F493353

General Info

Members Datasets Scaffolds Average Seq Length
1363 413 1359 361

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10004213|Ga0081455_1000421311
Length 351
Sequence MSTVRVLVGTRKGAFVLRADAKRARWDVSGPYFGGWEIYHLKGSPADPQRLYASQSSGWFGQQIQRSNDGGQTWEPVGNQFVYDGVPGTHQWYDGTPHPWEFKRVWHLEPSLTDPDTVYAGVEDAALFHSSDGGQTWQELPALRNVKGHLWQPGAGGMCVHTIVLDPSKPERIFIAISAAGTFRTDDAGRSWRPMNRGLRSEGIPDPHAEVGHCVHRIAMHPSRPHVLFMQKHWDVMRSDDAGESWHEVSGNLPTDFGFPIDVHAHEPDTIYVVPITSDAEHYPPEGKLRVYRSRTGGNEWEALTKGLPQRDCYVNVLRDAMGVDALDPCGLYFGTTGGQPVLSVEVQTLP

Samples

Sample ID Description Type Environment
1 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
2 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
3 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
119 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
217 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
218 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
219 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
238 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
249 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
250 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
253 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
254 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
255 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
267 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
288 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
296 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
297 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
300 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
328 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
381 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
382 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
383 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
384 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
406 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
407 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
408 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
409 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
410 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
413 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0.95
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 3.37
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10012413 3300003373 Bacteria 2184
2 JGI25404J52841_10012497 3300003659 Bacteria 1839
3 JGI25405J52794_10004861 3300003911 Bacteria 2407
4 Ga0058859_10080155 3300004798 Bacteria 1719
5 Ga0065712_10000384 3300005290 Bacteria 16592
6 Ga0065712_10002672 3300005290 Bacteria 7863
7 Ga0065712_10068399 3300005290 Bacteria 10914
8 Ga0065715_10000217 3300005293 Bacteria 35543
9 Ga0065715_10148960 3300005293 Bacteria 1735
10 Ga0065715_10153669 3300005293 Bacteria 1700
11 Ga0070658_10000021 3300005327 Bacteria 187218
12 Ga0070658_10000279 3300005327 Bacteria 44799
13 Ga0070658_10001619 3300005327 Bacteria 19029
14 Ga0070658_10002203 3300005327 Bacteria 16359
15 Ga0070658_10174992 3300005327 Bacteria 1804
16 Ga0070676_10019789 3300005328 Bacteria 3750
17 Ga0070676_10101927 3300005328 Bacteria 1775
18 Ga0070683_100001216 3300005329 Bacteria 19567
19 Ga0070683_100001771 3300005329 Bacteria 16815
20 Ga0070683_100055879 3300005329 Bacteria 3664
21 Ga0070683_100114351 3300005329 Bacteria 2547
22 Ga0070690_100010000 3300005330 Bacteria 5507
23 Ga0070670_100003176 3300005331 Bacteria 13576
24 Ga0070670_100229891 3300005331 Bacteria 1614
25 Ga0068869_100001843 3300005334 Bacteria 12736
26 Ga0068869_100018892 3300005334 Bacteria 4699
27 Ga0068869_100037317 3300005334 Bacteria 3454
28 Ga0068869_100113757 3300005334 Bacteria 2062
29 Ga0068869_100118927 3300005334 Bacteria 2018
30 Ga0070666_10002940 3300005335 Bacteria 10310
31 Ga0070666_10024727 3300005335 Bacteria 3915
32 Ga0070666_10032815 3300005335 Bacteria 3432
33 Ga0070680_100000021 3300005336 Bacteria 81631
34 Ga0070680_100005607 3300005336 Bacteria 9506
35 Ga0070680_100022475 3300005336 Bacteria 5024
36 Ga0070680_100068624 3300005336 Bacteria 2910
37 Ga0070680_100113510 3300005336 Bacteria 2257
38 Ga0070680_100201720 3300005336 Bacteria 1678
39 Ga0068868_100020520 3300005338 Bacteria 4967
40 Ga0070660_100027356 3300005339 Bacteria 4255
41 Ga0070660_100035154 3300005339 Bacteria 3792
42 Ga0070660_100067243 3300005339 Bacteria 2792
43 Ga0070660_100150544 3300005339 Bacteria 1870
44 Ga0070660_100213348 3300005339 Bacteria 1567
45 Ga0070689_100051129 3300005340 Bacteria 3194
46 Ga0070689_100059453 3300005340 Bacteria 2971
47 Ga0070691_10002131 3300005341 Bacteria 8750
48 Ga0070687_100017824 3300005343 Bacteria 3275
49 Ga0070661_100242395 3300005344 Bacteria 1388
50 Ga0070692_10033655 3300005345 Bacteria 2583
51 Ga0070692_10039327 3300005345 Bacteria 2414
52 Ga0070668_100067997 3300005347 Bacteria 2769
53 Ga0070669_100000130 3300005353 Bacteria 68799
54 Ga0070669_100016587 3300005353 Bacteria 5258
55 Ga0070669_100030220 3300005353 Unclassified 3908
56 Ga0070669_100080787 3300005353 Bacteria 2420
57 Ga0070675_100037793 3300005354 Bacteria 3935
58 Ga0070675_100041499 3300005354 Bacteria 3758
59 Ga0070675_100088747 3300005354 Bacteria 2588
60 Ga0070671_100343216 3300005355 Bacteria 1274
61 Ga0070674_100000408 3300005356 Bacteria 21620
62 Ga0070674_100015560 3300005356 Bacteria 4751
63 Ga0070674_100022011 3300005356 Bacteria 4105
64 Ga0070674_100150560 3300005356 Bacteria 1755
65 Ga0070673_100034557 3300005364 Bacteria 3827
66 Ga0070673_100087869 3300005364 Bacteria 2534
67 Ga0070673_100097124 3300005364 Bacteria 2419
68 Ga0070688_100013022 3300005365 Bacteria 4681
69 Ga0070688_100043817 3300005365 Bacteria 2759
70 Ga0070688_100088683 3300005365 Bacteria 2017
71 Ga0070659_100076626 3300005366 Bacteria 2666
72 Ga0070667_100046541 3300005367 Bacteria 3650
73 Ga0070667_100074725 3300005367 Bacteria 2892
74 Ga0070667_100090659 3300005367 Bacteria 2628
75 Ga0070667_100108267 3300005367 Bacteria 2407
76 Ga0070709_10013266 3300005434 Bacteria 4626
77 Ga0070714_100027720 3300005435 Bacteria 4693
78 Ga0070714_100037458 3300005435 Bacteria 4076
79 Ga0070714_100119448 3300005435 Bacteria 2343
80 Ga0070714_100300181 3300005435 Bacteria 1497
81 Ga0070713_100002127 3300005436 Bacteria 12821
82 Ga0070713_100003473 3300005436 Bacteria 10402
83 Ga0070713_100169287 3300005436 Bacteria 1956
84 Ga0070710_10001495 3300005437 Bacteria 11015
85 Ga0070710_10041420 3300005437 Bacteria 2543
86 Ga0070701_10036467 3300005438 Bacteria 2478
87 Ga0070711_100000098 3300005439 Bacteria 46357
88 Ga0070711_100032910 3300005439 Bacteria 3450
89 Ga0070711_100213126 3300005439 Bacteria 1497
90 Ga0070700_100026248 3300005441 Bacteria 3438
91 Ga0070694_100012021 3300005444 Bacteria 5374
92 Ga0070694_100012866 3300005444 Bacteria 5216
93 Ga0070694_100032535 3300005444 Bacteria 3425
94 Ga0070694_100114193 3300005444 Bacteria 1928
95 Ga0070694_100122831 3300005444 Bacteria 1865
96 Ga0070708_100000046 3300005445 Bacteria 80742
97 Ga0070708_100001033 3300005445 Bacteria 21195
98 Ga0070708_100011864 3300005445 Bacteria 7093
99 Ga0070708_100021166 3300005445 Bacteria 5494
100 Ga0070708_100060662 3300005445 Bacteria 3376
101 Ga0070708_100069123 3300005445 Bacteria 3175
102 Ga0070708_100086672 3300005445 Bacteria 2845
103 Ga0070708_100121044 3300005445 Bacteria 2414
104 Ga0070708_100132072 3300005445 Bacteria 2311
105 Ga0070663_100008957 3300005455 Bacteria 6180
106 Ga0070663_100040086 3300005455 Bacteria 3277
107 Ga0070663_100127449 3300005455 Bacteria 1929
108 Ga0070678_100009074 3300005456 Bacteria 5997
109 Ga0070678_100020034 3300005456 Bacteria 4380
110 Ga0070678_100073910 3300005456 Bacteria 2560
111 Ga0070662_100001664 3300005457 Bacteria 13677
112 Ga0070662_100073005 3300005457 Bacteria 2535
113 Ga0070662_100209408 3300005457 Bacteria 1551
114 Ga0070681_10005876 3300005458 Bacteria 11883
115 Ga0070681_10029790 3300005458 Bacteria 5478
116 Ga0070681_10031949 3300005458 Bacteria 5285
117 Ga0070681_10033519 3300005458 Bacteria 5156
118 Ga0070681_10039088 3300005458 Bacteria 4757
119 Ga0070681_10043078 3300005458 Bacteria 4522
120 Ga0070681_10058622 3300005458 Bacteria 3830
121 Ga0070681_10061152 3300005458 Bacteria 3742
122 Ga0070681_10080402 3300005458 Bacteria 3215
123 Ga0070681_10108052 3300005458 Bacteria 2722
124 Ga0070681_10170069 3300005458 Bacteria 2101
125 Ga0070681_10253650 3300005458 Bacteria 1671
126 Ga0068867_100022100 3300005459 Bacteria 4545
127 Ga0068867_100023735 3300005459 Bacteria 4392
128 Ga0068867_100052413 3300005459 Bacteria 3011
129 Ga0068867_100103154 3300005459 Bacteria 2181
130 Ga0068867_100108454 3300005459 Bacteria 2129
131 Ga0070685_10010554 3300005466 Bacteria 4803
132 Ga0070685_10020025 3300005466 Bacteria 3617
133 Ga0070685_10066599 3300005466 Bacteria 2123
134 Ga0070706_100000022 3300005467 Bacteria 160479
135 Ga0070706_100002607 3300005467 Bacteria 18058
136 Ga0070706_100005806 3300005467 Bacteria 11729
137 Ga0070706_100051696 3300005467 Bacteria 3793
138 Ga0070706_100074951 3300005467 Bacteria 3131
139 Ga0070706_100404162 3300005467 Bacteria 1271
140 Ga0070707_100000036 3300005468 Bacteria 116282
141 Ga0070707_100016158 3300005468 Bacteria 7003
142 Ga0070707_100039944 3300005468 Bacteria 4487
143 Ga0070707_100045935 3300005468 Bacteria 4179
144 Ga0070707_100114752 3300005468 Bacteria 2613
145 Ga0070707_100128594 3300005468 Bacteria 2462
146 Ga0070707_100131408 3300005468 Bacteria 2435
147 Ga0070707_100174087 3300005468 Bacteria 2097
148 Ga0070707_100255413 3300005468 Bacteria 1705
149 Ga0070707_100335337 3300005468 Bacteria 1469
150 Ga0070698_100000731 3300005471 Bacteria 35304
151 Ga0070698_100003493 3300005471 Bacteria 17299
152 Ga0070698_100014362 3300005471 Bacteria 8367
153 Ga0070698_100038179 3300005471 Bacteria 4949
154 Ga0070698_100048860 3300005471 Bacteria 4322
155 Ga0070698_100068642 3300005471 Bacteria 3561
156 Ga0070698_100096058 3300005471 Bacteria 2940
157 Ga0070698_100176102 3300005471 Bacteria 2078
158 Ga0070699_100000077 3300005518 Bacteria 94042
159 Ga0070699_100000186 3300005518 Bacteria 60505
160 Ga0070699_100000430 3300005518 Bacteria 40310
161 Ga0070699_100002807 3300005518 Bacteria 15541
162 Ga0070699_100003015 3300005518 Bacteria 14957
163 Ga0070699_100023706 3300005518 Bacteria 5287
164 Ga0070699_100025551 3300005518 Bacteria 5090
165 Ga0070679_100001620 3300005530 Bacteria 20259
166 Ga0070679_100011946 3300005530 Bacteria 8291
167 Ga0070679_100038962 3300005530 Bacteria 4725
168 Ga0070679_100040169 3300005530 Bacteria 4654
169 Ga0070679_100044889 3300005530 Bacteria 4403
170 Ga0070679_100050082 3300005530 Bacteria 4160
171 Ga0070679_100061928 3300005530 Bacteria 3729
172 Ga0070679_100219605 3300005530 Bacteria 1862
173 Ga0070684_100019144 3300005535 Bacteria 5660
174 Ga0070684_100069127 3300005535 Bacteria 3106
175 Ga0070684_100126957 3300005535 Bacteria 2298
176 Ga0070697_100048201 3300005536 Bacteria 3454
177 Ga0070697_100117141 3300005536 Bacteria 2225
178 Ga0070697_100232893 3300005536 Bacteria 1571
179 Ga0068853_100019160 3300005539 Bacteria 5671
180 Ga0068853_100110316 3300005539 Bacteria 2443
181 Ga0068853_100148754 3300005539 Bacteria 2107
182 Ga0068853_100181514 3300005539 Bacteria 1909
183 Ga0068853_100236811 3300005539 Bacteria 1672
184 Ga0070672_100199496 3300005543 Bacteria 1673
185 Ga0070672_100213721 3300005543 Bacteria 1616
186 Ga0070686_100003086 3300005544 Bacteria 9128
187 Ga0070695_100011784 3300005545 Bacteria 5235
188 Ga0070695_100054534 3300005545 Bacteria 2573
189 Ga0070695_100171656 3300005545 Bacteria 1530
190 Ga0070695_100295461 3300005545 Bacteria 1196
191 Ga0070696_100010232 3300005546 Bacteria 6278
192 Ga0070696_100034074 3300005546 Bacteria 3502
193 Ga0070696_100039903 3300005546 Bacteria 3241
194 Ga0070696_100076940 3300005546 Bacteria 2357
195 Ga0070696_100084323 3300005546 Bacteria 2254
196 Ga0070696_100100353 3300005546 Bacteria 2073
197 Ga0070696_100178889 3300005546 Bacteria 1572
198 Ga0070693_100001983 3300005547 Bacteria 9363
199 Ga0070693_100004196 3300005547 Bacteria 6804
200 Ga0070693_100024126 3300005547 Bacteria 3258
201 Ga0070665_100000225 3300005548 Bacteria 94249
202 Ga0070665_100055682 3300005548 Bacteria 3966
203 Ga0070665_100118325 3300005548 Bacteria 2652
204 Ga0070665_100210332 3300005548 Bacteria 1946
205 Ga0070704_100007081 3300005549 Bacteria 6657
206 Ga0070704_100054300 3300005549 Bacteria 2835
207 Ga0070704_100148069 3300005549 Bacteria 1842
208 Ga0070704_100237805 3300005549 Bacteria 1489
209 Ga0068855_100005502 3300005563 Bacteria 15456
210 Ga0068855_100017909 3300005563 Bacteria 8511
211 Ga0068855_100021105 3300005563 Bacteria 7809
212 Ga0068855_100029149 3300005563 Bacteria 6601
213 Ga0068855_100117079 3300005563 Bacteria 3053
214 Ga0068855_100250063 3300005563 Bacteria 1978
215 Ga0070664_100056172 3300005564 Bacteria 3345
216 Ga0070664_100098729 3300005564 Bacteria 2537
217 Ga0070664_100103803 3300005564 Bacteria 2475
218 Ga0068857_100000820 3300005577 Bacteria 23259
219 Ga0068857_100002114 3300005577 Bacteria 16152
220 Ga0068857_100016651 3300005577 Bacteria 6440
221 Ga0068857_100084209 3300005577 Bacteria 2841
222 Ga0068857_100170834 3300005577 Bacteria 1976
223 Ga0068854_100000738 3300005578 Bacteria 19378
224 Ga0068854_100037435 3300005578 Bacteria 3405
225 Ga0068854_100139285 3300005578 Bacteria 1860
226 Ga0068856_100004878 3300005614 Bacteria 13285
227 Ga0068856_100005943 3300005614 Bacteria 12014
228 Ga0068856_100007710 3300005614 Bacteria 10506
229 Ga0070702_100001772 3300005615 Bacteria 8979
230 Ga0070702_100019763 3300005615 Bacteria 3520
231 Ga0070702_100050912 3300005615 Bacteria 2368
232 Ga0068852_100045881 3300005616 Bacteria 3720
233 Ga0068859_100000016 3300005617 Bacteria 261719
234 Ga0068859_100016513 3300005617 Bacteria 7411
235 Ga0068859_100032177 3300005617 Bacteria 5268
236 Ga0068859_100062593 3300005617 Bacteria 3751
237 Ga0068859_100072875 3300005617 Bacteria 3472
238 Ga0068859_100083297 3300005617 Bacteria 3241
239 Ga0068859_100105517 3300005617 Bacteria 2877
240 Ga0068859_100112329 3300005617 Bacteria 2788
241 Ga0068859_100124647 3300005617 Bacteria 2644
242 Ga0068864_100005621 3300005618 Bacteria 10277
243 Ga0068864_100008355 3300005618 Bacteria 8541
244 Ga0068864_100147610 3300005618 Bacteria 2127
245 Ga0068864_100202940 3300005618 Bacteria 1822
246 Ga0068866_10003263 3300005718 Bacteria 6677
247 Ga0068866_10096169 3300005718 Bacteria 1624
248 Ga0068861_100057757 3300005719 Bacteria 2964
249 Ga0068861_100230570 3300005719 Bacteria 1570
250 Ga0068870_10051373 3300005840 Bacteria 2182
251 Ga0068863_100041151 3300005841 Bacteria 4393
252 Ga0068863_100046392 3300005841 Bacteria 4124
253 Ga0068863_100147216 3300005841 Bacteria 2253
254 Ga0068858_100007173 3300005842 Bacteria 10812
255 Ga0068858_100015031 3300005842 Bacteria 7282
256 Ga0068858_100052241 3300005842 Bacteria 3780
257 Ga0068858_100071919 3300005842 Bacteria 3208
258 Ga0068858_100078546 3300005842 Bacteria 3067
259 Ga0068858_100082793 3300005842 Bacteria 2983
260 Ga0068860_100004892 3300005843 Bacteria 13652
261 Ga0068860_100005548 3300005843 Bacteria 12772
262 Ga0068860_100016575 3300005843 Bacteria 7186
263 Ga0068860_100124411 3300005843 Bacteria 2472
264 Ga0068862_100099900 3300005844 Bacteria 2537
265 Ga0068862_100195958 3300005844 Bacteria 1820
266 Ga0081455_10004213 3300005937 Bacteria 16211
267 Ga0081455_10044558 3300005937 Bacteria 3868
268 Ga0081538_10003900 3300005981 Bacteria 13926
269 Ga0081538_10028746 3300005981 Bacteria 3815
270 Ga0081538_10042139 3300005981 Bacteria 2885
271 Ga0081538_10056363 3300005981 Bacteria 2303
272 Ga0081540_1009934 3300005983 Bacteria 6490
273 Ga0081540_1012854 3300005983 Bacteria 5475
274 Ga0081539_10003352 3300005985 Bacteria 19889
275 Ga0070717_10008202 3300006028 Bacteria 7800
276 Ga0070717_10076294 3300006028 Bacteria 2805
277 Ga0075368_10015259 3300006042 Bacteria 2848
278 Ga0070716_100025477 3300006173 Bacteria 3156
279 Ga0070716_100053655 3300006173 Bacteria 2300
280 Ga0070712_100001858 3300006175 Bacteria 12859
281 Ga0070712_100021289 3300006175 Bacteria 4257
282 Ga0075362_10053085 3300006177 Bacteria 1818
283 Ga0075366_10009056 3300006195 Bacteria 5551
284 Ga0097621_100015771 3300006237 Bacteria 5695
285 Ga0097621_100095130 3300006237 Bacteria 2498
286 Ga0068871_100024176 3300006358 Bacteria 4708
287 Ga0068871_100040514 3300006358 Bacteria 3731
288 Ga0068871_100079667 3300006358 Bacteria 2711
289 Ga0068871_100300267 3300006358 Bacteria 1409
290 Ga0075428_100006949 3300006844 Bacteria 12564
291 Ga0075428_100009279 3300006844 Bacteria 10910
292 Ga0075428_100015999 3300006844 Bacteria 8296
293 Ga0075428_100163970 3300006844 Bacteria 2411
294 Ga0075430_100001921 3300006846 Bacteria 17043
295 Ga0075430_100014480 3300006846 Bacteria 6718
296 Ga0075430_100015300 3300006846 Bacteria 6533
297 Ga0075430_100049805 3300006846 Bacteria 3534
298 Ga0075430_100054434 3300006846 Bacteria 3366
299 Ga0075430_100065660 3300006846 Bacteria 3048
300 Ga0075431_100003150 3300006847 Bacteria 15947
301 Ga0075431_100025019 3300006847 Bacteria 6120
302 Ga0075431_100060431 3300006847 Bacteria 3910
303 Ga0075431_100134216 3300006847 Bacteria 2552
304 Ga0075433_10000086 3300006852 Bacteria 42813
305 Ga0075433_10000917 3300006852 Bacteria 20732
306 Ga0075433_10004705 3300006852 Bacteria 10635
307 Ga0075433_10021822 3300006852 Bacteria 5372
308 Ga0075433_10037613 3300006852 Bacteria 4176
309 Ga0075433_10067016 3300006852 Bacteria 3150
310 Ga0075433_10103618 3300006852 Bacteria 2520
311 Ga0075433_10159394 3300006852 Bacteria 2008
312 Ga0075434_100001698 3300006871 Bacteria 18840
313 Ga0075434_100001870 3300006871 Bacteria 18213
314 Ga0075434_100001875 3300006871 Bacteria 18196
315 Ga0075434_100029067 3300006871 Bacteria 5435
316 Ga0075434_100039520 3300006871 Bacteria 4675
317 Ga0075434_100041574 3300006871 Bacteria 4554
318 Ga0075434_100071338 3300006871 Bacteria 3465
319 Ga0075434_100111314 3300006871 Bacteria 2749
320 Ga0075434_100276397 3300006871 Bacteria 1699
321 Ga0075434_100377929 3300006871 Bacteria 1437
322 Ga0075429_100000784 3300006880 Bacteria 25013
323 Ga0075429_100005496 3300006880 Bacteria 10910
324 Ga0075429_100017437 3300006880 Bacteria 6209
325 Ga0075429_100024561 3300006880 Bacteria 5229
326 Ga0075429_100052837 3300006880 Bacteria 3534
327 Ga0075429_100088418 3300006880 Bacteria 2700
328 Ga0075429_100094531 3300006880 Bacteria 2607
329 Ga0075429_100235509 3300006880 Bacteria 1604
330 Ga0068865_100011164 3300006881 Bacteria 5613
331 Ga0068865_100052187 3300006881 Bacteria 2833
332 Ga0068865_100056759 3300006881 Bacteria 2729
333 Ga0068865_100076261 3300006881 Bacteria 2392
334 Ga0068865_100166344 3300006881 Bacteria 1687
335 Ga0075436_100000567 3300006914 Bacteria 24122
336 Ga0075436_100003207 3300006914 Bacteria 11216
337 Ga0075436_100005341 3300006914 Bacteria 8836
338 Ga0075436_100016644 3300006914 Bacteria 5033
339 Ga0075436_100022912 3300006914 Bacteria 4290
340 Ga0075436_100141255 3300006914 Bacteria 1692
341 Ga0097620_100000016 3300006931 Bacteria 261719
342 Ga0097620_100016515 3300006931 Bacteria 7411
343 Ga0097620_100032177 3300006931 Bacteria 5268
344 Ga0097620_100062588 3300006931 Bacteria 3751
345 Ga0097620_100072876 3300006931 Bacteria 3472
346 Ga0097620_100083293 3300006931 Bacteria 3241
347 Ga0097620_100105515 3300006931 Bacteria 2877
348 Ga0097620_100112324 3300006931 Bacteria 2788
349 Ga0097620_100124649 3300006931 Bacteria 2644
350 Ga0075435_100000423 3300007076 Bacteria 26136
351 Ga0075435_100001237 3300007076 Bacteria 16361
352 Ga0075435_100002324 3300007076 Bacteria 12576
353 Ga0075435_100005245 3300007076 Bacteria 9023
354 Ga0075435_100016941 3300007076 Bacteria 5502
355 Ga0075435_100019539 3300007076 Bacteria 5178
356 Ga0075435_100043234 3300007076 Bacteria 3606
357 Ga0075435_100051448 3300007076 Bacteria 3318
358 Ga0075435_100169209 3300007076 Bacteria 1843
359 Ga0075435_100328583 3300007076 Bacteria 1309
360 Ga0099794_10001037 3300007265 Bacteria 9447
361 Ga0105251_10065033 3300009011 Bacteria 1708
362 Ga0105240_10000780 3300009093 Bacteria 57653
363 Ga0105240_10000788 3300009093 Bacteria 57440
364 Ga0105240_10003364 3300009093 Bacteria 24876
365 Ga0105240_10004522 3300009093 Bacteria 21131
366 Ga0105240_10012448 3300009093 Bacteria 11741
367 Ga0105240_10052425 3300009093 Bacteria 5130
368 Ga0105240_10107007 3300009093 Bacteria 3391
369 Ga0105240_10171643 3300009093 Bacteria 2568
370 Ga0111539_10000194 3300009094 Bacteria 71319
371 Ga0111539_10000874 3300009094 Bacteria 39347
372 Ga0111539_10001828 3300009094 Bacteria 28325
373 Ga0111539_10036240 3300009094 Bacteria 5966
374 Ga0111539_10050552 3300009094 Bacteria 4952
375 Ga0111539_10094764 3300009094 Bacteria 3507
376 Ga0111539_10126261 3300009094 Unclassified 2997
377 Ga0105245_10012991 3300009098 Bacteria 7256
378 Ga0105245_10015113 3300009098 Bacteria 6724
379 Ga0105245_10033778 3300009098 Bacteria 4534
380 Ga0105245_10073605 3300009098 Bacteria 3107
381 Ga0105245_10089981 3300009098 Bacteria 2822
382 Ga0105245_10124977 3300009098 Bacteria 2407
383 Ga0105245_10128762 3300009098 Bacteria 2372
384 Ga0105245_10145434 3300009098 Bacteria 2236
385 Ga0105247_10018711 3300009101 Bacteria 4158
386 Ga0114129_10002830 3300009147 Bacteria 24226
387 Ga0114129_10005328 3300009147 Bacteria 18157
388 Ga0114129_10007647 3300009147 Bacteria 15384
389 Ga0114129_10022381 3300009147 Bacteria 8974
390 Ga0114129_10029069 3300009147 Bacteria 7830
391 Ga0114129_10032097 3300009147 Bacteria 7423
392 Ga0114129_10077276 3300009147 Bacteria 4631
393 Ga0114129_10092839 3300009147 Bacteria 4181
394 Ga0114129_10115328 3300009147 Bacteria 3703
395 Ga0114129_10128931 3300009147 Bacteria 3476
396 Ga0114129_10188206 3300009147 Bacteria 2805
397 Ga0114129_10195602 3300009147 Bacteria 2742
398 Ga0105243_10041814 3300009148 Bacteria 3585
399 Ga0105243_10042087 3300009148 Bacteria 3575
400 Ga0105243_10079321 3300009148 Bacteria 2675
401 Ga0105243_10082169 3300009148 Bacteria 2632
402 Ga0105243_10200129 3300009148 Bacteria 1751
403 Ga0105241_10012989 3300009174 Bacteria 6109
404 Ga0105241_10014984 3300009174 Bacteria 5677
405 Ga0105241_10034591 3300009174 Bacteria 3797
406 Ga0105241_10063260 3300009174 Bacteria 2854
407 Ga0105242_10005180 3300009176 Bacteria 10062
408 Ga0105242_10066717 3300009176 Bacteria 2973
409 Ga0105248_10002426 3300009177 Bacteria 20687
410 Ga0105248_10017733 3300009177 Bacteria 7851
411 Ga0105248_10018490 3300009177 Bacteria 7702
412 Ga0105248_10021036 3300009177 Bacteria 7229
413 Ga0105248_10026504 3300009177 Bacteria 6448
414 Ga0105248_10050146 3300009177 Bacteria 4681
415 Ga0105248_10106626 3300009177 Bacteria 3159
416 Ga0105248_10122475 3300009177 Bacteria 2934
417 Ga0105248_10377478 3300009177 Bacteria 1596
418 Ga0105237_10013151 3300009545 Bacteria 8685
419 Ga0105237_10047673 3300009545 Bacteria 4307
420 Ga0105237_10116631 3300009545 Bacteria 2664
421 Ga0105237_10138100 3300009545 Bacteria 2432
422 Ga0105237_10144887 3300009545 Bacteria 2370
423 Ga0105237_10175580 3300009545 Bacteria 2142
424 Ga0105237_10182304 3300009545 Bacteria 2100
425 Ga0105238_10000394 3300009551 Bacteria 46531
426 Ga0105238_10019644 3300009551 Bacteria 6880
427 Ga0105238_10032392 3300009551 Bacteria 5320
428 Ga0105238_10092451 3300009551 Bacteria 3013
429 Ga0105238_10141939 3300009551 Bacteria 2378
430 Ga0105238_10333560 3300009551 Bacteria 1504
431 Ga0105249_10000354 3300009553 Bacteria 46003
432 Ga0105249_10040162 3300009553 Bacteria 4249
433 Ga0105249_10053011 3300009553 Bacteria 3706
434 Ga0105249_10091821 3300009553 Bacteria 2841
435 Ga0105249_10106429 3300009553 Bacteria 2646
436 Ga0105249_10139467 3300009553 Bacteria 2323
437 Ga0105249_10268811 3300009553 Bacteria 1698
438 Ga0105249_10385673 3300009553 Bacteria 1428
439 Ga0105239_10006913 3300010375 Bacteria 13088
440 Ga0105239_10008433 3300010375 Bacteria 11729
441 Ga0105239_10020714 3300010375 Bacteria 7254
442 Ga0105239_10136560 3300010375 Bacteria 2730
443 Ga0105246_10068645 3300011119 Bacteria 2487
444 Ga0105246_10139316 3300011119 Bacteria 1822
445 Ga0157336_1001662 3300012477 Bacteria 1174
446 Ga0157347_1001320 3300012502 Bacteria 1919
447 Ga0157373_10159155 3300013100 Bacteria 1589
448 Ga0157371_10088390 3300013102 Bacteria 2194
449 Ga0157371_10135320 3300013102 Bacteria 1754
450 Ga0157370_10004209 3300013104 Bacteria 16637
451 Ga0157370_10023425 3300013104 Bacteria 6128
452 Ga0157370_10030237 3300013104 Bacteria 5308
453 Ga0157370_10098051 3300013104 Bacteria 2749
454 Ga0157370_10099706 3300013104 Bacteria 2722
455 Ga0157370_10116358 3300013104 Bacteria 2497
456 Ga0157370_10128633 3300013104 Bacteria 2363
457 Ga0157370_10164129 3300013104 Bacteria 2066
458 Ga0157369_10001727 3300013105 Bacteria 26551
459 Ga0157369_10022024 3300013105 Bacteria 7122
460 Ga0157369_10042138 3300013105 Bacteria 4981
461 Ga0157369_10078009 3300013105 Bacteria 3549
462 Ga0157369_10088450 3300013105 Bacteria 3306
463 Ga0157369_10096570 3300013105 Bacteria 3153
464 Ga0157369_10171792 3300013105 Bacteria 2284
465 Ga0157369_10238734 3300013105 Bacteria 1898
466 Ga0157374_10015346 3300013296 Bacteria 6718
467 Ga0157374_10028810 3300013296 Bacteria 5020
468 Ga0157374_10085175 3300013296 Bacteria 3005
469 Ga0157374_10309305 3300013296 Bacteria 1564
470 Ga0157374_10354750 3300013296 Bacteria 1458
471 Ga0157378_10037489 3300013297 Bacteria 4294
472 Ga0157378_10048208 3300013297 Bacteria 3788
473 Ga0157378_10178196 3300013297 Bacteria 1998
474 Ga0157378_10320818 3300013297 Bacteria 1505
475 Ga0163162_10006142 3300013306 Bacteria 11626
476 Ga0163162_10009882 3300013306 Bacteria 9281
477 Ga0163162_10205237 3300013306 Bacteria 2100
478 Ga0163162_10318444 3300013306 Bacteria 1688
479 Ga0163162_10373508 3300013306 Bacteria 1559
480 Ga0157372_10010876 3300013307 Bacteria 9686
481 Ga0157372_10029220 3300013307 Bacteria 6017
482 Ga0157372_10085962 3300013307 Bacteria 3568
483 Ga0157372_10091253 3300013307 Bacteria 3465
484 Ga0157372_10242881 3300013307 Bacteria 2090
485 Ga0157372_10679631 3300013307 Bacteria 1198
486 Ga0157375_10114617 3300013308 Bacteria 2797
487 Ga0157375_10186851 3300013308 Bacteria 2226
488 Ga0157375_10285557 3300013308 Bacteria 1813
489 Ga0157375_10418870 3300013308 Bacteria 1505
490 Ga0157375_10468698 3300013308 Bacteria 1425
491 Ga0163163_10013182 3300014325 Bacteria 7555
492 Ga0163163_10032293 3300014325 Bacteria 5056
493 Ga0163163_10040367 3300014325 Bacteria 4557
494 Ga0163163_10100833 3300014325 Bacteria 2909
495 Ga0163163_10134143 3300014325 Bacteria 2516
496 Ga0163163_10174551 3300014325 Bacteria 2196
497 Ga0163163_10438936 3300014325 Bacteria 1365
498 Ga0157380_10044642 3300014326 Bacteria 3475
499 Ga0157380_10052478 3300014326 Bacteria 3229
500 Ga0157380_10071739 3300014326 Bacteria 2802
501 Ga0157380_10178801 3300014326 Unclassified 1862
502 Ga0157380_10187725 3300014326 Bacteria 1822
503 Ga0157380_10198141 3300014326 Bacteria 1779
504 Ga0157377_10010640 3300014745 Bacteria 4559
505 Ga0157377_10011423 3300014745 Bacteria 4433
506 Ga0157379_10007583 3300014968 Bacteria 9396
507 Ga0157379_10021531 3300014968 Bacteria 5708
508 Ga0157379_10022224 3300014968 Bacteria 5619
509 Ga0157379_10028170 3300014968 Bacteria 5000
510 Ga0157379_10059969 3300014968 Bacteria 3402
511 Ga0157376_10206312 3300014969 Bacteria 1811
512 Ga0163161_10141279 3300017792 Bacteria 1824
513 Ga0206349_1912197 3300020075 Bacteria 2197
514 Ga0206351_10258841 3300020077 Bacteria 2718
515 Ga0206352_11153136 3300020078 Bacteria 1912
516 Ga0206352_11337063 3300020078 Bacteria 1905
517 Ga0206350_10025740 3300020080 Bacteria 2933
518 Ga0206354_11089907 3300020081 Bacteria 1735
519 Ga0206354_11210034 3300020081 Bacteria 2948
520 Ga0154015_1359972 3300020610 Bacteria 1647
521 Ga0213872_10000378 3300021361 Bacteria 37429
522 Ga0213872_10039610 3300021361 Bacteria 2150
523 Ga0213872_10050106 3300021361 Bacteria 1896
524 Ga0213876_10000419 3300021384 Bacteria 35397
525 Ga0213876_10006788 3300021384 Bacteria 6250
526 Ga0213875_10000004 3300021388 Bacteria 703388
527 Ga0213875_10000128 3300021388 Bacteria 83892
528 Ga0213875_10000274 3300021388 Bacteria 50867
529 Ga0213875_10003100 3300021388 Bacteria 9586
530 Ga0213875_10008920 3300021388 Bacteria 5112
531 Ga0213875_10032249 3300021388 Bacteria 2476
532 Ga0213875_10037127 3300021388 Bacteria 2296
533 Ga0213871_10003443 3300021441 Bacteria 3050
534 Ga0224712_10007494 3300022467 Bacteria 3182
535 Ga0224712_10015601 3300022467 Bacteria 2476
536 Ga0224712_10019739 3300022467 Bacteria 2278
537 Ga0224712_10021856 3300022467 Bacteria 2196
538 Ga0224569_100836 3300022732 Bacteria 2597
539 Ga0207682_10046160 3300025893 Bacteria 1790
540 Ga0207692_10014016 3300025898 Bacteria 3493
541 Ga0207692_10099207 3300025898 Bacteria 1595
542 Ga0207692_10100524 3300025898 Bacteria 1586
543 Ga0207642_10002200 3300025899 Bacteria 6044
544 Ga0207710_10055337 3300025900 Bacteria 1789
545 Ga0207688_10089634 3300025901 Bacteria 1765
546 Ga0207688_10109665 3300025901 Bacteria 1601
547 Ga0207680_10027054 3300025903 Bacteria 3188
548 Ga0207680_10049551 3300025903 Bacteria 2500
549 Ga0207680_10154629 3300025903 Bacteria 1532
550 Ga0207647_10023700 3300025904 Bacteria 4054
551 Ga0207699_10001533 3300025906 Bacteria 10956
552 Ga0207699_10033217 3300025906 Bacteria 2915
553 Ga0207699_10035963 3300025906 Bacteria 2821
554 Ga0207645_10000208 3300025907 Bacteria 48175
555 Ga0207645_10031455 3300025907 Bacteria 3414
556 Ga0207643_10000114 3300025908 Bacteria 55362
557 Ga0207705_10000041 3300025909 Bacteria 183375
558 Ga0207705_10000311 3300025909 Bacteria 44823
559 Ga0207705_10001334 3300025909 Bacteria 19769
560 Ga0207705_10003470 3300025909 Bacteria 11989
561 Ga0207705_10005801 3300025909 Bacteria 9198
562 Ga0207705_10066129 3300025909 Bacteria 2614
563 Ga0207705_10146094 3300025909 Bacteria 1769
564 Ga0207684_10000092 3300025910 Bacteria 169174
565 Ga0207684_10000436 3300025910 Bacteria 55372
566 Ga0207684_10013377 3300025910 Bacteria 7098
567 Ga0207684_10019642 3300025910 Bacteria 5779
568 Ga0207684_10027926 3300025910 Bacteria 4807
569 Ga0207684_10046665 3300025910 Bacteria 3675
570 Ga0207684_10049817 3300025910 Bacteria 3553
571 Ga0207684_10055605 3300025910 Bacteria 3357
572 Ga0207684_10068958 3300025910 Bacteria 3005
573 Ga0207654_10002214 3300025911 Bacteria 9974
574 Ga0207654_10002864 3300025911 Bacteria 8750
575 Ga0207654_10007432 3300025911 Bacteria 5518
576 Ga0207654_10013831 3300025911 Bacteria 4158
577 Ga0207654_10045802 3300025911 Bacteria 2491
578 Ga0207707_10001893 3300025912 Bacteria 19072
579 Ga0207707_10005437 3300025912 Bacteria 11137
580 Ga0207707_10006077 3300025912 Bacteria 10569
581 Ga0207707_10031369 3300025912 Bacteria 4650
582 Ga0207707_10052444 3300025912 Bacteria 3551
583 Ga0207707_10058682 3300025912 Bacteria 3349
584 Ga0207707_10061170 3300025912 Bacteria 3276
585 Ga0207707_10068902 3300025912 Bacteria 3083
586 Ga0207707_10080991 3300025912 Bacteria 2834
587 Ga0207707_10163365 3300025912 Bacteria 1946
588 Ga0207707_10169221 3300025912 Bacteria 1910
589 Ga0207695_10000160 3300025913 Bacteria 200410
590 Ga0207695_10003956 3300025913 Bacteria 20476
591 Ga0207695_10016797 3300025913 Bacteria 8546
592 Ga0207695_10023397 3300025913 Bacteria 6981
593 Ga0207695_10028162 3300025913 Bacteria 6238
594 Ga0207695_10073347 3300025913 Bacteria 3488
595 Ga0207695_10119403 3300025913 Bacteria 2607
596 Ga0207695_10134520 3300025913 Bacteria 2427
597 Ga0207695_10183749 3300025913 Bacteria 2011
598 Ga0207695_10316875 3300025913 Bacteria 1449
599 Ga0207671_10026253 3300025914 Bacteria 4367
600 Ga0207671_10026881 3300025914 Bacteria 4304
601 Ga0207671_10079630 3300025914 Bacteria 2455
602 Ga0207671_10216440 3300025914 Bacteria 1500
603 Ga0207671_10302288 3300025914 Bacteria 1264
604 Ga0207693_10033902 3300025915 Bacteria 4028
605 Ga0207693_10057981 3300025915 Bacteria 3034
606 Ga0207663_10000080 3300025916 Bacteria 46340
607 Ga0207663_10005342 3300025916 Bacteria 6465
608 Ga0207663_10009150 3300025916 Bacteria 5224
609 Ga0207663_10216628 3300025916 Bacteria 1391
610 Ga0207660_10000239 3300025917 Bacteria 35581
611 Ga0207660_10015589 3300025917 Bacteria 5018
612 Ga0207660_10031235 3300025917 Bacteria 3665
613 Ga0207660_10046087 3300025917 Bacteria 3075
614 Ga0207660_10052614 3300025917 Bacteria 2900
615 Ga0207660_10111327 3300025917 Bacteria 2061
616 Ga0207660_10330206 3300025917 Bacteria 1219
617 Ga0207662_10002120 3300025918 Bacteria 9861
618 Ga0207662_10011179 3300025918 Bacteria 4969
619 Ga0207662_10044271 3300025918 Bacteria 2628
620 Ga0207657_10000368 3300025919 Bacteria 47501
621 Ga0207657_10002531 3300025919 Bacteria 19778
622 Ga0207657_10011168 3300025919 Bacteria 8927
623 Ga0207657_10030913 3300025919 Bacteria 4854
624 Ga0207657_10036867 3300025919 Bacteria 4374
625 Ga0207657_10038911 3300025919 Bacteria 4229
626 Ga0207657_10075845 3300025919 Bacteria 2837
627 Ga0207657_10133316 3300025919 Bacteria 2034
628 Ga0207649_10001877 3300025920 Bacteria 11995
629 Ga0207649_10011272 3300025920 Bacteria 4926
630 Ga0207652_10004093 3300025921 Bacteria 11897
631 Ga0207652_10010440 3300025921 Bacteria 7474
632 Ga0207652_10026867 3300025921 Bacteria 4796
633 Ga0207652_10051861 3300025921 Bacteria 3519
634 Ga0207652_10058211 3300025921 Bacteria 3330
635 Ga0207652_10064213 3300025921 Bacteria 3177
636 Ga0207652_10085735 3300025921 Bacteria 2760
637 Ga0207652_10109990 3300025921 Bacteria 2443
638 Ga0207652_10188205 3300025921 Bacteria 1856
639 Ga0207646_10000013 3300025922 Bacteria 364371
640 Ga0207646_10008137 3300025922 Bacteria 10550
641 Ga0207646_10012903 3300025922 Bacteria 8009
642 Ga0207646_10015336 3300025922 Bacteria 7239
643 Ga0207646_10017296 3300025922 Bacteria 6751
644 Ga0207646_10056656 3300025922 Bacteria 3502
645 Ga0207646_10076817 3300025922 Bacteria 2985
646 Ga0207646_10091381 3300025922 Bacteria 2724
647 Ga0207646_10105513 3300025922 Bacteria 2527
648 Ga0207646_10114670 3300025922 Bacteria 2420
649 Ga0207646_10117179 3300025922 Bacteria 2392
650 Ga0207646_10136340 3300025922 Bacteria 2210
651 Ga0207681_10000016 3300025923 Bacteria 345352
652 Ga0207681_10016075 3300025923 Bacteria 4675
653 Ga0207681_10018602 3300025923 Unclassified 4379
654 Ga0207681_10156304 3300025923 Bacteria 1714
655 Ga0207694_10006068 3300025924 Bacteria 9242
656 Ga0207694_10013385 3300025924 Bacteria 6179
657 Ga0207694_10047351 3300025924 Bacteria 3326
658 Ga0207694_10101226 3300025924 Bacteria 2283
659 Ga0207650_10001262 3300025925 Bacteria 18374
660 Ga0207650_10016282 3300025925 Bacteria 5194
661 Ga0207650_10038654 3300025925 Bacteria 3486
662 Ga0207650_10222053 3300025925 Bacteria 1521
663 Ga0207659_10226853 3300025926 Bacteria 1505
664 Ga0207687_10044525 3300025927 Bacteria 3063
665 Ga0207687_10063332 3300025927 Bacteria 2618
666 Ga0207687_10167357 3300025927 Bacteria 1692
667 Ga0207687_10265268 3300025927 Bacteria 1371
668 Ga0207700_10003399 3300025928 Bacteria 9243
669 Ga0207700_10009370 3300025928 Bacteria 6112
670 Ga0207700_10050631 3300025928 Bacteria 3096
671 Ga0207700_10056312 3300025928 Bacteria 2959
672 Ga0207664_10001895 3300025929 Bacteria 13748
673 Ga0207664_10014193 3300025929 Bacteria 5745
674 Ga0207664_10116826 3300025929 Bacteria 2226
675 Ga0207664_10135925 3300025929 Bacteria 2074
676 Ga0207644_10004501 3300025931 Bacteria 9054
677 Ga0207644_10214873 3300025931 Bacteria 1522
678 Ga0207690_10056615 3300025932 Bacteria 2646
679 Ga0207690_10143492 3300025932 Bacteria 1762
680 Ga0207706_10000214 3300025933 Bacteria 63776
681 Ga0207706_10000345 3300025933 Bacteria 50186
682 Ga0207706_10017068 3300025933 Bacteria 6547
683 Ga0207706_10032639 3300025933 Bacteria 4635
684 Ga0207706_10096451 3300025933 Bacteria 2600
685 Ga0207706_10162082 3300025933 Bacteria 1966
686 Ga0207706_10208693 3300025933 Bacteria 1712
687 Ga0207686_10000636 3300025934 Bacteria 21684
688 Ga0207686_10013611 3300025934 Bacteria 4504
689 Ga0207709_10036419 3300025935 Bacteria 2916
690 Ga0207670_10016051 3300025936 Bacteria 4491
691 Ga0207670_10071764 3300025936 Bacteria 2396
692 Ga0207669_10001612 3300025937 Bacteria 9591
693 Ga0207669_10054530 3300025937 Bacteria 2415
694 Ga0207704_10096823 3300025938 Bacteria 1955
695 Ga0207665_10074780 3300025939 Bacteria 2319
696 Ga0207665_10115766 3300025939 Bacteria 1889
697 Ga0207691_10156984 3300025940 Bacteria 1998
698 Ga0207711_10005289 3300025941 Bacteria 10941
699 Ga0207711_10021556 3300025941 Bacteria 5382
700 Ga0207711_10022693 3300025941 Bacteria 5250
701 Ga0207711_10026969 3300025941 Bacteria 4823
702 Ga0207711_10043437 3300025941 Bacteria 3834
703 Ga0207711_10292251 3300025941 Bacteria 1502
704 Ga0207689_10000934 3300025942 Bacteria 28044
705 Ga0207689_10012386 3300025942 Bacteria 7295
706 Ga0207689_10016850 3300025942 Bacteria 6184
707 Ga0207689_10017369 3300025942 Bacteria 6089
708 Ga0207689_10029324 3300025942 Bacteria 4596
709 Ga0207689_10050431 3300025942 Bacteria 3432
710 Ga0207689_10180922 3300025942 Bacteria 1738
711 Ga0207661_10006863 3300025944 Bacteria 8072
712 Ga0207661_10047206 3300025944 Bacteria 3418
713 Ga0207661_10093532 3300025944 Bacteria 2509
714 Ga0207661_10147328 3300025944 Bacteria 2032
715 Ga0207661_10167084 3300025944 Bacteria 1913
716 Ga0207661_10200906 3300025944 Bacteria 1752
717 Ga0207679_10010930 3300025945 Bacteria 5857
718 Ga0207679_10028211 3300025945 Bacteria 3892
719 Ga0207679_10029830 3300025945 Bacteria 3801
720 Ga0207679_10078364 3300025945 Bacteria 2517
721 Ga0207679_10111912 3300025945 Bacteria 2156
722 Ga0207667_10000702 3300025949 Bacteria 43396
723 Ga0207667_10010143 3300025949 Bacteria 11032
724 Ga0207667_10039866 3300025949 Bacteria 5002
725 Ga0207667_10048022 3300025949 Bacteria 4515
726 Ga0207667_10057049 3300025949 Bacteria 4101
727 Ga0207667_10311346 3300025949 Bacteria 1608
728 Ga0207667_10406442 3300025949 Bacteria 1386
729 Ga0207651_10005282 3300025960 Bacteria 6609
730 Ga0207651_10049682 3300025960 Bacteria 2843
731 Ga0207651_10120729 3300025960 Bacteria 1987
732 Ga0207651_10280363 3300025960 Bacteria 1377
733 Ga0207712_10000690 3300025961 Bacteria 26074
734 Ga0207712_10001483 3300025961 Bacteria 15954
735 Ga0207712_10039884 3300025961 Bacteria 3220
736 Ga0207668_10032741 3300025972 Bacteria 3439
737 Ga0207640_10005776 3300025981 Bacteria 6746
738 Ga0207640_10006121 3300025981 Bacteria 6581
739 Ga0207640_10022236 3300025981 Bacteria 3792
740 Ga0207658_10009848 3300025986 Bacteria 6491
741 Ga0207658_10058282 3300025986 Bacteria 2873
742 Ga0207658_10175093 3300025986 Bacteria 1771
743 Ga0207677_10003956 3300026023 Bacteria 7893
744 Ga0207677_10041012 3300026023 Bacteria 3057
745 Ga0207703_10004338 3300026035 Bacteria 11655
746 Ga0207703_10004915 3300026035 Bacteria 10854
747 Ga0207703_10058408 3300026035 Bacteria 3148
748 Ga0207703_10097363 3300026035 Bacteria 2486
749 Ga0207703_10152782 3300026035 Bacteria 2014
750 Ga0207639_10101340 3300026041 Bacteria 2328
751 Ga0207639_10111178 3300026041 Bacteria 2233
752 Ga0207639_10116585 3300026041 Bacteria 2187
753 Ga0207639_10153314 3300026041 Bacteria 1932
754 Ga0207678_10000465 3300026067 Bacteria 36723
755 Ga0207678_10001698 3300026067 Bacteria 20193
756 Ga0207678_10001991 3300026067 Bacteria 18611
757 Ga0207678_10004796 3300026067 Bacteria 12142
758 Ga0207678_10023885 3300026067 Bacteria 5346
759 Ga0207678_10046730 3300026067 Bacteria 3744
760 Ga0207678_10113678 3300026067 Bacteria 2310
761 Ga0207678_10127993 3300026067 Bacteria 2166
762 Ga0207678_10224994 3300026067 Bacteria 1606
763 Ga0207708_10050037 3300026075 Bacteria 3182
764 Ga0207708_10061547 3300026075 Bacteria 2866
765 Ga0207702_10002305 3300026078 Bacteria 18271
766 Ga0207702_10009123 3300026078 Bacteria 8351
767 Ga0207702_10021015 3300026078 Bacteria 5402
768 Ga0207702_10060700 3300026078 Bacteria 3223
769 Ga0207702_10171984 3300026078 Bacteria 1987
770 Ga0207641_10001987 3300026088 Bacteria 19523
771 Ga0207641_10039757 3300026088 Bacteria 3935
772 Ga0207641_10041674 3300026088 Bacteria 3849
773 Ga0207641_10145661 3300026088 Bacteria 2141
774 Ga0207648_10000098 3300026089 Bacteria 83484
775 Ga0207648_10013002 3300026089 Bacteria 7766
776 Ga0207648_10017351 3300026089 Bacteria 6555
777 Ga0207648_10357992 3300026089 Bacteria 1316
778 Ga0207648_10374289 3300026089 Bacteria 1287
779 Ga0207676_10003828 3300026095 Bacteria 10630
780 Ga0207676_10004080 3300026095 Bacteria 10296
781 Ga0207676_10059464 3300026095 Bacteria 3018
782 Ga0207676_10137044 3300026095 Bacteria 2090
783 Ga0207676_10163461 3300026095 Bacteria 1931
784 Ga0207676_10168745 3300026095 Bacteria 1904
785 Ga0207676_10180594 3300026095 Bacteria 1847
786 Ga0207674_10005378 3300026116 Bacteria 15233
787 Ga0207674_10024977 3300026116 Bacteria 6378
788 Ga0207674_10033615 3300026116 Bacteria 5367
789 Ga0207674_10041858 3300026116 Bacteria 4735
790 Ga0207674_10045402 3300026116 Bacteria 4520
791 Ga0207674_10098132 3300026116 Bacteria 2913
792 Ga0207674_10144046 3300026116 Bacteria 2342
793 Ga0207674_10148656 3300026116 Bacteria 2300
794 Ga0207675_100002507 3300026118 Bacteria 18172
795 Ga0207675_100047885 3300026118 Bacteria 3990
796 Ga0207675_100059960 3300026118 Bacteria 3551
797 Ga0207675_100071149 3300026118 Bacteria 3251
798 Ga0207683_10001200 3300026121 Bacteria 23463
799 Ga0207683_10004901 3300026121 Bacteria 11521
800 Ga0207683_10022689 3300026121 Bacteria 5390
801 Ga0207683_10101870 3300026121 Bacteria 2564
802 Ga0207698_10005017 3300026142 Bacteria 8121
803 Ga0207698_10402981 3300026142 Bacteria 1308
804 Ga0209971_1007869 3300027682 Bacteria 2528
805 Ga0207428_10000013 3300027907 Bacteria 346742
806 Ga0207428_10000365 3300027907 Bacteria 58330
807 Ga0207428_10097126 3300027907 Bacteria 2280
808 Ga0207428_10104343 3300027907 Bacteria 2188
809 Ga0207428_10188590 3300027907 Bacteria 1555
810 Ga0268266_10001188 3300028379 Bacteria 32133
811 Ga0268266_10066207 3300028379 Bacteria 3124
812 Ga0268266_10083188 3300028379 Bacteria 2794
813 Ga0268266_10193600 3300028379 Bacteria 1857
814 Ga0268266_10214716 3300028379 Bacteria 1766
815 Ga0268266_10294196 3300028379 Bacteria 1513
816 Ga0268266_10381765 3300028379 Bacteria 1329
817 Ga0268265_10016612 3300028380 Bacteria 5061
818 Ga0268265_10074086 3300028380 Bacteria 2661
819 Ga0268265_10080477 3300028380 Bacteria 2569
820 Ga0268265_10082547 3300028380 Bacteria 2542
821 Ga0268265_10139871 3300028380 Bacteria 2025
822 Ga0268264_10005694 3300028381 Bacteria 10560
823 Ga0268264_10056952 3300028381 Bacteria 3268
824 Ga0268264_10098771 3300028381 Bacteria 2532
825 Ga0268264_10223958 3300028381 Bacteria 1733
826 Ga0265337_1001662 3300028556 Bacteria 10806
827 Ga0265337_1017704 3300028556 Bacteria 2279
828 Ga0265319_1011903 3300028563 Bacteria 3539
829 Ga0265334_10010928 3300028573 Bacteria 3831
830 Ga0265318_10001427 3300028577 Bacteria 14139
831 Ga0265318_10007506 3300028577 Bacteria 4925
832 Ga0265318_10021401 3300028577 Bacteria 2596
833 Ga0265336_10025425 3300028666 Bacteria 1866
834 Ga0265338_10001819 3300028800 Bacteria 33490
835 Ga0265338_10007909 3300028800 Bacteria 13034
836 Ga0265338_10019875 3300028800 Bacteria 7096
837 Ga0265338_10122966 3300028800 Bacteria 2064
838 Ga0265324_10008937 3300029957 Bacteria 3943
839 Ga0265324_10035307 3300029957 Bacteria 1741
840 Ga0265330_10007691 3300031235 Bacteria 5234
841 Ga0265330_10009451 3300031235 Bacteria 4632
842 Ga0265330_10069164 3300031235 Bacteria 1528
843 Ga0265332_10000044 3300031238 Bacteria 114444
844 Ga0265332_10011759 3300031238 Bacteria 3887
845 Ga0265328_10005918 3300031239 Bacteria 5215
846 Ga0265320_10000815 3300031240 Bacteria 23530
847 Ga0265320_10000907 3300031240 Bacteria 22205
848 Ga0265320_10044139 3300031240 Bacteria 2198
849 Ga0265325_10000204 3300031241 Bacteria 42066
850 Ga0265325_10003360 3300031241 Bacteria 10501
851 Ga0265325_10008421 3300031241 Bacteria 6088
852 Ga0265325_10017204 3300031241 Bacteria 4021
853 Ga0265325_10038951 3300031241 Bacteria 2506
854 Ga0265340_10027583 3300031247 Bacteria 2862
855 Ga0265339_10000619 3300031249 Bacteria 27549
856 Ga0265339_10014690 3300031249 Bacteria 4714
857 Ga0265339_10027473 3300031249 Bacteria 3248
858 Ga0265339_10115299 3300031249 Bacteria 1386
859 Ga0265331_10000076 3300031250 Bacteria 145884
860 Ga0265331_10000427 3300031250 Bacteria 42238
861 Ga0265331_10016505 3300031250 Bacteria 3874
862 Ga0265316_10000006 3300031344 Bacteria 289686
863 Ga0265316_10000723 3300031344 Bacteria 36403
864 Ga0265316_10018409 3300031344 Bacteria 6003
865 Ga0265316_10026615 3300031344 Bacteria 4806
866 Ga0265316_10036639 3300031344 Bacteria 3966
867 Ga0265316_10077838 3300031344 Bacteria 2546
868 Ga0265316_10090784 3300031344 Bacteria 2331
869 Ga0265316_10090872 3300031344 Bacteria 2329
870 Ga0265316_10169777 3300031344 Bacteria 1628
871 Ga0307408_100247395 3300031548 Bacteria 1469
872 Ga0265313_10000445 3300031595 Bacteria 43753
873 Ga0265313_10000519 3300031595 Bacteria 40305
874 Ga0265313_10000821 3300031595 Bacteria 31354
875 Ga0265313_10009550 3300031595 Bacteria 6279
876 Ga0265313_10009654 3300031595 Bacteria 6232
877 Ga0265313_10030947 3300031595 Bacteria 2749
878 Ga0307508_10003592 3300031616 Bacteria 15601
879 Ga0265314_10000056 3300031711 Bacteria 171647
880 Ga0265314_10000757 3300031711 Bacteria 38655
881 Ga0265314_10001445 3300031711 Bacteria 26553
882 Ga0265314_10008395 3300031711 Bacteria 8853
883 Ga0265314_10020912 3300031711 Bacteria 5044
884 Ga0265342_10003118 3300031712 Bacteria 13851
885 Ga0265342_10014410 3300031712 Bacteria 5249
886 Ga0265342_10016137 3300031712 Bacteria 4887
887 Ga0265342_10025216 3300031712 Bacteria 3742
888 Ga0265342_10027518 3300031712 Bacteria 3552
889 Ga0265342_10050337 3300031712 Bacteria 2489
890 Ga0316578_10000109 3300031728 Bacteria 19551
891 Ga0316577_10000248 3300031733 Bacteria 18951
892 Ga0316577_10002471 3300031733 Bacteria 9171
893 Ga0307410_10044694 3300031852 Bacteria 2944
894 Ga0307407_10021227 3300031903 Bacteria 3345
895 Ga0307409_100175380 3300031995 Bacteria 1891
896 Ga0307416_100038666 3300032002 Bacteria 3683
897 Ga0307416_100072253 3300032002 Bacteria 2871
898 Ga0307416_100182279 3300032002 Bacteria 1969
899 Ga0307416_100340597 3300032002 Bacteria 1512
900 Ga0307414_10088334 3300032004 Bacteria 2294
901 Ga0307411_10110875 3300032005 Bacteria 1963
902 Ga0307415_100059920 3300032126 Bacteria 2628
903 Ga0307415_100202677 3300032126 Bacteria 1576
904 Ga0373958_0007264 3300034819 Bacteria 1758
905 Ga0373959_0000279 3300034820 Bacteria 10914
906 Ga0373938_0002818 3300034957 Bacteria 2806
907 Ga0373926_0003918 3300035083 Bacteria 4865
908 Ga0373929_0001098 3300035085 Bacteria 5259
909 Ga0373934_0005014 3300035086 Bacteria 4908
910 Ga0373934_0043181 3300035086 Bacteria 1782
911 Ga0373940_0000889 3300035088 Bacteria 5033
912 Ga0373949_0023204 3300035090 Bacteria 1435
913 Ga0373951_0000396 3300035091 Bacteria 12946
914 Ga0373952_0005552 3300035092 Bacteria 2309
915 Ga0373923_0001007 3300035111 Bacteria 7628
916 Ga0373932_0000346 3300035112 Bacteria 14205
917 Ga0373941_0000795 3300035115 Bacteria 6485
918 Ga0373941_0007888 3300035115 Bacteria 2624
919 Ga0373945_0059185 3300035116 Bacteria 1426
920 Ga0373953_0006637 3300035117 Bacteria 3826
921 Ga0373954_0003142 3300035118 Bacteria 6979
922 Ga0373954_0008627 3300035118 Bacteria 4482
923 Ga0373954_0068314 3300035118 Bacteria 1685
924 Ga0373956_0025687 3300035119 Bacteria 2547
925 Ga0373943_0005025 3300035170 Bacteria 5966
926 Ga0373943_0009965 3300035170 Bacteria 4259
927 Ga0373946_0046351 3300035171 Bacteria 1801
928 Ga0373955_0001910 3300035172 Bacteria 8995
929 Ga0373955_0035661 3300035172 Bacteria 2635
930 Ga0373955_0053988 3300035172 Bacteria 2196
931 Ga0373955_0060905 3300035172 Bacteria 2083
932 Ga0373955_0097009 3300035172 Bacteria 1687
933 Ga0373942_0003182 3300035207 Bacteria 3882
934 Ga0373961_0000737 3300035241 Bacteria 11348
935 Ga0373961_0010319 3300035241 Bacteria 2299
936 Ga0373962_0003263 3300035242 Bacteria 3904
937 Ga0373924_0001921 3300035410 Bacteria 6911
938 Ga0373924_0017999 3300035410 Bacteria 2718
939 Ga0373931_0008091 3300035691 Bacteria 4979
940 Ga0373931_0023343 3300035691 Bacteria 3122
941 Ga0373931_0068237 3300035691 Bacteria 1935
942 Ga0373935_0000564 3300035692 Bacteria 19309
943 Ga0373935_0015207 3300035692 Bacteria 4649
944 Ga0373935_0032002 3300035692 Bacteria 3267
945 Ga0373935_0040709 3300035692 Bacteria 2916
946 Ga0373935_0045454 3300035692 Bacteria 2771
947 Ga0373927_0001485 3300035695 Bacteria 17662
948 Ga0373927_0131998 3300035695 Bacteria 1632
949 Ga0373933_0012203 3300035724 Bacteria 4746
950 Ga0373933_0097564 3300035724 Bacteria 1820
951 Ga0373947_0003474 3300035725 Bacteria 9317
952 Ga0373947_0005413 3300035725 Bacteria 7453
953 Ga0373947_0059864 3300035725 Bacteria 2310
954 Ga0373947_0063494 3300035725 Bacteria 2250
955 Ga0373937_0001471 3300036401 Bacteria 19732
956 Ga0373937_0001677 3300036401 Bacteria 18626
957 Ga0373937_0003391 3300036401 Bacteria 13374
958 Ga0373937_0011040 3300036401 Bacteria 7919
959 Ga0373937_0054579 3300036401 Bacteria 3667
960 Ga0373937_0117351 3300036401 Bacteria 2479
961 Ga0373937_0174893 3300036401 Bacteria 2015
962 Ga0316584_0057748 3300036712 Bacteria 2905
963 Ga0316584_0069294 3300036712 Bacteria 2644
964 Ga0373925_0004714 3300037068 Bacteria 10288
965 Ga0373925_0041169 3300037068 Bacteria 3423
966 Ga0373925_0104791 3300037068 Bacteria 2178
967 Ga0373925_0329429 3300037068 Bacteria 1237
968 Ga0395899_0019356 3300037312 Bacteria 5173
969 Ga0395900_0004122 3300037418 Bacteria 15476
970 Ga0395900_0142047 3300037418 Bacteria 2458
971 Ga0395900_0272231 3300037418 Bacteria 1688
972 Ga0395900_0277014 3300037418 Bacteria 1671
973 Ga0395898_0002825 3300037466 Bacteria 19904
974 Ga0395898_0022195 3300037466 Bacteria 6432
975 Ga0395898_0027097 3300037466 Bacteria 5758
976 Ga0395905_0011043 3300037471 Bacteria 8741
977 Ga0395905_0138586 3300037471 Bacteria 2289
978 Ga0395905_0222380 3300037471 Bacteria 1767
979 Ga0436364_0354051 3300037853 Bacteria 18124
980 Ga0436364_0440807 3300037853 Bacteria 1820
981 Ga0436364_0541679 3300037853 Bacteria 3270
982 Ga0436364_0748068 3300037853 Bacteria 528910
983 Ga0436364_0763039 3300037853 Bacteria 19428
984 Ga0436364_0860100 3300037853 Unclassified 1624
985 Ga0436364_1009488 3300037853 Bacteria 3388
986 Ga0436364_1042412 3300037853 Bacteria 1415
987 Ga0436364_1150656 3300037853 Bacteria 2006
988 Ga0436364_1179371 3300037853 Bacteria 5285
989 Ga0436364_1222422 3300037853 Bacteria 3204
990 Ga0436364_1562251 3300037853 Bacteria 140891
991 Ga0395901_0001693 3300038443 Bacteria 22747
992 Ga0395901_0288647 3300038443 Bacteria 1703
993 Ga0436365_0912825 3300039437 Bacteria 101193
994 Ga0436365_1101641 3300039437 Bacteria 1856
995 Ga0436365_1306583 3300039437 Bacteria 3179
996 Ga0436361_0532220 3300039447 Bacteria 4028
997 Ga0436361_0784658 3300039447 Bacteria 13829
998 Ga0436361_0786779 3300039447 Bacteria 144856
999 Ga0436361_0877238 3300039447 Bacteria 37122
1000 Ga0436363_0226178 3300039450 Bacteria 4602
1001 Ga0436363_1060432 3300039450 Bacteria 3538
1002 Ga0436363_1214992 3300039450 Bacteria 6678
1003 Ga0436362_0097513 3300039453 Bacteria 1651
1004 Ga0436362_0731880 3300039453 Bacteria 1903
1005 Ga0439435_0010112 3300042436 Bacteria 2231
1006 Ga0451577_0042049 3300042876 Bacteria 4099
1007 Ga0451577_0060638 3300042876 Bacteria 3373
1008 Ga0466972_0001421 3300044658 Bacteria 11616
1009 Ga0453683_0021603 3300044673 Bacteria 4108
1010 Ga0453683_0024492 3300044673 Bacteria 3839
1011 Ga0466966_0047740 3300044684 Bacteria 2729
1012 Ga0466963_0011141 3300044694 Bacteria 5470
1013 Ga0453684_0005205 3300044712 Bacteria 26112
1014 Ga0453684_0035141 3300044712 Bacteria 6934
1015 Ga0453684_0056727 3300044712 Bacteria 5077
1016 Ga0466968_0011561 3300044735 Bacteria 3441
1017 Ga0466957_0075542 3300044842 Bacteria 2091
1018 Ga0466959_0080501 3300045049 Bacteria 2348
1019 Ga0451576_0003151 3300045051 Bacteria 23085
1020 Ga0451576_0023514 3300045051 Bacteria 6672
1021 Ga0451576_0083915 3300045051 Bacteria 3314
1022 Ga0451576_0110089 3300045051 Bacteria 2866
1023 Ga0451576_0196875 3300045051 Bacteria 2105
1024 Ga0451576_0249844 3300045051 Bacteria 1853
1025 Ga0466958_0042496 3300045836 Bacteria 2737
1026 Ga0466967_0000997 3300045976 Bacteria 15419
1027 Ga0466967_0017823 3300045976 Bacteria 5654
1028 Ga0466967_0210617 3300045976 Bacteria 1843
1029 Ga0466967_0302770 3300045976 Bacteria 1538
1030 Ga0466967_0329250 3300045976 Bacteria 1475
1031 Ga0495592_0051242 3300046454 Bacteria 3066
1032 Ga0495592_0052201 3300046454 Bacteria 3036
1033 Ga0495603_0018163 3300046455 Bacteria 4255
1034 Ga0495629_0017620 3300046459 Bacteria 5120
1035 Ga0495629_0190235 3300046459 Bacteria 1420
1036 Ga0495641_0008007 3300046461 Bacteria 6513
1037 Ga0495641_0056508 3300046461 Bacteria 1778
1038 Ga0495651_0005092 3300046462 Bacteria 10032
1039 Ga0495651_0013976 3300046462 Bacteria 6208
1040 Ga0495653_0001711 3300046463 Bacteria 17280
1041 Ga0495653_0002200 3300046463 Bacteria 15423
1042 Ga0495653_0017172 3300046463 Bacteria 5885
1043 Ga0495653_0106058 3300046463 Bacteria 2027
1044 Ga0495653_0123811 3300046463 Bacteria 1838
1045 Ga0495580_0002767 3300046472 Bacteria 15105
1046 Ga0495580_0023956 3300046472 Bacteria 4475
1047 Ga0495580_0035022 3300046472 Bacteria 3611
1048 Ga0495580_0061234 3300046472 Bacteria 2643
1049 Ga0495580_0062235 3300046472 Bacteria 2618
1050 Ga0495582_0002571 3300046473 Bacteria 10094
1051 Ga0495582_0003889 3300046473 Bacteria 8403
1052 Ga0495582_0005954 3300046473 Bacteria 6800
1053 Ga0495582_0075134 3300046473 Bacteria 1871
1054 Ga0495639_0003444 3300046475 Bacteria 6851
1055 Ga0495664_0001823 3300046477 Bacteria 11313
1056 Ga0495664_0015894 3300046477 Bacteria 4283
1057 Ga0495664_0021318 3300046477 Bacteria 3743
1058 Ga0495664_0047475 3300046477 Bacteria 2548
1059 Ga0495594_0015915 3300046499 Bacteria 3957
1060 Ga0495594_0054601 3300046499 Bacteria 2202
1061 Ga0495608_0025845 3300046511 Bacteria 4007
1062 Ga0495608_0072332 3300046511 Bacteria 2249
1063 Ga0495608_0138308 3300046511 Bacteria 1555
1064 Ga0495618_0004270 3300046514 Bacteria 8806
1065 Ga0495618_0014606 3300046514 Bacteria 4786
1066 Ga0495628_0010236 3300046516 Bacteria 7979
1067 Ga0495628_0024095 3300046516 Bacteria 4985
1068 Ga0495628_0038453 3300046516 Bacteria 3830
1069 Ga0495628_0147179 3300046516 Bacteria 1795
1070 Ga0495630_0023060 3300046517 Bacteria 4599
1071 Ga0495666_0035267 3300046526 Bacteria 2439
1072 Ga0495652_0002364 3300046529 Bacteria 19564
1073 Ga0495652_0014020 3300046529 Bacteria 7201
1074 Ga0495652_0044698 3300046529 Bacteria 3812
1075 Ga0495652_0226627 3300046529 Bacteria 1401
1076 Ga0495665_0001338 3300046531 Bacteria 13162
1077 Ga0495665_0007757 3300046531 Bacteria 5806
1078 Ga0495665_0076685 3300046531 Bacteria 1759
1079 Ga0495665_0109878 3300046531 Bacteria 1446
1080 Ga0495586_0001720 3300046535 Bacteria 11951
1081 Ga0495587_0002513 3300046536 Bacteria 12255
1082 Ga0495587_0006761 3300046536 Bacteria 7468
1083 Ga0495587_0009640 3300046536 Bacteria 6177
1084 Ga0495587_0016619 3300046536 Bacteria 4576
1085 Ga0495645_0020867 3300046543 Bacteria 4733
1086 Ga0495645_0024270 3300046543 Bacteria 4399
1087 Ga0495645_0026215 3300046543 Bacteria 4230
1088 Ga0495645_0074535 3300046543 Bacteria 2444
1089 Ga0495645_0077919 3300046543 Bacteria 2383
1090 Ga0495645_0211691 3300046543 Bacteria 1308
1091 Ga0495633_0108246 3300046558 Bacteria 1289
1092 Ga0495667_0014969 3300046559 Bacteria 5240
1093 Ga0495667_0015222 3300046559 Bacteria 5192
1094 Ga0495667_0017347 3300046559 Bacteria 4864
1095 Ga0495667_0028262 3300046559 Bacteria 3775
1096 Ga0495634_0009520 3300046642 Bacteria 7163
1097 Ga0495634_0072746 3300046642 Bacteria 2260
1098 Ga0495634_0101078 3300046642 Bacteria 1863
1099 Ga0495635_0002040 3300046663 Bacteria 13673
1100 Ga0495635_0051725 3300046663 Bacteria 2830
1101 Ga0495657_0002373 3300046675 Bacteria 15858
1102 Ga0495657_0008797 3300046675 Bacteria 7692
1103 Ga0495657_0032307 3300046675 Bacteria 3653
1104 Ga0495599_0013975 3300046678 Bacteria 4970
1105 Ga0495599_0028108 3300046678 Bacteria 3524
1106 Ga0495599_0108462 3300046678 Bacteria 1730
1107 Ga0495623_0003511 3300046679 Bacteria 10376
1108 Ga0495646_0005662 3300046680 Bacteria 7910
1109 Ga0495646_0022907 3300046680 Bacteria 3934
1110 Ga0495647_0016034 3300046681 Bacteria 2634
1111 Ga0495658_0004533 3300046683 Bacteria 6829
1112 Ga0495658_0005555 3300046683 Bacteria 6197
1113 Ga0495658_0097486 3300046683 Bacteria 1750
1114 Ga0495669_0002730 3300046684 Bacteria 7236
1115 Ga0495613_0005792 3300046689 Bacteria 9250
1116 Ga0495613_0006025 3300046689 Bacteria 9071
1117 Ga0495613_0043468 3300046689 Bacteria 3324
1118 Ga0495613_0073856 3300046689 Bacteria 2484
1119 Ga0495613_0095906 3300046689 Bacteria 2145
1120 Ga0495624_0001011 3300046690 Bacteria 22252
1121 Ga0495624_0009644 3300046690 Bacteria 6683
1122 Ga0495581_0008083 3300047315 Bacteria 6090
1123 Ga0495604_0006988 3300047317 Bacteria 8942
1124 Ga0495604_0020756 3300047317 Bacteria 5245
1125 Ga0495604_0031488 3300047317 Bacteria 4206
1126 Ga0495674_0005499 3300047319 Bacteria 12170
1127 Ga0495674_0005799 3300047319 Bacteria 11839
1128 Ga0495674_0007606 3300047319 Bacteria 10351
1129 Ga0495674_0008960 3300047319 Bacteria 9509
1130 Ga0495674_0018359 3300047319 Bacteria 6510
1131 Ga0495674_0299828 3300047319 Bacteria 1313
1132 Ga0495674_0310296 3300047319 Bacteria 1287
1133 Ga0495676_0069839 3300047321 Bacteria 2708
1134 Ga0495680_0010283 3300047322 Bacteria 8346
1135 Ga0495680_0019298 3300047322 Bacteria 5760
1136 Ga0495680_0073924 3300047322 Bacteria 2589
1137 Ga0495675_0007773 3300047444 Bacteria 6617
1138 Ga0495684_0000424 3300047471 Bacteria 34540
1139 Ga0495684_0000552 3300047471 Bacteria 30354
1140 Ga0495684_0018890 3300047471 Bacteria 5307
1141 Ga0495684_0030235 3300047471 Bacteria 4158
1142 Ga0495684_0039996 3300047471 Bacteria 3595
1143 Ga0495684_0042767 3300047471 Bacteria 3469
1144 Ga0495684_0051250 3300047471 Bacteria 3150
1145 Ga0495684_0078309 3300047471 Bacteria 2509
1146 Ga0495593_0001441 3300047673 Bacteria 13959
1147 Ga0495593_0015149 3300047673 Bacteria 4376
1148 Ga0495602_0005818 3300048088 Bacteria 12941
1149 Ga0495602_0018637 3300048088 Bacteria 6922
1150 Ga0495602_0052876 3300048088 Bacteria 3603
1151 Ga0495602_0270605 3300048088 Bacteria 1256
1152 Ga0495614_0055541 3300048089 Bacteria 1698
1153 Ga0496100_0024565 3300048903 Bacteria 3677
1154 Ga0496101_0044842 3300048904 Bacteria 3165
1155 Ga0496101_0081269 3300048904 Bacteria 2396
1156 Ga0496102_0002841 3300048905 Bacteria 14711
1157 Ga0496102_0020478 3300048905 Bacteria 5845
1158 Ga0496102_0036334 3300048905 Bacteria 4437
1159 Ga0496102_0038222 3300048905 Bacteria 4330
1160 Ga0496102_0096198 3300048905 Bacteria 2745
1161 Ga0496102_0128222 3300048905 Bacteria 2373
1162 Ga0496103_0009182 3300048906 Bacteria 5855
1163 Ga0496103_0084552 3300048906 Bacteria 1999
1164 Ga0496104_0066006 3300048907 Bacteria 3435
1165 Ga0496104_0214940 3300048907 Bacteria 1834
1166 Ga0496104_0443699 3300048907 Bacteria 1210
1167 Ga0496105_0008588 3300048908 Bacteria 7937
1168 Ga0496106_0006521 3300048909 Bacteria 8637
1169 Ga0496106_0019347 3300048909 Bacteria 5049
1170 Ga0496106_0042285 3300048909 Bacteria 3418
1171 Ga0496106_0074060 3300048909 Bacteria 2606
1172 Ga0496106_0088507 3300048909 Bacteria 2387
1173 Ga0496106_0108752 3300048909 Bacteria 2156
1174 Ga0496106_0115428 3300048909 Bacteria 2094
1175 Ga0496106_0131025 3300048909 Bacteria 1966
1176 Ga0496107_0068065 3300048910 Bacteria 2584
1177 Ga0496107_0156892 3300048910 Bacteria 1685
1178 Ga0496108_0000014 3300048911 Bacteria 245016
1179 Ga0496108_0000922 3300048911 Bacteria 22933
1180 Ga0496108_0002260 3300048911 Bacteria 15425
1181 Ga0496108_0078496 3300048911 Bacteria 2794
1182 Ga0496108_0081068 3300048911 Bacteria 2750
1183 Ga0496108_0238927 3300048911 Bacteria 1580
1184 Ga0496109_0012628 3300048912 Bacteria 7295
1185 Ga0496109_0207006 3300048912 Bacteria 1844
1186 Ga0496110_0001014 3300048913 Bacteria 19798
1187 Ga0496110_0099769 3300048913 Bacteria 2603
1188 Ga0496110_0420793 3300048913 Bacteria 1218
1189 Ga0496112_0013548 3300048915 Bacteria 7532
1190 Ga0496112_0190213 3300048915 Bacteria 2015
1191 Ga0496113_0000999 3300048916 Bacteria 15144
1192 Ga0496114_0000025 3300048917 Bacteria 213656
1193 Ga0496114_0045858 3300048917 Bacteria 3632
1194 Ga0496114_0195806 3300048917 Bacteria 1769
1195 Ga0496115_0073287 3300048918 Bacteria 2779
1196 Ga0496115_0146024 3300048918 Bacteria 1952
1197 Ga0496115_0156368 3300048918 Bacteria 1884
1198 Ga0496115_0184825 3300048918 Bacteria 1722
1199 Ga0501031_0019749 3300049568 Bacteria 4391
1200 Ga0501033_0040685 3300049570 Bacteria 3470
1201 Ga0501033_0182447 3300049570 Bacteria 1504
1202 Ga0501034_0146957 3300049571 Bacteria 2334
1203 Ga0501036_0025277 3300049572 Bacteria 5011
1204 Ga0501038_0023583 3300049574 Bacteria 5499
1205 Ga0501039_0031951 3300049575 Bacteria 4059
1206 Ga0501039_0206406 3300049575 Bacteria 1545
1207 Ga0501039_0222214 3300049575 Bacteria 1485
1208 Ga0501040_0007028 3300049576 Bacteria 7294
1209 Ga0501041_0023204 3300049577 Bacteria 3720
1210 Ga0501041_0167857 3300049577 Bacteria 1373
1211 Ga0501042_0018680 3300049578 Bacteria 4804
1212 Ga0501042_0134169 3300049578 Bacteria 1785
1213 Ga0501042_0145568 3300049578 Bacteria 1708
1214 Ga0501043_0022943 3300049579 Bacteria 4894
1215 Ga0501046_0131082 3300049580 Bacteria 1902
1216 Ga0501046_0153246 3300049580 Bacteria 1738
1217 Ga0501046_0164074 3300049580 Bacteria 1669
1218 Ga0501047_0043435 3300049581 Bacteria 4342
1219 Ga0501048_0235349 3300049582 Bacteria 1299
1220 Ga0501067_0006267 3300049583 Bacteria 6598
1221 Ga0501069_0007159 3300049585 Bacteria 5849
1222 Ga0501071_0006291 3300049587 Bacteria 7705
1223 Ga0501071_0259020 3300049587 Bacteria 1313
1224 Ga0501072_0074793 3300049588 Bacteria 2679
1225 Ga0501072_0182844 3300049588 Bacteria 1672
1226 Ga0501072_0298754 3300049588 Bacteria 1280
1227 Ga0501075_0037274 3300049591 Bacteria 3632
1228 Ga0501075_0080925 3300049591 Bacteria 2459
1229 Ga0501075_0084128 3300049591 Bacteria 2409
1230 Ga0501075_0085801 3300049591 Bacteria 2385
1231 Ga0501075_0104770 3300049591 Bacteria 2150
1232 Ga0501075_0203168 3300049591 Bacteria 1511
1233 Ga0501076_0007393 3300049592 Bacteria 7994
1234 Ga0501076_0037601 3300049592 Bacteria 3797
1235 Ga0501076_0074897 3300049592 Bacteria 2713
1236 Ga0501077_0000625 3300049593 Bacteria 21450
1237 Ga0501077_0005703 3300049593 Bacteria 7582
1238 Ga0501077_0126210 3300049593 Bacteria 1622
1239 Ga0501217_004606 3300049661 Bacteria 2841
1240 Ga0501227_001094 3300049665 Bacteria 6031
1241 Ga0501233_000567 3300049668 Bacteria 6009
1242 Ga0501240_003052 3300049673 Bacteria 1835
1243 Ga0501259_003844 3300049688 Bacteria 2388
1244 Ga0501079_0007530 3300049741 Bacteria 8239
1245 Ga0501079_0020331 3300049741 Bacteria 5073
1246 Ga0501079_0054017 3300049741 Bacteria 3099
1247 Ga0501080_0231903 3300049742 Bacteria 1687
1248 Ga0501081_0065642 3300049743 Bacteria 2523
1249 Ga0501083_0185227 3300049744 Bacteria 1359
1250 Ga0501044_0028967 3300049823 Bacteria 5841
1251 Ga0501045_0005188 3300049824 Bacteria 9006
1252 Ga0501045_0010130 3300049824 Bacteria 6597
1253 Ga0501045_0054363 3300049824 Bacteria 2927
1254 nmdc:mga03683_28492_c1 3300050489 Bacteria 1423
1255 nmdc:mga0yw44_10402_c1 3300050492 Bacteria 4752
1256 nmdc:mga05p37_110_c1 3300050507 Bacteria 74328
1257 nmdc:mga05p37_111803_c1 3300050507 Bacteria 3359
1258 nmdc:mga05p37_116944_c1 3300050507 Bacteria 3277
1259 nmdc:mga05p37_118394_c1 3300050507 Bacteria 3255
1260 nmdc:mga05p37_128519_c1 3300050507 Bacteria 3110
1261 nmdc:mga05p37_14979_c1 3300050507 Bacteria 9307
1262 nmdc:mga05p37_179705_c1 3300050507 Bacteria 2575
1263 nmdc:mga05p37_19401_c1 3300050507 Bacteria 8227
1264 nmdc:mga05p37_194455_c1 3300050507 Bacteria 2460
1265 nmdc:mga05p37_21004_c1 3300050507 Bacteria 7903
1266 nmdc:mga05p37_25331_c1 3300050507 Bacteria 7215
1267 nmdc:mga05p37_262943_c1 3300050507 Bacteria 2064
1268 nmdc:mga05p37_281840_c1 3300050507 Bacteria 1982
1269 nmdc:mga05p37_3141_c1 3300050507 Bacteria 19212
1270 nmdc:mga05p37_376010_c1 3300050507 Bacteria 1666
1271 nmdc:mga05p37_9539_c1 3300050507 Bacteria 11493
1272 nmdc:mga09592_3995_c1 3300050508 Bacteria 11889
1273 nmdc:mga09592_90_c1 3300050508 Bacteria 54292
1274 nmdc:mga0qj67_11162_c1 3300050509 Bacteria 6726
1275 nmdc:mga0qj67_22_c2 3300050509 Bacteria 21020
1276 nmdc:mga0qj67_30507_c1 3300050509 Bacteria 4198
1277 nmdc:mga0qj67_62642_c1 3300050509 Bacteria 2956
1278 nmdc:mga0qj67_83700_c1 3300050509 Bacteria 2558
1279 nmdc:mga0qj67_97756_c1 3300050509 Bacteria 2364
1280 nmdc:mga06r32_16367_c1 3300050510 Bacteria 6757
1281 nmdc:mga06r32_18553_c1 3300050510 Bacteria 6372
1282 nmdc:mga06r32_32526_c1 3300050510 Bacteria 4908
1283 nmdc:mga06r32_792_c1 3300050510 Bacteria 25359
1284 nmdc:mga08y16_1299_c1 3300050511 Bacteria 24801
1285 nmdc:mga08y16_14898_c1 3300050511 Bacteria 8179
1286 nmdc:mga08y16_193541_c1 3300050511 Bacteria 2108
1287 nmdc:mga08y16_27594_c1 3300050511 Bacteria 5982
1288 nmdc:mga08y16_3111_c1 3300050511 Bacteria 17189
1289 nmdc:mga08y16_47452_c1 3300050511 Bacteria 4495
1290 nmdc:mga08y16_7390_c1 3300050511 Bacteria 11515
1291 nmdc:mga0n895_108330_c1 3300050512 Bacteria 2792
1292 nmdc:mga0n895_155476_c1 3300050512 Bacteria 2317
1293 nmdc:mga0n895_173858_c1 3300050512 Bacteria 2185
1294 nmdc:mga0n895_21237_c1 3300050512 Bacteria 6067
1295 nmdc:mga0n895_33_c1 3300050512 Bacteria 80749
1296 nmdc:mga0n895_3543_c1 3300050512 Bacteria 12629
1297 nmdc:mga0n895_362935_c1 3300050512 Bacteria 1467
1298 nmdc:mga0n895_63918_c1 3300050512 Bacteria 3639
1299 nmdc:mga0n895_7713_c1 3300050512 Bacteria 9262
1300 nmdc:mga0n895_77425_c1 3300050512 Bacteria 3308
1301 nmdc:mga0n895_91689_c1 3300050512 Bacteria 3041
1302 nmdc:mga0n895_969_c1 3300050512 Bacteria 13990
1303 nmdc:mga0n895_9719_c1 3300050512 Bacteria 8436
1304 nmdc:mga0rr50_116587_c1 3300050513 Bacteria 2120
1305 nmdc:mga0rr50_1507_c1 3300050513 Bacteria 12817
1306 nmdc:mga0rr50_15951_c1 3300050513 Bacteria 4974
1307 nmdc:mga0rr50_17745_c1 3300050513 Bacteria 4761
1308 nmdc:mga0rr50_1851_c1 3300050513 Bacteria 11723
1309 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1310 nmdc:mga0rr50_5253_c1 3300050513 Bacteria 7706
1311 nmdc:mga0rr50_809_c1 3300050513 Bacteria 16823
1312 nmdc:mga08x19_177277_c1 3300050514 Bacteria 1454
1313 nmdc:mga08x19_39527_c1 3300050514 Bacteria 2999
1314 nmdc:mga08x19_396_c1 3300050514 Bacteria 30660
1315 nmdc:mga08x19_473_c1 3300050514 Bacteria 27166
1316 nmdc:mga08x19_7545_c1 3300050514 Bacteria 6463
1317 nmdc:mga0a205_102957_c1 3300050515 Bacteria 2753
1318 nmdc:mga0a205_103585_c1 3300050515 Bacteria 2744
1319 nmdc:mga0a205_165444_c1 3300050515 Bacteria 2107
1320 nmdc:mga0a205_169166_c1 3300050515 Bacteria 2081
1321 nmdc:mga0a205_19772_c1 3300050515 Bacteria 6355
1322 nmdc:mga0a205_35606_c2 3300050515 Bacteria 3731
1323 nmdc:mga0a205_36021_c1 3300050515 Bacteria 4754
1324 nmdc:mga0a205_3681_c1 3300050515 Bacteria 13725
1325 nmdc:mga0a205_3723_c1 3300050515 Bacteria 13652
1326 nmdc:mga0a205_459_c1 3300050515 Bacteria 31641
1327 nmdc:mga0a205_6938_c1 3300050515 Bacteria 10241
1328 nmdc:mga0a205_8199_c2 3300050515 Bacteria 5646
1329 Ga0495601_0001231 3300053077 Bacteria 14047
1330 Ga0495612_0000994 3300053078 Bacteria 11658
1331 Ga0495612_0017245 3300053078 Bacteria 2892
1332 Ga0495619_0003038 3300053085 Bacteria 10900
1333 Ga0495619_0029947 3300053085 Bacteria 3520
1334 Ga0495619_0057768 3300053085 Bacteria 2575
1335 Ga0495619_0091358 3300053085 Bacteria 2061
1336 Ga0495619_0169020 3300053085 Bacteria 1512
1337 Ga0500556_0000131 3300053104 Bacteria 63619
1338 Ga0501084_0005466 3300054114 Bacteria 10425
1339 Ga0501084_0111862 3300054114 Bacteria 2295
1340 Ga0501084_0134526 3300054114 Bacteria 2081
1341 Ga0590071_000088 3300059421 Bacteria 25182
1342 Ga0590071_000719 3300059421 Bacteria 9334
1343 Ga0590071_001388 3300059421 Bacteria 6417
1344 Ga0590074_004453 3300059423 Bacteria 2315
1345 Ga0590074_010779 3300059423 Bacteria 1529
1346 Ga0590075_000337 3300059424 Bacteria 13068
1347 Ga0590077_000177 3300059426 Bacteria 17986
1348 Ga0590077_000572 3300059426 Bacteria 10169
1349 Ga0590077_002992 3300059426 Bacteria 3540
1350 Ga0501082_0020076 3300060353 Bacteria 5759
1351 Ga0501082_0070999 3300060353 Bacteria 2998
1352 Ga0501082_0120252 3300060353 Bacteria 2277
1353 Ga0501082_0143661 3300060353 Bacteria 2071
1354 Ga0501082_0187416 3300060353 Bacteria 1800
1355 Ga0501082_0200303 3300060353 Bacteria 1737
1356 Ga0501082_0229330 3300060353 Bacteria 1616
1357 Ga0530510_0015742 3300061734 Bacteria 5347
1358 Ga0530510_0048353 3300061734 Bacteria 3074
1359 Ga0530510_0151735 3300061734 Bacteria 1711

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100147216 Ga0068863_1001472162 312
2 3300006852 Ga0075433_10067016 Ga0075433_100670163 312
3 3300006871 Ga0075434_100377929 Ga0075434_1003779292 312
4 3300026088 Ga0207641_10039757 Ga0207641_100397573 312
5 3300026095 Ga0207676_10003828 Ga0207676_100038284 312
6 3300046472 Ga0495580_0061234 Ga0495580_0061234_1295_2362 315
7 3300046689 Ga0495613_0095906 Ga0495613_0095906_82_1152 318
8 3300048088 Ga0495602_0052876 Ga0495602_0052876_37_1107 318
9 3300005437 Ga0070710_10041420 Ga0070710_100414203 331
10 3300025898 Ga0207692_10099207 Ga0207692_100992072 331
11 3300049661 Ga0501217_004606 Ga0501217_004606_1605_2672 331
12 3300049665 Ga0501227_001094 Ga0501227_001094_4657_5724 331
13 3300049668 Ga0501233_000567 Ga0501233_000567_1208_2275 331
14 3300049673 Ga0501240_003052 Ga0501240_003052_458_1525 331
15 3300049688 Ga0501259_003844 Ga0501259_003844_557_1624 331
16 3300025927 Ga0207687_10265268 Ga0207687_102652682 336
17 3300049591 Ga0501075_0203168 Ga0501075_0203168_155_1297 336
18 3300050512 nmdc:mga0n895_173858_c1 nmdc:mga0n895_173858_c1_34_1104 336
19 3300037068 Ga0373925_0329429 Ga0373925_0329429_141_1211 337
20 3300009147 Ga0114129_10005328 Ga0114129_100053289 339
21 3300013307 Ga0157372_10679631 Ga0157372_106796311 339
22 3300050507 nmdc:mga05p37_19401_c1 nmdc:mga05p37_19401_c1_3139_4239 339
23 3300050508 nmdc:mga09592_3995_c1 nmdc:mga09592_3995_c1_3097_4197 339
24 3300050510 nmdc:mga06r32_32526_c1 nmdc:mga06r32_32526_c1_410_1510 339
25 3300050512 nmdc:mga0n895_21237_c1 nmdc:mga0n895_21237_c1_4337_5437 339
26 3300050513 nmdc:mga0rr50_1507_c1 nmdc:mga0rr50_1507_c1_1437_2537 339
27 3300050515 nmdc:mga0a205_459_c1 nmdc:mga0a205_459_c1_21336_22436 339
28 3300005336 Ga0070680_100201720 Ga0070680_1002017202 341
29 3300005458 Ga0070681_10170069 Ga0070681_101700692 341
30 3300006852 Ga0075433_10037613 Ga0075433_100376133 341
31 3300013104 Ga0157370_10098051 Ga0157370_100980514 341
32 3300022467 Ga0224712_10019739 Ga0224712_100197393 341
33 3300025944 Ga0207661_10167084 Ga0207661_101670841 341
34 3300028556 Ga0265337_1017704 Ga0265337_10177044 341
35 3300031240 Ga0265320_10000815 Ga0265320_100008159 341
36 3300031595 Ga0265313_10000445 Ga0265313_1000044533 341
37 3300031712 Ga0265342_10050337 Ga0265342_100503374 341
38 3300048915 Ga0496112_0190213 Ga0496112_0190213_826_1941 342
39 3300012502 Ga0157347_1001320 Ga0157347_10013202 343
40 3300035090 Ga0373949_0023204 Ga0373949_0023204_136_1230 343
41 3300048912 Ga0496109_0207006 Ga0496109_0207006_527_1621 343
42 3300050512 nmdc:mga0n895_91689_c1 nmdc:mga0n895_91689_c1_726_1820 343
43 3300006847 Ga0075431_100134216 Ga0075431_1001342164 344
44 3300006852 Ga0075433_10004705 Ga0075433_100047057 344
45 3300006871 Ga0075434_100001698 Ga0075434_10000169822 344
46 3300006880 Ga0075429_100005496 Ga0075429_1000054968 344
47 3300007076 Ga0075435_100005245 Ga0075435_1000052459 344
48 3300009011 Ga0105251_10065033 Ga0105251_100650331 344
49 3300009176 Ga0105242_10066717 Ga0105242_100667172 344
50 3300010375 Ga0105239_10136560 Ga0105239_101365603 344
51 3300011119 Ga0105246_10068645 Ga0105246_100686452 344
52 3300013100 Ga0157373_10159155 Ga0157373_101591553 344
53 3300013102 Ga0157371_10135320 Ga0157371_101353201 344
54 3300013104 Ga0157370_10099706 Ga0157370_100997062 344
55 3300013297 Ga0157378_10178196 Ga0157378_101781962 344
56 3300014326 Ga0157380_10198141 Ga0157380_101981411 344
57 3300014969 Ga0157376_10206312 Ga0157376_102063123 344
58 3300021361 Ga0213872_10039610 Ga0213872_100396101 344
59 3300048904 Ga0496101_0044842 Ga0496101_0044842_448_1542 344
60 3300005468 Ga0070707_100335337 Ga0070707_1003353371 345
61 3300009098 Ga0105245_10012991 Ga0105245_100129915 345
62 3300009177 Ga0105248_10021036 Ga0105248_1002103610 345
63 3300012477 Ga0157336_1001662 Ga0157336_10016621 345
64 3300014968 Ga0157379_10022224 Ga0157379_100222244 345
65 3300049588 Ga0501072_0074793 Ga0501072_0074793_1227_2327 345
66 3300061734 Ga0530510_0015742 Ga0530510_0015742_623_1717 345
67 3300005468 Ga0070707_100174087 Ga0070707_1001740872 346
68 3300005471 Ga0070698_100176102 Ga0070698_1001761022 346
69 3300005614 Ga0068856_100005943 Ga0068856_1000059435 346
70 3300007076 Ga0075435_100002324 Ga0075435_1000023246 346
71 3300021361 Ga0213872_10000378 Ga0213872_1000037826 346
72 3300025910 Ga0207684_10027926 Ga0207684_100279264 346
73 3300025931 Ga0207644_10214873 Ga0207644_102148732 346
74 3300026078 Ga0207702_10021015 Ga0207702_100210153 346
75 3300026118 Ga0207675_100059960 Ga0207675_1000599603 346
76 3300034819 Ga0373958_0007264 Ga0373958_0007264_575_1690 346
77 3300034820 Ga0373959_0000279 Ga0373959_0000279_4418_5533 346
78 3300034957 Ga0373938_0002818 Ga0373938_0002818_1585_2700 346
79 3300035085 Ga0373929_0001098 Ga0373929_0001098_351_1466 346
80 3300035088 Ga0373940_0000889 Ga0373940_0000889_2009_3124 346
81 3300035091 Ga0373951_0000396 Ga0373951_0000396_5164_6279 346
82 3300035092 Ga0373952_0005552 Ga0373952_0005552_797_1912 346
83 3300035112 Ga0373932_0000346 Ga0373932_0000346_364_1479 346
84 3300035115 Ga0373941_0000795 Ga0373941_0000795_5032_6147 346
85 3300035207 Ga0373942_0003182 Ga0373942_0003182_2320_3435 346
86 3300035241 Ga0373961_0010319 Ga0373961_0010319_605_1720 346
87 3300039447 Ga0436361_0786779 Ga0436361_0786779_127380_128477 346
88 3300045051 Ga0451576_0003151 Ga0451576_0003151_5603_6718 346
89 3300045976 Ga0466967_0210617 Ga0466967_0210617_86_1186 346
90 3300054114 Ga0501084_0111862 Ga0501084_0111862_151_1251 346
91 3300060353 Ga0501082_0200303 Ga0501082_0200303_490_1590 346
92 3300009093 Ga0105240_10012448 Ga0105240_100124488 347
93 3300035172 Ga0373955_0097009 Ga0373955_0097009_21_1115 347
94 3300046531 Ga0495665_0109878 Ga0495665_0109878_212_1312 347
95 3300048917 Ga0496114_0195806 Ga0496114_0195806_331_1431 347
96 3300049591 Ga0501075_0080925 Ga0501075_0080925_1300_2415 347
97 3300049593 Ga0501077_0126210 Ga0501077_0126210_57_1229 347
98 3300050511 nmdc:mga08y16_193541_c1 nmdc:mga08y16_193541_c1_241_1413 348
99 3300006880 Ga0075429_100094531 Ga0075429_1000945311 349
100 3300005355 Ga0070671_100343216 Ga0070671_1003432161 350
101 3300005455 Ga0070663_100008957 Ga0070663_1000089574 350
102 3300005518 Ga0070699_100000430 Ga0070699_10000043014 350
103 3300005536 Ga0070697_100117141 Ga0070697_1001171413 350
104 3300005539 Ga0068853_100019160 Ga0068853_1000191605 350
105 3300005545 Ga0070695_100295461 Ga0070695_1002954611 350
106 3300005614 Ga0068856_100004878 Ga0068856_1000048782 350
107 3300005617 Ga0068859_100083297 Ga0068859_1000832973 350
108 3300005719 Ga0068861_100230570 Ga0068861_1002305703 350
109 3300005843 Ga0068860_100005548 Ga0068860_1000055482 350
110 3300005985 Ga0081539_10003352 Ga0081539_1000335211 350
111 3300006852 Ga0075433_10103618 Ga0075433_101036183 350
112 3300006871 Ga0075434_100039520 Ga0075434_1000395203 350
113 3300006871 Ga0075434_100071338 Ga0075434_1000713386 350
114 3300006914 Ga0075436_100022912 Ga0075436_1000229124 350
115 3300006914 Ga0075436_100141255 Ga0075436_1001412552 350
116 3300006931 Ga0097620_100083293 Ga0097620_1000832933 350
117 3300007076 Ga0075435_100328583 Ga0075435_1003285832 350
118 3300009094 Ga0111539_10094764 Ga0111539_100947642 350
119 3300009094 Ga0111539_10126261 Ga0111539_101262614 350
120 3300009147 Ga0114129_10002830 Ga0114129_1000283022 350
121 3300009147 Ga0114129_10188206 Ga0114129_101882064 350
122 3300013297 Ga0157378_10320818 Ga0157378_103208182 350
123 3300021388 Ga0213875_10032249 Ga0213875_100322493 350
124 3300025898 Ga0207692_10100524 Ga0207692_101005242 350
125 3300025901 Ga0207688_10089634 Ga0207688_100896343 350
126 3300025911 Ga0207654_10013831 Ga0207654_100138314 350
127 3300025919 Ga0207657_10000368 Ga0207657_1000036823 350
128 3300025919 Ga0207657_10036867 Ga0207657_100368673 350
129 3300025920 Ga0207649_10011272 Ga0207649_100112722 350
130 3300025923 Ga0207681_10156304 Ga0207681_101563042 350
131 3300025925 Ga0207650_10038654 Ga0207650_100386542 350
132 3300025929 Ga0207664_10001895 Ga0207664_100018957 350
133 3300025929 Ga0207664_10014193 Ga0207664_100141935 350
134 3300025933 Ga0207706_10000345 Ga0207706_1000034518 350
135 3300025942 Ga0207689_10000934 Ga0207689_1000093425 350
136 3300025945 Ga0207679_10010930 Ga0207679_100109308 350
137 3300025949 Ga0207667_10311346 Ga0207667_103113462 350
138 3300025981 Ga0207640_10005776 Ga0207640_100057761 350
139 3300026067 Ga0207678_10001991 Ga0207678_1000199121 350
140 3300026078 Ga0207702_10171984 Ga0207702_101719842 350
141 3300026095 Ga0207676_10059464 Ga0207676_100594641 350
142 3300026118 Ga0207675_100047885 Ga0207675_1000478852 350
143 3300028380 Ga0268265_10082547 Ga0268265_100825474 350
144 3300031711 Ga0265314_10000757 Ga0265314_1000075724 350
145 3300031728 Ga0316578_10000109 Ga0316578_1000010917 350
146 3300031733 Ga0316577_10000248 Ga0316577_100002484 350
147 3300035172 Ga0373955_0060905 Ga0373955_0060905_286_1401 350
148 3300036401 Ga0373937_0054579 Ga0373937_0054579_1783_2898 350
149 3300036712 Ga0316584_0069294 Ga0316584_0069294_1149_2288 350
150 3300039447 Ga0436361_0532220 Ga0436361_0532220_2623_3738 350
151 3300039453 Ga0436362_0731880 Ga0436362_0731880_552_1667 350
152 3300046459 Ga0495629_0190235 Ga0495629_0190235_207_1322 350
153 3300046462 Ga0495651_0013976 Ga0495651_0013976_2315_3430 350
154 3300046463 Ga0495653_0017172 Ga0495653_0017172_3268_4383 350
155 3300046463 Ga0495653_0106058 Ga0495653_0106058_481_1596 350
156 3300046477 Ga0495664_0001823 Ga0495664_0001823_2844_3959 350
157 3300046516 Ga0495628_0038453 Ga0495628_0038453_936_2051 350
158 3300046536 Ga0495587_0016619 Ga0495587_0016619_93_1208 350
159 3300046559 Ga0495667_0028262 Ga0495667_0028262_374_1489 350
160 3300046663 Ga0495635_0051725 Ga0495635_0051725_1043_2158 350
161 3300046675 Ga0495657_0032307 Ga0495657_0032307_1531_2646 350
162 3300046678 Ga0495599_0013975 Ga0495599_0013975_3283_4398 350
163 3300046689 Ga0495613_0073856 Ga0495613_0073856_222_1319 350
164 3300047322 Ga0495680_0019298 Ga0495680_0019298_4153_5268 350
165 3300047322 Ga0495680_0073924 Ga0495680_0073924_424_1539 350
166 3300047471 Ga0495684_0042767 Ga0495684_0042767_938_2053 350
167 3300047471 Ga0495684_0051250 Ga0495684_0051250_98_1213 350
168 3300048911 Ga0496108_0000922 Ga0496108_0000922_1724_2839 350
169 3300049577 Ga0501041_0167857 Ga0501041_0167857_174_1289 350
170 3300050507 nmdc:mga05p37_3141_c1 nmdc:mga05p37_3141_c1_16951_18066 350
171 3300050514 nmdc:mga08x19_39527_c1 nmdc:mga08x19_39527_c1_628_1743 350
172 3300050515 nmdc:mga0a205_36021_c1 nmdc:mga0a205_36021_c1_2195_3310 350
173 3300003659 JGI25404J52841_10012497 JGI25404J52841_100124972 351
174 3300003911 JGI25405J52794_10004861 JGI25405J52794_100048613 351
175 3300005327 Ga0070658_10001619 Ga0070658_100016195 351
176 3300005327 Ga0070658_10174992 Ga0070658_101749921 351
177 3300005329 Ga0070683_100001216 Ga0070683_1000012162 351
178 3300005334 Ga0068869_100018892 Ga0068869_1000188923 351
179 3300005335 Ga0070666_10032815 Ga0070666_100328152 351
180 3300005336 Ga0070680_100068624 Ga0070680_1000686243 351
181 3300005339 Ga0070660_100035154 Ga0070660_1000351543 351
182 3300005339 Ga0070660_100150544 Ga0070660_1001505443 351
183 3300005340 Ga0070689_100051129 Ga0070689_1000511293 351
184 3300005344 Ga0070661_100242395 Ga0070661_1002423951 351
185 3300005345 Ga0070692_10033655 Ga0070692_100336552 351
186 3300005364 Ga0070673_100087869 Ga0070673_1000878692 351
187 3300005365 Ga0070688_100088683 Ga0070688_1000886832 351
188 3300005367 Ga0070667_100108267 Ga0070667_1001082672 351
189 3300005435 Ga0070714_100027720 Ga0070714_1000277204 351
190 3300005435 Ga0070714_100300181 Ga0070714_1003001811 351
191 3300005436 Ga0070713_100003473 Ga0070713_1000034736 351
192 3300005437 Ga0070710_10001495 Ga0070710_100014956 351
193 3300005439 Ga0070711_100213126 Ga0070711_1002131262 351
194 3300005444 Ga0070694_100012866 Ga0070694_1000128663 351
195 3300005445 Ga0070708_100000046 Ga0070708_10000004667 351
196 3300005455 Ga0070663_100127449 Ga0070663_1001274491 351
197 3300005458 Ga0070681_10033519 Ga0070681_100335195 351
198 3300005458 Ga0070681_10039088 Ga0070681_100390882 351
199 3300005458 Ga0070681_10253650 Ga0070681_102536501 351
200 3300005459 Ga0068867_100103154 Ga0068867_1001031543 351
201 3300005459 Ga0068867_100108454 Ga0068867_1001084542 351
202 3300005466 Ga0070685_10066599 Ga0070685_100665992 351
203 3300005467 Ga0070706_100000022 Ga0070706_10000002269 351
204 3300005467 Ga0070706_100002607 Ga0070706_1000026076 351
205 3300005468 Ga0070707_100000036 Ga0070707_10000003682 351
206 3300005471 Ga0070698_100038179 Ga0070698_1000381793 351
207 3300005471 Ga0070698_100048860 Ga0070698_1000488604 351
208 3300005518 Ga0070699_100000186 Ga0070699_10000018629 351
209 3300005518 Ga0070699_100002807 Ga0070699_1000028078 351
210 3300005518 Ga0070699_100025551 Ga0070699_1000255514 351
211 3300005530 Ga0070679_100001620 Ga0070679_10000162011 351
212 3300005530 Ga0070679_100061928 Ga0070679_1000619281 351
213 3300005530 Ga0070679_100219605 Ga0070679_1002196052 351
214 3300005535 Ga0070684_100019144 Ga0070684_1000191444 351
215 3300005535 Ga0070684_100126957 Ga0070684_1001269573 351
216 3300005543 Ga0070672_100199496 Ga0070672_1001994962 351
217 3300005545 Ga0070695_100054534 Ga0070695_1000545343 351
218 3300005546 Ga0070696_100084323 Ga0070696_1000843231 351
219 3300005548 Ga0070665_100210332 Ga0070665_1002103322 351
220 3300005549 Ga0070704_100148069 Ga0070704_1001480692 351
221 3300005563 Ga0068855_100021105 Ga0068855_1000211055 351
222 3300005563 Ga0068855_100029149 Ga0068855_1000291495 351
223 3300005564 Ga0070664_100103803 Ga0070664_1001038032 351
224 3300005614 Ga0068856_100007710 Ga0068856_1000077103 351
225 3300005615 Ga0070702_100050912 Ga0070702_1000509121 351
226 3300005617 Ga0068859_100016513 Ga0068859_1000165133 351
227 3300005842 Ga0068858_100007173 Ga0068858_10000717310 351
228 3300005843 Ga0068860_100004892 Ga0068860_1000048925 351
229 3300005937 Ga0081455_10004213 Ga0081455_1000421311 351
230 3300005983 Ga0081540_1012854 Ga0081540_10128542 351
231 3300006028 Ga0070717_10076294 Ga0070717_100762943 351
232 3300006173 Ga0070716_100053655 Ga0070716_1000536553 351
233 3300006175 Ga0070712_100021289 Ga0070712_1000212894 351
234 3300006237 Ga0097621_100015771 Ga0097621_1000157713 351
235 3300006358 Ga0068871_100024176 Ga0068871_1000241764 351
236 3300006358 Ga0068871_100040514 Ga0068871_1000405143 351
237 3300006358 Ga0068871_100300267 Ga0068871_1003002671 351
238 3300006846 Ga0075430_100015300 Ga0075430_1000153001 351
239 3300006847 Ga0075431_100025019 Ga0075431_1000250194 351
240 3300006871 Ga0075434_100001875 Ga0075434_1000018756 351
241 3300006880 Ga0075429_100017437 Ga0075429_1000174373 351
242 3300006880 Ga0075429_100024561 Ga0075429_1000245615 351
243 3300006881 Ga0068865_100056759 Ga0068865_1000567593 351
244 3300006914 Ga0075436_100000567 Ga0075436_10000056715 351
245 3300006931 Ga0097620_100016515 Ga0097620_1000165153 351
246 3300007076 Ga0075435_100000423 Ga0075435_10000042319 351
247 3300009093 Ga0105240_10107007 Ga0105240_101070072 351
248 3300009093 Ga0105240_10171643 Ga0105240_101716434 351
249 3300009098 Ga0105245_10073605 Ga0105245_100736053 351
250 3300009147 Ga0114129_10077276 Ga0114129_100772763 351
251 3300009147 Ga0114129_10115328 Ga0114129_101153283 351
252 3300009148 Ga0105243_10041814 Ga0105243_100418142 351
253 3300009177 Ga0105248_10122475 Ga0105248_101224753 351
254 3300009545 Ga0105237_10182304 Ga0105237_101823042 351
255 3300009551 Ga0105238_10019644 Ga0105238_100196449 351
256 3300009551 Ga0105238_10032392 Ga0105238_100323925 351
257 3300009551 Ga0105238_10141939 Ga0105238_101419392 351
258 3300013104 Ga0157370_10030237 Ga0157370_100302374 351
259 3300013104 Ga0157370_10116358 Ga0157370_101163583 351
260 3300013104 Ga0157370_10128633 Ga0157370_101286332 351
261 3300013105 Ga0157369_10022024 Ga0157369_100220245 351
262 3300013105 Ga0157369_10238734 Ga0157369_102387343 351
263 3300013296 Ga0157374_10015346 Ga0157374_100153468 351
264 3300013296 Ga0157374_10309305 Ga0157374_103093052 351
265 3300013306 Ga0163162_10006142 Ga0163162_100061424 351
266 3300013307 Ga0157372_10010876 Ga0157372_1001087612 351
267 3300013308 Ga0157375_10114617 Ga0157375_101146173 351
268 3300014325 Ga0163163_10032293 Ga0163163_100322933 351
269 3300014325 Ga0163163_10438936 Ga0163163_104389362 351
270 3300014326 Ga0157380_10052478 Ga0157380_100524782 351
271 3300020078 Ga0206352_11153136 Ga0206352_111531362 351
272 3300021388 Ga0213875_10000274 Ga0213875_1000027427 351
273 3300021388 Ga0213875_10008920 Ga0213875_100089205 351
274 3300025900 Ga0207710_10055337 Ga0207710_100553372 351
275 3300025903 Ga0207680_10027054 Ga0207680_100270543 351
276 3300025906 Ga0207699_10001533 Ga0207699_100015337 351
277 3300025906 Ga0207699_10033217 Ga0207699_100332172 351
278 3300025909 Ga0207705_10005801 Ga0207705_100058015 351
279 3300025909 Ga0207705_10066129 Ga0207705_100661293 351
280 3300025909 Ga0207705_10146094 Ga0207705_101460942 351
281 3300025910 Ga0207684_10000092 Ga0207684_1000009272 351
282 3300025910 Ga0207684_10049817 Ga0207684_100498174 351
283 3300025912 Ga0207707_10001893 Ga0207707_1000189317 351
284 3300025912 Ga0207707_10006077 Ga0207707_1000607713 351
285 3300025912 Ga0207707_10169221 Ga0207707_101692212 351
286 3300025913 Ga0207695_10000160 Ga0207695_1000016054 351
287 3300025913 Ga0207695_10028162 Ga0207695_100281626 351
288 3300025913 Ga0207695_10119403 Ga0207695_101194033 351
289 3300025914 Ga0207671_10216440 Ga0207671_102164402 351
290 3300025915 Ga0207693_10057981 Ga0207693_100579813 351
291 3300025916 Ga0207663_10216628 Ga0207663_102166281 351
292 3300025917 Ga0207660_10330206 Ga0207660_103302061 351
293 3300025919 Ga0207657_10030913 Ga0207657_100309133 351
294 3300025921 Ga0207652_10010440 Ga0207652_100104402 351
295 3300025921 Ga0207652_10051861 Ga0207652_100518613 351
296 3300025921 Ga0207652_10109990 Ga0207652_101099903 351
297 3300025922 Ga0207646_10000013 Ga0207646_1000001373 351
298 3300025922 Ga0207646_10015336 Ga0207646_100153364 351
299 3300025922 Ga0207646_10056656 Ga0207646_100566562 351
300 3300025922 Ga0207646_10076817 Ga0207646_100768172 351
301 3300025924 Ga0207694_10013385 Ga0207694_100133857 351
302 3300025928 Ga0207700_10003399 Ga0207700_100033993 351
303 3300025928 Ga0207700_10056312 Ga0207700_100563124 351
304 3300025933 Ga0207706_10032639 Ga0207706_100326395 351
305 3300025933 Ga0207706_10208693 Ga0207706_102086932 351
306 3300025934 Ga0207686_10013611 Ga0207686_100136116 351
307 3300025939 Ga0207665_10074780 Ga0207665_100747802 351
308 3300025942 Ga0207689_10029324 Ga0207689_100293244 351
309 3300025944 Ga0207661_10147328 Ga0207661_101473283 351
310 3300025945 Ga0207679_10078364 Ga0207679_100783642 351
311 3300025949 Ga0207667_10039866 Ga0207667_100398662 351
312 3300025949 Ga0207667_10057049 Ga0207667_100570492 351
313 3300025986 Ga0207658_10058282 Ga0207658_100582822 351
314 3300026023 Ga0207677_10003956 Ga0207677_100039565 351
315 3300026035 Ga0207703_10004915 Ga0207703_100049155 351
316 3300026067 Ga0207678_10001698 Ga0207678_1000169814 351
317 3300026067 Ga0207678_10023885 Ga0207678_100238854 351
318 3300026067 Ga0207678_10046730 Ga0207678_100467304 351
319 3300026067 Ga0207678_10127993 Ga0207678_101279932 351
320 3300026089 Ga0207648_10357992 Ga0207648_103579922 351
321 3300026116 Ga0207674_10045402 Ga0207674_100454023 351
322 3300026118 Ga0207675_100071149 Ga0207675_1000711492 351
323 3300026121 Ga0207683_10022689 Ga0207683_100226894 351
324 3300028379 Ga0268266_10193600 Ga0268266_101936002 351
325 3300028379 Ga0268266_10214716 Ga0268266_102147162 351
326 3300028800 Ga0265338_10019875 Ga0265338_100198754 351
327 3300031238 Ga0265332_10011759 Ga0265332_100117593 351
328 3300031241 Ga0265325_10000204 Ga0265325_1000020424 351
329 3300031249 Ga0265339_10000619 Ga0265339_100006193 351
330 3300031250 Ga0265331_10000427 Ga0265331_1000042711 351
331 3300031595 Ga0265313_10000821 Ga0265313_1000082111 351
332 3300031711 Ga0265314_10001445 Ga0265314_1000144511 351
333 3300031711 Ga0265314_10020912 Ga0265314_100209125 351
334 3300031712 Ga0265342_10014410 Ga0265342_100144105 351
335 3300031712 Ga0265342_10016137 Ga0265342_100161372 351
336 3300032002 Ga0307416_100072253 Ga0307416_1000722533 351
337 3300035083 Ga0373926_0003918 Ga0373926_0003918_1994_3175 351
338 3300035086 Ga0373934_0005014 Ga0373934_0005014_3662_4777 351
339 3300035111 Ga0373923_0001007 Ga0373923_0001007_205_1386 351
340 3300035117 Ga0373953_0006637 Ga0373953_0006637_2312_3427 351
341 3300035118 Ga0373954_0003142 Ga0373954_0003142_4364_5545 351
342 3300035118 Ga0373954_0008627 Ga0373954_0008627_2823_3938 351
343 3300035119 Ga0373956_0025687 Ga0373956_0025687_210_1325 351
344 3300035170 Ga0373943_0009965 Ga0373943_0009965_1295_2410 351
345 3300035410 Ga0373924_0017999 Ga0373924_0017999_1436_2551 351
346 3300035692 Ga0373935_0032002 Ga0373935_0032002_339_1520 351
347 3300035692 Ga0373935_0040709 Ga0373935_0040709_1067_2182 351
348 3300035695 Ga0373927_0001485 Ga0373927_0001485_1363_2544 351
349 3300035724 Ga0373933_0097564 Ga0373933_0097564_289_1470 351
350 3300035725 Ga0373947_0005413 Ga0373947_0005413_4775_5890 351
351 3300035725 Ga0373947_0059864 Ga0373947_0059864_1010_2191 351
352 3300036401 Ga0373937_0001471 Ga0373937_0001471_17118_18233 351
353 3300036401 Ga0373937_0003391 Ga0373937_0003391_1727_2908 351
354 3300036401 Ga0373937_0011040 Ga0373937_0011040_2919_4034 351
355 3300037068 Ga0373925_0041169 Ga0373925_0041169_117_1232 351
356 3300037418 Ga0395900_0142047 Ga0395900_0142047_248_1363 351
357 3300037466 Ga0395898_0002825 Ga0395898_0002825_12379_13494 351
358 3300037471 Ga0395905_0011043 Ga0395905_0011043_283_1398 351
359 3300037853 Ga0436364_0763039 Ga0436364_0763039_10313_11428 351
360 3300037853 Ga0436364_0860100 Ga0436364_0860100_373_1488 351
361 3300037853 Ga0436364_1042412 Ga0436364_1042412_146_1261 351
362 3300037853 Ga0436364_1150656 Ga0436364_1150656_560_1675 351
363 3300037853 Ga0436364_1562251 Ga0436364_1562251_125204_126319 351
364 3300039437 Ga0436365_1306583 Ga0436365_1306583_29_1144 351
365 3300042876 Ga0451577_0042049 Ga0451577_0042049_1548_2663 351
366 3300044673 Ga0453683_0021603 Ga0453683_0021603_2548_3732 351
367 3300044694 Ga0466963_0011141 Ga0466963_0011141_3322_4500 351
368 3300044712 Ga0453684_0005205 Ga0453684_0005205_2495_3610 351
369 3300044712 Ga0453684_0056727 Ga0453684_0056727_1689_2804 351
370 3300045051 Ga0451576_0110089 Ga0451576_0110089_961_2076 351
371 3300045836 Ga0466958_0042496 Ga0466958_0042496_142_1257 351
372 3300046454 Ga0495592_0051242 Ga0495592_0051242_1766_2947 351
373 3300046461 Ga0495641_0056508 Ga0495641_0056508_614_1729 351
374 3300046463 Ga0495653_0002200 Ga0495653_0002200_5951_7132 351
375 3300046463 Ga0495653_0123811 Ga0495653_0123811_694_1809 351
376 3300046472 Ga0495580_0035022 Ga0495580_0035022_1123_2304 351
377 3300046473 Ga0495582_0002571 Ga0495582_0002571_5221_6336 351
378 3300046473 Ga0495582_0003889 Ga0495582_0003889_5322_6452 351
379 3300046473 Ga0495582_0005954 Ga0495582_0005954_338_1453 351
380 3300046475 Ga0495639_0003444 Ga0495639_0003444_3597_4712 351
381 3300046477 Ga0495664_0015894 Ga0495664_0015894_526_1641 351
382 3300046477 Ga0495664_0021318 Ga0495664_0021318_296_1477 351
383 3300046511 Ga0495608_0025845 Ga0495608_0025845_1192_2373 351
384 3300046511 Ga0495608_0138308 Ga0495608_0138308_164_1279 351
385 3300046514 Ga0495618_0014606 Ga0495618_0014606_2200_3315 351
386 3300046516 Ga0495628_0024095 Ga0495628_0024095_1096_2277 351
387 3300046516 Ga0495628_0147179 Ga0495628_0147179_360_1547 351
388 3300046517 Ga0495630_0023060 Ga0495630_0023060_1223_2404 351
389 3300046526 Ga0495666_0035267 Ga0495666_0035267_1024_2205 351
390 3300046529 Ga0495652_0002364 Ga0495652_0002364_14929_16110 351
391 3300046529 Ga0495652_0044698 Ga0495652_0044698_2133_3248 351
392 3300046531 Ga0495665_0001338 Ga0495665_0001338_10619_11800 351
393 3300046531 Ga0495665_0007757 Ga0495665_0007757_4523_5638 351
394 3300046535 Ga0495586_0001720 Ga0495586_0001720_2890_4071 351
395 3300046536 Ga0495587_0009640 Ga0495587_0009640_1580_2761 351
396 3300046543 Ga0495645_0020867 Ga0495645_0020867_654_1769 351
397 3300046543 Ga0495645_0024270 Ga0495645_0024270_3064_4245 351
398 3300046543 Ga0495645_0077919 Ga0495645_0077919_604_1719 351
399 3300046558 Ga0495633_0108246 Ga0495633_0108246_98_1279 351
400 3300046559 Ga0495667_0014969 Ga0495667_0014969_3059_4174 351
401 3300046559 Ga0495667_0017347 Ga0495667_0017347_123_1304 351
402 3300046642 Ga0495634_0072746 Ga0495634_0072746_27_1142 351
403 3300046642 Ga0495634_0101078 Ga0495634_0101078_83_1213 351
404 3300046663 Ga0495635_0002040 Ga0495635_0002040_10804_11985 351
405 3300046675 Ga0495657_0008797 Ga0495657_0008797_3078_4259 351
406 3300046678 Ga0495599_0028108 Ga0495599_0028108_808_1989 351
407 3300046679 Ga0495623_0003511 Ga0495623_0003511_3477_4658 351
408 3300046680 Ga0495646_0005662 Ga0495646_0005662_5007_6188 351
409 3300046680 Ga0495646_0022907 Ga0495646_0022907_2247_3362 351
410 3300046681 Ga0495647_0016034 Ga0495647_0016034_429_1544 351
411 3300046683 Ga0495658_0004533 Ga0495658_0004533_3678_4793 351
412 3300046683 Ga0495658_0005555 Ga0495658_0005555_3100_4281 351
413 3300046684 Ga0495669_0002730 Ga0495669_0002730_4107_5222 351
414 3300046689 Ga0495613_0005792 Ga0495613_0005792_6330_7511 351
415 3300046690 Ga0495624_0001011 Ga0495624_0001011_12821_14002 351
416 3300046690 Ga0495624_0009644 Ga0495624_0009644_3719_4834 351
417 3300047317 Ga0495604_0020756 Ga0495604_0020756_3639_4820 351
418 3300047317 Ga0495604_0031488 Ga0495604_0031488_1903_3018 351
419 3300047319 Ga0495674_0007606 Ga0495674_0007606_8175_9356 351
420 3300047319 Ga0495674_0008960 Ga0495674_0008960_5028_6143 351
421 3300047321 Ga0495676_0069839 Ga0495676_0069839_349_1464 351
422 3300047322 Ga0495680_0010283 Ga0495680_0010283_7205_8320 351
423 3300047471 Ga0495684_0018890 Ga0495684_0018890_3667_4782 351
424 3300047471 Ga0495684_0039996 Ga0495684_0039996_818_1933 351
425 3300047471 Ga0495684_0078309 Ga0495684_0078309_773_1888 351
426 3300047673 Ga0495593_0001441 Ga0495593_0001441_1904_3085 351
427 3300047673 Ga0495593_0015149 Ga0495593_0015149_3093_4208 351
428 3300048088 Ga0495602_0018637 Ga0495602_0018637_4879_6060 351
429 3300048089 Ga0495614_0055541 Ga0495614_0055541_182_1363 351
430 3300048911 Ga0496108_0000014 Ga0496108_0000014_4946_6061 351
431 3300048911 Ga0496108_0081068 Ga0496108_0081068_527_1642 351
432 3300048918 Ga0496115_0156368 Ga0496115_0156368_434_1549 351
433 3300048918 Ga0496115_0184825 Ga0496115_0184825_88_1203 351
434 3300049568 Ga0501031_0019749 Ga0501031_0019749_2949_4064 351
435 3300049575 Ga0501039_0031951 Ga0501039_0031951_2082_3197 351
436 3300049577 Ga0501041_0023204 Ga0501041_0023204_977_2092 351
437 3300049582 Ga0501048_0235349 Ga0501048_0235349_42_1157 351
438 3300049583 Ga0501067_0006267 Ga0501067_0006267_1669_2784 351
439 3300049585 Ga0501069_0007159 Ga0501069_0007159_4242_5357 351
440 3300049587 Ga0501071_0259020 Ga0501071_0259020_142_1257 351
441 3300049588 Ga0501072_0182844 Ga0501072_0182844_493_1608 351
442 3300049591 Ga0501075_0084128 Ga0501075_0084128_596_1711 351
443 3300049592 Ga0501076_0037601 Ga0501076_0037601_2506_3621 351
444 3300049824 Ga0501045_0005188 Ga0501045_0005188_7626_8741 351
445 3300050507 nmdc:mga05p37_111803_c1 nmdc:mga05p37_111803_c1_503_1630 351
446 3300050507 nmdc:mga05p37_118394_c1 nmdc:mga05p37_118394_c1_1591_2706 351
447 3300050507 nmdc:mga05p37_128519_c1 nmdc:mga05p37_128519_c1_602_1717 351
448 3300050509 nmdc:mga0qj67_11162_c1 nmdc:mga0qj67_11162_c1_4935_6062 351
449 3300050510 nmdc:mga06r32_18553_c1 nmdc:mga06r32_18553_c1_3880_5007 351
450 3300050512 nmdc:mga0n895_33_c1 nmdc:mga0n895_33_c1_28133_29248 351
451 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_415402_416517 351
452 3300050514 nmdc:mga08x19_396_c1 nmdc:mga08x19_396_c1_16072_17187 351
453 3300053078 Ga0495612_0000994 Ga0495612_0000994_8736_9917 351
454 3300053078 Ga0495612_0017245 Ga0495612_0017245_1474_2589 351
455 3300053085 Ga0495619_0029947 Ga0495619_0029947_1452_2567 351
456 3300053085 Ga0495619_0169020 Ga0495619_0169020_258_1373 351
457 3300060353 Ga0501082_0070999 Ga0501082_0070999_68_1183 351
458 3300004798 Ga0058859_10080155 Ga0058859_100801553 352
459 3300005327 Ga0070658_10000021 Ga0070658_10000021127 352
460 3300005327 Ga0070658_10000279 Ga0070658_100002798 352
461 3300005327 Ga0070658_10002203 Ga0070658_100022031 352
462 3300005328 Ga0070676_10019789 Ga0070676_100197893 352
463 3300005328 Ga0070676_10101927 Ga0070676_101019271 352
464 3300005329 Ga0070683_100001771 Ga0070683_10000177111 352
465 3300005329 Ga0070683_100055879 Ga0070683_1000558793 352
466 3300005330 Ga0070690_100010000 Ga0070690_1000100003 352
467 3300005334 Ga0068869_100037317 Ga0068869_1000373173 352
468 3300005334 Ga0068869_100118927 Ga0068869_1001189272 352
469 3300005335 Ga0070666_10024727 Ga0070666_100247273 352
470 3300005339 Ga0070660_100027356 Ga0070660_1000273563 352
471 3300005347 Ga0070668_100067997 Ga0070668_1000679972 352
472 3300005353 Ga0070669_100016587 Ga0070669_1000165873 352
473 3300005353 Ga0070669_100080787 Ga0070669_1000807873 352
474 3300005354 Ga0070675_100037793 Ga0070675_1000377933 352
475 3300005354 Ga0070675_100088747 Ga0070675_1000887473 352
476 3300005356 Ga0070674_100000408 Ga0070674_10000040817 352
477 3300005356 Ga0070674_100150560 Ga0070674_1001505602 352
478 3300005364 Ga0070673_100034557 Ga0070673_1000345573 352
479 3300005366 Ga0070659_100076626 Ga0070659_1000766262 352
480 3300005367 Ga0070667_100074725 Ga0070667_1000747251 352
481 3300005435 Ga0070714_100037458 Ga0070714_1000374584 352
482 3300005444 Ga0070694_100012021 Ga0070694_1000120212 352
483 3300005445 Ga0070708_100001033 Ga0070708_10000103318 352
484 3300005445 Ga0070708_100011864 Ga0070708_1000118645 352
485 3300005445 Ga0070708_100132072 Ga0070708_1001320722 352
486 3300005456 Ga0070678_100009074 Ga0070678_1000090743 352
487 3300005457 Ga0070662_100001664 Ga0070662_1000016648 352
488 3300005457 Ga0070662_100073005 Ga0070662_1000730053 352
489 3300005457 Ga0070662_100209408 Ga0070662_1002094081 352
490 3300005458 Ga0070681_10108052 Ga0070681_101080523 352
491 3300005459 Ga0068867_100022100 Ga0068867_1000221003 352
492 3300005459 Ga0068867_100023735 Ga0068867_1000237352 352
493 3300005467 Ga0070706_100074951 Ga0070706_1000749512 352
494 3300005468 Ga0070707_100128594 Ga0070707_1001285943 352
495 3300005471 Ga0070698_100068642 Ga0070698_1000686422 352
496 3300005518 Ga0070699_100023706 Ga0070699_1000237065 352
497 3300005535 Ga0070684_100069127 Ga0070684_1000691271 352
498 3300005536 Ga0070697_100048201 Ga0070697_1000482013 352
499 3300005539 Ga0068853_100148754 Ga0068853_1001487542 352
500 3300005539 Ga0068853_100236811 Ga0068853_1002368112 352
501 3300005545 Ga0070695_100011784 Ga0070695_1000117842 352
502 3300005545 Ga0070695_100171656 Ga0070695_1001716562 352
503 3300005546 Ga0070696_100178889 Ga0070696_1001788891 352
504 3300005547 Ga0070693_100004196 Ga0070693_1000041967 352
505 3300005547 Ga0070693_100024126 Ga0070693_1000241262 352
506 3300005549 Ga0070704_100007081 Ga0070704_1000070815 352
507 3300005549 Ga0070704_100054300 Ga0070704_1000543003 352
508 3300005563 Ga0068855_100005502 Ga0068855_10000550215 352
509 3300005563 Ga0068855_100017909 Ga0068855_10001790912 352
510 3300005563 Ga0068855_100117079 Ga0068855_1001170792 352
511 3300005563 Ga0068855_100250063 Ga0068855_1002500632 352
512 3300005564 Ga0070664_100098729 Ga0070664_1000987291 352
513 3300005577 Ga0068857_100002114 Ga0068857_1000021146 352
514 3300005577 Ga0068857_100170834 Ga0068857_1001708343 352
515 3300005578 Ga0068854_100000738 Ga0068854_1000007387 352
516 3300005578 Ga0068854_100139285 Ga0068854_1001392851 352
517 3300005617 Ga0068859_100000016 Ga0068859_10000001671 352
518 3300005617 Ga0068859_100032177 Ga0068859_1000321771 352
519 3300005618 Ga0068864_100147610 Ga0068864_1001476102 352
520 3300005718 Ga0068866_10003263 Ga0068866_100032634 352
521 3300005718 Ga0068866_10096169 Ga0068866_100961692 352
522 3300005719 Ga0068861_100057757 Ga0068861_1000577572 352
523 3300005842 Ga0068858_100082793 Ga0068858_1000827933 352
524 3300005843 Ga0068860_100016575 Ga0068860_1000165753 352
525 3300005843 Ga0068860_100124411 Ga0068860_1001244112 352
526 3300005844 Ga0068862_100099900 Ga0068862_1000999001 352
527 3300006844 Ga0075428_100006949 Ga0075428_1000069497 352
528 3300006844 Ga0075428_100015999 Ga0075428_1000159992 352
529 3300006844 Ga0075428_100163970 Ga0075428_1001639704 352
530 3300006846 Ga0075430_100014480 Ga0075430_1000144803 352
531 3300006846 Ga0075430_100049805 Ga0075430_1000498053 352
532 3300006846 Ga0075430_100054434 Ga0075430_1000544342 352
533 3300006847 Ga0075431_100060431 Ga0075431_1000604313 352
534 3300006871 Ga0075434_100029067 Ga0075434_1000290676 352
535 3300006880 Ga0075429_100052837 Ga0075429_1000528372 352
536 3300006881 Ga0068865_100011164 Ga0068865_1000111643 352
537 3300006914 Ga0075436_100016644 Ga0075436_1000166443 352
538 3300006931 Ga0097620_100000016 Ga0097620_100000016140 352
539 3300006931 Ga0097620_100032177 Ga0097620_1000321771 352
540 3300007076 Ga0075435_100019539 Ga0075435_1000195396 352
541 3300007265 Ga0099794_10001037 Ga0099794_1000103710 352
542 3300009093 Ga0105240_10000780 Ga0105240_1000078035 352
543 3300009093 Ga0105240_10000788 Ga0105240_1000078810 352
544 3300009093 Ga0105240_10003364 Ga0105240_1000336413 352
545 3300009093 Ga0105240_10004522 Ga0105240_100045225 352
546 3300009093 Ga0105240_10052425 Ga0105240_100524252 352
547 3300009098 Ga0105245_10033778 Ga0105245_100337781 352
548 3300009098 Ga0105245_10124977 Ga0105245_101249773 352
549 3300009098 Ga0105245_10128762 Ga0105245_101287622 352
550 3300009147 Ga0114129_10007647 Ga0114129_100076473 352
551 3300009147 Ga0114129_10029069 Ga0114129_100290695 352
552 3300009147 Ga0114129_10128931 Ga0114129_101289312 352
553 3300009147 Ga0114129_10195602 Ga0114129_101956021 352
554 3300009148 Ga0105243_10042087 Ga0105243_100420872 352
555 3300009174 Ga0105241_10014984 Ga0105241_100149845 352
556 3300009174 Ga0105241_10063260 Ga0105241_100632603 352
557 3300009176 Ga0105242_10005180 Ga0105242_100051803 352
558 3300009177 Ga0105248_10018490 Ga0105248_100184905 352
559 3300009177 Ga0105248_10026504 Ga0105248_100265046 352
560 3300009177 Ga0105248_10377478 Ga0105248_103774782 352
561 3300009545 Ga0105237_10047673 Ga0105237_100476733 352
562 3300009551 Ga0105238_10092451 Ga0105238_100924512 352
563 3300009551 Ga0105238_10333560 Ga0105238_103335602 352
564 3300009553 Ga0105249_10040162 Ga0105249_100401624 352
565 3300009553 Ga0105249_10053011 Ga0105249_100530112 352
566 3300009553 Ga0105249_10385673 Ga0105249_103856732 352
567 3300010375 Ga0105239_10006913 Ga0105239_100069136 352
568 3300010375 Ga0105239_10020714 Ga0105239_100207142 352
569 3300013102 Ga0157371_10088390 Ga0157371_100883903 352
570 3300013104 Ga0157370_10004209 Ga0157370_1000420913 352
571 3300013104 Ga0157370_10164129 Ga0157370_101641292 352
572 3300013105 Ga0157369_10001727 Ga0157369_1000172728 352
573 3300013105 Ga0157369_10042138 Ga0157369_100421384 352
574 3300013105 Ga0157369_10078009 Ga0157369_100780092 352
575 3300013105 Ga0157369_10171792 Ga0157369_101717923 352
576 3300013296 Ga0157374_10085175 Ga0157374_100851753 352
577 3300013296 Ga0157374_10354750 Ga0157374_103547502 352
578 3300013297 Ga0157378_10037489 Ga0157378_100374892 352
579 3300013297 Ga0157378_10048208 Ga0157378_100482085 352
580 3300013306 Ga0163162_10009882 Ga0163162_100098826 352
581 3300013306 Ga0163162_10205237 Ga0163162_102052373 352
582 3300013306 Ga0163162_10318444 Ga0163162_103184442 352
583 3300013307 Ga0157372_10029220 Ga0157372_100292202 352
584 3300013307 Ga0157372_10091253 Ga0157372_100912532 352
585 3300013307 Ga0157372_10242881 Ga0157372_102428812 352
586 3300013308 Ga0157375_10285557 Ga0157375_102855572 352
587 3300014325 Ga0163163_10174551 Ga0163163_101745511 352
588 3300014326 Ga0157380_10071739 Ga0157380_100717393 352
589 3300014968 Ga0157379_10059969 Ga0157379_100599695 352
590 3300020075 Ga0206349_1912197 Ga0206349_19121973 352
591 3300020077 Ga0206351_10258841 Ga0206351_102588413 352
592 3300020078 Ga0206352_11337063 Ga0206352_113370632 352
593 3300020080 Ga0206350_10025740 Ga0206350_100257403 352
594 3300020081 Ga0206354_11089907 Ga0206354_110899072 352
595 3300020610 Ga0154015_1359972 Ga0154015_13599721 352
596 3300022467 Ga0224712_10021856 Ga0224712_100218563 352
597 3300022732 Ga0224569_100836 Ga0224569_1008362 352
598 3300025893 Ga0207682_10046160 Ga0207682_100461602 352
599 3300025899 Ga0207642_10002200 Ga0207642_100022003 352
600 3300025903 Ga0207680_10049551 Ga0207680_100495513 352
601 3300025907 Ga0207645_10000208 Ga0207645_1000020829 352
602 3300025907 Ga0207645_10031455 Ga0207645_100314551 352
603 3300025909 Ga0207705_10000041 Ga0207705_10000041150 352
604 3300025909 Ga0207705_10000311 Ga0207705_100003118 352
605 3300025909 Ga0207705_10001334 Ga0207705_1000133415 352
606 3300025911 Ga0207654_10007432 Ga0207654_100074323 352
607 3300025912 Ga0207707_10005437 Ga0207707_1000543710 352
608 3300025912 Ga0207707_10080991 Ga0207707_100809913 352
609 3300025913 Ga0207695_10003956 Ga0207695_1000395611 352
610 3300025913 Ga0207695_10016797 Ga0207695_100167974 352
611 3300025913 Ga0207695_10073347 Ga0207695_100733472 352
612 3300025913 Ga0207695_10134520 Ga0207695_101345203 352
613 3300025913 Ga0207695_10316875 Ga0207695_103168751 352
614 3300025914 Ga0207671_10026881 Ga0207671_100268812 352
615 3300025919 Ga0207657_10002531 Ga0207657_1000253111 352
616 3300025921 Ga0207652_10004093 Ga0207652_1000409310 352
617 3300025921 Ga0207652_10188205 Ga0207652_101882052 352
618 3300025922 Ga0207646_10017296 Ga0207646_100172963 352
619 3300025922 Ga0207646_10114670 Ga0207646_101146703 352
620 3300025922 Ga0207646_10117179 Ga0207646_101171791 352
621 3300025923 Ga0207681_10016075 Ga0207681_100160754 352
622 3300025924 Ga0207694_10101226 Ga0207694_101012263 352
623 3300025929 Ga0207664_10135925 Ga0207664_101359253 352
624 3300025932 Ga0207690_10056615 Ga0207690_100566152 352
625 3300025932 Ga0207690_10143492 Ga0207690_101434921 352
626 3300025933 Ga0207706_10000214 Ga0207706_1000021478 352
627 3300025933 Ga0207706_10162082 Ga0207706_101620823 352
628 3300025934 Ga0207686_10000636 Ga0207686_1000063616 352
629 3300025935 Ga0207709_10036419 Ga0207709_100364193 352
630 3300025937 Ga0207669_10001612 Ga0207669_100016122 352
631 3300025941 Ga0207711_10021556 Ga0207711_100215565 352
632 3300025941 Ga0207711_10022693 Ga0207711_100226931 352
633 3300025942 Ga0207689_10016850 Ga0207689_100168502 352
634 3300025942 Ga0207689_10050431 Ga0207689_100504314 352
635 3300025944 Ga0207661_10200906 Ga0207661_102009062 352
636 3300025945 Ga0207679_10111912 Ga0207679_101119121 352
637 3300025949 Ga0207667_10000702 Ga0207667_1000070231 352
638 3300025949 Ga0207667_10010143 Ga0207667_100101437 352
639 3300025949 Ga0207667_10406442 Ga0207667_104064422 352
640 3300025960 Ga0207651_10049682 Ga0207651_100496824 352
641 3300025960 Ga0207651_10280363 Ga0207651_102803631 352
642 3300025961 Ga0207712_10000690 Ga0207712_1000069014 352
643 3300025961 Ga0207712_10039884 Ga0207712_100398841 352
644 3300025981 Ga0207640_10022236 Ga0207640_100222362 352
645 3300025986 Ga0207658_10009848 Ga0207658_100098483 352
646 3300026035 Ga0207703_10058408 Ga0207703_100584082 352
647 3300026041 Ga0207639_10153314 Ga0207639_101533142 352
648 3300026067 Ga0207678_10004796 Ga0207678_100047963 352
649 3300026067 Ga0207678_10224994 Ga0207678_102249942 352
650 3300026075 Ga0207708_10061547 Ga0207708_100615472 352
651 3300026089 Ga0207648_10000098 Ga0207648_1000009896 352
652 3300026089 Ga0207648_10017351 Ga0207648_100173513 352
653 3300026089 Ga0207648_10374289 Ga0207648_103742892 352
654 3300026095 Ga0207676_10137044 Ga0207676_101370443 352
655 3300026095 Ga0207676_10168745 Ga0207676_101687452 352
656 3300026116 Ga0207674_10005378 Ga0207674_100053786 352
657 3300026116 Ga0207674_10098132 Ga0207674_100981321 352
658 3300026118 Ga0207675_100002507 Ga0207675_10000250715 352
659 3300026121 Ga0207683_10004901 Ga0207683_100049013 352
660 3300026142 Ga0207698_10402981 Ga0207698_104029811 352
661 3300027682 Ga0209971_1007869 Ga0209971_10078693 352
662 3300028379 Ga0268266_10294196 Ga0268266_102941961 352
663 3300028380 Ga0268265_10016612 Ga0268265_100166122 352
664 3300028380 Ga0268265_10074086 Ga0268265_100740862 352
665 3300028381 Ga0268264_10005694 Ga0268264_100056944 352
666 3300028381 Ga0268264_10056952 Ga0268264_100569522 352
667 3300028381 Ga0268264_10098771 Ga0268264_100987713 352
668 3300028381 Ga0268264_10223958 Ga0268264_102239582 352
669 3300028800 Ga0265338_10122966 Ga0265338_101229662 352
670 3300031241 Ga0265325_10003360 Ga0265325_100033605 352
671 3300031241 Ga0265325_10008421 Ga0265325_100084215 352
672 3300031344 Ga0265316_10018409 Ga0265316_100184092 352
673 3300031344 Ga0265316_10026615 Ga0265316_100266152 352
674 3300031344 Ga0265316_10077838 Ga0265316_100778383 352
675 3300031344 Ga0265316_10169777 Ga0265316_101697772 352
676 3300031548 Ga0307408_100247395 Ga0307408_1002473951 352
677 3300031595 Ga0265313_10009550 Ga0265313_100095504 352
678 3300031712 Ga0265342_10027518 Ga0265342_100275184 352
679 3300032002 Ga0307416_100182279 Ga0307416_1001822792 352
680 3300032004 Ga0307414_10088334 Ga0307414_100883344 352
681 3300032005 Ga0307411_10110875 Ga0307411_101108752 352
682 3300032126 Ga0307415_100059920 Ga0307415_1000599203 352
683 3300032126 Ga0307415_100202677 Ga0307415_1002026771 352
684 3300035116 Ga0373945_0059185 Ga0373945_0059185_135_1250 352
685 3300035241 Ga0373961_0000737 Ga0373961_0000737_3592_4707 352
686 3300035692 Ga0373935_0045454 Ga0373935_0045454_256_1371 352
687 3300037418 Ga0395900_0272231 Ga0395900_0272231_177_1364 352
688 3300037418 Ga0395900_0277014 Ga0395900_0277014_305_1450 352
689 3300037471 Ga0395905_0222380 Ga0395905_0222380_379_1521 352
690 3300038443 Ga0395901_0288647 Ga0395901_0288647_70_1257 352
691 3300039447 Ga0436361_0877238 Ga0436361_0877238_18116_19231 352
692 3300039450 Ga0436363_1214992 Ga0436363_1214992_3941_5056 352
693 3300044684 Ga0466966_0047740 Ga0466966_0047740_605_1720 352
694 3300045051 Ga0451576_0196875 Ga0451576_0196875_334_1512 352
695 3300045051 Ga0451576_0249844 Ga0451576_0249844_229_1344 352
696 3300046455 Ga0495603_0018163 Ga0495603_0018163_2337_3452 352
697 3300046499 Ga0495594_0015915 Ga0495594_0015915_1045_2160 352
698 3300046543 Ga0495645_0026215 Ga0495645_0026215_1482_2597 352
699 3300046543 Ga0495645_0074535 Ga0495645_0074535_906_2093 352
700 3300047471 Ga0495684_0000552 Ga0495684_0000552_9630_10814 352
701 3300048905 Ga0496102_0096198 Ga0496102_0096198_918_2033 352
702 3300048907 Ga0496104_0443699 Ga0496104_0443699_69_1184 352
703 3300048909 Ga0496106_0088507 Ga0496106_0088507_554_1669 352
704 3300048909 Ga0496106_0115428 Ga0496106_0115428_174_1289 352
705 3300048909 Ga0496106_0131025 Ga0496106_0131025_126_1241 352
706 3300048911 Ga0496108_0238927 Ga0496108_0238927_98_1213 352
707 3300048913 Ga0496110_0420793 Ga0496110_0420793_50_1165 352
708 3300048917 Ga0496114_0000025 Ga0496114_0000025_107164_108279 352
709 3300048917 Ga0496114_0045858 Ga0496114_0045858_818_1933 352
710 3300049570 Ga0501033_0040685 Ga0501033_0040685_1515_2630 352
711 3300049570 Ga0501033_0182447 Ga0501033_0182447_29_1144 352
712 3300049571 Ga0501034_0146957 Ga0501034_0146957_1123_2238 352
713 3300049572 Ga0501036_0025277 Ga0501036_0025277_2259_3374 352
714 3300049574 Ga0501038_0023583 Ga0501038_0023583_403_1518 352
715 3300049575 Ga0501039_0222214 Ga0501039_0222214_122_1237 352
716 3300049578 Ga0501042_0018680 Ga0501042_0018680_2254_3369 352
717 3300049579 Ga0501043_0022943 Ga0501043_0022943_2210_3325 352
718 3300049580 Ga0501046_0131082 Ga0501046_0131082_682_1797 352
719 3300049580 Ga0501046_0153246 Ga0501046_0153246_118_1233 352
720 3300049580 Ga0501046_0164074 Ga0501046_0164074_502_1617 352
721 3300049581 Ga0501047_0043435 Ga0501047_0043435_2409_3524 352
722 3300049591 Ga0501075_0085801 Ga0501075_0085801_987_2174 352
723 3300049591 Ga0501075_0104770 Ga0501075_0104770_176_1291 352
724 3300049592 Ga0501076_0007393 Ga0501076_0007393_4387_5502 352
725 3300049592 Ga0501076_0074897 Ga0501076_0074897_1171_2286 352
726 3300049593 Ga0501077_0005703 Ga0501077_0005703_4722_5837 352
727 3300049741 Ga0501079_0020331 Ga0501079_0020331_1371_2486 352
728 3300049742 Ga0501080_0231903 Ga0501080_0231903_406_1521 352
729 3300049744 Ga0501083_0185227 Ga0501083_0185227_151_1266 352
730 3300049823 Ga0501044_0028967 Ga0501044_0028967_2900_4015 352
731 3300049824 Ga0501045_0010130 Ga0501045_0010130_874_1989 352
732 3300049824 Ga0501045_0054363 Ga0501045_0054363_1755_2870 352
733 3300050507 nmdc:mga05p37_116944_c1 nmdc:mga05p37_116944_c1_1454_2569 352
734 3300050507 nmdc:mga05p37_281840_c1 nmdc:mga05p37_281840_c1_577_1806 352
735 3300050508 nmdc:mga09592_90_c1 nmdc:mga09592_90_c1_48666_49781 352
736 3300050509 nmdc:mga0qj67_22_c2 nmdc:mga0qj67_22_c2_13870_14985 352
737 3300050510 nmdc:mga06r32_792_c1 nmdc:mga06r32_792_c1_18209_19324 352
738 3300050513 nmdc:mga0rr50_5253_c1 nmdc:mga0rr50_5253_c1_2241_3356 352
739 3300050515 nmdc:mga0a205_165444_c1 nmdc:mga0a205_165444_c1_555_1670 352
740 3300053085 Ga0495619_0057768 Ga0495619_0057768_33_1148 352
741 3300054114 Ga0501084_0005466 Ga0501084_0005466_2470_3585 352
742 3300054114 Ga0501084_0134526 Ga0501084_0134526_132_1247 352
743 3300059423 Ga0590074_010779 Ga0590074_010779_216_1331 352
744 3300059426 Ga0590077_000572 Ga0590077_000572_3015_4130 352
745 3300060353 Ga0501082_0020076 Ga0501082_0020076_936_2051 352
746 3300060353 Ga0501082_0120252 Ga0501082_0120252_488_1603 352
747 3300060353 Ga0501082_0187416 Ga0501082_0187416_194_1309 352
748 3300061734 Ga0530510_0151735 Ga0530510_0151735_431_1618 352
749 3300005468 Ga0070707_100255413 Ga0070707_1002554132 353
750 3300006880 Ga0075429_100235509 Ga0075429_1002355092 353
751 3300025922 Ga0207646_10012903 Ga0207646_100129036 353
752 3300031235 Ga0265330_10007691 Ga0265330_100076912 353
753 3300031344 Ga0265316_10036639 Ga0265316_100366394 353
754 3300005445 Ga0070708_100121044 Ga0070708_1001210441 354
755 3300005518 Ga0070699_100000077 Ga0070699_10000007745 354
756 3300013306 Ga0163162_10373508 Ga0163162_103735082 354
757 3300025904 Ga0207647_10023700 Ga0207647_100237002 354
758 3300031616 Ga0307508_10003592 Ga0307508_100035927 354
759 3300005458 Ga0070681_10031949 Ga0070681_100319495 355
760 3300005467 Ga0070706_100404162 Ga0070706_1004041621 355
761 3300005468 Ga0070707_100045935 Ga0070707_1000459353 355
762 3300005530 Ga0070679_100011946 Ga0070679_1000119464 355
763 3300005530 Ga0070679_100038962 Ga0070679_1000389623 355
764 3300006881 Ga0068865_100052187 Ga0068865_1000521873 355
765 3300025917 Ga0207660_10031235 Ga0207660_100312354 355
766 3300025921 Ga0207652_10064213 Ga0207652_100642132 355
767 3300031344 Ga0265316_10090872 Ga0265316_100908722 355
768 3300048918 Ga0496115_0146024 Ga0496115_0146024_518_1633 355
769 3300050512 nmdc:mga0n895_108330_c1 nmdc:mga0n895_108330_c1_308_1495 355
770 3300050515 nmdc:mga0a205_102957_c1 nmdc:mga0a205_102957_c1_28_1095 355
771 3300009551 Ga0105238_10000394 Ga0105238_1000039413 356
772 3300044658 Ga0466972_0001421 Ga0466972_0001421_5172_6287 356
773 3300044735 Ga0466968_0011561 Ga0466968_0011561_2162_3277 356
774 3300046472 Ga0495580_0023956 Ga0495580_0023956_803_1918 356
775 3300046529 Ga0495652_0226627 Ga0495652_0226627_177_1292 356
776 3300046536 Ga0495587_0006761 Ga0495587_0006761_4063_5178 356
777 3300046543 Ga0495645_0211691 Ga0495645_0211691_97_1212 356
778 3300046689 Ga0495613_0006025 Ga0495613_0006025_5653_6768 356
779 3300047319 Ga0495674_0005499 Ga0495674_0005499_6107_7222 356
780 3300047471 Ga0495684_0000424 Ga0495684_0000424_24339_25454 356
781 3300053077 Ga0495601_0001231 Ga0495601_0001231_1248_2363 356
782 3300053085 Ga0495619_0003038 Ga0495619_0003038_9320_10435 356
783 3300021388 Ga0213875_10000128 Ga0213875_1000012814 357
784 3300025901 Ga0207688_10109665 Ga0207688_101096652 357
785 3300037853 Ga0436364_0354051 Ga0436364_0354051_9405_10520 357
786 3300050507 nmdc:mga05p37_14979_c1 nmdc:mga05p37_14979_c1_1146_2261 357
787 3300005339 Ga0070660_100067243 Ga0070660_1000672431 358
788 3300005367 Ga0070667_100046541 Ga0070667_1000465412 358
789 3300005458 Ga0070681_10043078 Ga0070681_100430783 358
790 3300006881 Ga0068865_100166344 Ga0068865_1001663442 358
791 3300009545 Ga0105237_10138100 Ga0105237_101381002 358
792 3300021384 Ga0213876_10006788 Ga0213876_100067885 358
793 3300025912 Ga0207707_10068902 Ga0207707_100689022 358
794 3300025919 Ga0207657_10075845 Ga0207657_100758452 358
795 3300039450 Ga0436363_0226178 Ga0436363_0226178_2872_3987 358
796 3300039453 Ga0436362_0097513 Ga0436362_0097513_118_1233 358
797 3300014326 Ga0157380_10187725 Ga0157380_101877252 359
798 3300032002 Ga0307416_100340597 Ga0307416_1003405971 359
799 3300050512 nmdc:mga0n895_155476_c1 nmdc:mga0n895_155476_c1_84_1199 359
800 3300005937 Ga0081455_10044558 Ga0081455_100445583 362
801 3300005618 Ga0068864_100202940 Ga0068864_1002029403 363
802 3300026095 Ga0207676_10180594 Ga0207676_101805943 363
803 3300035725 Ga0373947_0063494 Ga0373947_0063494_260_1378 363
804 3300037853 Ga0436364_0440807 Ga0436364_0440807_24_1139 363
805 3300046461 Ga0495641_0008007 Ga0495641_0008007_2869_3984 363
806 3300053085 Ga0495619_0091358 Ga0495619_0091358_234_1346 363
807 3300046678 Ga0495599_0108462 Ga0495599_0108462_563_1657 364
808 3300005336 Ga0070680_100113510 Ga0070680_1001135103 365
809 3300005539 Ga0068853_100181514 Ga0068853_1001815142 365
810 3300009094 Ga0111539_10050552 Ga0111539_100505521 365
811 3300013105 Ga0157369_10096570 Ga0157369_100965704 365
812 3300025917 Ga0207660_10111327 Ga0207660_101113271 365
813 3300026041 Ga0207639_10116585 Ga0207639_101165853 365
814 3300050511 nmdc:mga08y16_27594_c1 nmdc:mga08y16_27594_c1_1072_2169 365
815 3300035086 Ga0373934_0043181 Ga0373934_0043181_20_1120 366
816 3300035172 Ga0373955_0053988 Ga0373955_0053988_1050_2156 366
817 3300045051 Ga0451576_0083915 Ga0451576_0083915_659_1759 366
818 3300049576 Ga0501040_0007028 Ga0501040_0007028_5767_6867 366
819 3300049578 Ga0501042_0134169 Ga0501042_0134169_172_1272 366
820 3300049593 Ga0501077_0000625 Ga0501077_0000625_3017_4117 366
821 3300049741 Ga0501079_0007530 Ga0501079_0007530_2136_3236 366
822 3300050507 nmdc:mga05p37_110_c1 nmdc:mga05p37_110_c1_11169_12341 366
823 3300050512 nmdc:mga0n895_969_c1 nmdc:mga0n895_969_c1_7901_9016 366
824 iso_pu_bacteria 2675903058 2676477661 367
825 iso_pu_bacteria 2827628540 2827634423 367
826 iso_pu_bacteria 2866065130 2866067349 367
827 iso_pu_bacteria 8056207758 8056208788 367
828 3300009553 Ga0105249_10091821 Ga0105249_100918214 368
829 3300050512 nmdc:mga0n895_3543_c1 nmdc:mga0n895_3543_c1_2051_3238 369
830 3300050515 nmdc:mga0a205_6938_c1 nmdc:mga0a205_6938_c1_4027_5214 369
831 3300005290 Ga0065712_10002672 Ga0065712_100026724 370
832 3300005293 Ga0065715_10148960 Ga0065715_101489601 370
833 3300005293 Ga0065715_10153669 Ga0065715_101536692 370
834 3300005434 Ga0070709_10013266 Ga0070709_100132665 370
835 3300005439 Ga0070711_100000098 Ga0070711_10000009831 370
836 3300005444 Ga0070694_100122831 Ga0070694_1001228312 370
837 3300005471 Ga0070698_100096058 Ga0070698_1000960583 370
838 3300005981 Ga0081538_10028746 Ga0081538_100287463 370
839 3300005981 Ga0081538_10056363 Ga0081538_100563633 370
840 3300006173 Ga0070716_100025477 Ga0070716_1000254772 370
841 3300006880 Ga0075429_100088418 Ga0075429_1000884183 370
842 3300009094 Ga0111539_10036240 Ga0111539_100362403 370
843 3300009545 Ga0105237_10175580 Ga0105237_101755802 370
844 3300021384 Ga0213876_10000419 Ga0213876_100004196 370
845 3300025898 Ga0207692_10014016 Ga0207692_100140162 370
846 3300025906 Ga0207699_10035963 Ga0207699_100359634 370
847 3300025916 Ga0207663_10000080 Ga0207663_1000008027 370
848 3300031852 Ga0307410_10044694 Ga0307410_100446942 370
849 3300031903 Ga0307407_10021227 Ga0307407_100212272 370
850 3300031995 Ga0307409_100175380 Ga0307409_1001753801 370
851 3300032002 Ga0307416_100038666 Ga0307416_1000386661 370
852 3300039437 Ga0436365_0912825 Ga0436365_0912825_19593_20708 370
853 3300039437 Ga0436365_1101641 Ga0436365_1101641_614_1744 370
854 3300039450 Ga0436363_1060432 Ga0436363_1060432_1902_3071 370
855 3300048913 Ga0496110_0099769 Ga0496110_0099769_208_1320 370
856 3300050509 nmdc:mga0qj67_30507_c1 nmdc:mga0qj67_30507_c1_780_1895 370
857 3300050511 nmdc:mga08y16_7390_c1 nmdc:mga08y16_7390_c1_7164_8276 370
858 3300003373 JGI25407J50210_10012413 JGI25407J50210_100124134 371
859 3300005290 Ga0065712_10000384 Ga0065712_1000038410 371
860 3300005290 Ga0065712_10068399 Ga0065712_1006839910 371
861 3300005293 Ga0065715_10000217 Ga0065715_100002177 371
862 3300005329 Ga0070683_100114351 Ga0070683_1001143514 371
863 3300005331 Ga0070670_100003176 Ga0070670_1000031762 371
864 3300005331 Ga0070670_100229891 Ga0070670_1002298912 371
865 3300005334 Ga0068869_100001843 Ga0068869_1000018434 371
866 3300005334 Ga0068869_100113757 Ga0068869_1001137572 371
867 3300005335 Ga0070666_10002940 Ga0070666_100029407 371
868 3300005336 Ga0070680_100000021 Ga0070680_10000002145 371
869 3300005336 Ga0070680_100005607 Ga0070680_1000056073 371
870 3300005336 Ga0070680_100022475 Ga0070680_1000224754 371
871 3300005338 Ga0068868_100020520 Ga0068868_1000205204 371
872 3300005339 Ga0070660_100213348 Ga0070660_1002133482 371
873 3300005340 Ga0070689_100059453 Ga0070689_1000594531 371
874 3300005341 Ga0070691_10002131 Ga0070691_100021313 371
875 3300005343 Ga0070687_100017824 Ga0070687_1000178242 371
876 3300005345 Ga0070692_10039327 Ga0070692_100393273 371
877 3300005353 Ga0070669_100000130 Ga0070669_10000013053 371
878 3300005353 Ga0070669_100030220 Ga0070669_1000302203 371
879 3300005354 Ga0070675_100041499 Ga0070675_1000414992 371
880 3300005356 Ga0070674_100015560 Ga0070674_1000155605 371
881 3300005356 Ga0070674_100022011 Ga0070674_1000220111 371
882 3300005364 Ga0070673_100097124 Ga0070673_1000971242 371
883 3300005365 Ga0070688_100013022 Ga0070688_1000130223 371
884 3300005365 Ga0070688_100043817 Ga0070688_1000438174 371
885 3300005367 Ga0070667_100090659 Ga0070667_1000906592 371
886 3300005435 Ga0070714_100119448 Ga0070714_1001194483 371
887 3300005436 Ga0070713_100002127 Ga0070713_1000021273 371
888 3300005436 Ga0070713_100169287 Ga0070713_1001692872 371
889 3300005438 Ga0070701_10036467 Ga0070701_100364673 371
890 3300005439 Ga0070711_100032910 Ga0070711_1000329105 371
891 3300005441 Ga0070700_100026248 Ga0070700_1000262483 371
892 3300005444 Ga0070694_100032535 Ga0070694_1000325354 371
893 3300005444 Ga0070694_100114193 Ga0070694_1001141931 371
894 3300005445 Ga0070708_100021166 Ga0070708_1000211667 371
895 3300005445 Ga0070708_100060662 Ga0070708_1000606623 371
896 3300005445 Ga0070708_100069123 Ga0070708_1000691234 371
897 3300005445 Ga0070708_100086672 Ga0070708_1000866724 371
898 3300005455 Ga0070663_100040086 Ga0070663_1000400865 371
899 3300005456 Ga0070678_100020034 Ga0070678_1000200343 371
900 3300005456 Ga0070678_100073910 Ga0070678_1000739103 371
901 3300005458 Ga0070681_10005876 Ga0070681_100058768 371
902 3300005458 Ga0070681_10029790 Ga0070681_100297903 371
903 3300005458 Ga0070681_10058622 Ga0070681_100586224 371
904 3300005458 Ga0070681_10061152 Ga0070681_100611524 371
905 3300005458 Ga0070681_10080402 Ga0070681_100804022 371
906 3300005459 Ga0068867_100052413 Ga0068867_1000524132 371
907 3300005466 Ga0070685_10010554 Ga0070685_100105543 371
908 3300005466 Ga0070685_10020025 Ga0070685_100200253 371
909 3300005467 Ga0070706_100005806 Ga0070706_1000058064 371
910 3300005467 Ga0070706_100051696 Ga0070706_1000516964 371
911 3300005468 Ga0070707_100016158 Ga0070707_10001615810 371
912 3300005468 Ga0070707_100039944 Ga0070707_1000399443 371
913 3300005468 Ga0070707_100114752 Ga0070707_1001147522 371
914 3300005468 Ga0070707_100131408 Ga0070707_1001314083 371
915 3300005471 Ga0070698_100000731 Ga0070698_1000007317 371
916 3300005471 Ga0070698_100003493 Ga0070698_1000034939 371
917 3300005471 Ga0070698_100014362 Ga0070698_10001436211 371
918 3300005518 Ga0070699_100003015 Ga0070699_10000301511 371
919 3300005530 Ga0070679_100040169 Ga0070679_1000401694 371
920 3300005530 Ga0070679_100044889 Ga0070679_1000448893 371
921 3300005530 Ga0070679_100050082 Ga0070679_1000500824 371
922 3300005536 Ga0070697_100232893 Ga0070697_1002328932 371
923 3300005539 Ga0068853_100110316 Ga0068853_1001103163 371
924 3300005543 Ga0070672_100213721 Ga0070672_1002137212 371
925 3300005544 Ga0070686_100003086 Ga0070686_1000030863 371
926 3300005546 Ga0070696_100010232 Ga0070696_1000102323 371
927 3300005546 Ga0070696_100034074 Ga0070696_1000340743 371
928 3300005546 Ga0070696_100039903 Ga0070696_1000399032 371
929 3300005546 Ga0070696_100076940 Ga0070696_1000769401 371
930 3300005546 Ga0070696_100100353 Ga0070696_1001003533 371
931 3300005547 Ga0070693_100001983 Ga0070693_1000019833 371
932 3300005548 Ga0070665_100000225 Ga0070665_10000022526 371
933 3300005548 Ga0070665_100055682 Ga0070665_1000556823 371
934 3300005548 Ga0070665_100118325 Ga0070665_1001183253 371
935 3300005549 Ga0070704_100237805 Ga0070704_1002378051 371
936 3300005564 Ga0070664_100056172 Ga0070664_1000561726 371
937 3300005577 Ga0068857_100000820 Ga0068857_10000082012 371
938 3300005577 Ga0068857_100016651 Ga0068857_1000166513 371
939 3300005577 Ga0068857_100084209 Ga0068857_1000842095 371
940 3300005578 Ga0068854_100037435 Ga0068854_1000374354 371
941 3300005615 Ga0070702_100001772 Ga0070702_1000017723 371
942 3300005615 Ga0070702_100019763 Ga0070702_1000197632 371
943 3300005616 Ga0068852_100045881 Ga0068852_1000458812 371
944 3300005617 Ga0068859_100062593 Ga0068859_1000625932 371
945 3300005617 Ga0068859_100072875 Ga0068859_1000728753 371
946 3300005617 Ga0068859_100105517 Ga0068859_1001055173 371
947 3300005617 Ga0068859_100112329 Ga0068859_1001123292 371
948 3300005617 Ga0068859_100124647 Ga0068859_1001246474 371
949 3300005618 Ga0068864_100005621 Ga0068864_1000056214 371
950 3300005618 Ga0068864_100008355 Ga0068864_1000083558 371
951 3300005840 Ga0068870_10051373 Ga0068870_100513732 371
952 3300005841 Ga0068863_100041151 Ga0068863_1000411513 371
953 3300005841 Ga0068863_100046392 Ga0068863_1000463924 371
954 3300005842 Ga0068858_100015031 Ga0068858_1000150316 371
955 3300005842 Ga0068858_100052241 Ga0068858_1000522413 371
956 3300005842 Ga0068858_100071919 Ga0068858_1000719194 371
957 3300005842 Ga0068858_100078546 Ga0068858_1000785463 371
958 3300005844 Ga0068862_100195958 Ga0068862_1001959583 371
959 3300005981 Ga0081538_10003900 Ga0081538_100039001 371
960 3300005981 Ga0081538_10042139 Ga0081538_100421393 371
961 3300005983 Ga0081540_1009934 Ga0081540_10099343 371
962 3300006028 Ga0070717_10008202 Ga0070717_100082024 371
963 3300006042 Ga0075368_10015259 Ga0075368_100152593 371
964 3300006175 Ga0070712_100001858 Ga0070712_10000185810 371
965 3300006177 Ga0075362_10053085 Ga0075362_100530852 371
966 3300006195 Ga0075366_10009056 Ga0075366_100090562 371
967 3300006237 Ga0097621_100095130 Ga0097621_1000951302 371
968 3300006358 Ga0068871_100079667 Ga0068871_1000796671 371
969 3300006844 Ga0075428_100009279 Ga0075428_1000092793 371
970 3300006846 Ga0075430_100001921 Ga0075430_1000019219 371
971 3300006846 Ga0075430_100065660 Ga0075430_1000656602 371
972 3300006847 Ga0075431_100003150 Ga0075431_1000031509 371
973 3300006852 Ga0075433_10000086 Ga0075433_100000862 371
974 3300006852 Ga0075433_10000917 Ga0075433_100009177 371
975 3300006852 Ga0075433_10021822 Ga0075433_100218223 371
976 3300006852 Ga0075433_10159394 Ga0075433_101593942 371
977 3300006871 Ga0075434_100001870 Ga0075434_10000187010 371
978 3300006871 Ga0075434_100041574 Ga0075434_1000415742 371
979 3300006871 Ga0075434_100111314 Ga0075434_1001113143 371
980 3300006871 Ga0075434_100276397 Ga0075434_1002763972 371
981 3300006880 Ga0075429_100000784 Ga0075429_10000078419 371
982 3300006881 Ga0068865_100076261 Ga0068865_1000762613 371
983 3300006914 Ga0075436_100003207 Ga0075436_1000032077 371
984 3300006914 Ga0075436_100005341 Ga0075436_1000053419 371
985 3300006931 Ga0097620_100062588 Ga0097620_1000625882 371
986 3300006931 Ga0097620_100072876 Ga0097620_1000728763 371
987 3300006931 Ga0097620_100105515 Ga0097620_1001055154 371
988 3300006931 Ga0097620_100112324 Ga0097620_1001123242 371
989 3300006931 Ga0097620_100124649 Ga0097620_1001246492 371
990 3300007076 Ga0075435_100001237 Ga0075435_10000123711 371
991 3300007076 Ga0075435_100016941 Ga0075435_1000169412 371
992 3300007076 Ga0075435_100043234 Ga0075435_1000432345 371
993 3300007076 Ga0075435_100051448 Ga0075435_1000514481 371
994 3300007076 Ga0075435_100169209 Ga0075435_1001692093 371
995 3300009094 Ga0111539_10000194 Ga0111539_1000019440 371
996 3300009094 Ga0111539_10000874 Ga0111539_100008743 371
997 3300009094 Ga0111539_10001828 Ga0111539_1000182823 371
998 3300009098 Ga0105245_10015113 Ga0105245_100151134 371
999 3300009098 Ga0105245_10089981 Ga0105245_100899812 371
1000 3300009098 Ga0105245_10145434 Ga0105245_101454342 371
1001 3300009101 Ga0105247_10018711 Ga0105247_100187113 371
1002 3300009147 Ga0114129_10022381 Ga0114129_100223818 371
1003 3300009147 Ga0114129_10032097 Ga0114129_100320973 371
1004 3300009147 Ga0114129_10092839 Ga0114129_100928393 371
1005 3300009148 Ga0105243_10079321 Ga0105243_100793212 371
1006 3300009148 Ga0105243_10082169 Ga0105243_100821693 371
1007 3300009148 Ga0105243_10200129 Ga0105243_102001292 371
1008 3300009174 Ga0105241_10012989 Ga0105241_100129898 371
1009 3300009174 Ga0105241_10034591 Ga0105241_100345912 371
1010 3300009177 Ga0105248_10002426 Ga0105248_100024269 371
1011 3300009177 Ga0105248_10017733 Ga0105248_100177337 371
1012 3300009177 Ga0105248_10050146 Ga0105248_100501464 371
1013 3300009177 Ga0105248_10106626 Ga0105248_101066262 371
1014 3300009545 Ga0105237_10013151 Ga0105237_100131513 371
1015 3300009545 Ga0105237_10116631 Ga0105237_101166313 371
1016 3300009545 Ga0105237_10144887 Ga0105237_101448873 371
1017 3300009553 Ga0105249_10000354 Ga0105249_1000035445 371
1018 3300009553 Ga0105249_10106429 Ga0105249_101064293 371
1019 3300009553 Ga0105249_10139467 Ga0105249_101394673 371
1020 3300009553 Ga0105249_10268811 Ga0105249_102688112 371
1021 3300010375 Ga0105239_10008433 Ga0105239_100084332 371
1022 3300011119 Ga0105246_10139316 Ga0105246_101393161 371
1023 3300013104 Ga0157370_10023425 Ga0157370_100234253 371
1024 3300013105 Ga0157369_10088450 Ga0157369_100884501 371
1025 3300013296 Ga0157374_10028810 Ga0157374_100288102 371
1026 3300013307 Ga0157372_10085962 Ga0157372_100859623 371
1027 3300013308 Ga0157375_10186851 Ga0157375_101868513 371
1028 3300013308 Ga0157375_10418870 Ga0157375_104188702 371
1029 3300013308 Ga0157375_10468698 Ga0157375_104686981 371
1030 3300014325 Ga0163163_10013182 Ga0163163_100131825 371
1031 3300014325 Ga0163163_10040367 Ga0163163_100403672 371
1032 3300014325 Ga0163163_10100833 Ga0163163_101008334 371
1033 3300014325 Ga0163163_10134143 Ga0163163_101341433 371
1034 3300014326 Ga0157380_10044642 Ga0157380_100446421 371
1035 3300014326 Ga0157380_10178801 Ga0157380_101788011 371
1036 3300014745 Ga0157377_10010640 Ga0157377_100106404 371
1037 3300014745 Ga0157377_10011423 Ga0157377_100114233 371
1038 3300014968 Ga0157379_10007583 Ga0157379_100075833 371
1039 3300014968 Ga0157379_10021531 Ga0157379_100215315 371
1040 3300014968 Ga0157379_10028170 Ga0157379_100281703 371
1041 3300017792 Ga0163161_10141279 Ga0163161_101412791 371
1042 3300020081 Ga0206354_11210034 Ga0206354_112100343 371
1043 3300021361 Ga0213872_10050106 Ga0213872_100501063 371
1044 3300021388 Ga0213875_10000004 Ga0213875_10000004383 371
1045 3300021388 Ga0213875_10003100 Ga0213875_100031003 371
1046 3300021388 Ga0213875_10037127 Ga0213875_100371272 371
1047 3300021441 Ga0213871_10003443 Ga0213871_100034433 371
1048 3300022467 Ga0224712_10007494 Ga0224712_100074944 371
1049 3300022467 Ga0224712_10015601 Ga0224712_100156013 371
1050 3300025903 Ga0207680_10154629 Ga0207680_101546292 371
1051 3300025908 Ga0207643_10000114 Ga0207643_1000011448 371
1052 3300025909 Ga0207705_10003470 Ga0207705_1000347012 371
1053 3300025910 Ga0207684_10000436 Ga0207684_100004366 371
1054 3300025910 Ga0207684_10013377 Ga0207684_100133776 371
1055 3300025910 Ga0207684_10019642 Ga0207684_100196426 371
1056 3300025910 Ga0207684_10046665 Ga0207684_100466654 371
1057 3300025910 Ga0207684_10055605 Ga0207684_100556053 371
1058 3300025910 Ga0207684_10068958 Ga0207684_100689585 371
1059 3300025911 Ga0207654_10002214 Ga0207654_100022147 371
1060 3300025911 Ga0207654_10002864 Ga0207654_100028644 371
1061 3300025911 Ga0207654_10045802 Ga0207654_100458022 371
1062 3300025912 Ga0207707_10031369 Ga0207707_100313694 371
1063 3300025912 Ga0207707_10052444 Ga0207707_100524444 371
1064 3300025912 Ga0207707_10058682 Ga0207707_100586824 371
1065 3300025912 Ga0207707_10061170 Ga0207707_100611704 371
1066 3300025912 Ga0207707_10163365 Ga0207707_101633652 371
1067 3300025913 Ga0207695_10023397 Ga0207695_100233975 371
1068 3300025913 Ga0207695_10183749 Ga0207695_101837491 371
1069 3300025914 Ga0207671_10026253 Ga0207671_100262533 371
1070 3300025914 Ga0207671_10079630 Ga0207671_100796303 371
1071 3300025914 Ga0207671_10302288 Ga0207671_103022881 371
1072 3300025915 Ga0207693_10033902 Ga0207693_100339025 371
1073 3300025916 Ga0207663_10005342 Ga0207663_100053425 371
1074 3300025916 Ga0207663_10009150 Ga0207663_100091505 371
1075 3300025917 Ga0207660_10000239 Ga0207660_100002397 371
1076 3300025917 Ga0207660_10015589 Ga0207660_100155893 371
1077 3300025917 Ga0207660_10046087 Ga0207660_100460872 371
1078 3300025917 Ga0207660_10052614 Ga0207660_100526144 371
1079 3300025918 Ga0207662_10002120 Ga0207662_100021205 371
1080 3300025918 Ga0207662_10011179 Ga0207662_100111795 371
1081 3300025918 Ga0207662_10044271 Ga0207662_100442713 371
1082 3300025919 Ga0207657_10011168 Ga0207657_100111689 371
1083 3300025919 Ga0207657_10038911 Ga0207657_100389114 371
1084 3300025919 Ga0207657_10133316 Ga0207657_101333163 371
1085 3300025920 Ga0207649_10001877 Ga0207649_100018775 371
1086 3300025921 Ga0207652_10026867 Ga0207652_100268672 371
1087 3300025921 Ga0207652_10058211 Ga0207652_100582113 371
1088 3300025921 Ga0207652_10085735 Ga0207652_100857352 371
1089 3300025922 Ga0207646_10008137 Ga0207646_100081376 371
1090 3300025922 Ga0207646_10091381 Ga0207646_100913815 371
1091 3300025922 Ga0207646_10105513 Ga0207646_101055132 371
1092 3300025922 Ga0207646_10136340 Ga0207646_101363403 371
1093 3300025923 Ga0207681_10000016 Ga0207681_1000001668 371
1094 3300025923 Ga0207681_10018602 Ga0207681_100186023 371
1095 3300025924 Ga0207694_10006068 Ga0207694_100060687 371
1096 3300025924 Ga0207694_10047351 Ga0207694_100473512 371
1097 3300025925 Ga0207650_10001262 Ga0207650_1000126210 371
1098 3300025925 Ga0207650_10016282 Ga0207650_100162821 371
1099 3300025925 Ga0207650_10222053 Ga0207650_102220531 371
1100 3300025926 Ga0207659_10226853 Ga0207659_102268532 371
1101 3300025927 Ga0207687_10044525 Ga0207687_100445255 371
1102 3300025927 Ga0207687_10063332 Ga0207687_100633321 371
1103 3300025927 Ga0207687_10167357 Ga0207687_101673572 371
1104 3300025928 Ga0207700_10009370 Ga0207700_100093703 371
1105 3300025928 Ga0207700_10050631 Ga0207700_100506312 371
1106 3300025929 Ga0207664_10116826 Ga0207664_101168263 371
1107 3300025931 Ga0207644_10004501 Ga0207644_100045013 371
1108 3300025933 Ga0207706_10017068 Ga0207706_100170682 371
1109 3300025933 Ga0207706_10096451 Ga0207706_100964512 371
1110 3300025936 Ga0207670_10016051 Ga0207670_100160512 371
1111 3300025936 Ga0207670_10071764 Ga0207670_100717642 371
1112 3300025937 Ga0207669_10054530 Ga0207669_100545301 371
1113 3300025938 Ga0207704_10096823 Ga0207704_100968231 371
1114 3300025939 Ga0207665_10115766 Ga0207665_101157662 371
1115 3300025940 Ga0207691_10156984 Ga0207691_101569842 371
1116 3300025941 Ga0207711_10005289 Ga0207711_100052893 371
1117 3300025941 Ga0207711_10026969 Ga0207711_100269698 371
1118 3300025941 Ga0207711_10043437 Ga0207711_100434372 371
1119 3300025941 Ga0207711_10292251 Ga0207711_102922511 371
1120 3300025942 Ga0207689_10012386 Ga0207689_100123863 371
1121 3300025942 Ga0207689_10017369 Ga0207689_100173696 371
1122 3300025942 Ga0207689_10180922 Ga0207689_101809221 371
1123 3300025944 Ga0207661_10006863 Ga0207661_100068633 371
1124 3300025944 Ga0207661_10047206 Ga0207661_100472064 371
1125 3300025944 Ga0207661_10093532 Ga0207661_100935321 371
1126 3300025945 Ga0207679_10028211 Ga0207679_100282116 371
1127 3300025945 Ga0207679_10029830 Ga0207679_100298302 371
1128 3300025949 Ga0207667_10048022 Ga0207667_100480224 371
1129 3300025960 Ga0207651_10005282 Ga0207651_100052823 371
1130 3300025960 Ga0207651_10120729 Ga0207651_101207292 371
1131 3300025961 Ga0207712_10001483 Ga0207712_100014836 371
1132 3300025972 Ga0207668_10032741 Ga0207668_100327415 371
1133 3300025981 Ga0207640_10006121 Ga0207640_100061214 371
1134 3300025986 Ga0207658_10175093 Ga0207658_101750931 371
1135 3300026023 Ga0207677_10041012 Ga0207677_100410123 371
1136 3300026035 Ga0207703_10004338 Ga0207703_100043387 371
1137 3300026035 Ga0207703_10097363 Ga0207703_100973632 371
1138 3300026035 Ga0207703_10152782 Ga0207703_101527821 371
1139 3300026041 Ga0207639_10101340 Ga0207639_101013402 371
1140 3300026041 Ga0207639_10111178 Ga0207639_101111782 371
1141 3300026067 Ga0207678_10000465 Ga0207678_1000046518 371
1142 3300026067 Ga0207678_10113678 Ga0207678_101136782 371
1143 3300026075 Ga0207708_10050037 Ga0207708_100500373 371
1144 3300026078 Ga0207702_10002305 Ga0207702_100023058 371
1145 3300026078 Ga0207702_10009123 Ga0207702_100091233 371
1146 3300026078 Ga0207702_10060700 Ga0207702_100607004 371
1147 3300026088 Ga0207641_10001987 Ga0207641_100019879 371
1148 3300026088 Ga0207641_10041674 Ga0207641_100416744 371
1149 3300026088 Ga0207641_10145661 Ga0207641_101456612 371
1150 3300026089 Ga0207648_10013002 Ga0207648_100130022 371
1151 3300026095 Ga0207676_10004080 Ga0207676_100040808 371
1152 3300026095 Ga0207676_10163461 Ga0207676_101634612 371
1153 3300026116 Ga0207674_10024977 Ga0207674_100249774 371
1154 3300026116 Ga0207674_10033615 Ga0207674_100336154 371
1155 3300026116 Ga0207674_10041858 Ga0207674_100418586 371
1156 3300026116 Ga0207674_10144046 Ga0207674_101440462 371
1157 3300026116 Ga0207674_10148656 Ga0207674_101486562 371
1158 3300026121 Ga0207683_10001200 Ga0207683_1000120013 371
1159 3300026121 Ga0207683_10101870 Ga0207683_101018703 371
1160 3300026142 Ga0207698_10005017 Ga0207698_100050174 371
1161 3300027907 Ga0207428_10000013 Ga0207428_10000013270 371
1162 3300027907 Ga0207428_10000365 Ga0207428_100003652 371
1163 3300027907 Ga0207428_10097126 Ga0207428_100971262 371
1164 3300027907 Ga0207428_10104343 Ga0207428_101043432 371
1165 3300027907 Ga0207428_10188590 Ga0207428_101885902 371
1166 3300028379 Ga0268266_10001188 Ga0268266_1000118821 371
1167 3300028379 Ga0268266_10066207 Ga0268266_100662072 371
1168 3300028379 Ga0268266_10083188 Ga0268266_100831882 371
1169 3300028379 Ga0268266_10381765 Ga0268266_103817652 371
1170 3300028380 Ga0268265_10080477 Ga0268265_100804772 371
1171 3300028380 Ga0268265_10139871 Ga0268265_101398712 371
1172 3300028556 Ga0265337_1001662 Ga0265337_10016626 371
1173 3300028563 Ga0265319_1011903 Ga0265319_10119033 371
1174 3300028573 Ga0265334_10010928 Ga0265334_100109283 371
1175 3300028577 Ga0265318_10001427 Ga0265318_100014272 371
1176 3300028577 Ga0265318_10007506 Ga0265318_100075062 371
1177 3300028577 Ga0265318_10021401 Ga0265318_100214011 371
1178 3300028666 Ga0265336_10025425 Ga0265336_100254252 371
1179 3300028800 Ga0265338_10001819 Ga0265338_1000181927 371
1180 3300028800 Ga0265338_10007909 Ga0265338_100079093 371
1181 3300029957 Ga0265324_10008937 Ga0265324_100089372 371
1182 3300029957 Ga0265324_10035307 Ga0265324_100353072 371
1183 3300031235 Ga0265330_10009451 Ga0265330_100094516 371
1184 3300031235 Ga0265330_10069164 Ga0265330_100691642 371
1185 3300031238 Ga0265332_10000044 Ga0265332_1000004449 371
1186 3300031239 Ga0265328_10005918 Ga0265328_100059184 371
1187 3300031240 Ga0265320_10000907 Ga0265320_1000090716 371
1188 3300031240 Ga0265320_10044139 Ga0265320_100441392 371
1189 3300031241 Ga0265325_10017204 Ga0265325_100172043 371
1190 3300031241 Ga0265325_10038951 Ga0265325_100389513 371
1191 3300031247 Ga0265340_10027583 Ga0265340_100275832 371
1192 3300031249 Ga0265339_10014690 Ga0265339_100146902 371
1193 3300031249 Ga0265339_10027473 Ga0265339_100274733 371
1194 3300031249 Ga0265339_10115299 Ga0265339_101152991 371
1195 3300031250 Ga0265331_10000076 Ga0265331_10000076114 371
1196 3300031250 Ga0265331_10016505 Ga0265331_100165053 371
1197 3300031344 Ga0265316_10000006 Ga0265316_10000006132 371
1198 3300031344 Ga0265316_10000723 Ga0265316_1000072324 371
1199 3300031344 Ga0265316_10090784 Ga0265316_100907842 371
1200 3300031595 Ga0265313_10000519 Ga0265313_1000051917 371
1201 3300031595 Ga0265313_10009654 Ga0265313_100096541 371
1202 3300031595 Ga0265313_10030947 Ga0265313_100309472 371
1203 3300031711 Ga0265314_10000056 Ga0265314_1000005678 371
1204 3300031711 Ga0265314_10008395 Ga0265314_100083958 371
1205 3300031712 Ga0265342_10003118 Ga0265342_100031184 371
1206 3300031712 Ga0265342_10025216 Ga0265342_100252162 371
1207 3300031733 Ga0316577_10002471 Ga0316577_100024715 371
1208 3300035115 Ga0373941_0007888 Ga0373941_0007888_961_2079 371
1209 3300035118 Ga0373954_0068314 Ga0373954_0068314_549_1664 371
1210 3300035170 Ga0373943_0005025 Ga0373943_0005025_3020_4156 371
1211 3300035171 Ga0373946_0046351 Ga0373946_0046351_498_1634 371
1212 3300035172 Ga0373955_0001910 Ga0373955_0001910_6400_7515 371
1213 3300035172 Ga0373955_0035661 Ga0373955_0035661_1216_2352 371
1214 3300035242 Ga0373962_0003263 Ga0373962_0003263_2766_3881 371
1215 3300035410 Ga0373924_0001921 Ga0373924_0001921_5451_6587 371
1216 3300035691 Ga0373931_0008091 Ga0373931_0008091_2491_3606 371
1217 3300035691 Ga0373931_0023343 Ga0373931_0023343_1611_2726 371
1218 3300035691 Ga0373931_0068237 Ga0373931_0068237_107_1222 371
1219 3300035692 Ga0373935_0000564 Ga0373935_0000564_8936_10072 371
1220 3300035692 Ga0373935_0015207 Ga0373935_0015207_2829_3944 371
1221 3300035695 Ga0373927_0131998 Ga0373927_0131998_184_1320 371
1222 3300035724 Ga0373933_0012203 Ga0373933_0012203_1960_3075 371
1223 3300035725 Ga0373947_0003474 Ga0373947_0003474_7868_9004 371
1224 3300036401 Ga0373937_0001677 Ga0373937_0001677_15762_16877 371
1225 3300036401 Ga0373937_0117351 Ga0373937_0117351_1330_2466 371
1226 3300036401 Ga0373937_0174893 Ga0373937_0174893_93_1208 371
1227 3300036712 Ga0316584_0057748 Ga0316584_0057748_119_1234 371
1228 3300037068 Ga0373925_0004714 Ga0373925_0004714_4747_5883 371
1229 3300037068 Ga0373925_0104791 Ga0373925_0104791_657_1772 371
1230 3300037312 Ga0395899_0019356 Ga0395899_0019356_3772_4887 371
1231 3300037418 Ga0395900_0004122 Ga0395900_0004122_5438_6553 371
1232 3300037466 Ga0395898_0022195 Ga0395898_0022195_1224_2339 371
1233 3300037466 Ga0395898_0027097 Ga0395898_0027097_4397_5512 371
1234 3300037471 Ga0395905_0138586 Ga0395905_0138586_411_1526 371
1235 3300037853 Ga0436364_0541679 Ga0436364_0541679_335_1450 371
1236 3300037853 Ga0436364_0748068 Ga0436364_0748068_181423_182538 371
1237 3300037853 Ga0436364_1009488 Ga0436364_1009488_1364_2479 371
1238 3300037853 Ga0436364_1179371 Ga0436364_1179371_2054_3169 371
1239 3300037853 Ga0436364_1222422 Ga0436364_1222422_74_1189 371
1240 3300038443 Ga0395901_0001693 Ga0395901_0001693_14326_15441 371
1241 3300039447 Ga0436361_0784658 Ga0436361_0784658_1566_2681 371
1242 3300042436 Ga0439435_0010112 Ga0439435_0010112_518_1633 371
1243 3300042876 Ga0451577_0060638 Ga0451577_0060638_1149_2267 371
1244 3300044673 Ga0453683_0024492 Ga0453683_0024492_1773_2888 371
1245 3300044712 Ga0453684_0035141 Ga0453684_0035141_2343_3458 371
1246 3300044842 Ga0466957_0075542 Ga0466957_0075542_679_1794 371
1247 3300045049 Ga0466959_0080501 Ga0466959_0080501_842_1957 371
1248 3300045051 Ga0451576_0023514 Ga0451576_0023514_1208_2323 371
1249 3300045976 Ga0466967_0000997 Ga0466967_0000997_2461_3576 371
1250 3300045976 Ga0466967_0017823 Ga0466967_0017823_936_2051 371
1251 3300045976 Ga0466967_0302770 Ga0466967_0302770_293_1408 371
1252 3300045976 Ga0466967_0329250 Ga0466967_0329250_151_1266 371
1253 3300046454 Ga0495592_0052201 Ga0495592_0052201_1562_2677 371
1254 3300046459 Ga0495629_0017620 Ga0495629_0017620_575_1690 371
1255 3300046462 Ga0495651_0005092 Ga0495651_0005092_7265_8380 371
1256 3300046463 Ga0495653_0001711 Ga0495653_0001711_1270_2385 371
1257 3300046472 Ga0495580_0002767 Ga0495580_0002767_7609_8736 371
1258 3300046472 Ga0495580_0062235 Ga0495580_0062235_132_1247 371
1259 3300046473 Ga0495582_0075134 Ga0495582_0075134_589_1704 371
1260 3300046477 Ga0495664_0047475 Ga0495664_0047475_1393_2508 371
1261 3300046499 Ga0495594_0054601 Ga0495594_0054601_709_1824 371
1262 3300046511 Ga0495608_0072332 Ga0495608_0072332_112_1227 371
1263 3300046514 Ga0495618_0004270 Ga0495618_0004270_559_1674 371
1264 3300046516 Ga0495628_0010236 Ga0495628_0010236_5604_6719 371
1265 3300046529 Ga0495652_0014020 Ga0495652_0014020_1053_2168 371
1266 3300046531 Ga0495665_0076685 Ga0495665_0076685_489_1604 371
1267 3300046536 Ga0495587_0002513 Ga0495587_0002513_9535_10650 371
1268 3300046559 Ga0495667_0015222 Ga0495667_0015222_2331_3446 371
1269 3300046642 Ga0495634_0009520 Ga0495634_0009520_1042_2157 371
1270 3300046675 Ga0495657_0002373 Ga0495657_0002373_12847_13962 371
1271 3300046683 Ga0495658_0097486 Ga0495658_0097486_560_1681 371
1272 3300046689 Ga0495613_0043468 Ga0495613_0043468_115_1230 371
1273 3300047315 Ga0495581_0008083 Ga0495581_0008083_460_1575 371
1274 3300047317 Ga0495604_0006988 Ga0495604_0006988_4634_5749 371
1275 3300047319 Ga0495674_0005799 Ga0495674_0005799_1917_3032 371
1276 3300047319 Ga0495674_0018359 Ga0495674_0018359_1380_2495 371
1277 3300047319 Ga0495674_0299828 Ga0495674_0299828_172_1287 371
1278 3300047319 Ga0495674_0310296 Ga0495674_0310296_77_1204 371
1279 3300047444 Ga0495675_0007773 Ga0495675_0007773_1667_2782 371
1280 3300047471 Ga0495684_0030235 Ga0495684_0030235_1060_2175 371
1281 3300048088 Ga0495602_0005818 Ga0495602_0005818_1046_2161 371
1282 3300048088 Ga0495602_0270605 Ga0495602_0270605_14_1129 371
1283 3300048903 Ga0496100_0024565 Ga0496100_0024565_280_1395 371
1284 3300048904 Ga0496101_0081269 Ga0496101_0081269_1019_2134 371
1285 3300048905 Ga0496102_0002841 Ga0496102_0002841_3899_5017 371
1286 3300048905 Ga0496102_0020478 Ga0496102_0020478_3752_4867 371
1287 3300048905 Ga0496102_0036334 Ga0496102_0036334_2389_3504 371
1288 3300048905 Ga0496102_0038222 Ga0496102_0038222_1345_2460 371
1289 3300048905 Ga0496102_0128222 Ga0496102_0128222_100_1215 371
1290 3300048906 Ga0496103_0009182 Ga0496103_0009182_1810_2925 371
1291 3300048906 Ga0496103_0084552 Ga0496103_0084552_712_1827 371
1292 3300048907 Ga0496104_0066006 Ga0496104_0066006_150_1265 371
1293 3300048907 Ga0496104_0214940 Ga0496104_0214940_282_1397 371
1294 3300048908 Ga0496105_0008588 Ga0496105_0008588_5053_6168 371
1295 3300048909 Ga0496106_0006521 Ga0496106_0006521_4517_5632 371
1296 3300048909 Ga0496106_0019347 Ga0496106_0019347_154_1269 371
1297 3300048909 Ga0496106_0042285 Ga0496106_0042285_853_1971 371
1298 3300048909 Ga0496106_0074060 Ga0496106_0074060_585_1700 371
1299 3300048909 Ga0496106_0108752 Ga0496106_0108752_728_1843 371
1300 3300048910 Ga0496107_0068065 Ga0496107_0068065_831_1946 371
1301 3300048910 Ga0496107_0156892 Ga0496107_0156892_363_1478 371
1302 3300048911 Ga0496108_0002260 Ga0496108_0002260_10880_11995 371
1303 3300048911 Ga0496108_0078496 Ga0496108_0078496_356_1477 371
1304 3300048912 Ga0496109_0012628 Ga0496109_0012628_3454_4569 371
1305 3300048913 Ga0496110_0001014 Ga0496110_0001014_13715_14830 371
1306 3300048915 Ga0496112_0013548 Ga0496112_0013548_2379_3494 371
1307 3300048916 Ga0496113_0000999 Ga0496113_0000999_7156_8271 371
1308 3300048918 Ga0496115_0073287 Ga0496115_0073287_980_2095 371
1309 3300049575 Ga0501039_0206406 Ga0501039_0206406_230_1345 371
1310 3300049578 Ga0501042_0145568 Ga0501042_0145568_287_1402 371
1311 3300049587 Ga0501071_0006291 Ga0501071_0006291_82_1197 371
1312 3300049588 Ga0501072_0298754 Ga0501072_0298754_54_1244 371
1313 3300049591 Ga0501075_0037274 Ga0501075_0037274_2444_3559 371
1314 3300049741 Ga0501079_0054017 Ga0501079_0054017_116_1306 371
1315 3300049743 Ga0501081_0065642 Ga0501081_0065642_273_1463 371
1316 3300050489 nmdc:mga03683_28492_c1 nmdc:mga03683_28492_c1_74_1261 371
1317 3300050492 nmdc:mga0yw44_10402_c1 nmdc:mga0yw44_10402_c1_3037_4224 371
1318 3300050507 nmdc:mga05p37_179705_c1 nmdc:mga05p37_179705_c1_1331_2446 371
1319 3300050507 nmdc:mga05p37_194455_c1 nmdc:mga05p37_194455_c1_13_1200 371
1320 3300050507 nmdc:mga05p37_21004_c1 nmdc:mga05p37_21004_c1_5894_7009 371
1321 3300050507 nmdc:mga05p37_25331_c1 nmdc:mga05p37_25331_c1_758_1873 371
1322 3300050507 nmdc:mga05p37_262943_c1 nmdc:mga05p37_262943_c1_544_1659 371
1323 3300050507 nmdc:mga05p37_376010_c1 nmdc:mga05p37_376010_c1_474_1589 371
1324 3300050507 nmdc:mga05p37_9539_c1 nmdc:mga05p37_9539_c1_10030_11145 371
1325 3300050509 nmdc:mga0qj67_62642_c1 nmdc:mga0qj67_62642_c1_1646_2761 371
1326 3300050509 nmdc:mga0qj67_83700_c1 nmdc:mga0qj67_83700_c1_1047_2162 371
1327 3300050509 nmdc:mga0qj67_97756_c1 nmdc:mga0qj67_97756_c1_972_2159 371
1328 3300050510 nmdc:mga06r32_16367_c1 nmdc:mga06r32_16367_c1_5327_6442 371
1329 3300050511 nmdc:mga08y16_1299_c1 nmdc:mga08y16_1299_c1_984_2171 371
1330 3300050511 nmdc:mga08y16_14898_c1 nmdc:mga08y16_14898_c1_1992_3107 371
1331 3300050511 nmdc:mga08y16_3111_c1 nmdc:mga08y16_3111_c1_15262_16377 371
1332 3300050511 nmdc:mga08y16_47452_c1 nmdc:mga08y16_47452_c1_2541_3656 371
1333 3300050512 nmdc:mga0n895_362935_c1 nmdc:mga0n895_362935_c1_192_1379 371
1334 3300050512 nmdc:mga0n895_63918_c1 nmdc:mga0n895_63918_c1_1615_2730 371
1335 3300050512 nmdc:mga0n895_7713_c1 nmdc:mga0n895_7713_c1_1372_2487 371
1336 3300050512 nmdc:mga0n895_77425_c1 nmdc:mga0n895_77425_c1_901_2016 371
1337 3300050512 nmdc:mga0n895_9719_c1 nmdc:mga0n895_9719_c1_4675_5790 371
1338 3300050513 nmdc:mga0rr50_116587_c1 nmdc:mga0rr50_116587_c1_951_2066 371
1339 3300050513 nmdc:mga0rr50_15951_c1 nmdc:mga0rr50_15951_c1_1801_2988 371
1340 3300050513 nmdc:mga0rr50_17745_c1 nmdc:mga0rr50_17745_c1_3137_4252 371
1341 3300050513 nmdc:mga0rr50_1851_c1 nmdc:mga0rr50_1851_c1_5413_6528 371
1342 3300050513 nmdc:mga0rr50_809_c1 nmdc:mga0rr50_809_c1_7405_8520 371
1343 3300050514 nmdc:mga08x19_177277_c1 nmdc:mga08x19_177277_c1_220_1407 371
1344 3300050514 nmdc:mga08x19_473_c1 nmdc:mga08x19_473_c1_10356_11471 371
1345 3300050514 nmdc:mga08x19_7545_c1 nmdc:mga08x19_7545_c1_4591_5706 371
1346 3300050515 nmdc:mga0a205_103585_c1 nmdc:mga0a205_103585_c1_1057_2172 371
1347 3300050515 nmdc:mga0a205_169166_c1 nmdc:mga0a205_169166_c1_274_1389 371
1348 3300050515 nmdc:mga0a205_19772_c1 nmdc:mga0a205_19772_c1_2793_3908 371
1349 3300050515 nmdc:mga0a205_35606_c2 nmdc:mga0a205_35606_c2_1521_2708 371
1350 3300050515 nmdc:mga0a205_3681_c1 nmdc:mga0a205_3681_c1_6995_8110 371
1351 3300050515 nmdc:mga0a205_3723_c1 nmdc:mga0a205_3723_c1_3804_4919 371
1352 3300050515 nmdc:mga0a205_8199_c2 nmdc:mga0a205_8199_c2_3971_5086 371
1353 3300053104 Ga0500556_0000131 Ga0500556_0000131_15577_16692 371
1354 3300059421 Ga0590071_000088 Ga0590071_000088_5637_6752 371
1355 3300059421 Ga0590071_000719 Ga0590071_000719_1295_2410 371
1356 3300059421 Ga0590071_001388 Ga0590071_001388_5214_6329 371
1357 3300059423 Ga0590074_004453 Ga0590074_004453_662_1777 371
1358 3300059424 Ga0590075_000337 Ga0590075_000337_4004_5119 371
1359 3300059426 Ga0590077_000177 Ga0590077_000177_16378_17493 371
1360 3300059426 Ga0590077_002992 Ga0590077_002992_301_1416 371
1361 3300060353 Ga0501082_0143661 Ga0501082_0143661_647_1762 371
1362 3300060353 Ga0501082_0229330 Ga0501082_0229330_187_1302 371
1363 3300061734 Ga0530510_0048353 Ga0530510_0048353_1871_2986 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02012

BNR

BNR/Asp-box repeat

128

139

0.9

PF02012

BNR

BNR/Asp-box repeat

65

76

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9215 2 371
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9047 2 371
7mq9-assembly1.cif.gz_LJ cryo-em structure of the human ssu processome, state pre-a1* 0.7788 38 364
7mqa-assembly1.cif.gz_LJ cryo-em structure of the human ssu processome, state post-a1 0.7587 38 364
8evl-assembly1.cif.gz_A crystal structure of alpha-copi n-terminal wd40 domain 0.7555 38 358
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8958 1 371 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8838 1 371 2.130.10.10
af_A0A1D6LLW6_250_394_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7739 6 186 2.130.10.10
af_Q7KWL3_145_386_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7694 38 301 2.130.10.10
af_O74340_142_366_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7624 36 301 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7W0KDR5-F1-model_v4 Exo-alpha-sialidase 0.9992 261 371
AF-A0A522U6V1-F1-model_v4 Exo-alpha-sialidase 0.9948 1 371 GO:0000272
GO:0010411
GO:0016798
AF-A0A3D1AQV5-F1-model_v4 Glycosyl hydrolase 0.9945 234 339
AF-A0A651HHJ8-F1-model_v4 Exo-alpha-sialidase 0.994 1 371 GO:0000272
GO:0010411
GO:0016798
AF-A0A534WDT7-F1-model_v4 Exo-alpha-sialidase 0.9939 173 371 GO:0000272
GO:0010411
GO:0016798

Feature Viewer

pLDDT pTM Quality
94.47 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map