300032126 Bacteria 5015
889 Ga0307415_100110120 3300032126 Bacteria 2041
890 Ga0307415_100214214 3300032126 Bacteria 1539
891 Ga0307415_100401813 3300032126 Bacteria 1170
892 Ga0307415_100404413 3300032126 Bacteria 1166
893 Ga0316583_10024650 3300032133 Bacteria 2148
894 Ga0316593_10009543 3300032168 Bacteria 2745
895 Ga0307510_10002311 3300033180 Bacteria 21551
896 Ga0316588_1135970 3300033528 Unclassified 627
897 Ga0373930_0030647 3300034816 Bacteria 1105
898 Ga0373958_0034955 3300034819 Bacteria 1004
899 Ga0373926_0009877 3300035083 Bacteria 3192
900 Ga0373934_0000166 3300035086 Bacteria 24039
901 Ga0373944_0006824 3300035089 Bacteria 3043
902 Ga0373923_0015436 3300035111 Bacteria 2884
903 Ga0373953_0005021 3300035117 Bacteria 4263
904 Ga0373956_0000183 3300035119 Bacteria 23812
905 Ga0373943_0001415 3300035170 Bacteria 10819
906 Ga0373943_0017073 3300035170 Bacteria 3319
907 Ga0373946_0002897 3300035171 Bacteria 6085
908 Ga0373955_0000753 3300035172 Bacteria 13899
909 Ga0373924_0007550 3300035410 Bacteria 3930
910 Ga0373935_0005704 3300035692 Bacteria 7350
911 Ga0373935_0175156 3300035692 Unclassified 1469
912 Ga0373927_0021535 3300035695 Bacteria 4225
913 Ga0373933_0000131 3300035724 Bacteria 47471
914 Ga0373947_0001610 3300035725 Bacteria 13849
915 Ga0373937_0000512 3300036401 Bacteria 35027
916 Ga0373937_0911175 3300036401 Unclassified 828
917 Ga0316582_0155203 3300036647 Bacteria 1549
918 Ga0316582_0158614 3300036647 Bacteria 1532
919 Ga0316582_0555736 3300036647 Bacteria 791
920 Ga0373925_0003211 3300037068 Bacteria 12781
921 Ga0373925_0131580 3300037068 Bacteria 1951
922 Ga0395899_0187269 3300037312 Bacteria 1450
923 Ga0395900_0162022 3300037418 Bacteria 2281
924 Ga0395898_0152291 3300037466 Bacteria 2212
925 Ga0395898_0609773 3300037466 Bacteria 1034
926 Ga0395905_0002689 3300037471 Bacteria 19495
927 Ga0395905_0358540 3300037471 Bacteria 1351
928 Ga0436364_0647371 3300037853 Bacteria 3943
929 Ga0395901_0364573 3300038443 Bacteria 1489
930 Ga0395901_0701191 3300038443 Bacteria 1010
931 Ga0395901_1016363 3300038443 Bacteria 804
932 Ga0242420_001481 3300038996 Bacteria 3137
933 Ga0400489_51950 3300039093 Bacteria 1135
934 Ga0436365_0143962 3300039437 Bacteria 1061
935 Ga0436365_0479744 3300039437 Bacteria 662
936 Ga0436365_1821459 3300039437 Bacteria 3719
937 Ga0439439_0011221 3300041406 Bacteria 2153
938 Ga0451802_1617087 3300041460 Bacteria 610
939 Ga0451839_0303675 3300041496 Bacteria 1076
940 Ga0451839_1201838 3300041496 Bacteria 761
941 Ga0439448_0064085 3300042005 Bacteria 1218
942 Ga0450912_007828 3300042116 Bacteria 876
943 Ga0450923_018708 3300042125 Bacteria 1328
944 Ga0439446_0096860 3300042156 Bacteria 929
945 Ga0439446_0108724 3300042156 Bacteria 883
946 Ga0439444_0015838 3300042437 Bacteria 1277
947 Ga0451577_0000016 3300042876 Bacteria 531002
948 Ga0451577_0071378 3300042876 Bacteria 3097
949 Ga0451577_0208209 3300042876 Bacteria 1766
950 Ga0451577_0611274 3300042876 Bacteria 989
951 Ga0466969_0040961 3300044656 Bacteria 2319
952 Ga0453683_0091147 3300044673 Bacteria 1911
953 Ga0453683_0122524 3300044673 Bacteria 1637
954 Ga0453683_0154459 3300044673 Bacteria 1451
955 Ga0453683_0194666 3300044673 Bacteria 1287
956 Ga0453683_0249604 3300044673 Bacteria 1131
957 Ga0453683_0378458 3300044673 Bacteria 911
958 Ga0466961_0001485 3300044693 Bacteria 14575
959 Ga0466957_0680759 3300044842 Bacteria 725
960 Ga0466957_0808530 3300044842 Bacteria 666
961 Ga0466959_0254615 3300045049 Bacteria 1210
962 Ga0451576_0005609 3300045051 Bacteria 15677
963 Ga0451576_0014051 3300045051 Bacteria 8921
964 Ga0451576_0024084 3300045051 Bacteria 6578
965 Ga0451576_0033100 3300045051 Bacteria 5495
966 Ga0451576_0116219 3300045051 Bacteria 2785
967 Ga0451576_0164712 3300045051 Bacteria 2313
968 Ga0451576_0235878 3300045051 Bacteria 1911
969 Ga0451576_0286223 3300045051 Bacteria 1723
970 Ga0451576_0308237 3300045051 Bacteria 1656
971 Ga0451576_0411948 3300045051 Bacteria 1417
972 Ga0451576_0437646 3300045051 Bacteria 1372
973 Ga0451576_1004544 3300045051 Bacteria 874
974 Ga0466958_0350601 3300045836 Bacteria 950
975 Ga0466967_0041154 3300045976 Bacteria 3982
976 Ga0466967_0423507 3300045976 Bacteria 1298
977 Ga0495617_003809 3300046452 Bacteria 5578
978 Ga0495617_034525 3300046452 Bacteria 1698
979 Ga0495617_077577 3300046452 Bacteria 1090
980 Ga0495627_000615 3300046453 Bacteria 28285
981 Ga0495592_0001194 3300046454 Bacteria 18032
982 Ga0495603_0001831 3300046455 Bacteria 12545
983 Ga0495629_0037844 3300046459 Bacteria 3400
984 Ga0495629_0226023 3300046459 Bacteria 1290
985 Ga0495638_0000051 3300046460 Bacteria 206003
986 Ga0495638_0177218 3300046460 Bacteria 1219
987 Ga0495638_0252754 3300046460 Bacteria 971
988 Ga0495641_0194832 3300046461 Bacteria 908
989 Ga0495651_0000098 3300046462 Bacteria 63881
990 Ga0495653_0000168 3300046463 Bacteria 54127
991 Ga0495650_0000670 3300046471 Bacteria 44598
992 Ga0495580_0005634 3300046472 Bacteria 10300
993 Ga0495580_0079783 3300046472 Bacteria 2282
994 Ga0495582_0000694 3300046473 Bacteria 18567
995 Ga0495639_0000412 3300046475 Bacteria 20413
996 Ga0495639_0054369 3300046475 Bacteria 1825
997 Ga0495639_0162507 3300046475 Bacteria 1081
998 Ga0495639_0356119 3300046475 Unclassified 735
999 Ga0495584_0069479 3300046491 Bacteria 1770
1000 Ga0495585_0426236 3300046492 Bacteria 637
1001 Ga0495596_0001277 3300046500 Bacteria 14545
1002 Ga0495596_0010224 3300046500 Bacteria 4094
1003 Ga0495596_0028255 3300046500 Bacteria 2253
1004 Ga0495596_0272443 3300046500 Bacteria 657
1005 Ga0495607_0120354 3300046501 Bacteria 1379
1006 Ga0495607_0208425 3300046501 Bacteria 963
1007 Ga0495583_0000038 3300046506 Bacteria 243395
1008 Ga0495583_0002196 3300046506 Bacteria 17335
1009 Ga0495583_0004381 3300046506 Bacteria 10147
1010 Ga0495583_0039917 3300046506 Bacteria 2208
1011 Ga0495583_0061344 3300046506 Bacteria 1678
1012 Ga0495583_0108756 3300046506 Bacteria 1176
1013 Ga0495606_0069957 3300046507 Bacteria 2215
1014 Ga0495608_0003342 3300046511 Bacteria 11466
1015 Ga0495610_0000280 3300046512 Bacteria 53046
1016 Ga0495610_0001450 3300046512 Bacteria 20950
1017 Ga0495616_0000040 3300046513 Bacteria 122596
1018 Ga0495616_0122665 3300046513 Bacteria 1198
1019 Ga0495618_0099010 3300046514 Unclassified 1866
1020 Ga0495628_0000991 3300046516 Bacteria 25951
1021 Ga0495630_0028854 3300046517 Bacteria 4124
1022 Ga0495630_0059253 3300046517 Bacteria 2872
1023 Ga0495630_0188832 3300046517 Bacteria 1572
1024 Ga0495631_0083146 3300046518 Bacteria 1380
1025 Ga0495632_0008232 3300046519 Bacteria 6430
1026 Ga0495632_0012016 3300046519 Bacteria 5015
1027 Ga0495637_0024958 3300046520 Bacteria 2700
1028 Ga0495643_0000024 3300046522 Bacteria 282193
1029 Ga0495643_0003604 3300046522 Bacteria 11255
1030 Ga0495643_0006598 3300046522 Bacteria 7626
1031 Ga0495643_0009295 3300046522 Bacteria 6121
1032 Ga0495643_0010333 3300046522 Bacteria 5747
1033 Ga0495643_0043554 3300046522 Bacteria 2442
1034 Ga0495643_0158021 3300046522 Bacteria 1117
1035 Ga0495648_0000032 3300046524 Bacteria 205970
1036 Ga0495648_0002055 3300046524 Bacteria 19074
1037 Ga0495648_0037338 3300046524 Bacteria 3123
1038 Ga0495663_0105672 3300046525 Bacteria 931
1039 Ga0495666_0093790 3300046526 Bacteria 1416
1040 Ga0495642_0117854 3300046528 Bacteria 1138
1041 Ga0495642_0138682 3300046528 Bacteria 1049
1042 Ga0495652_0000694 3300046529 Bacteria 39080
1043 Ga0495665_0000916 3300046531 Bacteria 15543
1044 Ga0495665_0109111 3300046531 Unclassified 1452
1045 Ga0495640_0530831 3300046533 Unclassified 714
1046 Ga0495586_0235721 3300046535 Bacteria 1042
1047 Ga0495587_0000628 3300046536 Bacteria 23752
1048 Ga0495598_0007061 3300046537 Bacteria 2560
1049 Ga0495609_0003753 3300046538 Bacteria 8568
1050 Ga0495609_0169291 3300046538 Bacteria 923
1051 Ga0495621_0178660 3300046539 Bacteria 846
1052 Ga0495645_0000106 3300046543 Bacteria 57528
1053 Ga0495622_0008547 3300046557 Bacteria 4744
1054 Ga0495622_0121061 3300046557 Bacteria 1195
1055 Ga0495633_0067542 3300046558 Bacteria 1669
1056 Ga0495667_0000431 3300046559 Bacteria 26897
1057 Ga0495656_0032053 3300046615 Bacteria 2136
1058 Ga0495668_0001117 3300046616 Bacteria 27675
1059 Ga0495668_0006518 3300046616 Bacteria 7634
1060 Ga0495668_0097369 3300046616 Bacteria 1610
1061 Ga0495611_0021891 3300046648 Bacteria 2763
1062 Ga0495625_0007661 3300046660 Bacteria 9359
1063 Ga0495625_0010831 3300046660 Bacteria 7501
1064 Ga0495625_0038178 3300046660 Bacteria 3517
1065 Ga0495635_0000344 3300046663 Bacteria 29638
1066 Ga0495588_0005262 3300046674 Bacteria 5751
1067 Ga0495657_0001006 3300046675 Bacteria 24822
1068 Ga0495599_0000150 3300046678 Bacteria 45637
1069 Ga0495623_0000597 3300046679 Bacteria 24122
1070 Ga0495646_0001072 3300046680 Bacteria 15888
1071 Ga0495647_0070788 3300046681 Bacteria 1396
1072 Ga0495647_0140762 3300046681 Bacteria 1028
1073 Ga0495647_0176939 3300046681 Bacteria 927
1074 Ga0495658_0000829 3300046683 Bacteria 16573
1075 Ga0495658_0263008 3300046683 Bacteria 1086
1076 Ga0495669_0162452 3300046684 Bacteria 1060
1077 Ga0495670_0093770 3300046691 Bacteria 1539
1078 Ga0495671_0000020 3300046692 Bacteria 268306
1079 Ga0495671_0140005 3300046692 Bacteria 1179
1080 Ga0495649_0143183 3300046694 Bacteria 1257
1081 Ga0495600_0000156 3300046809 Bacteria 39196
1082 Ga0495600_0002857 3300046809 Bacteria 10053
1083 Ga0495581_0001381 3300047315 Bacteria 13446
1084 Ga0495581_0357140 3300047315 Bacteria 853
1085 Ga0495604_0000519 3300047317 Bacteria 33907
1086 Ga0495674_0009525 3300047319 Bacteria 9227
1087 Ga0495680_0042318 3300047322 Bacteria 3616
1088 Ga0495683_0006512 3300047323 Bacteria 6379
1089 Ga0495675_0003427 3300047444 Bacteria 9552
1090 Ga0495677_0072950 3300047445 Bacteria 1280
1091 Ga0495673_0000076 3300047469 Bacteria 205985
1092 Ga0495681_0000110 3300047470 Bacteria 70960
1093 Ga0495681_0012381 3300047470 Bacteria 5016
1094 Ga0495681_0084255 3300047470 Bacteria 1414
1095 Ga0495684_0000216 3300047471 Bacteria 44631
1096 Ga0495686_0025735 3300047472 Bacteria 3855
1097 Ga0495686_0036162 3300047472 Bacteria 3170
1098 Ga0495593_0001785 3300047673 Bacteria 12750
1099 Ga0495593_0168665 3300047673 Bacteria 1104
1100 Ga0495602_0002360 3300048088 Bacteria 19106
1101 Ga0495614_0012061 3300048089 Bacteria 3795
1102 Ga0495626_0002997 3300048091 Bacteria 11187
1103 Ga0496100_0065575 3300048903 Bacteria 2406
1104 Ga0496100_0388923 3300048903 Bacteria 1060
1105 Ga0496101_0010381 3300048904 Bacteria 6149
1106 Ga0496101_0037387 3300048904 Bacteria 3444
1107 Ga0496102_0000106 3300048905 Bacteria 118841
1108 Ga0496102_0000452 3300048905 Bacteria 46768
1109 Ga0496102_0207163 3300048905 Bacteria 1849
1110 Ga0496102_1062306 3300048905 Bacteria 730
1111 Ga0496103_0000095 3300048906 Bacteria 98260
1112 Ga0496103_0000518 3300048906 Bacteria 31718
1113 Ga0496104_0000060 3300048907 Bacteria 117966
1114 Ga0496104_0052117 3300048907 Bacteria 3864
1115 Ga0496105_0000122 3300048908 Bacteria 52475
1116 Ga0496106_0311509 3300048909 Bacteria 1263
1117 Ga0496107_0253564 3300048910 Bacteria 1309
1118 Ga0496109_0084360 3300048912 Bacteria 2931
1119 Ga0496112_0492901 3300048915 Bacteria 1161
1120 Ga0496113_0040834 3300048916 Bacteria 3420
1121 Ga0496113_0209281 3300048916 Bacteria 1552
1122 Ga0496113_0851735 3300048916 Bacteria 722
1123 Ga0496114_0032385 3300048917 Bacteria 4303
1124 Ga0496114_0156191 3300048917 Bacteria 1981
1125 Ga0496114_1014845 3300048917 Bacteria 713
1126 Ga0496115_0000230 3300048918 Bacteria 50872
1127 Ga0496116_0000035 3300048919 Bacteria 402424
1128 Ga0496116_0022284 3300048919 Bacteria 4751
1129 Ga0496116_0109884 3300048919 Bacteria 1623
1130 Ga0496117_0000885 3300048920 Bacteria 46146
1131 Ga0496117_0003116 3300048920 Bacteria 19798
1132 Ga0496117_0111026 3300048920 Bacteria 1708
1133 Ga0496118_0000144 3300048921 Bacteria 124411
1134 Ga0496118_0002769 3300048921 Bacteria 22965
1135 Ga0496118_0155393 3300048921 Bacteria 1424
1136 Ga0496119_0000222 3300048922 Bacteria 79824
1137 Ga0496119_0017296 3300048922 Bacteria 5429
1138 Ga0496120_0001728 3300048923 Bacteria 24842
1139 Ga0496120_0184298 3300048923 Bacteria 1022
1140 Ga0496121_0000295 3300048924 Bacteria 103239
1141 Ga0496121_0000681 3300048924 Bacteria 63345
1142 Ga0496121_0002209 3300048924 Bacteria 30388
1143 Ga0496121_0324839 3300048924 Bacteria 1034
1144 Ga0496122_0001902 3300048925 Bacteria 31581
1145 Ga0496122_0018297 3300048925 Bacteria 6485
1146 Ga0496123_0003060 3300048926 Bacteria 19222
1147 Ga0496123_0081359 3300048926 Bacteria 1968
1148 Ga0496123_0106643 3300048926 Bacteria 1613
1149 Ga0496124_0000683 3300048927 Bacteria 55788
1150 Ga0496124_0001019 3300048927 Bacteria 44416
1151 Ga0496124_0004374 3300048927 Bacteria 16529
1152 Ga0496124_0011492 3300048927 Bacteria 8845
1153 Ga0496125_0022675 3300048928 Bacteria 5823
1154 Ga0496125_0023499 3300048928 Bacteria 5689
1155 Ga0496125_0085179 3300048928 Bacteria 2396
1156 Ga0496125_0180598 3300048928 Bacteria 1406
1157 Ga0496125_0394095 3300048928 Bacteria 811
1158 Ga0496126_0000084 3300048929 Bacteria 217111
1159 Ga0496126_0000294 3300048929 Bacteria 106327
1160 Ga0496126_0001756 3300048929 Bacteria 32069
1161 Ga0496126_0028161 3300048929 Bacteria 5357
1162 Ga0495678_037828 3300049459 Bacteria 1957
1163 Ga0495682_0278892 3300049460 Bacteria 590
1164 Ga0501033_0148431 3300049570 Bacteria 1693
1165 Ga0501033_0420282 3300049570 Bacteria 931
1166 Ga0501034_0205917 3300049571 Bacteria 1924
1167 Ga0501036_0131146 3300049572 Bacteria 2116
1168 Ga0501036_0717434 3300049572 Bacteria 826
1169 Ga0501038_0040818 3300049574 Bacteria 4049
1170 Ga0501038_0160538 3300049574 Bacteria 1827
1171 Ga0501040_0011434 3300049576 Bacteria 5812
1172 Ga0501040_0349794 3300049576 Bacteria 1059
1173 Ga0501041_0074500 3300049577 Bacteria 2086
1174 Ga0501042_0523373 3300049578 Bacteria 861
1175 Ga0501046_0499865 3300049580 Bacteria 871
1176 Ga0501046_0773466 3300049580 Bacteria 674
1177 Ga0501047_0049597 3300049581 Bacteria 4053
1178 Ga0501048_0078360 3300049582 Bacteria 2332
1179 Ga0501048_0384830 3300049582 Bacteria 1002
1180 Ga0501067_0002587 3300049583 Bacteria 9997
1181 Ga0501067_0007341 3300049583 Bacteria 6124
1182 Ga0501067_0272501 3300049583 Bacteria 942
1183 Ga0501068_0009565 3300049584 Bacteria 5428
1184 Ga0501069_0068679 3300049585 Bacteria 1983
1185 Ga0501069_0091690 3300049585 Bacteria 1718
1186 Ga0501070_0010086 3300049586 Bacteria 7994
1187 Ga0501070_0018920 3300049586 Bacteria 5777
1188 Ga0501070_0027735 3300049586 Bacteria 4751
1189 Ga0501071_0037770 3300049587 Bacteria 3449
1190 Ga0501071_0486449 3300049587 Bacteria 946
1191 Ga0501072_0069103 3300049588 Bacteria 2789
1192 Ga0501072_0104051 3300049588 Bacteria 2257
1193 Ga0501073_0000699 3300049589 Bacteria 23637
1194 Ga0501073_0079560 3300049589 Bacteria 2281
1195 Ga0501073_0560125 3300049589 Bacteria 790
1196 Ga0501074_0018819 3300049590 Bacteria 5016
1197 Ga0501074_0216128 3300049590 Bacteria 1365
1198 Ga0501075_0117832 3300049591 Bacteria 2019
1199 Ga0501075_0241150 3300049591 Bacteria 1378
1200 Ga0501076_0013971 3300049592 Bacteria 6032
1201 Ga0501076_0364913 3300049592 Bacteria 1186
1202 Ga0501077_0013893 3300049593 Bacteria 5048
1203 Ga0501077_0313608 3300049593 Bacteria 1000
1204 Ga0501198_053201 3300049649 Bacteria 726
1205 Ga0501239_021921 3300049672 Bacteria 790
1206 Ga0501239_032088 3300049672 Bacteria 694
1207 Ga0501242_019155 3300049674 Bacteria 873
1208 Ga0501243_000868 3300049675 Bacteria 4213
1209 Ga0501249_052454 3300049679 Bacteria 937
1210 Ga0501256_007484 3300049685 Bacteria 1003
1211 Ga0501257_021569 3300049686 Bacteria 1520
1212 Ga0501258_015862 3300049687 Bacteria 847
1213 Ga0501259_019257 3300049688 Bacteria 1200
1214 Ga0501234_013329 3300049707 Unclassified 1290
1215 Ga0501080_0017347 3300049742 Bacteria 6656
1216 Ga0501080_0035643 3300049742 Bacteria 4643
1217 Ga0501080_0205592 3300049742 Bacteria 1806
1218 Ga0501080_0772936 3300049742 Bacteria 844
1219 Ga0501080_0930910 3300049742 Bacteria 756
1220 Ga0501081_0008481 3300049743 Bacteria 6680
1221 Ga0501081_0126430 3300049743 Bacteria 1824
1222 Ga0501083_0155109 3300049744 Bacteria 1499
1223 Ga0501083_0241184 3300049744 Bacteria 1177
1224 Ga0501241_003688 3300049758 Bacteria 2888
1225 Ga0501268_023134 3300049765 Bacteria 1077
1226 Ga0501268_039691 3300049765 Bacteria 882
1227 Ga0501279_038112 3300049775 Bacteria 730
1228 Ga0501035_0054536 3300049822 Bacteria 3572
1229 Ga0501045_0109752 3300049824 Bacteria 2045
1230 Ga0501045_0325217 3300049824 Bacteria 1144
1231 nmdc:mga03n38_656455_c1 3300050490 Bacteria 601
1232 nmdc:mga0k408_137697_c1 3300050493 Bacteria 1451
1233 nmdc:mga0k408_32421_c1 3300050493 Bacteria 2985
1234 nmdc:mga07m45_242839_c1 3300050496 Bacteria 1048
1235 nmdc:mga07m45_318841_c1 3300050496 Bacteria 903
1236 nmdc:mga05p37_106348_c1 3300050507 Bacteria 3452
1237 nmdc:mga05p37_238495_c1 3300050507 Bacteria 2188
1238 nmdc:mga05p37_258866_c1 3300050507 Bacteria 2083
1239 nmdc:mga05p37_281510_c1 3300050507 Bacteria 1983
1240 nmdc:mga05p37_454546_c1 3300050507 Bacteria 1481
1241 nmdc:mga05p37_47795_c1 3300050507 Bacteria 5262
1242 nmdc:mga05p37_608385_c1 3300050507 Bacteria 1232
1243 nmdc:mga05p37_999832_c1 3300050507 Bacteria 889
1244 nmdc:mga09592_211828_c1 3300050508 Bacteria 1679
1245 nmdc:mga09592_217202_c1 3300050508 Bacteria 1657
1246 nmdc:mga09592_341055_c1 3300050508 Bacteria 1297
1247 nmdc:mga09592_436827_c1 3300050508 Bacteria 1130
1248 nmdc:mga09592_51799_c1 3300050508 Bacteria 3463
1249 nmdc:mga09592_59608_c1 3300050508 Bacteria 3227
1250 nmdc:mga0qj67_143145_c1 3300050509 Bacteria 1939
1251 nmdc:mga0qj67_45376_c1 3300050509 Bacteria 3468
1252 nmdc:mga0qj67_82037_c1 3300050509 Bacteria 2586
1253 nmdc:mga0qj67_86238_c1 3300050509 Bacteria 2519
1254 nmdc:mga0qj67_981014_c1 3300050509 Bacteria 663
1255 nmdc:mga06r32_127682_c1 3300050510 Bacteria 2512
1256 nmdc:mga06r32_148749_c1 3300050510 Bacteria 2320
1257 nmdc:mga06r32_1559200_c1 3300050510 Bacteria 600
1258 nmdc:mga06r32_159464_c1 3300050510 Bacteria 2238
1259 nmdc:mga06r32_26098_c1 3300050510 Bacteria 5443
1260 nmdc:mga06r32_303452_c1 3300050510 Bacteria 1582
1261 nmdc:mga06r32_313984_c1 3300050510 Bacteria 1553
1262 nmdc:mga06r32_32791_c1 3300050510 Bacteria 4890
1263 nmdc:mga06r32_357944_c1 3300050510 Bacteria 1444
1264 nmdc:mga06r32_39284_c1 3300050510 Bacteria 4490
1265 nmdc:mga08y16_542106_c1 3300050511 Bacteria 1178
1266 nmdc:mga08y16_67181_c1 3300050511 Bacteria 3740
1267 nmdc:mga08y16_83386_c1 3300050511 Bacteria 3331
1268 nmdc:mga0n895_114290_c1 3300050512 Bacteria 2718
1269 nmdc:mga0n895_1190322_c1 3300050512 Bacteria 736
1270 nmdc:mga0n895_1574_c1 3300050512 Bacteria 17176
1271 nmdc:mga0n895_17899_c1 3300050512 Bacteria 6545
1272 nmdc:mga0n895_1919_c1 3300050512 Bacteria 15927
1273 nmdc:mga0n895_227436_c1 3300050512 Bacteria 1894
1274 nmdc:mga0n895_2307_c1 3300050512 Bacteria 14848
1275 nmdc:mga0n895_23905_c1 3300050512 Bacteria 5751
1276 nmdc:mga0n895_2537_c1 3300050512 Bacteria 14302
1277 nmdc:mga0n895_3125_c1 3300050512 Bacteria 13200
1278 nmdc:mga0n895_35737_c1 3300050512 Bacteria 4793
1279 nmdc:mga0n895_470111_c1 3300050512 Bacteria 1268
1280 nmdc:mga0n895_572583_c1 3300050512 Bacteria 1134
1281 nmdc:mga0n895_6624_c1 3300050512 Bacteria 9864
1282 nmdc:mga0rr50_101881_c1 3300050513 Bacteria 2258
1283 nmdc:mga0rr50_106710_c1 3300050513 Bacteria 2210
1284 nmdc:mga0rr50_108757_c1 3300050513 Bacteria 2191
1285 nmdc:mga0rr50_133632_c1 3300050513 Bacteria 1989
1286 nmdc:mga0rr50_3714_c1 3300050513 Bacteria 8843
1287 nmdc:mga0rr50_38425_c1 3300050513 Bacteria 3464
1288 nmdc:mga0rr50_409360_c1 3300050513 Bacteria 1146
1289 nmdc:mga0rr50_481079_c1 3300050513 Bacteria 1055
1290 nmdc:mga0rr50_55370_c1 3300050513 Bacteria 2959
1291 nmdc:mga0rr50_643070_c1 3300050513 Bacteria 905
1292 nmdc:mga0rr50_783307_c1 3300050513 Bacteria 814
1293 nmdc:mga0rr50_87720_c1 3300050513 Bacteria 2416
1294 nmdc:mga08x19_11535_c1 3300050514 Bacteria 5319
1295 nmdc:mga08x19_149006_c1 3300050514 Bacteria 1583
1296 nmdc:mga08x19_2911_c1 3300050514 Bacteria 10296
1297 nmdc:mga08x19_372281_c1 3300050514 Bacteria 1000
1298 nmdc:mga08x19_416786_c1 3300050514 Bacteria 943
1299 nmdc:mga08x19_569815_c1 3300050514 Bacteria 802
1300 nmdc:mga08x19_61281_c1 3300050514 Bacteria 2438
1301 nmdc:mga0a205_115969_c1 3300050515 Bacteria 2577
1302 nmdc:mga0a205_14814_c1 3300050515 Bacteria 7275
1303 nmdc:mga0a205_152270_c1 3300050515 Bacteria 2212
1304 nmdc:mga0a205_169260_c1 3300050515 Bacteria 2081
1305 nmdc:mga0a205_32015_c2 3300050515 Bacteria 3703
1306 nmdc:mga0a205_446766_c1 3300050515 Bacteria 1153
1307 nmdc:mga0a205_46322_c1 3300050515 Bacteria 4194
1308 nmdc:mga0a205_53423_c1 3300050515 Bacteria 3900
1309 nmdc:mga0a205_582_c1 3300050515 Bacteria 28885
1310 nmdc:mga0a205_591774_c1 3300050515 Bacteria 963
1311 nmdc:mga0a205_61953_c1 3300050515 Bacteria 3614
1312 nmdc:mga0sz30_83042_c1 3300050516 Bacteria 1388
1313 Ga0495601_0003853 3300053077 Bacteria 8636
1314 Ga0495612_0000349 3300053078 Bacteria 18632
1315 Ga0495619_0282889 3300053085 Bacteria 1149
1316 Ga0500643_007503 3300053087 Bacteria 4384
1317 Ga0500644_0213975 3300053088 Bacteria 801
1318 Ga0500647_0049787 3300053091 Bacteria 2015
1319 Ga0500594_0000002 3300053118 Bacteria 916890
1320 Ga0500594_0105277 3300053118 Bacteria 872
1321 Ga0500595_001822 3300053119 Bacteria 11037
1322 Ga0500595_037368 3300053119 Bacteria 1584
1323 Ga0500607_000130 3300053121 Bacteria 61720
1324 Ga0500608_007240 3300053122 Bacteria 4577
1325 Ga0500608_140924 3300053122 Bacteria 1069
1326 Ga0500618_002979 3300053125 Bacteria 6042
1327 Ga0500642_0004589 3300053130 Bacteria 4347
1328 Ga0500559_0002365 3300053136 Bacteria 9829
1329 Ga0500559_0007163 3300053136 Bacteria 4968
1330 Ga0500559_0182535 3300053136 Bacteria 988
1331 Ga0500564_002596 3300053138 Bacteria 6735
1332 Ga0500573_0098653 3300053140 Bacteria 1645
1333 Ga0500590_058642 3300053148 Bacteria 1939
1334 Ga0500590_059403 3300053148 Bacteria 1924
1335 Ga0500604_0010676 3300053151 Bacteria 2460
1336 Ga0500619_003163 3300053154 Bacteria 3321
1337 Ga0500622_0004558 3300053156 Bacteria 8640
1338 Ga0500624_000212 3300053157 Bacteria 21975
1339 Ga0500627_0001009 3300053158 Bacteria 7670
1340 Ga0500636_0001430 3300053177 Bacteria 13006
1341 Ga0500636_0021652 3300053177 Bacteria 3806
1342 Ga0500637_0000205 3300053178 Bacteria 21975
1343 Ga0500637_0003185 3300053178 Bacteria 7513
1344 Ga0500567_058259 3300053723 Bacteria 1739
1345 Ga0500625_000041 3300053729 Bacteria 35224
1346 Ga0500645_004991 3300053730 Bacteria 4973
1347 Ga0500596_004593 3300053735 Bacteria 2516
1348 Ga0501084_0008141 3300054114 Bacteria 8641
1349 Ga0501084_0171973 3300054114 Bacteria 1829
1350 Ga0590071_005592 3300059421 Bacteria 3022
1351 Ga0590071_030642 3300059421 Bacteria 1281
1352 Ga0590075_056282 3300059424 Bacteria 1011
1353 Ga0587088_017668 3300059508 Bacteria 1151
1354 Ga0587128_041835 3300059630 Bacteria 804
1355 Ga0501082_0035130 3300060353 Bacteria 4320
1356 Ga0501082_0075923 3300060353 Bacteria 2896
1357 Ga0501082_0253021 3300060353 Bacteria 1533
1358 Ga0530510_0492103 3300061734 Bacteria 929
1359 Ga0530510_0663459 3300061734 Bacteria 794

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0155203 Ga0316582_0155203_469_1026 135
2 3300045051 Ga0451576_0437646 Ga0451576_0437646_397_909 139
3 3300032168 Ga0316593_10009543 Ga0316593_100095433 141
4 iso_pu_bacteria 2895880812 2895883296 144
5 3300005289 Ga0065704_10228061 Ga0065704_102280612 145
6 3300005330 Ga0070690_100590120 Ga0070690_1005901202 145
7 3300005334 Ga0068869_100001046 Ga0068869_10000104610 145
8 3300005338 Ga0068868_100008151 Ga0068868_1000081513 145
9 3300005339 Ga0070660_100008554 Ga0070660_1000085548 145
10 3300005353 Ga0070669_100005923 Ga0070669_1000059233 145
11 3300005354 Ga0070675_100010460 Ga0070675_1000104603 145
12 3300005367 Ga0070667_100011180 Ga0070667_1000111802 145
13 3300005440 Ga0070705_100006184 Ga0070705_1000061844 145
14 3300005444 Ga0070694_100011744 Ga0070694_1000117442 145
15 3300005444 Ga0070694_100039862 Ga0070694_1000398624 145
16 3300005471 Ga0070698_100115485 Ga0070698_1001154851 145
17 3300005518 Ga0070699_100018956 Ga0070699_1000189564 145
18 3300005535 Ga0070684_100009791 Ga0070684_1000097912 145
19 3300005536 Ga0070697_100021503 Ga0070697_1000215034 145
20 3300005536 Ga0070697_100043195 Ga0070697_1000431955 145
21 3300005543 Ga0070672_100004511 Ga0070672_1000045117 145
22 3300005543 Ga0070672_100350923 Ga0070672_1003509232 145
23 3300005544 Ga0070686_100088111 Ga0070686_1000881112 145
24 3300005577 Ga0068857_100163670 Ga0068857_1001636703 145
25 3300005578 Ga0068854_100065299 Ga0068854_1000652993 145
26 3300005616 Ga0068852_100006969 Ga0068852_1000069699 145
27 3300005617 Ga0068859_100011685 Ga0068859_1000116859 145
28 3300005719 Ga0068861_100001489 Ga0068861_10000148910 145
29 3300005834 Ga0068851_10005001 Ga0068851_100050012 145
30 3300005841 Ga0068863_100014025 Ga0068863_1000140257 145
31 3300005842 Ga0068858_100028680 Ga0068858_1000286802 145
32 3300005843 Ga0068860_100239531 Ga0068860_1002395312 145
33 3300005844 Ga0068862_100050715 Ga0068862_1000507153 145
34 3300006237 Ga0097621_100064685 Ga0097621_1000646852 145
35 3300006844 Ga0075428_100046020 Ga0075428_1000460204 145
36 3300006846 Ga0075430_100447415 Ga0075430_1004474152 145
37 3300006852 Ga0075433_10107444 Ga0075433_101074443 145
38 3300006852 Ga0075433_10235052 Ga0075433_102350522 145
39 3300006871 Ga0075434_100001715 Ga0075434_10000171516 145
40 3300006871 Ga0075434_100015325 Ga0075434_1000153257 145
41 3300006880 Ga0075429_100112884 Ga0075429_1001128842 145
42 3300006881 Ga0068865_100004706 Ga0068865_1000047063 145
43 3300006931 Ga0097620_100011685 Ga0097620_1000116859 145
44 3300007265 Ga0099794_10000062 Ga0099794_1000006230 145
45 3300009093 Ga0105240_10598589 Ga0105240_105985892 145
46 3300009098 Ga0105245_10080445 Ga0105245_100804454 145
47 3300009147 Ga0114129_11270524 Ga0114129_112705242 145
48 3300009176 Ga0105242_11197584 Ga0105242_111975842 145
49 3300009177 Ga0105248_10015120 Ga0105248_100151204 145
50 3300009553 Ga0105249_10001114 Ga0105249_1000111423 145
51 3300010375 Ga0105239_10058708 Ga0105239_100587082 145
52 3300013102 Ga0157371_10022797 Ga0157371_100227976 145
53 3300013105 Ga0157369_10497639 Ga0157369_104976391 145
54 3300013306 Ga0163162_10001006 Ga0163162_1000100623 145
55 3300013307 Ga0157372_10091516 Ga0157372_100915163 145
56 3300013308 Ga0157375_10015258 Ga0157375_100152585 145
57 3300014325 Ga0163163_10010270 Ga0163163_100102708 145
58 3300014326 Ga0157380_10293396 Ga0157380_102933962 145
59 3300014745 Ga0157377_10009821 Ga0157377_100098213 145
60 3300014968 Ga0157379_10003141 Ga0157379_1000314113 145
61 3300015262 Ga0182007_10023256 Ga0182007_100232563 145
62 3300017792 Ga0163161_10356819 Ga0163161_103568192 145
63 3300025315 Ga0207697_10006428 Ga0207697_100064283 145
64 3300025321 Ga0207656_10025908 Ga0207656_100259083 145
65 3300025893 Ga0207682_10005680 Ga0207682_100056803 145
66 3300025904 Ga0207647_10195785 Ga0207647_101957852 145
67 3300025907 Ga0207645_10000267 Ga0207645_1000026731 145
68 3300025917 Ga0207660_10083349 Ga0207660_100833492 145
69 3300025918 Ga0207662_10002655 Ga0207662_1000265510 145
70 3300025919 Ga0207657_10017502 Ga0207657_100175022 145
71 3300025920 Ga0207649_10024692 Ga0207649_100246924 145
72 3300025923 Ga0207681_10001950 Ga0207681_1000195013 145
73 3300025925 Ga0207650_10004192 Ga0207650_100041927 145
74 3300025926 Ga0207659_10007491 Ga0207659_100074912 145
75 3300025926 Ga0207659_10264237 Ga0207659_102642372 145
76 3300025932 Ga0207690_10013028 Ga0207690_100130286 145
77 3300025933 Ga0207706_10009804 Ga0207706_100098043 145
78 3300025936 Ga0207670_10052770 Ga0207670_100527704 145
79 3300025940 Ga0207691_10000124 Ga0207691_1000012430 145
80 3300025940 Ga0207691_10102660 Ga0207691_101026602 145
81 3300025941 Ga0207711_10313947 Ga0207711_103139472 145
82 3300025942 Ga0207689_10003772 Ga0207689_1000377211 145
83 3300025944 Ga0207661_10051100 Ga0207661_100511004 145
84 3300025945 Ga0207679_10000700 Ga0207679_100007008 145
85 3300025949 Ga0207667_10044658 Ga0207667_100446585 145
86 3300025961 Ga0207712_10069399 Ga0207712_100693993 145
87 3300025981 Ga0207640_10046019 Ga0207640_100460193 145
88 3300025986 Ga0207658_10095677 Ga0207658_100956773 145
89 3300026023 Ga0207677_10002595 Ga0207677_100025959 145
90 3300026035 Ga0207703_10007697 Ga0207703_100076978 145
91 3300026041 Ga0207639_10010259 Ga0207639_100102597 145
92 3300026075 Ga0207708_10021285 Ga0207708_100212855 145
93 3300026088 Ga0207641_10337289 Ga0207641_103372892 145
94 3300026095 Ga0207676_10327430 Ga0207676_103274303 145
95 3300026116 Ga0207674_10005101 Ga0207674_1000510110 145
96 3300026118 Ga0207675_100000073 Ga0207675_10000007364 145
97 3300026142 Ga0207698_10022884 Ga0207698_100228841 145
98 3300028380 Ga0268265_10011944 Ga0268265_100119442 145
99 3300028381 Ga0268264_10030217 Ga0268264_100302173 145
100 3300035170 Ga0373943_0017073 Ga0373943_0017073_289_801 145
101 3300036401 Ga0373937_0911175 Ga0373937_0911175_10_522 145
102 3300037471 Ga0395905_0358540 Ga0395905_0358540_110_622 145
103 3300038443 Ga0395901_1016363 Ga0395901_1016363_280_792 145
104 3300041460 Ga0451802_1617087 Ga0451802_1617087_75_587 145
105 3300042005 Ga0439448_0064085 Ga0439448_0064085_566_1078 145
106 3300042876 Ga0451577_0611274 Ga0451577_0611274_461_973 145
107 3300045051 Ga0451576_1004544 Ga0451576_1004544_120_632 145
108 3300046459 Ga0495629_0226023 Ga0495629_0226023_438_950 145
109 3300046528 Ga0495642_0117854 Ga0495642_0117854_273_785 145
110 3300046681 Ga0495647_0140762 Ga0495647_0140762_170_682 145
111 3300046683 Ga0495658_0263008 Ga0495658_0263008_147_659 145
112 3300047315 Ga0495581_0357140 Ga0495581_0357140_222_734 145
113 3300048909 Ga0496106_0311509 Ga0496106_0311509_717_1229 145
114 3300048912 Ga0496109_0084360 Ga0496109_0084360_1778_2290 145
115 3300048917 Ga0496114_1014845 Ga0496114_1014845_27_539 145
116 3300049570 Ga0501033_0148431 Ga0501033_0148431_506_1018 145
117 3300049570 Ga0501033_0420282 Ga0501033_0420282_402_914 145
118 3300049572 Ga0501036_0131146 Ga0501036_0131146_1493_2005 145
119 3300049574 Ga0501038_0160538 Ga0501038_0160538_23_535 145
120 3300049576 Ga0501040_0011434 Ga0501040_0011434_1080_1592 145
121 3300049580 Ga0501046_0499865 Ga0501046_0499865_198_710 145
122 3300049582 Ga0501048_0078360 Ga0501048_0078360_73_585 145
123 3300049588 Ga0501072_0069103 Ga0501072_0069103_107_619 145
124 3300049592 Ga0501076_0013971 Ga0501076_0013971_4369_4881 145
125 3300049593 Ga0501077_0313608 Ga0501077_0313608_460_972 145
126 3300049742 Ga0501080_0930910 Ga0501080_0930910_87_599 145
127 3300050507 nmdc:mga05p37_106348_c1 nmdc:mga05p37_106348_c1_967_1479 145
128 3300050508 nmdc:mga09592_51799_c1 nmdc:mga09592_51799_c1_1294_1806 145
129 3300050510 nmdc:mga06r32_313984_c1 nmdc:mga06r32_313984_c1_575_1087 145
130 3300050510 nmdc:mga06r32_39284_c1 nmdc:mga06r32_39284_c1_608_1120 145
131 3300050512 nmdc:mga0n895_1190322_c1 nmdc:mga0n895_1190322_c1_210_722 145
132 3300050512 nmdc:mga0n895_1919_c1 nmdc:mga0n895_1919_c1_6613_7125 145
133 3300050512 nmdc:mga0n895_2307_c1 nmdc:mga0n895_2307_c1_11590_12102 145
134 3300050512 nmdc:mga0n895_572583_c1 nmdc:mga0n895_572583_c1_471_983 145
135 3300050513 nmdc:mga0rr50_481079_c1 nmdc:mga0rr50_481079_c1_312_824 145
136 3300050515 nmdc:mga0a205_14814_c1 nmdc:mga0a205_14814_c1_4246_4758 145
137 3300050515 nmdc:mga0a205_53423_c1 nmdc:mga0a205_53423_c1_1284_1796 145
138 3300053118 Ga0500594_0000002 Ga0500594_0000002_830023_830571 145
139 3300054114 Ga0501084_0171973 Ga0501084_0171973_557_1069 145
140 3300060353 Ga0501082_0075923 Ga0501082_0075923_2296_2808 145
141 3300061734 Ga0530510_0492103 Ga0530510_0492103_367_879 145
142 3300006914 Ga0075436_100507516 Ga0075436_1005075162 146
143 3300053125 Ga0500618_002979 Ga0500618_002979_4948_5511 146
144 3300032133 Ga0316583_10024650 Ga0316583_100246502 147
145 3300003758 Ga0055532_1000736 Ga0055532_100073614 148
146 3300006195 Ga0075366_10154093 Ga0075366_101540932 148
147 3300025229 Ga0209147_100053 Ga0209147_100053102 148
148 3300047673 Ga0495593_0168665 Ga0495593_0168665_489_1040 148
149 3300049649 Ga0501198_053201 Ga0501198_053201_138_659 148
150 3300050490 nmdc:mga03n38_656455_c1 nmdc:mga03n38_656455_c1_11_532 148
151 3300050493 nmdc:mga0k408_137697_c1 nmdc:mga0k408_137697_c1_122_679 148
152 3300005436 Ga0070713_100120522 Ga0070713_1001205222 149
153 3300025928 Ga0207700_10185280 Ga0207700_101852802 149
154 3300050512 nmdc:mga0n895_23905_c1 nmdc:mga0n895_23905_c1_2219_2785 149
155 3300050513 nmdc:mga0rr50_783307_c1 nmdc:mga0rr50_783307_c1_11_535 149
156 3300050515 nmdc:mga0a205_115969_c1 nmdc:mga0a205_115969_c1_1124_1690 149
157 3300005341 Ga0070691_10068913 Ga0070691_100689131 150
158 3300006852 Ga0075433_10096250 Ga0075433_100962504 150
159 3300006871 Ga0075434_100009189 Ga0075434_10000918910 150
160 3300006871 Ga0075434_100122155 Ga0075434_1001221554 150
161 3300006914 Ga0075436_100145059 Ga0075436_1001450593 150
162 3300007076 Ga0075435_100005046 Ga0075435_1000050467 150
163 3300045051 Ga0451576_0014051 Ga0451576_0014051_1696_2265 150
164 3300049571 Ga0501034_0205917 Ga0501034_0205917_294_851 150
165 3300050512 nmdc:mga0n895_1574_c1 nmdc:mga0n895_1574_c1_8942_9511 150
166 3300050513 nmdc:mga0rr50_55370_c1 nmdc:mga0rr50_55370_c1_511_1080 150
167 3300050514 nmdc:mga08x19_372281_c1 nmdc:mga08x19_372281_c1_312_881 150
168 3300005548 Ga0070665_100720029 Ga0070665_1007200291 151
169 3300006846 Ga0075430_100001742 Ga0075430_10000174215 151
170 3300037466 Ga0395898_0152291 Ga0395898_0152291_1076_1636 151
171 3300038443 Ga0395901_0364573 Ga0395901_0364573_409_969 151
172 3300042156 Ga0439446_0096860 Ga0439446_0096860_299_838 151
173 3300050512 nmdc:mga0n895_227436_c1 nmdc:mga0n895_227436_c1_290_859 151
174 3300050515 nmdc:mga0a205_46322_c1 nmdc:mga0a205_46322_c1_973_1542 151
175 3300005466 Ga0070685_10197847 Ga0070685_101978472 152
176 3300042156 Ga0439446_0108724 Ga0439446_0108724_138_692 152
177 3300048924 Ga0496121_0002209 Ga0496121_0002209_25208_25765 152
178 3300048927 Ga0496124_0011492 Ga0496124_0011492_752_1309 152
179 3300050508 nmdc:mga09592_341055_c1 nmdc:mga09592_341055_c1_130_693 152
180 3300050509 nmdc:mga0qj67_45376_c1 nmdc:mga0qj67_45376_c1_1013_1576 152
181 3300050510 nmdc:mga06r32_159464_c1 nmdc:mga06r32_159464_c1_17_550 152
182 3300025904 Ga0207647_10278603 Ga0207647_102786032 153
183 3300031824 Ga0307413_10069582 Ga0307413_100695822 153
184 3300032004 Ga0307414_10018739 Ga0307414_100187394 153
185 3300032005 Ga0307411_10094333 Ga0307411_100943333 153
186 3300039437 Ga0436365_0479744 Ga0436365_0479744_37_576 153
187 3300046492 Ga0495585_0426236 Ga0495585_0426236_40_594 153
188 3300005434 Ga0070709_10064529 Ga0070709_100645293 154
189 3300005444 Ga0070694_100128137 Ga0070694_1001281372 154
190 3300005445 Ga0070708_100003104 Ga0070708_10000310410 154
191 3300005445 Ga0070708_100045450 Ga0070708_1000454504 154
192 3300005467 Ga0070706_100019882 Ga0070706_1000198828 154
193 3300005467 Ga0070706_100438411 Ga0070706_1004384112 154
194 3300005468 Ga0070707_100204293 Ga0070707_1002042932 154
195 3300005468 Ga0070707_100967413 Ga0070707_1009674131 154
196 3300005471 Ga0070698_100002188 Ga0070698_10000218812 154
197 3300005536 Ga0070697_100140942 Ga0070697_1001409423 154
198 3300005536 Ga0070697_100191978 Ga0070697_1001919783 154
199 3300005545 Ga0070695_100388602 Ga0070695_1003886021 154
200 3300006846 Ga0075430_100349267 Ga0075430_1003492672 154
201 3300006847 Ga0075431_100023932 Ga0075431_1000239323 154
202 3300006852 Ga0075433_10019290 Ga0075433_100192905 154
203 3300006852 Ga0075433_10320685 Ga0075433_103206852 154
204 3300006871 Ga0075434_100059833 Ga0075434_1000598334 154
205 3300006871 Ga0075434_100156563 Ga0075434_1001565632 154
206 3300006880 Ga0075429_100006449 Ga0075429_10000644910 154
207 3300006914 Ga0075436_100003907 Ga0075436_1000039078 154
208 3300006914 Ga0075436_100360317 Ga0075436_1003603172 154
209 3300007076 Ga0075435_100283510 Ga0075435_1002835101 154
210 3300009147 Ga0114129_10334606 Ga0114129_103346062 154
211 3300009147 Ga0114129_10424428 Ga0114129_104244282 154
212 3300013307 Ga0157372_10934055 Ga0157372_109340552 154
213 3300017792 Ga0163161_10266881 Ga0163161_102668812 154
214 3300025910 Ga0207684_10265564 Ga0207684_102655642 154
215 3300025916 Ga0207663_10226994 Ga0207663_102269942 154
216 3300025922 Ga0207646_10664212 Ga0207646_106642122 154
217 3300031995 Ga0307409_100718902 Ga0307409_1007189022 154
218 3300038996 Ga0242420_001481 Ga0242420_001481_2418_2969 154
219 3300042876 Ga0451577_0071378 Ga0451577_0071378_1677_2228 154
220 3300044673 Ga0453683_0249604 Ga0453683_0249604_11_562 154
221 3300045051 Ga0451576_0033100 Ga0451576_0033100_786_1337 154
222 3300045051 Ga0451576_0116219 Ga0451576_0116219_1076_1627 154
223 3300045051 Ga0451576_0286223 Ga0451576_0286223_938_1489 154
224 3300045051 Ga0451576_0411948 Ga0451576_0411948_114_665 154
225 3300046472 Ga0495580_0079783 Ga0495580_0079783_240_794 154
226 3300046517 Ga0495630_0188832 Ga0495630_0188832_700_1251 154
227 3300046526 Ga0495666_0093790 Ga0495666_0093790_130_681 154
228 3300046535 Ga0495586_0235721 Ga0495586_0235721_242_793 154
229 3300049591 Ga0501075_0117832 Ga0501075_0117832_205_756 154
230 3300049742 Ga0501080_0772936 Ga0501080_0772936_250_798 154
231 3300050507 nmdc:mga05p37_47795_c1 nmdc:mga05p37_47795_c1_3005_3556 154
232 3300050508 nmdc:mga09592_217202_c1 nmdc:mga09592_217202_c1_505_1056 154
233 3300050510 nmdc:mga06r32_26098_c1 nmdc:mga06r32_26098_c1_3364_3915 154
234 3300050512 nmdc:mga0n895_3125_c1 nmdc:mga0n895_3125_c1_4122_4673 154
235 3300050513 nmdc:mga0rr50_101881_c1 nmdc:mga0rr50_101881_c1_1122_1673 154
236 3300050514 nmdc:mga08x19_416786_c1 nmdc:mga08x19_416786_c1_151_702 154
237 3300050515 nmdc:mga0a205_32015_c2 nmdc:mga0a205_32015_c2_1350_1901 154
238 3300050515 nmdc:mga0a205_446766_c1 nmdc:mga0a205_446766_c1_277_828 154
239 3300005295 Ga0065707_10156161 Ga0065707_101561613 155
240 3300005343 Ga0070687_100145220 Ga0070687_1001452202 155
241 3300005345 Ga0070692_10206604 Ga0070692_102066042 155
242 3300005406 Ga0070703_10216051 Ga0070703_102160512 155
243 3300005434 Ga0070709_10002860 Ga0070709_100028606 155
244 3300005434 Ga0070709_10147409 Ga0070709_101474092 155
245 3300005435 Ga0070714_100028375 Ga0070714_1000283751 155
246 3300005435 Ga0070714_100319241 Ga0070714_1003192412 155
247 3300005436 Ga0070713_100287896 Ga0070713_1002878962 155
248 3300005439 Ga0070711_100000763 Ga0070711_1000007638 155
249 3300005439 Ga0070711_100043432 Ga0070711_1000434322 155
250 3300005440 Ga0070705_100004409 Ga0070705_1000044097 155
251 3300005440 Ga0070705_100301220 Ga0070705_1003012202 155
252 3300005444 Ga0070694_100049828 Ga0070694_1000498284 155
253 3300005444 Ga0070694_100065662 Ga0070694_1000656624 155
254 3300005444 Ga0070694_100436182 Ga0070694_1004361821 155
255 3300005444 Ga0070694_101052501 Ga0070694_1010525011 155
256 3300005467 Ga0070706_100025904 Ga0070706_1000259045 155
257 3300005467 Ga0070706_100498172 Ga0070706_1004981721 155
258 3300005468 Ga0070707_101139567 Ga0070707_1011395671 155
259 3300005471 Ga0070698_100090936 Ga0070698_1000909362 155
260 3300005471 Ga0070698_100226699 Ga0070698_1002266993 155
261 3300005518 Ga0070699_100088760 Ga0070699_1000887602 155
262 3300005536 Ga0070697_100062375 Ga0070697_1000623752 155
263 3300005545 Ga0070695_100000766 Ga0070695_10000076616 155
264 3300005545 Ga0070695_100080454 Ga0070695_1000804543 155
265 3300005545 Ga0070695_100116107 Ga0070695_1001161071 155
266 3300005546 Ga0070696_100028934 Ga0070696_1000289343 155
267 3300005546 Ga0070696_100033862 Ga0070696_1000338624 155
268 3300005546 Ga0070696_100133051 Ga0070696_1001330512 155
269 3300005549 Ga0070704_100004453 Ga0070704_1000044536 155
270 3300005549 Ga0070704_100007933 Ga0070704_1000079333 155
271 3300005549 Ga0070704_100049260 Ga0070704_1000492603 155
272 3300005549 Ga0070704_100171632 Ga0070704_1001716322 155
273 3300006028 Ga0070717_10148234 Ga0070717_101482341 155
274 3300006173 Ga0070716_100036528 Ga0070716_1000365282 155
275 3300006173 Ga0070716_100111920 Ga0070716_1001119202 155
276 3300006175 Ga0070712_100027361 Ga0070712_1000273614 155
277 3300006844 Ga0075428_100454033 Ga0075428_1004540332 155
278 3300006847 Ga0075431_100157152 Ga0075431_1001571523 155
279 3300006852 Ga0075433_10002006 Ga0075433_1000200612 155
280 3300006852 Ga0075433_10279999 Ga0075433_102799992 155
281 3300006871 Ga0075434_100047773 Ga0075434_1000477733 155
282 3300006871 Ga0075434_100170357 Ga0075434_1001703572 155
283 3300006871 Ga0075434_100209120 Ga0075434_1002091203 155
284 3300006914 Ga0075436_100015422 Ga0075436_1000154227 155
285 3300006914 Ga0075436_100034721 Ga0075436_1000347213 155
286 3300007076 Ga0075435_100592094 Ga0075435_1005920942 155
287 3300007076 Ga0075435_101069852 Ga0075435_1010698522 155
288 3300007265 Ga0099794_10247155 Ga0099794_102471552 155
289 3300009147 Ga0114129_10241792 Ga0114129_102417922 155
290 3300009147 Ga0114129_11727715 Ga0114129_117277152 155
291 3300013308 Ga0157375_10001559 Ga0157375_1000155916 155
292 3300025885 Ga0207653_10003351 Ga0207653_100033517 155
293 3300025885 Ga0207653_10093059 Ga0207653_100930592 155
294 3300025906 Ga0207699_10004506 Ga0207699_100045063 155
295 3300025906 Ga0207699_10113348 Ga0207699_101133482 155
296 3300025910 Ga0207684_10012758 Ga0207684_100127585 155
297 3300025910 Ga0207684_10025200 Ga0207684_100252008 155
298 3300025915 Ga0207693_10011202 Ga0207693_100112024 155
299 3300025916 Ga0207663_10000529 Ga0207663_100005298 155
300 3300025916 Ga0207663_10394237 Ga0207663_103942372 155
301 3300025922 Ga0207646_10003953 Ga0207646_1000395311 155
302 3300025922 Ga0207646_10041894 Ga0207646_100418944 155
303 3300025922 Ga0207646_10320785 Ga0207646_103207852 155
304 3300025928 Ga0207700_10015427 Ga0207700_100154274 155
305 3300025929 Ga0207664_10004982 Ga0207664_100049822 155
306 3300025939 Ga0207665_10002787 Ga0207665_1000278712 155
307 3300025939 Ga0207665_10020492 Ga0207665_100204925 155
308 3300025939 Ga0207665_10179007 Ga0207665_101790072 155
309 3300026142 Ga0207698_10968950 Ga0207698_109689502 155
310 3300031548 Ga0307408_100268737 Ga0307408_1002687371 155
311 3300031711 Ga0265314_10285958 Ga0265314_102859582 155
312 3300031731 Ga0307405_10196779 Ga0307405_101967792 155
313 3300031824 Ga0307413_10012087 Ga0307413_100120874 155
314 3300031852 Ga0307410_10132424 Ga0307410_101324242 155
315 3300031901 Ga0307406_10074775 Ga0307406_100747751 155
316 3300031995 Ga0307409_101032041 Ga0307409_1010320412 155
317 3300032004 Ga0307414_10073604 Ga0307414_100736044 155
318 3300037068 Ga0373925_0131580 Ga0373925_0131580_378_929 155
319 3300044673 Ga0453683_0091147 Ga0453683_0091147_601_1167 155
320 3300045049 Ga0466959_0254615 Ga0466959_0254615_171_722 155
321 3300045051 Ga0451576_0235878 Ga0451576_0235878_683_1240 155
322 3300045976 Ga0466967_0423507 Ga0466967_0423507_648_1199 155
323 3300049765 Ga0501268_023134 Ga0501268_023134_159_710 155
324 3300050507 nmdc:mga05p37_281510_c1 nmdc:mga05p37_281510_c1_861_1418 155
325 3300050507 nmdc:mga05p37_608385_c1 nmdc:mga05p37_608385_c1_126_683 155
326 3300050507 nmdc:mga05p37_999832_c1 nmdc:mga05p37_999832_c1_200_772 155
327 3300050510 nmdc:mga06r32_357944_c1 nmdc:mga06r32_357944_c1_41_598 155
328 3300050512 nmdc:mga0n895_114290_c1 nmdc:mga0n895_114290_c1_2069_2641 155
329 3300050512 nmdc:mga0n895_6624_c1 nmdc:mga0n895_6624_c1_6568_7134 155
330 3300050513 nmdc:mga0rr50_106710_c1 nmdc:mga0rr50_106710_c1_287_847 155
331 3300050513 nmdc:mga0rr50_108757_c1 nmdc:mga0rr50_108757_c1_287_859 155
332 3300050514 nmdc:mga08x19_11535_c1 nmdc:mga08x19_11535_c1_1698_2255 155
333 3300050514 nmdc:mga08x19_2911_c1 nmdc:mga08x19_2911_c1_5748_6308 155
334 3300050514 nmdc:mga08x19_569815_c1 nmdc:mga08x19_569815_c1_59_625 155
335 3300050515 nmdc:mga0a205_152270_c1 nmdc:mga0a205_152270_c1_1006_1578 155
336 3300050515 nmdc:mga0a205_582_c1 nmdc:mga0a205_582_c1_20557_21123 155
337 3300050515 nmdc:mga0a205_591774_c1 nmdc:mga0a205_591774_c1_22_579 155
338 3300053148 Ga0500590_059403 Ga0500590_059403_1147_1707 155
339 3300003322 rootL2_10047888 rootL2_100478883 156
340 3300004803 Ga0058862_12766732 Ga0058862_127667322 156
341 3300005290 Ga0065712_10273635 Ga0065712_102736352 156
342 3300005293 Ga0065715_10208396 Ga0065715_102083962 156
343 3300005295 Ga0065707_10184341 Ga0065707_101843412 156
344 3300005295 Ga0065707_10514479 Ga0065707_105144791 156
345 3300005327 Ga0070658_10009041 Ga0070658_100090413 156
346 3300005327 Ga0070658_10023796 Ga0070658_100237962 156
347 3300005328 Ga0070676_10001338 Ga0070676_100013383 156
348 3300005329 Ga0070683_100011534 Ga0070683_1000115342 156
349 3300005329 Ga0070683_100100523 Ga0070683_1001005233 156
350 3300005331 Ga0070670_100006075 Ga0070670_1000060754 156
351 3300005331 Ga0070670_100481995 Ga0070670_1004819951 156
352 3300005331 Ga0070670_100551229 Ga0070670_1005512291 156
353 3300005333 Ga0070677_10003562 Ga0070677_100035627 156
354 3300005334 Ga0068869_100772626 Ga0068869_1007726261 156
355 3300005335 Ga0070666_10091777 Ga0070666_100917773 156
356 3300005335 Ga0070666_10280251 Ga0070666_102802512 156
357 3300005335 Ga0070666_10469668 Ga0070666_104696682 156
358 3300005336 Ga0070680_100005245 Ga0070680_10000524510 156
359 3300005336 Ga0070680_100043681 Ga0070680_1000436815 156
360 3300005336 Ga0070680_100055182 Ga0070680_1000551822 156
361 3300005336 Ga0070680_100081380 Ga0070680_1000813802 156
362 3300005336 Ga0070680_100767975 Ga0070680_1007679751 156
363 3300005336 Ga0070680_100852438 Ga0070680_1008524381 156
364 3300005337 Ga0070682_101350022 Ga0070682_1013500221 156
365 3300005339 Ga0070660_100015441 Ga0070660_1000154413 156
366 3300005339 Ga0070660_100058949 Ga0070660_1000589492 156
367 3300005339 Ga0070660_100545427 Ga0070660_1005454272 156
368 3300005339 Ga0070660_100862697 Ga0070660_1008626971 156
369 3300005340 Ga0070689_100016069 Ga0070689_1000160692 156
370 3300005340 Ga0070689_100039876 Ga0070689_1000398763 156
371 3300005341 Ga0070691_10207304 Ga0070691_102073042 156
372 3300005344 Ga0070661_100003226 Ga0070661_10000322610 156
373 3300005344 Ga0070661_100020303 Ga0070661_1000203033 156
374 3300005344 Ga0070661_100031136 Ga0070661_1000311364 156
375 3300005344 Ga0070661_100110416 Ga0070661_1001104163 156
376 3300005344 Ga0070661_100570307 Ga0070661_1005703072 156
377 3300005344 Ga0070661_101342487 Ga0070661_1013424871 156
378 3300005345 Ga0070692_10086845 Ga0070692_100868451 156
379 3300005345 Ga0070692_10101147 Ga0070692_101011472 156
380 3300005345 Ga0070692_10161796 Ga0070692_101617962 156
381 3300005347 Ga0070668_100003214 Ga0070668_1000032144 156
382 3300005347 Ga0070668_100059198 Ga0070668_1000591983 156
383 3300005353 Ga0070669_100003091 Ga0070669_1000030913 156
384 3300005353 Ga0070669_100006591 Ga0070669_1000065914 156
385 3300005353 Ga0070669_100647778 Ga0070669_1006477781 156
386 3300005354 Ga0070675_100032603 Ga0070675_1000326034 156
387 3300005354 Ga0070675_100050984 Ga0070675_1000509844 156
388 3300005354 Ga0070675_101329155 Ga0070675_1013291551 156
389 3300005355 Ga0070671_100017519 Ga0070671_1000175192 156
390 3300005355 Ga0070671_100287392 Ga0070671_1002873922 156
391 3300005355 Ga0070671_100773801 Ga0070671_1007738012 156
392 3300005364 Ga0070673_100216339 Ga0070673_1002163392 156
393 3300005364 Ga0070673_100337301 Ga0070673_1003373012 156
394 3300005364 Ga0070673_101464189 Ga0070673_1014641891 156
395 3300005364 Ga0070673_101464190 Ga0070673_1014641901 156
396 3300005365 Ga0070688_100017268 Ga0070688_1000172684 156
397 3300005366 Ga0070659_100004329 Ga0070659_1000043293 156
398 3300005366 Ga0070659_100119172 Ga0070659_1001191721 156
399 3300005366 Ga0070659_100143173 Ga0070659_1001431732 156
400 3300005366 Ga0070659_100193879 Ga0070659_1001938792 156
401 3300005366 Ga0070659_100417976 Ga0070659_1004179762 156
402 3300005367 Ga0070667_100023300 Ga0070667_1000233006 156
403 3300005367 Ga0070667_100165741 Ga0070667_1001657413 156
404 3300005406 Ga0070703_10069069 Ga0070703_100690692 156
405 3300005435 Ga0070714_100015492 Ga0070714_1000154924 156
406 3300005435 Ga0070714_100540160 Ga0070714_1005401602 156
407 3300005436 Ga0070713_100020561 Ga0070713_1000205613 156
408 3300005438 Ga0070701_10011686 Ga0070701_100116864 156
409 3300005438 Ga0070701_10053321 Ga0070701_100533213 156
410 3300005438 Ga0070701_10090699 Ga0070701_100906992 156
411 3300005439 Ga0070711_100103221 Ga0070711_1001032213 156
412 3300005439 Ga0070711_100548056 Ga0070711_1005480562 156
413 3300005441 Ga0070700_100012422 Ga0070700_1000124225 156
414 3300005441 Ga0070700_100130222 Ga0070700_1001302222 156
415 3300005444 Ga0070694_100005166 Ga0070694_1000051665 156
416 3300005444 Ga0070694_100007601 Ga0070694_1000076014 156
417 3300005444 Ga0070694_100062238 Ga0070694_1000622382 156
418 3300005444 Ga0070694_100093833 Ga0070694_1000938332 156
419 3300005444 Ga0070694_100238942 Ga0070694_1002389421 156
420 3300005445 Ga0070708_100023798 Ga0070708_1000237984 156
421 3300005445 Ga0070708_100263627 Ga0070708_1002636272 156
422 3300005445 Ga0070708_100603490 Ga0070708_1006034901 156
423 3300005456 Ga0070678_100119539 Ga0070678_1001195393 156
424 3300005457 Ga0070662_100079964 Ga0070662_1000799643 156
425 3300005457 Ga0070662_100478267 Ga0070662_1004782672 156
426 3300005457 Ga0070662_100583617 Ga0070662_1005836172 156
427 3300005458 Ga0070681_10001510 Ga0070681_100015109 156
428 3300005458 Ga0070681_10001743 Ga0070681_100017436 156
429 3300005458 Ga0070681_10015442 Ga0070681_100154425 156
430 3300005458 Ga0070681_10100356 Ga0070681_101003563 156
431 3300005458 Ga0070681_10211006 Ga0070681_102110062 156
432 3300005459 Ga0068867_100101141 Ga0068867_1001011413 156
433 3300005459 Ga0068867_100145152 Ga0068867_1001451522 156
434 3300005459 Ga0068867_100170171 Ga0068867_1001701712 156
435 3300005466 Ga0070685_10022699 Ga0070685_100226992 156
436 3300005467 Ga0070706_100004050 Ga0070706_10000405011 156
437 3300005467 Ga0070706_100009104 Ga0070706_1000091046 156
438 3300005467 Ga0070706_100175207 Ga0070706_1001752072 156
439 3300005467 Ga0070706_100324018 Ga0070706_1003240182 156
440 3300005468 Ga0070707_100009027 Ga0070707_1000090273 156
441 3300005468 Ga0070707_100013395 Ga0070707_10001339510 156
442 3300005471 Ga0070698_100005453 Ga0070698_1000054536 156
443 3300005471 Ga0070698_100022556 Ga0070698_1000225563 156
444 3300005471 Ga0070698_100040069 Ga0070698_1000400692 156
445 3300005471 Ga0070698_101145347 Ga0070698_1011453471 156
446 3300005518 Ga0070699_100003425 Ga0070699_10000342512 156
447 3300005518 Ga0070699_100003978 Ga0070699_1000039783 156
448 3300005518 Ga0070699_100021866 Ga0070699_1000218665 156
449 3300005518 Ga0070699_100034681 Ga0070699_1000346814 156
450 3300005518 Ga0070699_100047467 Ga0070699_1000474673 156
451 3300005518 Ga0070699_100049321 Ga0070699_1000493214 156
452 3300005518 Ga0070699_100855094 Ga0070699_1008550941 156
453 3300005530 Ga0070679_100011678 Ga0070679_1000116789 156
454 3300005530 Ga0070679_100012367 Ga0070679_1000123677 156
455 3300005530 Ga0070679_100036557 Ga0070679_1000365575 156
456 3300005530 Ga0070679_100153483 Ga0070679_1001534832 156
457 3300005530 Ga0070679_100599943 Ga0070679_1005999432 156
458 3300005530 Ga0070679_101080389 Ga0070679_1010803891 156
459 3300005535 Ga0070684_100001201 Ga0070684_1000012019 156
460 3300005535 Ga0070684_100124039 Ga0070684_1001240392 156
461 3300005535 Ga0070684_100145302 Ga0070684_1001453021 156
462 3300005535 Ga0070684_100273265 Ga0070684_1002732652 156
463 3300005536 Ga0070697_100003808 Ga0070697_1000038085 156
464 3300005536 Ga0070697_100048947 Ga0070697_1000489474 156
465 3300005536 Ga0070697_100259172 Ga0070697_1002591722 156
466 3300005539 Ga0068853_100025797 Ga0068853_1000257977 156
467 3300005539 Ga0068853_100070909 Ga0068853_1000709094 156
468 3300005543 Ga0070672_100007978 Ga0070672_1000079786 156
469 3300005543 Ga0070672_100125948 Ga0070672_1001259482 156
470 3300005543 Ga0070672_100161078 Ga0070672_1001610782 156
471 3300005544 Ga0070686_100104594 Ga0070686_1001045943 156
472 3300005545 Ga0070695_100022573 Ga0070695_1000225735 156
473 3300005545 Ga0070695_100027500 Ga0070695_1000275004 156
474 3300005546 Ga0070696_100000557 Ga0070696_1000005578 156
475 3300005546 Ga0070696_100002916 Ga0070696_1000029167 156
476 3300005546 Ga0070696_100053328 Ga0070696_1000533284 156
477 3300005546 Ga0070696_100096352 Ga0070696_1000963523 156
478 3300005547 Ga0070693_100039499 Ga0070693_1000394993 156
479 3300005547 Ga0070693_100049802 Ga0070693_1000498022 156
480 3300005548 Ga0070665_100074227 Ga0070665_1000742273 156
481 3300005548 Ga0070665_101096035 Ga0070665_1010960351 156
482 3300005549 Ga0070704_100002995 Ga0070704_1000029956 156
483 3300005549 Ga0070704_100003240 Ga0070704_1000032401 156
484 3300005549 Ga0070704_100008264 Ga0070704_1000082643 156
485 3300005549 Ga0070704_100153674 Ga0070704_1001536742 156
486 3300005563 Ga0068855_100397026 Ga0068855_1003970262 156
487 3300005563 Ga0068855_100563239 Ga0068855_1005632392 156
488 3300005563 Ga0068855_100605530 Ga0068855_1006055302 156
489 3300005563 Ga0068855_101414225 Ga0068855_1014142251 156
490 3300005564 Ga0070664_100071838 Ga0070664_1000718383 156
491 3300005564 Ga0070664_100094454 Ga0070664_1000944543 156
492 3300005577 Ga0068857_100766560 Ga0068857_1007665602 156
493 3300005578 Ga0068854_100042976 Ga0068854_1000429763 156
494 3300005614 Ga0068856_100196671 Ga0068856_1001966712 156
495 3300005614 Ga0068856_100477274 Ga0068856_1004772742 156
496 3300005615 Ga0070702_100005374 Ga0070702_1000053744 156
497 3300005615 Ga0070702_100223738 Ga0070702_1002237382 156
498 3300005616 Ga0068852_100055216 Ga0068852_1000552165 156
499 3300005616 Ga0068852_100663718 Ga0068852_1006637182 156
500 3300005617 Ga0068859_100015946 Ga0068859_1000159469 156
501 3300005617 Ga0068859_100084497 Ga0068859_1000844973 156
502 3300005617 Ga0068859_100235657 Ga0068859_1002356572 156
503 3300005617 Ga0068859_100424737 Ga0068859_1004247372 156
504 3300005718 Ga0068866_10024774 Ga0068866_100247743 156
505 3300005719 Ga0068861_100265654 Ga0068861_1002656542 156
506 3300005719 Ga0068861_100609738 Ga0068861_1006097382 156
507 3300005840 Ga0068870_10109191 Ga0068870_101091913 156
508 3300005841 Ga0068863_100538760 Ga0068863_1005387602 156
509 3300005843 Ga0068860_100196845 Ga0068860_1001968453 156
510 3300005844 Ga0068862_100000174 Ga0068862_10000017411 156
511 3300005844 Ga0068862_100059030 Ga0068862_1000590304 156
512 3300005844 Ga0068862_100080212 Ga0068862_1000802123 156
513 3300005844 Ga0068862_100336604 Ga0068862_1003366042 156
514 3300005844 Ga0068862_100768156 Ga0068862_1007681562 156
515 3300005985 Ga0081539_10144261 Ga0081539_101442612 156
516 3300006028 Ga0070717_10467355 Ga0070717_104673551 156
517 3300006028 Ga0070717_10566197 Ga0070717_105661972 156
518 3300006058 Ga0075432_10168757 Ga0075432_101687572 156
519 3300006163 Ga0070715_10430265 Ga0070715_104302652 156
520 3300006175 Ga0070712_100019259 Ga0070712_1000192595 156
521 3300006175 Ga0070712_100028546 Ga0070712_1000285462 156
522 3300006178 Ga0075367_10509878 Ga0075367_105098781 156
523 3300006358 Ga0068871_100599514 Ga0068871_1005995142 156
524 3300006844 Ga0075428_100004397 Ga0075428_10000439711 156
525 3300006844 Ga0075428_100017502 Ga0075428_1000175024 156
526 3300006844 Ga0075428_100065223 Ga0075428_1000652232 156
527 3300006844 Ga0075428_100272896 Ga0075428_1002728962 156
528 3300006846 Ga0075430_100009716 Ga0075430_10000971610 156
529 3300006846 Ga0075430_100045232 Ga0075430_1000452323 156
530 3300006846 Ga0075430_100054291 Ga0075430_1000542913 156
531 3300006846 Ga0075430_100095435 Ga0075430_1000954352 156
532 3300006846 Ga0075430_100334933 Ga0075430_1003349332 156
533 3300006846 Ga0075430_100652849 Ga0075430_1006528492 156
534 3300006847 Ga0075431_100011703 Ga0075431_1000117037 156
535 3300006847 Ga0075431_100172718 Ga0075431_1001727183 156
536 3300006847 Ga0075431_100392137 Ga0075431_1003921372 156
537 3300006847 Ga0075431_100465403 Ga0075431_1004654032 156
538 3300006847 Ga0075431_100581859 Ga0075431_1005818593 156
539 3300006847 Ga0075431_100670104 Ga0075431_1006701042 156
540 3300006852 Ga0075433_10084032 Ga0075433_100840322 156
541 3300006852 Ga0075433_10102622 Ga0075433_101026224 156
542 3300006852 Ga0075433_10249971 Ga0075433_102499713 156
543 3300006871 Ga0075434_100025733 Ga0075434_1000257333 156
544 3300006871 Ga0075434_100045126 Ga0075434_1000451264 156
545 3300006871 Ga0075434_100522052 Ga0075434_1005220522 156
546 3300006871 Ga0075434_100570052 Ga0075434_1005700522 156
547 3300006880 Ga0075429_100010632 Ga0075429_1000106329 156
548 3300006880 Ga0075429_100085461 Ga0075429_1000854614 156
549 3300006880 Ga0075429_100205912 Ga0075429_1002059123 156
550 3300006914 Ga0075436_100006600 Ga0075436_1000066003 156
551 3300006914 Ga0075436_100159040 Ga0075436_1001590402 156
552 3300006914 Ga0075436_100182347 Ga0075436_1001823472 156
553 3300006931 Ga0097620_100015946 Ga0097620_1000159469 156
554 3300006931 Ga0097620_100084495 Ga0097620_1000844953 156
555 3300006931 Ga0097620_100235656 Ga0097620_1002356562 156
556 3300006931 Ga0097620_100424727 Ga0097620_1004247272 156
557 3300007076 Ga0075435_100013658 Ga0075435_1000136583 156
558 3300007076 Ga0075435_100090136 Ga0075435_1000901363 156
559 3300007076 Ga0075435_100114637 Ga0075435_1001146372 156
560 3300007076 Ga0075435_100272701 Ga0075435_1002727012 156
561 3300007265 Ga0099794_10286798 Ga0099794_102867982 156
562 3300009093 Ga0105240_10003506 Ga0105240_1000350623 156
563 3300009093 Ga0105240_10031807 Ga0105240_100318074 156
564 3300009093 Ga0105240_10084049 Ga0105240_100840494 156
565 3300009093 Ga0105240_10170312 Ga0105240_101703122 156
566 3300009094 Ga0111539_10149686 Ga0111539_101496862 156
567 3300009094 Ga0111539_10633362 Ga0111539_106333622 156
568 3300009094 Ga0111539_11167040 Ga0111539_111670402 156
569 3300009098 Ga0105245_10602813 Ga0105245_106028132 156
570 3300009098 Ga0105245_11456042 Ga0105245_114560422 156
571 3300009147 Ga0114129_10038312 Ga0114129_100383123 156
572 3300009148 Ga0105243_10258773 Ga0105243_102587732 156
573 3300009174 Ga0105241_10009703 Ga0105241_100097033 156
574 3300009176 Ga0105242_10048006 Ga0105242_100480062 156
575 3300009177 Ga0105248_10167669 Ga0105248_101676693 156
576 3300009551 Ga0105238_10467858 Ga0105238_104678582 156
577 3300009553 Ga0105249_10000202 Ga0105249_1000020242 156
578 3300009553 Ga0105249_10104817 Ga0105249_101048173 156
579 3300009553 Ga0105249_10805792 Ga0105249_108057922 156
580 3300013100 Ga0157373_10002032 Ga0157373_100020322 156
581 3300013100 Ga0157373_10059108 Ga0157373_100591082 156
582 3300013100 Ga0157373_10503986 Ga0157373_105039862 156
583 3300013102 Ga0157371_10024497 Ga0157371_100244974 156
584 3300013102 Ga0157371_10028167 Ga0157371_100281674 156
585 3300013102 Ga0157371_10726890 Ga0157371_107268902 156
586 3300013102 Ga0157371_10853337 Ga0157371_108533371 156
587 3300013104 Ga0157370_10001252 Ga0157370_1000125225 156
588 3300013104 Ga0157370_10027603 Ga0157370_100276032 156
589 3300013104 Ga0157370_10037747 Ga0157370_100377474 156
590 3300013104 Ga0157370_10057063 Ga0157370_100570634 156
591 3300013104 Ga0157370_10447669 Ga0157370_104476692 156
592 3300013104 Ga0157370_10693496 Ga0157370_106934962 156
593 3300013104 Ga0157370_11018516 Ga0157370_110185162 156
594 3300013105 Ga0157369_10020822 Ga0157369_100208226 156
595 3300013105 Ga0157369_10027155 Ga0157369_100271554 156
596 3300013105 Ga0157369_10196094 Ga0157369_101960943 156
597 3300013105 Ga0157369_10216120 Ga0157369_102161202 156
598 3300013296 Ga0157374_10190375 Ga0157374_101903753 156
599 3300013296 Ga0157374_10446678 Ga0157374_104466782 156
600 3300013297 Ga0157378_10009314 Ga0157378_100093148 156
601 3300013297 Ga0157378_10168495 Ga0157378_101684953 156
602 3300013297 Ga0157378_11514332 Ga0157378_115143322 156
603 3300013306 Ga0163162_10172950 Ga0163162_101729502 156
604 3300013307 Ga0157372_10005157 Ga0157372_100051578 156
605 3300013307 Ga0157372_10017987 Ga0157372_100179877 156
606 3300013307 Ga0157372_10021493 Ga0157372_100214935 156
607 3300013307 Ga0157372_10022214 Ga0157372_100222145 156
608 3300013307 Ga0157372_10029768 Ga0157372_100297684 156
609 3300013307 Ga0157372_10031639 Ga0157372_100316395 156
610 3300013307 Ga0157372_10074672 Ga0157372_100746723 156
611 3300013307 Ga0157372_10133341 Ga0157372_101333411 156
612 3300013307 Ga0157372_11705928 Ga0157372_117059281 156
613 3300013308 Ga0157375_10088154 Ga0157375_100881543 156
614 3300013308 Ga0157375_10163344 Ga0157375_101633442 156
615 3300013308 Ga0157375_11467913 Ga0157375_114679131 156
616 3300014326 Ga0157380_10692446 Ga0157380_106924462 156
617 3300014497 Ga0182008_10119759 Ga0182008_101197592 156
618 3300014745 Ga0157377_10010160 Ga0157377_100101604 156
619 3300014745 Ga0157377_10118108 Ga0157377_101181082 156
620 3300020082 Ga0206353_11560936 Ga0206353_115609362 156
621 3300021384 Ga0213876_10200344 Ga0213876_102003442 156
622 3300025885 Ga0207653_10000258 Ga0207653_100002582 156
623 3300025899 Ga0207642_10062229 Ga0207642_100622292 156
624 3300025901 Ga0207688_10017583 Ga0207688_100175833 156
625 3300025903 Ga0207680_10273093 Ga0207680_102730932 156
626 3300025903 Ga0207680_10354407 Ga0207680_103544071 156
627 3300025903 Ga0207680_10744120 Ga0207680_107441201 156
628 3300025904 Ga0207647_10089925 Ga0207647_100899252 156
629 3300025906 Ga0207699_10141848 Ga0207699_101418482 156
630 3300025907 Ga0207645_10099225 Ga0207645_100992252 156
631 3300025908 Ga0207643_10032681 Ga0207643_100326812 156
632 3300025908 Ga0207643_10040135 Ga0207643_100401353 156
633 3300025909 Ga0207705_10021651 Ga0207705_100216513 156
634 3300025909 Ga0207705_10090304 Ga0207705_100903042 156
635 3300025909 Ga0207705_10191650 Ga0207705_101916501 156
636 3300025909 Ga0207705_10455854 Ga0207705_104558542 156
637 3300025910 Ga0207684_10138245 Ga0207684_101382452 156
638 3300025910 Ga0207684_10180151 Ga0207684_101801512 156
639 3300025911 Ga0207654_10019437 Ga0207654_100194374 156
640 3300025912 Ga0207707_10000375 Ga0207707_1000037518 156
641 3300025912 Ga0207707_10009397 Ga0207707_100093973 156
642 3300025912 Ga0207707_10011934 Ga0207707_100119348 156
643 3300025912 Ga0207707_10015521 Ga0207707_100155216 156
644 3300025912 Ga0207707_10190165 Ga0207707_101901652 156
645 3300025913 Ga0207695_10001648 Ga0207695_1000164831 156
646 3300025913 Ga0207695_10024557 Ga0207695_100245575 156
647 3300025913 Ga0207695_10094850 Ga0207695_100948502 156
648 3300025913 Ga0207695_10277877 Ga0207695_102778772 156
649 3300025915 Ga0207693_10029290 Ga0207693_100292903 156
650 3300025917 Ga0207660_10001140 Ga0207660_100011405 156
651 3300025917 Ga0207660_10007084 Ga0207660_100070845 156
652 3300025917 Ga0207660_10053829 Ga0207660_100538293 156
653 3300025917 Ga0207660_10082765 Ga0207660_100827653 156
654 3300025917 Ga0207660_10495624 Ga0207660_104956242 156
655 3300025918 Ga0207662_10088607 Ga0207662_100886073 156
656 3300025918 Ga0207662_10382781 Ga0207662_103827812 156
657 3300025919 Ga0207657_10036203 Ga0207657_100362034 156
658 3300025919 Ga0207657_10209574 Ga0207657_102095742 156
659 3300025919 Ga0207657_10295898 Ga0207657_102958982 156
660 3300025920 Ga0207649_10002039 Ga0207649_100020396 156
661 3300025920 Ga0207649_10018576 Ga0207649_100185762 156
662 3300025920 Ga0207649_10050746 Ga0207649_100507463 156
663 3300025920 Ga0207649_10589554 Ga0207649_105895542 156
664 3300025921 Ga0207652_10000654 Ga0207652_1000065415 156
665 3300025921 Ga0207652_10014383 Ga0207652_100143838 156
666 3300025921 Ga0207652_10024992 Ga0207652_100249925 156
667 3300025921 Ga0207652_10053269 Ga0207652_100532693 156
668 3300025921 Ga0207652_10646304 Ga0207652_106463042 156
669 3300025922 Ga0207646_10015549 Ga0207646_100155493 156
670 3300025922 Ga0207646_10090461 Ga0207646_100904612 156
671 3300025922 Ga0207646_10349292 Ga0207646_103492922 156
672 3300025923 Ga0207681_10000517 Ga0207681_100005175 156
673 3300025923 Ga0207681_10012624 Ga0207681_100126243 156
674 3300025923 Ga0207681_10023961 Ga0207681_100239614 156
675 3300025923 Ga0207681_10025964 Ga0207681_100259644 156
676 3300025924 Ga0207694_10137033 Ga0207694_101370332 156
677 3300025925 Ga0207650_10012785 Ga0207650_100127852 156
678 3300025925 Ga0207650_10170586 Ga0207650_101705862 156
679 3300025926 Ga0207659_10010032 Ga0207659_100100324 156
680 3300025926 Ga0207659_10249185 Ga0207659_102491852 156
681 3300025926 Ga0207659_10638810 Ga0207659_106388102 156
682 3300025928 Ga0207700_10017835 Ga0207700_100178352 156
683 3300025928 Ga0207700_10456489 Ga0207700_104564892 156
684 3300025929 Ga0207664_10030378 Ga0207664_100303786 156
685 3300025929 Ga0207664_10554073 Ga0207664_105540732 156
686 3300025931 Ga0207644_10217026 Ga0207644_102170262 156
687 3300025931 Ga0207644_10461967 Ga0207644_104619672 156
688 3300025931 Ga0207644_10686546 Ga0207644_106865462 156
689 3300025932 Ga0207690_10039887 Ga0207690_100398873 156
690 3300025932 Ga0207690_10122555 Ga0207690_101225553 156
691 3300025932 Ga0207690_10200131 Ga0207690_102001313 156
692 3300025934 Ga0207686_10170536 Ga0207686_101705362 156
693 3300025934 Ga0207686_10972708 Ga0207686_109727082 156
694 3300025936 Ga0207670_10005395 Ga0207670_100053955 156
695 3300025937 Ga0207669_10118463 Ga0207669_101184632 156
696 3300025937 Ga0207669_10267180 Ga0207669_102671802 156
697 3300025938 Ga0207704_10023799 Ga0207704_100237993 156
698 3300025938 Ga0207704_10295297 Ga0207704_102952972 156
699 3300025940 Ga0207691_10002376 Ga0207691_1000237617 156
700 3300025940 Ga0207691_10024319 Ga0207691_100243194 156
701 3300025940 Ga0207691_10029402 Ga0207691_100294025 156
702 3300025941 Ga0207711_10064544 Ga0207711_100645444 156
703 3300025942 Ga0207689_10148077 Ga0207689_101480772 156
704 3300025942 Ga0207689_10301407 Ga0207689_103014072 156
705 3300025944 Ga0207661_10001425 Ga0207661_1000142510 156
706 3300025944 Ga0207661_10024729 Ga0207661_100247295 156
707 3300025944 Ga0207661_10025863 Ga0207661_100258636 156
708 3300025944 Ga0207661_10316802 Ga0207661_103168023 156
709 3300025944 Ga0207661_10460918 Ga0207661_104609181 156
710 3300025945 Ga0207679_10066173 Ga0207679_100661732 156
711 3300025945 Ga0207679_10466594 Ga0207679_104665942 156
712 3300025945 Ga0207679_10549962 Ga0207679_105499622 156
713 3300025949 Ga0207667_10008688 Ga0207667_100086889 156
714 3300025949 Ga0207667_10072664 Ga0207667_100726644 156
715 3300025960 Ga0207651_10043339 Ga0207651_100433394 156
716 3300025960 Ga0207651_10144382 Ga0207651_101443822 156
717 3300025961 Ga0207712_10000387 Ga0207712_1000038720 156
718 3300025972 Ga0207668_10133724 Ga0207668_101337243 156
719 3300025981 Ga0207640_10000561 Ga0207640_1000056111 156
720 3300025981 Ga0207640_10248226 Ga0207640_102482262 156
721 3300025981 Ga0207640_10753501 Ga0207640_107535012 156
722 3300025986 Ga0207658_10081105 Ga0207658_100811051 156
723 3300025986 Ga0207658_10109338 Ga0207658_101093383 156
724 3300025986 Ga0207658_11102789 Ga0207658_111027891 156
725 3300026035 Ga0207703_10182157 Ga0207703_101821572 156
726 3300026041 Ga0207639_10180893 Ga0207639_101808932 156
727 3300026067 Ga0207678_10752091 Ga0207678_107520912 156
728 3300026075 Ga0207708_10022116 Ga0207708_100221165 156
729 3300026075 Ga0207708_10079877 Ga0207708_100798772 156
730 3300026078 Ga0207702_10153614 Ga0207702_101536142 156
731 3300026078 Ga0207702_10156142 Ga0207702_101561422 156
732 3300026078 Ga0207702_11274774 Ga0207702_112747741 156
733 3300026089 Ga0207648_10009133 Ga0207648_100091333 156
734 3300026089 Ga0207648_10068867 Ga0207648_100688672 156
735 3300026089 Ga0207648_10293499 Ga0207648_102934992 156
736 3300026089 Ga0207648_10738413 Ga0207648_107384132 156
737 3300026095 Ga0207676_10075904 Ga0207676_100759044 156
738 3300026116 Ga0207674_10038342 Ga0207674_100383422 156
739 3300026118 Ga0207675_100158343 Ga0207675_1001583432 156
740 3300026118 Ga0207675_100312684 Ga0207675_1003126842 156
741 3300026118 Ga0207675_100718510 Ga0207675_1007185102 156
742 3300026121 Ga0207683_10267080 Ga0207683_102670803 156
743 3300026121 Ga0207683_10950559 Ga0207683_109505591 156
744 3300026142 Ga0207698_10026876 Ga0207698_100268763 156
745 3300026142 Ga0207698_10049238 Ga0207698_100492384 156
746 3300026142 Ga0207698_10256870 Ga0207698_102568702 156
747 3300026142 Ga0207698_10582448 Ga0207698_105824482 156
748 3300026142 Ga0207698_10986605 Ga0207698_109866052 156
749 3300027671 Ga0209588_1001748 Ga0209588_10017482 156
750 3300027907 Ga0207428_10043467 Ga0207428_100434674 156
751 3300027907 Ga0207428_10251403 Ga0207428_102514032 156
752 3300027907 Ga0207428_10298601 Ga0207428_102986012 156
753 3300028379 Ga0268266_10575708 Ga0268266_105757082 156
754 3300028379 Ga0268266_10796202 Ga0268266_107962022 156
755 3300028380 Ga0268265_10000317 Ga0268265_1000031730 156
756 3300028380 Ga0268265_10013830 Ga0268265_100138302 156
757 3300028380 Ga0268265_10136214 Ga0268265_101362142 156
758 3300028381 Ga0268264_10122888 Ga0268264_101228883 156
759 3300031548 Ga0307408_100009821 Ga0307408_1000098215 156
760 3300031548 Ga0307408_100034024 Ga0307408_1000340242 156
761 3300031548 Ga0307408_100136555 Ga0307408_1001365552 156
762 3300031548 Ga0307408_100243875 Ga0307408_1002438752 156
763 3300031548 Ga0307408_100479616 Ga0307408_1004796162 156
764 3300031691 Ga0316579_10163426 Ga0316579_101634262 156
765 3300031731 Ga0307405_10000218 Ga0307405_1000021812 156
766 3300031731 Ga0307405_10001167 Ga0307405_100011679 156
767 3300031731 Ga0307405_10006163 Ga0307405_100061633 156
768 3300031731 Ga0307405_10239598 Ga0307405_102395982 156
769 3300031731 Ga0307405_10249526 Ga0307405_102495262 156
770 3300031731 Ga0307405_10527914 Ga0307405_105279142 156
771 3300031731 Ga0307405_10536923 Ga0307405_105369232 156
772 3300031824 Ga0307413_10000688 Ga0307413_1000068810 156
773 3300031824 Ga0307413_10015903 Ga0307413_100159035 156
774 3300031824 Ga0307413_10056419 Ga0307413_100564192 156
775 3300031824 Ga0307413_10101886 Ga0307413_101018862 156
776 3300031824 Ga0307413_10175339 Ga0307413_101753392 156
777 3300031824 Ga0307413_10243718 Ga0307413_102437182 156
778 3300031824 Ga0307413_10602636 Ga0307413_106026362 156
779 3300031852 Ga0307410_10002272 Ga0307410_100022722 156
780 3300031852 Ga0307410_10002390 Ga0307410_100023909 156
781 3300031852 Ga0307410_10047756 Ga0307410_100477562 156
782 3300031852 Ga0307410_10206885 Ga0307410_102068852 156
783 3300031852 Ga0307410_10250217 Ga0307410_102502172 156
784 3300031852 Ga0307410_10262838 Ga0307410_102628382 156
785 3300031852 Ga0307410_10497493 Ga0307410_104974932 156
786 3300031852 Ga0307410_10813110 Ga0307410_108131102 156
787 3300031901 Ga0307406_10005499 Ga0307406_100054997 156
788 3300031901 Ga0307406_10010733 Ga0307406_100107334 156
789 3300031901 Ga0307406_10020447 Ga0307406_100204473 156
790 3300031901 Ga0307406_10027312 Ga0307406_100273124 156
791 3300031901 Ga0307406_10665288 Ga0307406_106652882 156
792 3300031903 Ga0307407_10001188 Ga0307407_100011883 156
793 3300031903 Ga0307407_10003414 Ga0307407_100034142 156
794 3300031903 Ga0307407_10012118 Ga0307407_100121184 156
795 3300031903 Ga0307407_10298697 Ga0307407_102986972 156
796 3300031903 Ga0307407_10689269 Ga0307407_106892692 156
797 3300031911 Ga0307412_10013680 Ga0307412_100136804 156
798 3300031911 Ga0307412_10054281 Ga0307412_100542812 156
799 3300031911 Ga0307412_10154854 Ga0307412_101548543 156
800 3300031911 Ga0307412_10165327 Ga0307412_101653273 156
801 3300031995 Ga0307409_100002960 Ga0307409_1000029603 156
802 3300031995 Ga0307409_100006362 Ga0307409_1000063625 156
803 3300031995 Ga0307409_100047713 Ga0307409_1000477132 156
804 3300031995 Ga0307409_100561431 Ga0307409_1005614311 156
805 3300031995 Ga0307409_100583169 Ga0307409_1005831692 156
806 3300031995 Ga0307409_100910479 Ga0307409_1009104792 156
807 3300031995 Ga0307409_101355372 Ga0307409_1013553721 156
808 3300032002 Ga0307416_100000558 Ga0307416_1000005587 156
809 3300032002 Ga0307416_100005562 Ga0307416_1000055622 156
810 3300032002 Ga0307416_100024697 Ga0307416_1000246972 156
811 3300032002 Ga0307416_100138514 Ga0307416_1001385142 156
812 3300032002 Ga0307416_100191072 Ga0307416_1001910723 156
813 3300032002 Ga0307416_100358158 Ga0307416_1003581582 156
814 3300032002 Ga0307416_100506417 Ga0307416_1005064172 156
815 3300032002 Ga0307416_100520118 Ga0307416_1005201182 156
816 3300032002 Ga0307416_100585750 Ga0307416_1005857501 156
817 3300032004 Ga0307414_10002216 Ga0307414_1000221611 156
818 3300032004 Ga0307414_10020825 Ga0307414_100208252 156
819 3300032004 Ga0307414_10025283 Ga0307414_100252833 156
820 3300032004 Ga0307414_10070923 Ga0307414_100709232 156
821 3300032004 Ga0307414_10151109 Ga0307414_101511092 156
822 3300032004 Ga0307414_10720647 Ga0307414_107206472 156
823 3300032005 Ga0307411_10000106 Ga0307411_100001065 156
824 3300032005 Ga0307411_10000758 Ga0307411_1000075810 156
825 3300032005 Ga0307411_10004491 Ga0307411_100044919 156
826 3300032005 Ga0307411_10058012 Ga0307411_100580124 156
827 3300032005 Ga0307411_10082023 Ga0307411_100820232 156
828 3300032005 Ga0307411_10129842 Ga0307411_101298422 156
829 3300032005 Ga0307411_10199209 Ga0307411_101992092 156
830 3300032126 Ga0307415_100011835 Ga0307415_1000118354 156
831 3300032126 Ga0307415_100110120 Ga0307415_1001101203 156
832 3300032126 Ga0307415_100214214 Ga0307415_1002142141 156
833 3300032126 Ga0307415_100401813 Ga0307415_1004018132 156
834 3300032126 Ga0307415_100404413 Ga0307415_1004044132 156
835 3300034819 Ga0373958_0034955 Ga0373958_0034955_324_878 156
836 3300035083 Ga0373926_0009877 Ga0373926_0009877_58_612 156
837 3300035086 Ga0373934_0000166 Ga0373934_0000166_6505_7059 156
838 3300035089 Ga0373944_0006824 Ga0373944_0006824_320_874 156
839 3300035111 Ga0373923_0015436 Ga0373923_0015436_1029_1583 156
840 3300035117 Ga0373953_0005021 Ga0373953_0005021_3142_3696 156
841 3300035119 Ga0373956_0000183 Ga0373956_0000183_21373_21927 156
842 3300035170 Ga0373943_0001415 Ga0373943_0001415_6755_7309 156
843 3300035171 Ga0373946_0002897 Ga0373946_0002897_3470_4024 156
844 3300035172 Ga0373955_0000753 Ga0373955_0000753_9490_10044 156
845 3300035410 Ga0373924_0007550 Ga0373924_0007550_639_1193 156
846 3300035692 Ga0373935_0005704 Ga0373935_0005704_3242_3796 156
847 3300035692 Ga0373935_0175156 Ga0373935_0175156_546_1100 156
848 3300035695 Ga0373927_0021535 Ga0373927_0021535_2713_3267 156
849 3300035724 Ga0373933_0000131 Ga0373933_0000131_40273_40827 156
850 3300035725 Ga0373947_0001610 Ga0373947_0001610_11906_12460 156
851 3300036401 Ga0373937_0000512 Ga0373937_0000512_26184_26738 156
852 3300036647 Ga0316582_0158614 Ga0316582_0158614_664_1221 156
853 3300037068 Ga0373925_0003211 Ga0373925_0003211_8741_9295 156
854 3300039093 Ga0400489_51950 Ga0400489_51950_520_1017 156
855 3300039437 Ga0436365_0143962 Ga0436365_0143962_378_932 156
856 3300041406 Ga0439439_0011221 Ga0439439_0011221_79_633 156
857 3300041496 Ga0451839_0303675 Ga0451839_0303675_259_813 156
858 3300041496 Ga0451839_1201838 Ga0451839_1201838_81_644 156
859 3300042125 Ga0450923_018708 Ga0450923_018708_494_1048 156
860 3300042437 Ga0439444_0015838 Ga0439444_0015838_244_798 156
861 3300042876 Ga0451577_0000016 Ga0451577_0000016_279349_279903 156
862 3300042876 Ga0451577_0208209 Ga0451577_0208209_89_658 156
863 3300044673 Ga0453683_0122524 Ga0453683_0122524_953_1507 156
864 3300044673 Ga0453683_0154459 Ga0453683_0154459_206_775 156
865 3300044673 Ga0453683_0378458 Ga0453683_0378458_126_680 156
866 3300044842 Ga0466957_0680759 Ga0466957_0680759_16_570 156
867 3300044842 Ga0466957_0808530 Ga0466957_0808530_23_577 156
868 3300045051 Ga0451576_0005609 Ga0451576_0005609_12874_13443 156
869 3300045051 Ga0451576_0024084 Ga0451576_0024084_4207_4776 156
870 3300045051 Ga0451576_0164712 Ga0451576_0164712_341_910 156
871 3300045051 Ga0451576_0308237 Ga0451576_0308237_615_1169 156
872 3300045836 Ga0466958_0350601 Ga0466958_0350601_189_743 156
873 3300045976 Ga0466967_0041154 Ga0466967_0041154_1798_2352 156
874 3300046454 Ga0495592_0001194 Ga0495592_0001194_8021_8575 156
875 3300046455 Ga0495603_0001831 Ga0495603_0001831_8471_9025 156
876 3300046459 Ga0495629_0037844 Ga0495629_0037844_596_1150 156
877 3300046461 Ga0495641_0194832 Ga0495641_0194832_132_686 156
878 3300046462 Ga0495651_0000098 Ga0495651_0000098_56176_56730 156
879 3300046463 Ga0495653_0000168 Ga0495653_0000168_46930_47484 156
880 3300046472 Ga0495580_0005634 Ga0495580_0005634_8538_9092 156
881 3300046473 Ga0495582_0000694 Ga0495582_0000694_5668_6222 156
882 3300046475 Ga0495639_0000412 Ga0495639_0000412_944_1498 156
883 3300046475 Ga0495639_0356119 Ga0495639_0356119_62_616 156
884 3300046500 Ga0495596_0272443 Ga0495596_0272443_16_570 156
885 3300046511 Ga0495608_0003342 Ga0495608_0003342_7514_8068 156
886 3300046514 Ga0495618_0099010 Ga0495618_0099010_19_573 156
887 3300046516 Ga0495628_0000991 Ga0495628_0000991_17968_18522 156
888 3300046517 Ga0495630_0028854 Ga0495630_0028854_3384_3938 156
889 3300046517 Ga0495630_0059253 Ga0495630_0059253_870_1424 156
890 3300046525 Ga0495663_0105672 Ga0495663_0105672_228_782 156
891 3300046529 Ga0495652_0000694 Ga0495652_0000694_29654_30208 156
892 3300046531 Ga0495665_0000916 Ga0495665_0000916_4198_4752 156
893 3300046531 Ga0495665_0109111 Ga0495665_0109111_153_707 156
894 3300046533 Ga0495640_0530831 Ga0495640_0530831_102_656 156
895 3300046536 Ga0495587_0000628 Ga0495587_0000628_9870_10424 156
896 3300046537 Ga0495598_0007061 Ga0495598_0007061_1632_2201 156
897 3300046538 Ga0495609_0169291 Ga0495609_0169291_155_724 156
898 3300046539 Ga0495621_0178660 Ga0495621_0178660_162_731 156
899 3300046543 Ga0495645_0000106 Ga0495645_0000106_41438_41992 156
900 3300046557 Ga0495622_0121061 Ga0495622_0121061_99_653 156
901 3300046559 Ga0495667_0000431 Ga0495667_0000431_9589_10143 156
902 3300046615 Ga0495656_0032053 Ga0495656_0032053_906_1475 156
903 3300046663 Ga0495635_0000344 Ga0495635_0000344_24593_25147 156
904 3300046674 Ga0495588_0005262 Ga0495588_0005262_1612_2166 156
905 3300046675 Ga0495657_0001006 Ga0495657_0001006_22281_22835 156
906 3300046678 Ga0495599_0000150 Ga0495599_0000150_34016_34570 156
907 3300046679 Ga0495623_0000597 Ga0495623_0000597_667_1221 156
908 3300046680 Ga0495646_0001072 Ga0495646_0001072_2740_3294 156
909 3300046681 Ga0495647_0070788 Ga0495647_0070788_301_855 156
910 3300046683 Ga0495658_0000829 Ga0495658_0000829_12144_12698 156
911 3300046684 Ga0495669_0162452 Ga0495669_0162452_452_1006 156
912 3300046809 Ga0495600_0000156 Ga0495600_0000156_17795_18349 156
913 3300047315 Ga0495581_0001381 Ga0495581_0001381_12368_12922 156
914 3300047317 Ga0495604_0000519 Ga0495604_0000519_25923_26477 156
915 3300047319 Ga0495674_0009525 Ga0495674_0009525_3421_3975 156
916 3300047322 Ga0495680_0042318 Ga0495680_0042318_2300_2854 156
917 3300047444 Ga0495675_0003427 Ga0495675_0003427_7577_8131 156
918 3300047471 Ga0495684_0000216 Ga0495684_0000216_37248_37802 156
919 3300047673 Ga0495593_0001785 Ga0495593_0001785_7247_7801 156
920 3300048088 Ga0495602_0002360 Ga0495602_0002360_14363_14917 156
921 3300048089 Ga0495614_0012061 Ga0495614_0012061_1630_2184 156
922 3300048903 Ga0496100_0388923 Ga0496100_0388923_467_1021 156
923 3300048904 Ga0496101_0037387 Ga0496101_0037387_1284_1838 156
924 3300048905 Ga0496102_0207163 Ga0496102_0207163_1066_1620 156
925 3300048915 Ga0496112_0492901 Ga0496112_0492901_421_975 156
926 3300048916 Ga0496113_0851735 Ga0496113_0851735_21_575 156
927 3300048917 Ga0496114_0156191 Ga0496114_0156191_250_804 156
928 3300049574 Ga0501038_0040818 Ga0501038_0040818_98_652 156
929 3300049576 Ga0501040_0349794 Ga0501040_0349794_95_649 156
930 3300049580 Ga0501046_0773466 Ga0501046_0773466_100_654 156
931 3300049581 Ga0501047_0049597 Ga0501047_0049597_3352_3906 156
932 3300049582 Ga0501048_0384830 Ga0501048_0384830_193_747 156
933 3300049583 Ga0501067_0002587 Ga0501067_0002587_4276_4830 156
934 3300049583 Ga0501067_0007341 Ga0501067_0007341_2068_2622 156
935 3300049583 Ga0501067_0272501 Ga0501067_0272501_46_600 156
936 3300049584 Ga0501068_0009565 Ga0501068_0009565_2520_3074 156
937 3300049585 Ga0501069_0068679 Ga0501069_0068679_1281_1835 156
938 3300049585 Ga0501069_0091690 Ga0501069_0091690_1118_1672 156
939 3300049586 Ga0501070_0010086 Ga0501070_0010086_430_984 156
940 3300049586 Ga0501070_0018920 Ga0501070_0018920_2516_3070 156
941 3300049586 Ga0501070_0027735 Ga0501070_0027735_3111_3665 156
942 3300049587 Ga0501071_0037770 Ga0501071_0037770_226_780 156
943 3300049588 Ga0501072_0104051 Ga0501072_0104051_397_951 156
944 3300049589 Ga0501073_0000699 Ga0501073_0000699_21187_21741 156
945 3300049589 Ga0501073_0079560 Ga0501073_0079560_1106_1669 156
946 3300049590 Ga0501074_0018819 Ga0501074_0018819_1944_2498 156
947 3300049590 Ga0501074_0216128 Ga0501074_0216128_274_828 156
948 3300049593 Ga0501077_0013893 Ga0501077_0013893_1018_1581 156
949 3300049672 Ga0501239_021921 Ga0501239_021921_114_668 156
950 3300049672 Ga0501239_032088 Ga0501239_032088_112_666 156
951 3300049675 Ga0501243_000868 Ga0501243_000868_294_848 156
952 3300049679 Ga0501249_052454 Ga0501249_052454_72_626 156
953 3300049685 Ga0501256_007484 Ga0501256_007484_418_972 156
954 3300049686 Ga0501257_021569 Ga0501257_021569_628_1182 156
955 3300049687 Ga0501258_015862 Ga0501258_015862_279_833 156
956 3300049688 Ga0501259_019257 Ga0501259_019257_158_712 156
957 3300049707 Ga0501234_013329 Ga0501234_013329_294_848 156
958 3300049742 Ga0501080_0017347 Ga0501080_0017347_4360_4914 156
959 3300049742 Ga0501080_0035643 Ga0501080_0035643_2191_2745 156
960 3300049742 Ga0501080_0205592 Ga0501080_0205592_704_1258 156
961 3300049743 Ga0501081_0008481 Ga0501081_0008481_599_1153 156
962 3300049744 Ga0501083_0155109 Ga0501083_0155109_358_912 156
963 3300049744 Ga0501083_0241184 Ga0501083_0241184_285_839 156
964 3300049765 Ga0501268_039691 Ga0501268_039691_172_726 156
965 3300049775 Ga0501279_038112 Ga0501279_038112_78_632 156
966 3300049822 Ga0501035_0054536 Ga0501035_0054536_445_999 156
967 3300049824 Ga0501045_0325217 Ga0501045_0325217_100_654 156
968 3300050507 nmdc:mga05p37_238495_c1 nmdc:mga05p37_238495_c1_692_1246 156
969 3300050507 nmdc:mga05p37_258866_c1 nmdc:mga05p37_258866_c1_46_600 156
970 3300050507 nmdc:mga05p37_454546_c1 nmdc:mga05p37_454546_c1_666_1220 156
971 3300050508 nmdc:mga09592_211828_c1 nmdc:mga09592_211828_c1_618_1172 156
972 3300050508 nmdc:mga09592_436827_c1 nmdc:mga09592_436827_c1_298_852 156
973 3300050508 nmdc:mga09592_59608_c1 nmdc:mga09592_59608_c1_1698_2252 156
974 3300050509 nmdc:mga0qj67_143145_c1 nmdc:mga0qj67_143145_c1_635_1189 156
975 3300050509 nmdc:mga0qj67_82037_c1 nmdc:mga0qj67_82037_c1_1441_1995 156
976 3300050509 nmdc:mga0qj67_86238_c1 nmdc:mga0qj67_86238_c1_322_876 156
977 3300050509 nmdc:mga0qj67_981014_c1 nmdc:mga0qj67_981014_c1_84_638 156
978 3300050510 nmdc:mga06r32_127682_c1 nmdc:mga06r32_127682_c1_222_776 156
979 3300050510 nmdc:mga06r32_148749_c1 nmdc:mga06r32_148749_c1_455_1009 156
980 3300050510 nmdc:mga06r32_1559200_c1 nmdc:mga06r32_1559200_c1_10_579 156
981 3300050510 nmdc:mga06r32_303452_c1 nmdc:mga06r32_303452_c1_531_1085 156
982 3300050510 nmdc:mga06r32_32791_c1 nmdc:mga06r32_32791_c1_223_777 156
983 3300050511 nmdc:mga08y16_542106_c1 nmdc:mga08y16_542106_c1_289_843 156
984 3300050511 nmdc:mga08y16_67181_c1 nmdc:mga08y16_67181_c1_2634_3188 156
985 3300050511 nmdc:mga08y16_83386_c1 nmdc:mga08y16_83386_c1_1872_2435 156
986 3300050512 nmdc:mga0n895_17899_c1 nmdc:mga0n895_17899_c1_5138_5692 156
987 3300050512 nmdc:mga0n895_2537_c1 nmdc:mga0n895_2537_c1_990_1559 156
988 3300050512 nmdc:mga0n895_35737_c1 nmdc:mga0n895_35737_c1_2962_3531 156
989 3300050512 nmdc:mga0n895_470111_c1 nmdc:mga0n895_470111_c1_486_1040 156
990 3300050513 nmdc:mga0rr50_133632_c1 nmdc:mga0rr50_133632_c1_579_1133 156
991 3300050513 nmdc:mga0rr50_3714_c1 nmdc:mga0rr50_3714_c1_5988_6557 156
992 3300050513 nmdc:mga0rr50_38425_c1 nmdc:mga0rr50_38425_c1_737_1306 156
993 3300050513 nmdc:mga0rr50_409360_c1 nmdc:mga0rr50_409360_c1_404_973 156
994 3300050513 nmdc:mga0rr50_643070_c1 nmdc:mga0rr50_643070_c1_172_741 156
995 3300050513 nmdc:mga0rr50_87720_c1 nmdc:mga0rr50_87720_c1_1330_1899 156
996 3300050514 nmdc:mga08x19_149006_c1 nmdc:mga08x19_149006_c1_590_1159 156
997 3300050514 nmdc:mga08x19_61281_c1 nmdc:mga08x19_61281_c1_421_990 156
998 3300050515 nmdc:mga0a205_169260_c1 nmdc:mga0a205_169260_c1_273_842 156
999 3300050515 nmdc:mga0a205_61953_c1 nmdc:mga0a205_61953_c1_2056_2625 156
1000 3300053077 Ga0495601_0003853 Ga0495601_0003853_2548_3102 156
1001 3300053078 Ga0495612_0000349 Ga0495612_0000349_16517_17071 156
1002 3300053085 Ga0495619_0282889 Ga0495619_0282889_45_599 156
1003 3300054114 Ga0501084_0008141 Ga0501084_0008141_5553_6107 156
1004 3300059421 Ga0590071_005592 Ga0590071_005592_38_592 156
1005 3300059421 Ga0590071_030642 Ga0590071_030642_438_1001 156
1006 3300059424 Ga0590075_056282 Ga0590075_056282_374_928 156
1007 3300060353 Ga0501082_0035130 Ga0501082_0035130_1225_1779 156
1008 3300060353 Ga0501082_0253021 Ga0501082_0253021_478_1032 156
1009 iso_pu_bacteria 2510917021 2511126159 156
1010 iso_pu_bacteria 2510917027 2511180735 156
1011 iso_pu_bacteria 2512564013 2512636941 156
1012 iso_pu_bacteria 2643221588 2643949666 156
1013 iso_pu_bacteria 2738541275 2738712527 156
1014 iso_pu_bacteria 2738541301 2738850951 156
1015 iso_pu_bacteria 2738541304 2738866681 156
1016 iso_pu_bacteria 2738543022 2739299198 156
1017 iso_pu_bacteria 2738543033 2739360877 156
1018 iso_pu_bacteria 2739367664 2739650416 156
1019 iso_pu_bacteria 2739367865 2740028889 156
1020 iso_pu_bacteria 2818991438 2819552694 156
1021 iso_pu_bacteria 2857465823 2857466785 156
1022 iso_pu_bacteria 2857591370 2857592785 156
1023 iso_pu_bacteria 2915597211 2915602126 156
1024 iso_pu_bacteria 2915606848 2915610996 156
1025 iso_pu_bacteria 2928100450 2928103835 156
1026 iso_pu_bacteria 2928959182 2928961764 156
1027 iso_pu_bacteria 2929183550 2929187223 156
1028 3300005340 Ga0070689_100306229 Ga0070689_1003062292 157
1029 3300005343 Ga0070687_100091666 Ga0070687_1000916661 157
1030 3300005457 Ga0070662_100000491 Ga0070662_10000049111 157
1031 3300005471 Ga0070698_100039839 Ga0070698_1000398392 157
1032 3300005544 Ga0070686_100000114 Ga0070686_10000011452 157
1033 3300005615 Ga0070702_100132907 Ga0070702_1001329072 157
1034 3300005719 Ga0068861_100292686 Ga0068861_1002926861 157
1035 3300009093 Ga0105240_10000096 Ga0105240_10000096119 157
1036 3300009174 Ga0105241_10247520 Ga0105241_102475202 157
1037 3300009551 Ga0105238_10000271 Ga0105238_1000027114 157
1038 3300013296 Ga0157374_10242300 Ga0157374_102423002 157
1039 3300021384 Ga0213876_10199902 Ga0213876_101999021 157
1040 3300025913 Ga0207695_10000836 Ga0207695_1000083651 157
1041 3300025918 Ga0207662_10072737 Ga0207662_100727371 157
1042 3300025924 Ga0207694_10000007 Ga0207694_10000007449 157
1043 3300025933 Ga0207706_10001815 Ga0207706_1000181513 157
1044 3300025972 Ga0207668_10894767 Ga0207668_108947671 157
1045 3300026118 Ga0207675_100794296 Ga0207675_1007942961 157
1046 3300031548 Ga0307408_100254937 Ga0307408_1002549372 157
1047 3300031548 Ga0307408_101236386 Ga0307408_1012363861 157
1048 3300031852 Ga0307410_10115080 Ga0307410_101150803 157
1049 3300031903 Ga0307407_10313344 Ga0307407_103133442 157
1050 3300031911 Ga0307412_10068016 Ga0307412_100680163 157
1051 3300031911 Ga0307412_10256254 Ga0307412_102562541 157
1052 3300032002 Ga0307416_101158283 Ga0307416_1011582831 157
1053 3300034816 Ga0373930_0030647 Ga0373930_0030647_335_886 157
1054 3300037853 Ga0436364_0647371 Ga0436364_0647371_2783_3334 157
1055 3300039437 Ga0436365_1821459 Ga0436365_1821459_2711_3265 157
1056 3300044656 Ga0466969_0040961 Ga0466969_0040961_1283_1837 157
1057 3300044673 Ga0453683_0194666 Ga0453683_0194666_466_1020 157
1058 3300044693 Ga0466961_0001485 Ga0466961_0001485_12106_12660 157
1059 3300046522 Ga0495643_0000024 Ga0495643_0000024_226664_227215 157
1060 3300048919 Ga0496116_0000035 Ga0496116_0000035_43442_43999 157
1061 3300048920 Ga0496117_0111026 Ga0496117_0111026_506_1063 157
1062 3300048921 Ga0496118_0155393 Ga0496118_0155393_428_985 157
1063 3300048925 Ga0496122_0001902 Ga0496122_0001902_29090_29647 157
1064 3300048926 Ga0496123_0003060 Ga0496123_0003060_4631_5188 157
1065 3300048927 Ga0496124_0004374 Ga0496124_0004374_8740_9297 157
1066 3300048928 Ga0496125_0394095 Ga0496125_0394095_220_777 157
1067 3300048929 Ga0496126_0000084 Ga0496126_0000084_190005_190562 157
1068 3300049577 Ga0501041_0074500 Ga0501041_0074500_530_1087 157
1069 3300049578 Ga0501042_0523373 Ga0501042_0523373_281_838 157
1070 3300049587 Ga0501071_0486449 Ga0501071_0486449_56_613 157
1071 3300049589 Ga0501073_0560125 Ga0501073_0560125_47_604 157
1072 3300049591 Ga0501075_0241150 Ga0501075_0241150_686_1243 157
1073 3300049592 Ga0501076_0364913 Ga0501076_0364913_227_784 157
1074 3300049743 Ga0501081_0126430 Ga0501081_0126430_885_1442 157
1075 3300049824 Ga0501045_0109752 Ga0501045_0109752_1241_1798 157
1076 iso_pu_bacteria 2848297114 2848298527 157
1077 3300003791 Ga0055530_10024341 Ga0055530_100243412 158
1078 3300005290 Ga0065712_10268430 Ga0065712_102684301 158
1079 3300005331 Ga0070670_100270083 Ga0070670_1002700831 158
1080 3300005364 Ga0070673_100597198 Ga0070673_1005971982 158
1081 3300005543 Ga0070672_100700283 Ga0070672_1007002832 158
1082 3300025298 Ga0209050_1000119 Ga0209050_1000119111 158
1083 3300025907 Ga0207645_10278586 Ga0207645_102785862 158
1084 3300025940 Ga0207691_10050359 Ga0207691_100503593 158
1085 3300025941 Ga0207711_10470439 Ga0207711_104704392 158
1086 3300025986 Ga0207658_11513617 Ga0207658_115136171 158
1087 3300031727 Ga0316576_10269855 Ga0316576_102698552 158
1088 3300033528 Ga0316588_1135970 Ga0316588_11359701 158
1089 3300036647 Ga0316582_0555736 Ga0316582_0555736_180_737 158
1090 3300046475 Ga0495639_0162507 Ga0495639_0162507_144_701 158
1091 3300046681 Ga0495647_0176939 Ga0495647_0176939_124_684 158
1092 3300053118 Ga0500594_0105277 Ga0500594_0105277_162_719 158
1093 3300053122 Ga0500608_007240 Ga0500608_007240_3169_3726 158
1094 3300053136 Ga0500559_0182535 Ga0500559_0182535_138_695 158
1095 3300053138 Ga0500564_002596 Ga0500564_002596_4217_4774 158
1096 3300053140 Ga0500573_0098653 Ga0500573_0098653_163_720 158
1097 3300053723 Ga0500567_058259 Ga0500567_058259_303_860 158
1098 3300053729 Ga0500625_000041 Ga0500625_000041_2409_2966 158
1099 iso_pu_bacteria 2919138771 2919139931 158
1100 3300002067 JGI24735J21928_10005029 JGI24735J21928_100050293 159
1101 3300005327 Ga0070658_10140495 Ga0070658_101404953 159
1102 3300005327 Ga0070658_10185935 Ga0070658_101859353 159
1103 3300005336 Ga0070680_100123681 Ga0070680_1001236813 159
1104 3300005338 Ga0068868_100367684 Ga0068868_1003676842 159
1105 3300005344 Ga0070661_100384462 Ga0070661_1003844622 159
1106 3300005435 Ga0070714_100410941 Ga0070714_1004109412 159
1107 3300005455 Ga0070663_100098153 Ga0070663_1000981533 159
1108 3300005455 Ga0070663_100168187 Ga0070663_1001681872 159
1109 3300005530 Ga0070679_100098963 Ga0070679_1000989632 159
1110 3300005539 Ga0068853_100108600 Ga0068853_1001086004 159
1111 3300005563 Ga0068855_100000416 Ga0068855_10000041641 159
1112 3300005614 Ga0068856_100088525 Ga0068856_1000885253 159
1113 3300009093 Ga0105240_10160871 Ga0105240_101608714 159
1114 3300013105 Ga0157369_10197649 Ga0157369_101976492 159
1115 3300013105 Ga0157369_11222477 Ga0157369_112224772 159
1116 3300013307 Ga0157372_11130858 Ga0157372_111308582 159
1117 3300025904 Ga0207647_10011032 Ga0207647_100110322 159
1118 3300025909 Ga0207705_10019571 Ga0207705_100195715 159
1119 3300025909 Ga0207705_10331411 Ga0207705_103314112 159
1120 3300025913 Ga0207695_10014275 Ga0207695_100142758 159
1121 3300025917 Ga0207660_10216079 Ga0207660_102160792 159
1122 3300025919 Ga0207657_10069520 Ga0207657_100695202 159
1123 3300025920 Ga0207649_10430301 Ga0207649_104303011 159
1124 3300025921 Ga0207652_10094773 Ga0207652_100947732 159
1125 3300025924 Ga0207694_10207136 Ga0207694_102071362 159
1126 3300025949 Ga0207667_10000504 Ga0207667_100005043 159
1127 3300025981 Ga0207640_10158005 Ga0207640_101580052 159
1128 3300026041 Ga0207639_11302081 Ga0207639_113020812 159
1129 3300026067 Ga0207678_10011844 Ga0207678_100118444 159
1130 3300026067 Ga0207678_10113768 Ga0207678_101137682 159
1131 3300026078 Ga0207702_10171250 Ga0207702_101712503 159
1132 3300032005 Ga0307411_10252838 Ga0307411_102528382 159
1133 2162886007 SwRhRL2b_contig_3476705 SwRhRL2b_0675.00001680 160
1134 3300001904 JGI24736J21556_1008912 JGI24736J21556_10089122 160
1135 3300001976 JGI24752J21851_1002825 JGI24752J21851_10028252 160
1136 3300001979 JGI24740J21852_10035970 JGI24740J21852_100359702 160
1137 3300001989 JGI24739J22299_10011607 JGI24739J22299_100116073 160
1138 3300001990 JGI24737J22298_10002260 JGI24737J22298_100022605 160
1139 3300002074 JGI24748J21848_1007217 JGI24748J21848_10072172 160
1140 3300005262 Ga0065165_1005594 Ga0065165_10055942 160
1141 3300005289 Ga0065704_10070273 Ga0065704_1007027344 160
1142 3300005331 Ga0070670_100067835 Ga0070670_1000678353 160
1143 3300005331 Ga0070670_100388569 Ga0070670_1003885692 160
1144 3300005335 Ga0070666_10258004 Ga0070666_102580042 160
1145 3300005336 Ga0070680_100000206 Ga0070680_10000020610 160
1146 3300005347 Ga0070668_100880158 Ga0070668_1008801582 160
1147 3300005353 Ga0070669_100004070 Ga0070669_1000040707 160
1148 3300005354 Ga0070675_100295667 Ga0070675_1002956672 160
1149 3300005355 Ga0070671_100034005 Ga0070671_1000340053 160
1150 3300005355 Ga0070671_100089835 Ga0070671_1000898353 160
1151 3300005355 Ga0070671_100135503 Ga0070671_1001355032 160
1152 3300005356 Ga0070674_100036769 Ga0070674_1000367692 160
1153 3300005367 Ga0070667_100002812 Ga0070667_1000028125 160
1154 3300005367 Ga0070667_100008633 Ga0070667_1000086336 160
1155 3300005367 Ga0070667_100098366 Ga0070667_1000983662 160
1156 3300005436 Ga0070713_100007021 Ga0070713_1000070215 160
1157 3300005457 Ga0070662_100092931 Ga0070662_1000929312 160
1158 3300005471 Ga0070698_100687524 Ga0070698_1006875241 160
1159 3300005539 Ga0068853_100017554 Ga0068853_1000175547 160
1160 3300005548 Ga0070665_100000086 Ga0070665_100000086101 160
1161 3300005548 Ga0070665_100009816 Ga0070665_10000981611 160
1162 3300005548 Ga0070665_100254763 Ga0070665_1002547632 160
1163 3300005548 Ga0070665_100606194 Ga0070665_1006061942 160
1164 3300005577 Ga0068857_100082647 Ga0068857_1000826473 160
1165 3300005577 Ga0068857_100986032 Ga0068857_1009860322 160
1166 3300005578 Ga0068854_100046064 Ga0068854_1000460642 160
1167 3300005616 Ga0068852_100157528 Ga0068852_1001575283 160
1168 3300005616 Ga0068852_100211155 Ga0068852_1002111552 160
1169 3300005616 Ga0068852_100526462 Ga0068852_1005264622 160
1170 3300005616 Ga0068852_100552106 Ga0068852_1005521061 160
1171 3300005617 Ga0068859_100088464 Ga0068859_1000884642 160
1172 3300005841 Ga0068863_100279059 Ga0068863_1002790593 160
1173 3300005841 Ga0068863_100661842 Ga0068863_1006618422 160
1174 3300005843 Ga0068860_100036705 Ga0068860_1000367054 160
1175 3300005844 Ga0068862_100050217 Ga0068862_1000502174 160
1176 3300006048 Ga0075363_100000282 Ga0075363_1000002825 160
1177 3300006173 Ga0070716_100420264 Ga0070716_1004202642 160
1178 3300006195 Ga0075366_10185062 Ga0075366_101850622 160
1179 3300006353 Ga0075370_10262191 Ga0075370_102621912 160
1180 3300006353 Ga0075370_10302140 Ga0075370_103021402 160
1181 3300006931 Ga0097620_100088462 Ga0097620_1000884622 160
1182 3300009011 Ga0105251_10202031 Ga0105251_102020312 160
1183 3300009092 Ga0105250_10119118 Ga0105250_101191182 160
1184 3300009176 Ga0105242_10473717 Ga0105242_104737172 160
1185 3300009177 Ga0105248_10163851 Ga0105248_101638514 160
1186 3300013102 Ga0157371_10020775 Ga0157371_100207755 160
1187 3300013297 Ga0157378_10013994 Ga0157378_100139947 160
1188 3300013297 Ga0157378_10081901 Ga0157378_100819013 160
1189 3300013306 Ga0163162_10017746 Ga0163162_100177466 160
1190 3300013306 Ga0163162_10207369 Ga0163162_102073692 160
1191 3300017792 Ga0163161_10056221 Ga0163161_100562213 160
1192 3300025315 Ga0207697_10216301 Ga0207697_102163012 160
1193 3300025711 Ga0207696_1015285 Ga0207696_10152853 160
1194 3300025735 Ga0207713_1003677 Ga0207713_10036776 160
1195 3300025901 Ga0207688_10077248 Ga0207688_100772482 160
1196 3300025903 Ga0207680_10071119 Ga0207680_100711192 160
1197 3300025907 Ga0207645_10116122 Ga0207645_101161222 160
1198 3300025918 Ga0207662_10109756 Ga0207662_101097563 160
1199 3300025923 Ga0207681_10000125 Ga0207681_1000012514 160
1200 3300025925 Ga0207650_10146857 Ga0207650_101468573 160
1201 3300025925 Ga0207650_10260460 Ga0207650_102604602 160
1202 3300025931 Ga0207644_10000963 Ga0207644_1000096320 160
1203 3300025931 Ga0207644_10303045 Ga0207644_103030451 160
1204 3300025933 Ga0207706_10053461 Ga0207706_100534614 160
1205 3300025937 Ga0207669_10004857 Ga0207669_100048573 160
1206 3300025939 Ga0207665_10301077 Ga0207665_103010772 160
1207 3300025981 Ga0207640_10044900 Ga0207640_100449003 160
1208 3300025986 Ga0207658_10005272 Ga0207658_100052723 160
1209 3300025986 Ga0207658_10043202 Ga0207658_100432022 160
1210 3300026041 Ga0207639_10001537 Ga0207639_100015375 160
1211 3300026088 Ga0207641_10536993 Ga0207641_105369932 160
1212 3300026116 Ga0207674_10042932 Ga0207674_100429323 160
1213 3300026116 Ga0207674_10574035 Ga0207674_105740352 160
1214 3300026121 Ga0207683_10160292 Ga0207683_101602923 160
1215 3300026142 Ga0207698_10132163 Ga0207698_101321633 160
1216 3300026142 Ga0207698_10264203 Ga0207698_102642032 160
1217 3300026142 Ga0207698_10286733 Ga0207698_102867332 160
1218 3300028379 Ga0268266_10000002 Ga0268266_100000022459 160
1219 3300028379 Ga0268266_10209518 Ga0268266_102095182 160
1220 3300028379 Ga0268266_10725514 Ga0268266_107255142 160
1221 3300028381 Ga0268264_10009384 Ga0268264_100093844 160
1222 3300028577 Ga0265318_10012857 Ga0265318_100128572 160
1223 3300028786 Ga0307517_10016351 Ga0307517_100163514 160
1224 3300028786 Ga0307517_10033670 Ga0307517_100336704 160
1225 3300031235 Ga0265330_10125862 Ga0265330_101258622 160
1226 3300031238 Ga0265332_10042857 Ga0265332_100428572 160
1227 3300031249 Ga0265339_10164758 Ga0265339_101647581 160
1228 3300031250 Ga0265331_10141666 Ga0265331_101416661 160
1229 3300031344 Ga0265316_10090223 Ga0265316_100902232 160
1230 3300031456 Ga0307513_10111590 Ga0307513_101115901 160
1231 3300031712 Ga0265342_10028392 Ga0265342_100283924 160
1232 3300031731 Ga0307405_10568266 Ga0307405_105682661 160
1233 3300031911 Ga0307412_10267337 Ga0307412_102673371 160
1234 3300031911 Ga0307412_10538666 Ga0307412_105386662 160
1235 3300032002 Ga0307416_101063088 Ga0307416_1010630882 160
1236 3300032004 Ga0307414_10488708 Ga0307414_104887082 160
1237 3300033180 Ga0307510_10002311 Ga0307510_1000231125 160
1238 3300037312 Ga0395899_0187269 Ga0395899_0187269_160_720 160
1239 3300037418 Ga0395900_0162022 Ga0395900_0162022_1115_1675 160
1240 3300037466 Ga0395898_0609773 Ga0395898_0609773_300_860 160
1241 3300037471 Ga0395905_0002689 Ga0395905_0002689_3727_4287 160
1242 3300038443 Ga0395901_0701191 Ga0395901_0701191_376_936 160
1243 3300042116 Ga0450912_007828 Ga0450912_007828_75_632 160
1244 3300046452 Ga0495617_003809 Ga0495617_003809_4062_4619 160
1245 3300046452 Ga0495617_034525 Ga0495617_034525_867_1424 160
1246 3300046452 Ga0495617_077577 Ga0495617_077577_259_816 160
1247 3300046453 Ga0495627_000615 Ga0495627_000615_22314_22871 160
1248 3300046460 Ga0495638_0000051 Ga0495638_0000051_132912_133469 160
1249 3300046460 Ga0495638_0177218 Ga0495638_0177218_324_881 160
1250 3300046460 Ga0495638_0252754 Ga0495638_0252754_123_680 160
1251 3300046471 Ga0495650_0000670 Ga0495650_0000670_2337_2894 160
1252 3300046475 Ga0495639_0054369 Ga0495639_0054369_379_936 160
1253 3300046491 Ga0495584_0069479 Ga0495584_0069479_168_725 160
1254 3300046500 Ga0495596_0001277 Ga0495596_0001277_4559_5116 160
1255 3300046500 Ga0495596_0010224 Ga0495596_0010224_3038_3595 160
1256 3300046500 Ga0495596_0028255 Ga0495596_0028255_1465_2022 160
1257 3300046501 Ga0495607_0120354 Ga0495607_0120354_459_1016 160
1258 3300046501 Ga0495607_0208425 Ga0495607_0208425_129_686 160
1259 3300046506 Ga0495583_0000038 Ga0495583_0000038_240533_241093 160
1260 3300046506 Ga0495583_0002196 Ga0495583_0002196_6180_6737 160
1261 3300046506 Ga0495583_0004381 Ga0495583_0004381_1729_2286 160
1262 3300046506 Ga0495583_0039917 Ga0495583_0039917_824_1381 160
1263 3300046506 Ga0495583_0061344 Ga0495583_0061344_541_1098 160
1264 3300046506 Ga0495583_0108756 Ga0495583_0108756_56_613 160
1265 3300046507 Ga0495606_0069957 Ga0495606_0069957_312_869 160
1266 3300046512 Ga0495610_0000280 Ga0495610_0000280_43764_44321 160
1267 3300046512 Ga0495610_0001450 Ga0495610_0001450_8647_9204 160
1268 3300046513 Ga0495616_0000040 Ga0495616_0000040_74223_74780 160
1269 3300046513 Ga0495616_0122665 Ga0495616_0122665_148_705 160
1270 3300046518 Ga0495631_0083146 Ga0495631_0083146_786_1343 160
1271 3300046519 Ga0495632_0008232 Ga0495632_0008232_2256_2813 160
1272 3300046519 Ga0495632_0012016 Ga0495632_0012016_2796_3353 160
1273 3300046520 Ga0495637_0024958 Ga0495637_0024958_256_813 160
1274 3300046522 Ga0495643_0003604 Ga0495643_0003604_698_1255 160
1275 3300046522 Ga0495643_0006598 Ga0495643_0006598_2387_2944 160
1276 3300046522 Ga0495643_0009295 Ga0495643_0009295_5216_5773 160
1277 3300046522 Ga0495643_0010333 Ga0495643_0010333_1691_2248 160
1278 3300046522 Ga0495643_0043554 Ga0495643_0043554_858_1415 160
1279 3300046522 Ga0495643_0158021 Ga0495643_0158021_49_606 160
1280 3300046524 Ga0495648_0000032 Ga0495648_0000032_72515_73072 160
1281 3300046524 Ga0495648_0002055 Ga0495648_0002055_2106_2663 160
1282 3300046524 Ga0495648_0037338 Ga0495648_0037338_728_1285 160
1283 3300046528 Ga0495642_0138682 Ga0495642_0138682_220_777 160
1284 3300046538 Ga0495609_0003753 Ga0495609_0003753_4312_4869 160
1285 3300046557 Ga0495622_0008547 Ga0495622_0008547_1650_2207 160
1286 3300046558 Ga0495633_0067542 Ga0495633_0067542_967_1524 160
1287 3300046616 Ga0495668_0001117 Ga0495668_0001117_20755_21312 160
1288 3300046616 Ga0495668_0006518 Ga0495668_0006518_4526_5083 160
1289 3300046616 Ga0495668_0097369 Ga0495668_0097369_58_615 160
1290 3300046648 Ga0495611_0021891 Ga0495611_0021891_1061_1618 160
1291 3300046660 Ga0495625_0007661 Ga0495625_0007661_6294_6851 160
1292 3300046660 Ga0495625_0010831 Ga0495625_0010831_4920_5477 160
1293 3300046660 Ga0495625_0038178 Ga0495625_0038178_2042_2599 160
1294 3300046691 Ga0495670_0093770 Ga0495670_0093770_412_969 160
1295 3300046692 Ga0495671_0000020 Ga0495671_0000020_132284_132841 160
1296 3300046692 Ga0495671_0140005 Ga0495671_0140005_12_569 160
1297 3300046694 Ga0495649_0143183 Ga0495649_0143183_97_654 160
1298 3300046809 Ga0495600_0002857 Ga0495600_0002857_8268_8825 160
1299 3300047323 Ga0495683_0006512 Ga0495683_0006512_2156_2713 160
1300 3300047445 Ga0495677_0072950 Ga0495677_0072950_596_1153 160
1301 3300047469 Ga0495673_0000076 Ga0495673_0000076_72632_73189 160
1302 3300047470 Ga0495681_0000110 Ga0495681_0000110_48118_48675 160
1303 3300047470 Ga0495681_0012381 Ga0495681_0012381_2308_2865 160
1304 3300047470 Ga0495681_0084255 Ga0495681_0084255_52_609 160
1305 3300047472 Ga0495686_0025735 Ga0495686_0025735_260_817 160
1306 3300047472 Ga0495686_0036162 Ga0495686_0036162_80_637 160
1307 3300048091 Ga0495626_0002997 Ga0495626_0002997_4849_5406 160
1308 3300048903 Ga0496100_0065575 Ga0496100_0065575_1094_1651 160
1309 3300048904 Ga0496101_0010381 Ga0496101_0010381_1388_1945 160
1310 3300048905 Ga0496102_0000106 Ga0496102_0000106_25940_26497 160
1311 3300048905 Ga0496102_0000452 Ga0496102_0000452_45323_45880 160
1312 3300048905 Ga0496102_1062306 Ga0496102_1062306_146_703 160
1313 3300048906 Ga0496103_0000095 Ga0496103_0000095_77532_78089 160
1314 3300048906 Ga0496103_0000518 Ga0496103_0000518_2394_2951 160
1315 3300048907 Ga0496104_0000060 Ga0496104_0000060_62439_62996 160
1316 3300048907 Ga0496104_0052117 Ga0496104_0052117_631_1188 160
1317 3300048908 Ga0496105_0000122 Ga0496105_0000122_14621_15178 160
1318 3300048910 Ga0496107_0253564 Ga0496107_0253564_394_951 160
1319 3300048916 Ga0496113_0040834 Ga0496113_0040834_1957_2514 160
1320 3300048916 Ga0496113_0209281 Ga0496113_0209281_779_1336 160
1321 3300048917 Ga0496114_0032385 Ga0496114_0032385_2814_3371 160
1322 3300048918 Ga0496115_0000230 Ga0496115_0000230_5765_6322 160
1323 3300048919 Ga0496116_0022284 Ga0496116_0022284_231_788 160
1324 3300048919 Ga0496116_0109884 Ga0496116_0109884_572_1129 160
1325 3300048920 Ga0496117_0000885 Ga0496117_0000885_865_1422 160
1326 3300048920 Ga0496117_0003116 Ga0496117_0003116_15789_16346 160
1327 3300048921 Ga0496118_0000144 Ga0496118_0000144_121134_121691 160
1328 3300048921 Ga0496118_0002769 Ga0496118_0002769_11480_12037 160
1329 3300048922 Ga0496119_0000222 Ga0496119_0000222_53079_53636 160
1330 3300048922 Ga0496119_0017296 Ga0496119_0017296_627_1184 160
1331 3300048923 Ga0496120_0001728 Ga0496120_0001728_22723_23280 160
1332 3300048923 Ga0496120_0184298 Ga0496120_0184298_241_798 160
1333 3300048924 Ga0496121_0000295 Ga0496121_0000295_73780_74337 160
1334 3300048924 Ga0496121_0000681 Ga0496121_0000681_59566_60123 160
1335 3300048924 Ga0496121_0324839 Ga0496121_0324839_88_645 160
1336 3300048925 Ga0496122_0018297 Ga0496122_0018297_2231_2788 160
1337 3300048926 Ga0496123_0081359 Ga0496123_0081359_650_1207 160
1338 3300048926 Ga0496123_0106643 Ga0496123_0106643_220_777 160
1339 3300048927 Ga0496124_0000683 Ga0496124_0000683_2533_3090 160
1340 3300048927 Ga0496124_0001019 Ga0496124_0001019_11254_11811 160
1341 3300048928 Ga0496125_0022675 Ga0496125_0022675_2755_3312 160
1342 3300048928 Ga0496125_0023499 Ga0496125_0023499_5077_5634 160
1343 3300048928 Ga0496125_0085179 Ga0496125_0085179_517_1074 160
1344 3300048928 Ga0496125_0180598 Ga0496125_0180598_762_1319 160
1345 3300048929 Ga0496126_0000294 Ga0496126_0000294_14381_14938 160
1346 3300048929 Ga0496126_0001756 Ga0496126_0001756_28840_29397 160
1347 3300048929 Ga0496126_0028161 Ga0496126_0028161_2879_3436 160
1348 3300049459 Ga0495678_037828 Ga0495678_037828_1250_1807 160
1349 3300049460 Ga0495682_0278892 Ga0495682_0278892_20_577 160
1350 3300049572 Ga0501036_0717434 Ga0501036_0717434_35_592 160
1351 3300049674 Ga0501242_019155 Ga0501242_019155_245_808 160
1352 3300049758 Ga0501241_003688 Ga0501241_003688_1518_2075 160
1353 3300050493 nmdc:mga0k408_32421_c1 nmdc:mga0k408_32421_c1_1656_2213 160
1354 3300050496 nmdc:mga07m45_242839_c1 nmdc:mga07m45_242839_c1_216_773 160
1355 3300050496 nmdc:mga07m45_318841_c1 nmdc:mga07m45_318841_c1_273_839 160
1356 3300050516 nmdc:mga0sz30_83042_c1 nmdc:mga0sz30_83042_c1_507_1064 160
1357 3300053087 Ga0500643_007503 Ga0500643_007503_2217_2774 160
1358 3300053088 Ga0500644_0213975 Ga0500644_0213975_234_791 160
1359 3300053091 Ga0500647_0049787 Ga0500647_0049787_794_1351 160
1360 3300053119 Ga0500595_001822 Ga0500595_001822_8156_8713 160
1361 3300053119 Ga0500595_037368 Ga0500595_037368_1012_1569 160
1362 3300053121 Ga0500607_000130 Ga0500607_000130_2444_3001 160
1363 3300053122 Ga0500608_140924 Ga0500608_140924_467_1024 160
1364 3300053130 Ga0500642_0004589 Ga0500642_0004589_1659_2216 160
1365 3300053136 Ga0500559_0002365 Ga0500559_0002365_1951_2508 160
1366 3300053136 Ga0500559_0007163 Ga0500559_0007163_733_1290 160
1367 3300053148 Ga0500590_058642 Ga0500590_058642_533_1090 160
1368 3300053151 Ga0500604_0010676 Ga0500604_0010676_1105_1662 160
1369 3300053154 Ga0500619_003163 Ga0500619_003163_616_1173 160
1370 3300053156 Ga0500622_0004558 Ga0500622_0004558_2483_3040 160
1371 3300053157 Ga0500624_000212 Ga0500624_000212_20641_21198 160
1372 3300053158 Ga0500627_0001009 Ga0500627_0001009_2539_3096 160
1373 3300053177 Ga0500636_0001430 Ga0500636_0001430_2335_2892 160
1374 3300053177 Ga0500636_0021652 Ga0500636_0021652_1340_1903 160
1375 3300053178 Ga0500637_0000205 Ga0500637_0000205_778_1335 160
1376 3300053178 Ga0500637_0003185 Ga0500637_0003185_4560_5117 160
1377 3300053730 Ga0500645_004991 Ga0500645_004991_1848_2405 160
1378 3300053735 Ga0500596_004593 Ga0500596_004593_766_1323 160
1379 3300059508 Ga0587088_017668 Ga0587088_017668_91_648 160
1380 3300059630 Ga0587128_041835 Ga0587128_041835_79_636 160
1381 3300061734 Ga0530510_0663459 Ga0530510_0663459_194_757 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

28

188

0.99

Feature Viewer

pLDDT pTM Quality
69.06 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map