F493341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1362 | 524 | 1315 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10097302|Ga0105237_100973022 |
| Length | 178 |
| Sequence | LPSPPGALEDIEIMAKLHVSTTINGEPVEYLCEPNDTMLDALRGPLGLTGSKEGCASGDCGACSITLDDRLVCSCLMLAAEAAGRRVGTIEGMAKGGKLHPLQQAFLEMAALQCGICTSGMLIASEALLKKNPQPNEEEVRFWLAGNLCRCTGYDKVVRAVLEAAAEMREQGIKESWQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 13 | 2791355199 | |||
| 14 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 15 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 19 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 20 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 21 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 22 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 23 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 24 | 2904699407 | |||
| 25 | 2906610324 | |||
| 26 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 27 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 28 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 29 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 30 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 31 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 32 | 2922425934 | |||
| 33 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 34 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 35 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 36 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 37 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 38 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 39 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 114 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 115 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 131 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 132 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 133 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 134 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 135 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 136 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 151 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 174 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 243 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 251 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 252 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 260 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 264 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 269 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 272 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 273 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 274 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 275 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 276 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 278 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 279 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 284 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 292 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 298 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 299 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 302 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 303 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 304 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 307 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 308 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 309 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 310 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 311 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 312 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 313 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 316 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 317 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 322 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 323 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 324 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 325 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 326 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 327 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 328 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 329 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 330 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 333 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 334 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 422 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 425 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 429 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 430 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 431 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 432 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 433 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 434 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 435 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 436 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 437 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 438 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 439 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 440 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 449 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 470 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 474 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 475 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 476 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 477 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 478 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 482 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 483 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 486 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 488 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 489 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 490 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 491 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 494 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 495 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 496 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 497 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 498 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 501 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 502 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 503 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 505 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 507 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 508 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 509 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 510 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 511 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 512 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 514 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 515 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 516 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 517 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 518 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 519 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 520 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 521 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 522 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 523 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 524 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.47 |
| Metatranscriptomes | 0.37 |
| Isolates | 3.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.66 |
| Nodule | 2.86 |
| Rhizoplane | 7.64 |
| Rhizosphere | 74.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10174835 | 3300002067 | Bacteria | 621 |
| 2 | JGI25406J46586_10000009 | 3300003203 | Bacteria | 109818 |
| 3 | JGI25153J46596_10004964 | 3300003215 | Bacteria | 7066 |
| 4 | rootH1_10096066 | 3300003316 | Bacteria | 1748 |
| 5 | rootL2_10051549 | 3300003322 | Bacteria | 2021 |
| 6 | JGI25404J52841_10005977 | 3300003659 | Bacteria | 2529 |
| 7 | JGI25404J52841_10020452 | 3300003659 | Bacteria | 1433 |
| 8 | JGI25404J52841_10091040 | 3300003659 | Bacteria | 638 |
| 9 | Ga0070658_10007845 | 3300005327 | Bacteria | 8600 |
| 10 | Ga0070658_10068198 | 3300005327 | Bacteria | 2907 |
| 11 | Ga0070658_10523972 | 3300005327 | Bacteria | 1025 |
| 12 | Ga0070658_11196780 | 3300005327 | Bacteria | 661 |
| 13 | Ga0070676_10895108 | 3300005328 | Bacteria | 661 |
| 14 | Ga0070683_100021476 | 3300005329 | Bacteria | 5763 |
| 15 | Ga0070683_100119491 | 3300005329 | Bacteria | 2489 |
| 16 | Ga0070683_100282679 | 3300005329 | Bacteria | 1578 |
| 17 | Ga0070670_100679750 | 3300005331 | Bacteria | 925 |
| 18 | Ga0068869_100275915 | 3300005334 | Bacteria | 1350 |
| 19 | Ga0070666_10155323 | 3300005335 | Bacteria | 1598 |
| 20 | Ga0070666_10433589 | 3300005335 | Bacteria | 948 |
| 21 | Ga0070666_11106615 | 3300005335 | Bacteria | 589 |
| 22 | Ga0070680_100001803 | 3300005336 | Bacteria | 15723 |
| 23 | Ga0070680_100011799 | 3300005336 | Bacteria | 6777 |
| 24 | Ga0070680_100433827 | 3300005336 | Bacteria | 1121 |
| 25 | Ga0070680_100493238 | 3300005336 | Bacteria | 1047 |
| 26 | Ga0070682_100104401 | 3300005337 | Bacteria | 1877 |
| 27 | Ga0070682_100104816 | 3300005337 | Bacteria | 1873 |
| 28 | Ga0070682_100334348 | 3300005337 | Bacteria | 1124 |
| 29 | Ga0070682_100887369 | 3300005337 | Bacteria | 732 |
| 30 | Ga0068868_100041686 | 3300005338 | Bacteria | 3577 |
| 31 | Ga0068868_100047327 | 3300005338 | Bacteria | 3369 |
| 32 | Ga0068868_100807001 | 3300005338 | Bacteria | 847 |
| 33 | Ga0068868_101009649 | 3300005338 | Bacteria | 761 |
| 34 | Ga0070660_100011735 | 3300005339 | Bacteria | 6238 |
| 35 | Ga0070660_100197578 | 3300005339 | Bacteria | 1631 |
| 36 | Ga0070689_100002458 | 3300005340 | Bacteria | 12116 |
| 37 | Ga0070689_100090584 | 3300005340 | Bacteria | 2410 |
| 38 | Ga0070691_10001192 | 3300005341 | Bacteria | 10895 |
| 39 | Ga0070691_10089264 | 3300005341 | Bacteria | 1518 |
| 40 | Ga0070691_10262217 | 3300005341 | Bacteria | 931 |
| 41 | Ga0070661_100204859 | 3300005344 | Bacteria | 1508 |
| 42 | Ga0070668_100040084 | 3300005347 | Bacteria | 3583 |
| 43 | Ga0070668_100047147 | 3300005347 | Bacteria | 3312 |
| 44 | Ga0070668_100088409 | 3300005347 | Bacteria | 2439 |
| 45 | Ga0070668_100511776 | 3300005347 | Bacteria | 1040 |
| 46 | Ga0070668_100593062 | 3300005347 | Bacteria | 968 |
| 47 | Ga0070668_100594096 | 3300005347 | Bacteria | 968 |
| 48 | Ga0070668_100696650 | 3300005347 | Bacteria | 896 |
| 49 | Ga0070668_101157946 | 3300005347 | Bacteria | 699 |
| 50 | Ga0070669_100000514 | 3300005353 | Bacteria | 29157 |
| 51 | Ga0070669_100117540 | 3300005353 | Bacteria | 2024 |
| 52 | Ga0070675_101216544 | 3300005354 | Bacteria | 694 |
| 53 | Ga0070671_100000067 | 3300005355 | Bacteria | 70750 |
| 54 | Ga0070671_100007781 | 3300005355 | Bacteria | 8562 |
| 55 | Ga0070671_100059926 | 3300005355 | Bacteria | 3168 |
| 56 | Ga0070671_100202729 | 3300005355 | Bacteria | 1682 |
| 57 | Ga0070671_100290042 | 3300005355 | Bacteria | 1392 |
| 58 | Ga0070671_100719657 | 3300005355 | Bacteria | 866 |
| 59 | Ga0070671_101090832 | 3300005355 | Bacteria | 701 |
| 60 | Ga0070674_100035366 | 3300005356 | Bacteria | 3345 |
| 61 | Ga0070674_100114276 | 3300005356 | Bacteria | 1988 |
| 62 | Ga0070674_100142635 | 3300005356 | Bacteria | 1799 |
| 63 | Ga0070673_100635591 | 3300005364 | Bacteria | 976 |
| 64 | Ga0070688_100486508 | 3300005365 | Bacteria | 928 |
| 65 | Ga0070667_100333628 | 3300005367 | Bacteria | 1370 |
| 66 | Ga0070667_100729876 | 3300005367 | Bacteria | 918 |
| 67 | Ga0070703_10303195 | 3300005406 | Bacteria | 667 |
| 68 | Ga0070709_10003808 | 3300005434 | Bacteria | 8112 |
| 69 | Ga0070709_10007552 | 3300005434 | Bacteria | 5966 |
| 70 | Ga0070709_10057714 | 3300005434 | Bacteria | 2459 |
| 71 | Ga0070709_11067153 | 3300005434 | Bacteria | 645 |
| 72 | Ga0070714_100028634 | 3300005435 | Bacteria | 4624 |
| 73 | Ga0070714_100093490 | 3300005435 | Bacteria | 2637 |
| 74 | Ga0070714_100160852 | 3300005435 | Bacteria | 2031 |
| 75 | Ga0070714_100249116 | 3300005435 | Bacteria | 1642 |
| 76 | Ga0070714_100882843 | 3300005435 | Bacteria | 868 |
| 77 | Ga0070713_100002435 | 3300005436 | Bacteria | 12135 |
| 78 | Ga0070713_100073158 | 3300005436 | Bacteria | 2901 |
| 79 | Ga0070713_100131735 | 3300005436 | Bacteria | 2206 |
| 80 | Ga0070713_100258840 | 3300005436 | Bacteria | 1590 |
| 81 | Ga0070713_100286853 | 3300005436 | Bacteria | 1512 |
| 82 | Ga0070710_10002245 | 3300005437 | Bacteria | 9143 |
| 83 | Ga0070710_10006209 | 3300005437 | Bacteria | 5721 |
| 84 | Ga0070710_10260683 | 3300005437 | Bacteria | 1117 |
| 85 | Ga0070710_10456928 | 3300005437 | Bacteria | 867 |
| 86 | Ga0070701_10326152 | 3300005438 | Bacteria | 951 |
| 87 | Ga0070711_100002514 | 3300005439 | Bacteria | 10473 |
| 88 | Ga0070711_100024311 | 3300005439 | Bacteria | 3950 |
| 89 | Ga0070711_100039210 | 3300005439 | Bacteria | 3189 |
| 90 | Ga0070711_100342004 | 3300005439 | Bacteria | 1201 |
| 91 | Ga0070700_100362108 | 3300005441 | Bacteria | 1079 |
| 92 | Ga0070700_100690139 | 3300005441 | Bacteria | 810 |
| 93 | Ga0070708_100735694 | 3300005445 | Bacteria | 928 |
| 94 | Ga0070663_100004258 | 3300005455 | Bacteria | 8374 |
| 95 | Ga0070663_100164013 | 3300005455 | Bacteria | 1712 |
| 96 | Ga0070663_100165928 | 3300005455 | Bacteria | 1703 |
| 97 | Ga0070663_100486520 | 3300005455 | Bacteria | 1022 |
| 98 | Ga0070663_100909677 | 3300005455 | Bacteria | 760 |
| 99 | Ga0070663_101250232 | 3300005455 | Bacteria | 654 |
| 100 | Ga0070678_100029826 | 3300005456 | Bacteria | 3740 |
| 101 | Ga0070678_100062529 | 3300005456 | Bacteria | 2749 |
| 102 | Ga0070678_100222512 | 3300005456 | Bacteria | 1569 |
| 103 | Ga0070662_100102169 | 3300005457 | Bacteria | 2171 |
| 104 | Ga0070662_101404043 | 3300005457 | Bacteria | 602 |
| 105 | Ga0070681_10009096 | 3300005458 | Bacteria | 9761 |
| 106 | Ga0070681_10147974 | 3300005458 | Bacteria | 2276 |
| 107 | Ga0070681_10155196 | 3300005458 | Bacteria | 2215 |
| 108 | Ga0070681_10225037 | 3300005458 | Bacteria | 1791 |
| 109 | Ga0070681_10715255 | 3300005458 | Bacteria | 917 |
| 110 | Ga0070681_10760630 | 3300005458 | Bacteria | 885 |
| 111 | Ga0068867_100133578 | 3300005459 | Bacteria | 1931 |
| 112 | Ga0068867_100781647 | 3300005459 | Bacteria | 850 |
| 113 | Ga0070706_100686668 | 3300005467 | Bacteria | 950 |
| 114 | Ga0070707_100131402 | 3300005468 | Bacteria | 2435 |
| 115 | Ga0070698_100293524 | 3300005471 | Bacteria | 1557 |
| 116 | Ga0070699_100499672 | 3300005518 | Bacteria | 1105 |
| 117 | Ga0070699_101436602 | 3300005518 | Bacteria | 633 |
| 118 | Ga0070679_100005316 | 3300005530 | Bacteria | 11917 |
| 119 | Ga0070679_100119450 | 3300005530 | Bacteria | 2621 |
| 120 | Ga0070679_100288199 | 3300005530 | Bacteria | 1594 |
| 121 | Ga0070684_100018865 | 3300005535 | Bacteria | 5694 |
| 122 | Ga0070684_100040283 | 3300005535 | Bacteria | 4022 |
| 123 | Ga0070684_100191844 | 3300005535 | Bacteria | 1859 |
| 124 | Ga0068853_100021395 | 3300005539 | Bacteria | 5392 |
| 125 | Ga0068853_100141746 | 3300005539 | Bacteria | 2158 |
| 126 | Ga0068853_100248758 | 3300005539 | Bacteria | 1631 |
| 127 | Ga0068853_100714351 | 3300005539 | Bacteria | 956 |
| 128 | Ga0070672_100234660 | 3300005543 | Bacteria | 1542 |
| 129 | Ga0070672_100257256 | 3300005543 | Bacteria | 1472 |
| 130 | Ga0070672_101140541 | 3300005543 | Bacteria | 693 |
| 131 | Ga0070686_100030509 | 3300005544 | Bacteria | 3289 |
| 132 | Ga0070686_100282868 | 3300005544 | Bacteria | 1224 |
| 133 | Ga0070686_100824072 | 3300005544 | Bacteria | 749 |
| 134 | Ga0070686_100948640 | 3300005544 | Bacteria | 703 |
| 135 | Ga0070696_100225976 | 3300005546 | Bacteria | 1406 |
| 136 | Ga0070696_100550148 | 3300005546 | Bacteria | 925 |
| 137 | Ga0070693_100042981 | 3300005547 | Bacteria | 2550 |
| 138 | Ga0070693_100220775 | 3300005547 | Bacteria | 1242 |
| 139 | Ga0070665_100044811 | 3300005548 | Bacteria | 4441 |
| 140 | Ga0070665_100057106 | 3300005548 | Bacteria | 3913 |
| 141 | Ga0070665_100069254 | 3300005548 | Bacteria | 3536 |
| 142 | Ga0070665_100171529 | 3300005548 | Bacteria | 2170 |
| 143 | Ga0070665_100549915 | 3300005548 | Bacteria | 1167 |
| 144 | Ga0070665_100611798 | 3300005548 | Bacteria | 1103 |
| 145 | Ga0070665_100636708 | 3300005548 | Bacteria | 1079 |
| 146 | Ga0070665_100784671 | 3300005548 | Bacteria | 966 |
| 147 | Ga0070665_101002409 | 3300005548 | Bacteria | 847 |
| 148 | Ga0070665_101924692 | 3300005548 | Bacteria | 597 |
| 149 | Ga0068855_100000994 | 3300005563 | Bacteria | 35284 |
| 150 | Ga0068855_100023587 | 3300005563 | Bacteria | 7368 |
| 151 | Ga0068855_100032725 | 3300005563 | Bacteria | 6208 |
| 152 | Ga0068855_100056856 | 3300005563 | Bacteria | 4587 |
| 153 | Ga0068855_100065587 | 3300005563 | Bacteria | 4233 |
| 154 | Ga0068855_100170343 | 3300005563 | Bacteria | 2466 |
| 155 | Ga0068855_100186786 | 3300005563 | Bacteria | 2340 |
| 156 | Ga0068855_100286670 | 3300005563 | Bacteria | 1826 |
| 157 | Ga0068855_100691188 | 3300005563 | Bacteria | 1092 |
| 158 | Ga0068855_102075284 | 3300005563 | Bacteria | 573 |
| 159 | Ga0070664_100245982 | 3300005564 | Bacteria | 1606 |
| 160 | Ga0070664_100346944 | 3300005564 | Bacteria | 1349 |
| 161 | Ga0070664_100797496 | 3300005564 | Bacteria | 883 |
| 162 | Ga0070664_101482409 | 3300005564 | Bacteria | 642 |
| 163 | Ga0068857_100013137 | 3300005577 | Bacteria | 7216 |
| 164 | Ga0068857_100051455 | 3300005577 | Bacteria | 3655 |
| 165 | Ga0068854_100565285 | 3300005578 | Bacteria | 966 |
| 166 | Ga0068854_100985186 | 3300005578 | Bacteria | 746 |
| 167 | Ga0068856_100006491 | 3300005614 | Bacteria | 11469 |
| 168 | Ga0068856_100147819 | 3300005614 | Bacteria | 2357 |
| 169 | Ga0068856_100245946 | 3300005614 | Bacteria | 1804 |
| 170 | Ga0068856_100266581 | 3300005614 | Bacteria | 1729 |
| 171 | Ga0068856_100627006 | 3300005614 | Bacteria | 1096 |
| 172 | Ga0068856_100702331 | 3300005614 | Bacteria | 1032 |
| 173 | Ga0068856_101172716 | 3300005614 | Bacteria | 785 |
| 174 | Ga0068856_101718419 | 3300005614 | Bacteria | 640 |
| 175 | Ga0070702_100298427 | 3300005615 | Bacteria | 1113 |
| 176 | Ga0070702_100350477 | 3300005615 | Bacteria | 1040 |
| 177 | Ga0068852_100067025 | 3300005616 | Bacteria | 3138 |
| 178 | Ga0068852_100242251 | 3300005616 | Bacteria | 1724 |
| 179 | Ga0068852_100575395 | 3300005616 | Bacteria | 1129 |
| 180 | Ga0068852_101016554 | 3300005616 | Bacteria | 848 |
| 181 | Ga0068852_101209859 | 3300005616 | Bacteria | 776 |
| 182 | Ga0068859_100000028 | 3300005617 | Bacteria | 180121 |
| 183 | Ga0068859_100007456 | 3300005617 | Bacteria | 11105 |
| 184 | Ga0068859_100063326 | 3300005617 | Bacteria | 3729 |
| 185 | Ga0068859_100214710 | 3300005617 | Bacteria | 2011 |
| 186 | Ga0068859_101696236 | 3300005617 | Bacteria | 698 |
| 187 | Ga0068864_100029724 | 3300005618 | Bacteria | 4630 |
| 188 | Ga0068864_100144519 | 3300005618 | Bacteria | 2149 |
| 189 | Ga0068866_10164293 | 3300005718 | Bacteria | 1297 |
| 190 | Ga0068866_10420738 | 3300005718 | Bacteria | 867 |
| 191 | Ga0068866_10932502 | 3300005718 | Bacteria | 613 |
| 192 | Ga0068861_100436972 | 3300005719 | Bacteria | 1169 |
| 193 | Ga0068861_101164855 | 3300005719 | Bacteria | 744 |
| 194 | Ga0068861_101451533 | 3300005719 | Bacteria | 672 |
| 195 | Ga0068851_10034114 | 3300005834 | Bacteria | 2539 |
| 196 | Ga0068870_10300733 | 3300005840 | Bacteria | 1013 |
| 197 | Ga0068863_100023157 | 3300005841 | Bacteria | 5936 |
| 198 | Ga0068863_100231953 | 3300005841 | Bacteria | 1780 |
| 199 | Ga0068863_100386800 | 3300005841 | Bacteria | 1366 |
| 200 | Ga0068863_100744649 | 3300005841 | Bacteria | 975 |
| 201 | Ga0068863_101228515 | 3300005841 | Bacteria | 755 |
| 202 | Ga0068858_100019652 | 3300005842 | Bacteria | 6315 |
| 203 | Ga0068858_100354095 | 3300005842 | Bacteria | 1406 |
| 204 | Ga0068858_101009146 | 3300005842 | Bacteria | 816 |
| 205 | Ga0068858_101101733 | 3300005842 | Bacteria | 780 |
| 206 | Ga0068860_100012742 | 3300005843 | Bacteria | 8270 |
| 207 | Ga0068860_100021301 | 3300005843 | Bacteria | 6279 |
| 208 | Ga0068860_100285965 | 3300005843 | Bacteria | 1612 |
| 209 | Ga0068860_100320673 | 3300005843 | Bacteria | 1521 |
| 210 | Ga0068860_100920649 | 3300005843 | Bacteria | 891 |
| 211 | Ga0068862_100102556 | 3300005844 | Bacteria | 2504 |
| 212 | Ga0068862_100152077 | 3300005844 | Bacteria | 2060 |
| 213 | Ga0068862_100297237 | 3300005844 | Bacteria | 1484 |
| 214 | Ga0068862_100640216 | 3300005844 | Bacteria | 1024 |
| 215 | Ga0068862_100694043 | 3300005844 | Bacteria | 985 |
| 216 | Ga0081455_10000633 | 3300005937 | Bacteria | 45582 |
| 217 | Ga0081455_10007244 | 3300005937 | Bacteria | 11710 |
| 218 | Ga0081455_10036376 | 3300005937 | Bacteria | 4384 |
| 219 | Ga0081455_10076848 | 3300005937 | Bacteria | 2749 |
| 220 | Ga0081455_10095062 | 3300005937 | Bacteria | 2406 |
| 221 | Ga0081455_10144769 | 3300005937 | Bacteria | 1840 |
| 222 | Ga0081540_1001273 | 3300005983 | Bacteria | 21971 |
| 223 | Ga0081540_1004295 | 3300005983 | Bacteria | 10918 |
| 224 | Ga0081540_1004433 | 3300005983 | Bacteria | 10710 |
| 225 | Ga0081540_1007588 | 3300005983 | Bacteria | 7707 |
| 226 | Ga0081540_1015480 | 3300005983 | Bacteria | 4828 |
| 227 | Ga0081540_1020000 | 3300005983 | Bacteria | 4045 |
| 228 | Ga0081540_1029423 | 3300005983 | Bacteria | 3060 |
| 229 | Ga0081540_1114366 | 3300005983 | Bacteria | 1133 |
| 230 | Ga0081540_1147325 | 3300005983 | Bacteria | 935 |
| 231 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 232 | Ga0081539_10000203 | 3300005985 | Bacteria | 138096 |
| 233 | Ga0081539_10119548 | 3300005985 | Bacteria | 1311 |
| 234 | Ga0081539_10127058 | 3300005985 | Bacteria | 1258 |
| 235 | Ga0070717_10001217 | 3300006028 | Bacteria | 17468 |
| 236 | Ga0070717_10033689 | 3300006028 | Bacteria | 4134 |
| 237 | Ga0070717_10711403 | 3300006028 | Bacteria | 913 |
| 238 | Ga0070717_10793140 | 3300006028 | Bacteria | 862 |
| 239 | Ga0070717_10901607 | 3300006028 | Bacteria | 805 |
| 240 | Ga0075365_10004788 | 3300006038 | Bacteria | 7222 |
| 241 | Ga0075365_10057450 | 3300006038 | Bacteria | 2588 |
| 242 | Ga0075365_10122121 | 3300006038 | Bacteria | 1797 |
| 243 | Ga0075365_10172876 | 3300006038 | Bacteria | 1508 |
| 244 | Ga0075368_10317224 | 3300006042 | Bacteria | 675 |
| 245 | Ga0075363_100005068 | 3300006048 | Bacteria | 5827 |
| 246 | Ga0075363_100094048 | 3300006048 | Bacteria | 1652 |
| 247 | Ga0075364_10243222 | 3300006051 | Bacteria | 1222 |
| 248 | Ga0075364_10348156 | 3300006051 | Bacteria | 1010 |
| 249 | Ga0075364_10669074 | 3300006051 | Bacteria | 709 |
| 250 | Ga0075432_10101437 | 3300006058 | Bacteria | 1064 |
| 251 | Ga0070715_10232644 | 3300006163 | Bacteria | 954 |
| 252 | Ga0070715_10241348 | 3300006163 | Bacteria | 940 |
| 253 | Ga0070715_10398088 | 3300006163 | Bacteria | 765 |
| 254 | Ga0070716_100017080 | 3300006173 | Bacteria | 3756 |
| 255 | Ga0070716_100044733 | 3300006173 | Bacteria | 2481 |
| 256 | Ga0070716_100351381 | 3300006173 | Bacteria | 1044 |
| 257 | Ga0070716_100445426 | 3300006173 | Bacteria | 943 |
| 258 | Ga0070712_100010424 | 3300006175 | Bacteria | 5863 |
| 259 | Ga0070712_100027750 | 3300006175 | Bacteria | 3783 |
| 260 | Ga0070712_100117209 | 3300006175 | Bacteria | 1998 |
| 261 | Ga0070712_100473801 | 3300006175 | Bacteria | 1046 |
| 262 | Ga0070712_100525035 | 3300006175 | Bacteria | 995 |
| 263 | Ga0070712_100566390 | 3300006175 | Bacteria | 959 |
| 264 | Ga0075362_10002833 | 3300006177 | Bacteria | 5915 |
| 265 | Ga0075362_10477687 | 3300006177 | Bacteria | 635 |
| 266 | Ga0075367_10006819 | 3300006178 | Bacteria | 5804 |
| 267 | Ga0075367_10136490 | 3300006178 | Bacteria | 1518 |
| 268 | Ga0075367_10152067 | 3300006178 | Bacteria | 1437 |
| 269 | Ga0075367_10231237 | 3300006178 | Bacteria | 1158 |
| 270 | Ga0075367_10404420 | 3300006178 | Bacteria | 864 |
| 271 | Ga0075367_10418586 | 3300006178 | Bacteria | 848 |
| 272 | Ga0075367_10435364 | 3300006178 | Bacteria | 831 |
| 273 | Ga0075366_10645420 | 3300006195 | Bacteria | 657 |
| 274 | Ga0075366_10660925 | 3300006195 | Bacteria | 648 |
| 275 | Ga0097621_100499621 | 3300006237 | Bacteria | 1101 |
| 276 | Ga0097621_100664082 | 3300006237 | Bacteria | 957 |
| 277 | Ga0075370_10028134 | 3300006353 | Bacteria | 3123 |
| 278 | Ga0075370_10155586 | 3300006353 | Bacteria | 1340 |
| 279 | Ga0075370_10464034 | 3300006353 | Bacteria | 762 |
| 280 | Ga0068871_100275487 | 3300006358 | Bacteria | 1470 |
| 281 | Ga0068871_100315755 | 3300006358 | Bacteria | 1375 |
| 282 | Ga0068871_100340216 | 3300006358 | Bacteria | 1325 |
| 283 | Ga0068871_100540174 | 3300006358 | Bacteria | 1055 |
| 284 | Ga0075428_100726299 | 3300006844 | Bacteria | 1057 |
| 285 | Ga0075434_100028126 | 3300006871 | Bacteria | 5523 |
| 286 | Ga0068865_100067502 | 3300006881 | Bacteria | 2526 |
| 287 | Ga0068865_100441924 | 3300006881 | Bacteria | 1073 |
| 288 | Ga0068865_100628287 | 3300006881 | Bacteria | 910 |
| 289 | Ga0097620_100000028 | 3300006931 | Bacteria | 180121 |
| 290 | Ga0097620_100007456 | 3300006931 | Bacteria | 11105 |
| 291 | Ga0097620_100063328 | 3300006931 | Bacteria | 3729 |
| 292 | Ga0097620_100214708 | 3300006931 | Bacteria | 2011 |
| 293 | Ga0097620_101696533 | 3300006931 | Bacteria | 698 |
| 294 | Ga0099825_1036353 | 3300006941 | Bacteria | 1700 |
| 295 | Ga0099824_1012432 | 3300006942 | Bacteria | 9280 |
| 296 | Ga0099822_1000676 | 3300006943 | Bacteria | 34395 |
| 297 | Ga0075435_100033061 | 3300007076 | Bacteria | 4088 |
| 298 | Ga0075435_100147933 | 3300007076 | Bacteria | 1973 |
| 299 | Ga0075435_100570463 | 3300007076 | Bacteria | 981 |
| 300 | Ga0099794_10090494 | 3300007265 | Bacteria | 1518 |
| 301 | Ga0099795_10018379 | 3300007788 | Bacteria | 2246 |
| 302 | Ga0099795_10150933 | 3300007788 | Bacteria | 952 |
| 303 | Ga0105244_10268305 | 3300009036 | Bacteria | 793 |
| 304 | Ga0105250_10260498 | 3300009092 | Bacteria | 742 |
| 305 | Ga0105240_10010432 | 3300009093 | Bacteria | 13052 |
| 306 | Ga0105240_10022388 | 3300009093 | Bacteria | 8377 |
| 307 | Ga0105240_10052813 | 3300009093 | Bacteria | 5106 |
| 308 | Ga0105240_10446739 | 3300009093 | Bacteria | 1448 |
| 309 | Ga0105240_10488562 | 3300009093 | Bacteria | 1371 |
| 310 | Ga0105240_10961608 | 3300009093 | Bacteria | 915 |
| 311 | Ga0105240_11643168 | 3300009093 | Bacteria | 672 |
| 312 | Ga0111539_10463556 | 3300009094 | Bacteria | 1475 |
| 313 | Ga0111539_10554387 | 3300009094 | Bacteria | 1339 |
| 314 | Ga0111539_11578324 | 3300009094 | Bacteria | 761 |
| 315 | Ga0105245_10139110 | 3300009098 | Bacteria | 2285 |
| 316 | Ga0105245_11235466 | 3300009098 | Bacteria | 795 |
| 317 | Ga0105245_11955993 | 3300009098 | Bacteria | 640 |
| 318 | Ga0105245_12614679 | 3300009098 | Bacteria | 558 |
| 319 | Ga0105247_10000988 | 3300009101 | Bacteria | 21435 |
| 320 | Ga0105247_10059204 | 3300009101 | Bacteria | 2371 |
| 321 | Ga0105247_10113322 | 3300009101 | Bacteria | 1748 |
| 322 | Ga0105247_10219304 | 3300009101 | Bacteria | 1287 |
| 323 | Ga0105247_10507400 | 3300009101 | Bacteria | 880 |
| 324 | Ga0105247_10578478 | 3300009101 | Bacteria | 830 |
| 325 | Ga0114129_10827321 | 3300009147 | Bacteria | 1179 |
| 326 | Ga0105243_10407528 | 3300009148 | Bacteria | 1265 |
| 327 | Ga0105243_10708577 | 3300009148 | Bacteria | 982 |
| 328 | Ga0105241_10035235 | 3300009174 | Bacteria | 3764 |
| 329 | Ga0105241_10535063 | 3300009174 | Bacteria | 1050 |
| 330 | Ga0105241_10620129 | 3300009174 | Bacteria | 979 |
| 331 | Ga0105241_10822697 | 3300009174 | Bacteria | 857 |
| 332 | Ga0105242_10398312 | 3300009176 | Bacteria | 1284 |
| 333 | Ga0105242_11491921 | 3300009176 | Bacteria | 706 |
| 334 | Ga0105242_11496406 | 3300009176 | Bacteria | 706 |
| 335 | Ga0105242_11506969 | 3300009176 | Bacteria | 703 |
| 336 | Ga0105248_10047570 | 3300009177 | Bacteria | 4811 |
| 337 | Ga0105248_10114790 | 3300009177 | Bacteria | 3037 |
| 338 | Ga0105248_10378607 | 3300009177 | Bacteria | 1593 |
| 339 | Ga0105248_10640216 | 3300009177 | Bacteria | 1200 |
| 340 | Ga0105248_10858805 | 3300009177 | Bacteria | 1024 |
| 341 | Ga0105248_10895067 | 3300009177 | Bacteria | 1002 |
| 342 | Ga0105248_11436330 | 3300009177 | Bacteria | 781 |
| 343 | Ga0105237_10097302 | 3300009545 | Bacteria | 2933 |
| 344 | Ga0105237_10100303 | 3300009545 | Bacteria | 2886 |
| 345 | Ga0105237_10104870 | 3300009545 | Bacteria | 2818 |
| 346 | Ga0105237_10127776 | 3300009545 | Bacteria | 2536 |
| 347 | Ga0105237_10227928 | 3300009545 | Bacteria | 1864 |
| 348 | Ga0105238_10054676 | 3300009551 | Bacteria | 4008 |
| 349 | Ga0105238_10220793 | 3300009551 | Bacteria | 1871 |
| 350 | Ga0105238_10419151 | 3300009551 | Bacteria | 1333 |
| 351 | Ga0105238_10579086 | 3300009551 | Bacteria | 1129 |
| 352 | Ga0105238_10657626 | 3300009551 | Bacteria | 1058 |
| 353 | Ga0105238_10779032 | 3300009551 | Bacteria | 971 |
| 354 | Ga0105249_10131543 | 3300009553 | Bacteria | 2390 |
| 355 | Ga0105249_10386945 | 3300009553 | Bacteria | 1426 |
| 356 | Ga0105249_10416484 | 3300009553 | Bacteria | 1376 |
| 357 | Ga0105249_10521675 | 3300009553 | Bacteria | 1235 |
| 358 | Ga0105249_10531777 | 3300009553 | Bacteria | 1224 |
| 359 | Ga0105249_11462716 | 3300009553 | Bacteria | 755 |
| 360 | Ga0105035_116225 | 3300009988 | Bacteria | 687 |
| 361 | Ga0099796_10058628 | 3300010159 | Bacteria | 1358 |
| 362 | Ga0099796_10061146 | 3300010159 | Bacteria | 1335 |
| 363 | Ga0099796_10309674 | 3300010159 | Bacteria | 671 |
| 364 | Ga0105239_10057882 | 3300010375 | Bacteria | 4252 |
| 365 | Ga0105239_10094432 | 3300010375 | Bacteria | 3304 |
| 366 | Ga0105239_10158415 | 3300010375 | Bacteria | 2529 |
| 367 | Ga0105239_10188851 | 3300010375 | Bacteria | 2306 |
| 368 | Ga0105239_10547140 | 3300010375 | Bacteria | 1318 |
| 369 | Ga0105239_11018154 | 3300010375 | Bacteria | 952 |
| 370 | Ga0105239_11278588 | 3300010375 | Bacteria | 846 |
| 371 | Ga0105239_11521608 | 3300010375 | Bacteria | 773 |
| 372 | Ga0105239_11595024 | 3300010375 | Bacteria | 755 |
| 373 | Ga0105239_13011793 | 3300010375 | Bacteria | 549 |
| 374 | Ga0105246_10031311 | 3300011119 | Bacteria | 3520 |
| 375 | Ga0105246_10044167 | 3300011119 | Bacteria | 3027 |
| 376 | Ga0105246_10418940 | 3300011119 | Bacteria | 1117 |
| 377 | Ga0105246_10620219 | 3300011119 | Bacteria | 937 |
| 378 | Ga0105246_10669029 | 3300011119 | Bacteria | 906 |
| 379 | Ga0105246_10917949 | 3300011119 | Bacteria | 787 |
| 380 | Ga0157373_10258670 | 3300013100 | Bacteria | 1232 |
| 381 | Ga0157371_10652389 | 3300013102 | Bacteria | 785 |
| 382 | Ga0157370_10136478 | 3300013104 | Bacteria | 2286 |
| 383 | Ga0157370_10237235 | 3300013104 | Bacteria | 1688 |
| 384 | Ga0157370_10314118 | 3300013104 | Bacteria | 1446 |
| 385 | Ga0157370_10946928 | 3300013104 | Bacteria | 781 |
| 386 | Ga0157369_10121716 | 3300013105 | Bacteria | 2768 |
| 387 | Ga0157369_10246166 | 3300013105 | Bacteria | 1866 |
| 388 | Ga0157369_10335635 | 3300013105 | Bacteria | 1570 |
| 389 | Ga0157369_12170976 | 3300013105 | Bacteria | 563 |
| 390 | Ga0157374_10042146 | 3300013296 | Bacteria | 4210 |
| 391 | Ga0157374_10071292 | 3300013296 | Bacteria | 3276 |
| 392 | Ga0157374_10085422 | 3300013296 | Bacteria | 3001 |
| 393 | Ga0157374_10370458 | 3300013296 | Bacteria | 1425 |
| 394 | Ga0157374_11006947 | 3300013296 | Bacteria | 852 |
| 395 | Ga0157374_12274556 | 3300013296 | Bacteria | 569 |
| 396 | Ga0157378_10059778 | 3300013297 | Bacteria | 3401 |
| 397 | Ga0157378_10124203 | 3300013297 | Bacteria | 2383 |
| 398 | Ga0157378_10269721 | 3300013297 | Bacteria | 1636 |
| 399 | Ga0157378_10557641 | 3300013297 | Bacteria | 1152 |
| 400 | Ga0157378_11059528 | 3300013297 | Bacteria | 847 |
| 401 | Ga0163162_10070625 | 3300013306 | Bacteria | 3543 |
| 402 | Ga0163162_10162094 | 3300013306 | Bacteria | 2358 |
| 403 | Ga0163162_10746522 | 3300013306 | Bacteria | 1098 |
| 404 | Ga0163162_10798576 | 3300013306 | Bacteria | 1061 |
| 405 | Ga0163162_10806919 | 3300013306 | Bacteria | 1056 |
| 406 | Ga0163162_11718944 | 3300013306 | Bacteria | 717 |
| 407 | Ga0157375_10165114 | 3300013308 | Bacteria | 2358 |
| 408 | Ga0157375_10667029 | 3300013308 | Bacteria | 1195 |
| 409 | Ga0157375_10668897 | 3300013308 | Bacteria | 1193 |
| 410 | Ga0163163_10048338 | 3300014325 | Bacteria | 4183 |
| 411 | Ga0163163_10396842 | 3300014325 | Bacteria | 1437 |
| 412 | Ga0163163_10520501 | 3300014325 | Bacteria | 1252 |
| 413 | Ga0157380_10060148 | 3300014326 | Bacteria | 3034 |
| 414 | Ga0157380_10186435 | 3300014326 | Bacteria | 1828 |
| 415 | Ga0157380_10234153 | 3300014326 | Bacteria | 1651 |
| 416 | Ga0157380_10949387 | 3300014326 | Bacteria | 890 |
| 417 | Ga0157380_11031643 | 3300014326 | Bacteria | 858 |
| 418 | Ga0157379_10157257 | 3300014968 | Bacteria | 2051 |
| 419 | Ga0157379_10279604 | 3300014968 | Bacteria | 1519 |
| 420 | Ga0157379_11242506 | 3300014968 | Bacteria | 718 |
| 421 | Ga0157379_11719451 | 3300014968 | Bacteria | 615 |
| 422 | Ga0157376_10037168 | 3300014969 | Bacteria | 3950 |
| 423 | Ga0157376_10533785 | 3300014969 | Bacteria | 1158 |
| 424 | Ga0157376_11981849 | 3300014969 | Bacteria | 620 |
| 425 | Ga0163161_10480318 | 3300017792 | Bacteria | 1009 |
| 426 | Ga0197907_10033556 | 3300020069 | Bacteria | 2637 |
| 427 | Ga0206352_10877984 | 3300020078 | Bacteria | 880 |
| 428 | Ga0206353_10274628 | 3300020082 | Bacteria | 1847 |
| 429 | Ga0206353_11984242 | 3300020082 | Bacteria | 985 |
| 430 | Ga0213872_10162189 | 3300021361 | Bacteria | 972 |
| 431 | Ga0213872_10340844 | 3300021361 | Bacteria | 616 |
| 432 | Ga0213874_10064230 | 3300021377 | Bacteria | 1157 |
| 433 | Ga0213876_10085041 | 3300021384 | Bacteria | 1673 |
| 434 | Ga0213875_10022449 | 3300021388 | Bacteria | 3017 |
| 435 | Ga0209233_1003513 | 3300025261 | Bacteria | 5509 |
| 436 | Ga0207697_10058295 | 3300025315 | Bacteria | 1604 |
| 437 | Ga0207697_10120431 | 3300025315 | Bacteria | 1129 |
| 438 | Ga0207697_10279151 | 3300025315 | Bacteria | 740 |
| 439 | Ga0207656_10037335 | 3300025321 | Bacteria | 2043 |
| 440 | Ga0207696_1084892 | 3300025711 | Bacteria | 872 |
| 441 | Ga0207692_10051478 | 3300025898 | Bacteria | 2088 |
| 442 | Ga0207692_10052673 | 3300025898 | Bacteria | 2069 |
| 443 | Ga0207692_10381735 | 3300025898 | Bacteria | 875 |
| 444 | Ga0207692_10542414 | 3300025898 | Bacteria | 742 |
| 445 | Ga0207642_10020577 | 3300025899 | Bacteria | 2579 |
| 446 | Ga0207642_10478528 | 3300025899 | Bacteria | 759 |
| 447 | Ga0207710_10025072 | 3300025900 | Bacteria | 2572 |
| 448 | Ga0207710_10071617 | 3300025900 | Bacteria | 1590 |
| 449 | Ga0207710_10182256 | 3300025900 | Bacteria | 1031 |
| 450 | Ga0207710_10399755 | 3300025900 | Bacteria | 705 |
| 451 | Ga0207688_10028174 | 3300025901 | Bacteria | 3091 |
| 452 | Ga0207688_10333094 | 3300025901 | Bacteria | 933 |
| 453 | Ga0207680_10139088 | 3300025903 | Bacteria | 1608 |
| 454 | Ga0207680_10342479 | 3300025903 | Bacteria | 1049 |
| 455 | Ga0207685_10045309 | 3300025905 | Bacteria | 1667 |
| 456 | Ga0207685_10068327 | 3300025905 | Bacteria | 1431 |
| 457 | Ga0207699_10007093 | 3300025906 | Bacteria | 5463 |
| 458 | Ga0207699_10014450 | 3300025906 | Bacteria | 4071 |
| 459 | Ga0207699_10066405 | 3300025906 | Bacteria | 2190 |
| 460 | Ga0207645_10717171 | 3300025907 | Bacteria | 680 |
| 461 | Ga0207643_10463358 | 3300025908 | Bacteria | 807 |
| 462 | Ga0207705_10034900 | 3300025909 | Bacteria | 3598 |
| 463 | Ga0207705_10063236 | 3300025909 | Bacteria | 2674 |
| 464 | Ga0207705_10141395 | 3300025909 | Bacteria | 1798 |
| 465 | Ga0207705_10154531 | 3300025909 | Bacteria | 1721 |
| 466 | Ga0207705_10358941 | 3300025909 | Bacteria | 1124 |
| 467 | Ga0207684_10558205 | 3300025910 | Bacteria | 979 |
| 468 | Ga0207684_10926391 | 3300025910 | Bacteria | 731 |
| 469 | Ga0207654_10055630 | 3300025911 | Bacteria | 2292 |
| 470 | Ga0207654_10246746 | 3300025911 | Bacteria | 1195 |
| 471 | Ga0207654_10774201 | 3300025911 | Bacteria | 692 |
| 472 | Ga0207707_10000852 | 3300025912 | Bacteria | 29744 |
| 473 | Ga0207707_10008752 | 3300025912 | Bacteria | 8785 |
| 474 | Ga0207707_10013145 | 3300025912 | Bacteria | 7214 |
| 475 | Ga0207707_10219273 | 3300025912 | Bacteria | 1656 |
| 476 | Ga0207707_10367627 | 3300025912 | Bacteria | 1238 |
| 477 | Ga0207707_10551254 | 3300025912 | Bacteria | 979 |
| 478 | Ga0207695_10078385 | 3300025913 | Bacteria | 3352 |
| 479 | Ga0207695_10241413 | 3300025913 | Bacteria | 1708 |
| 480 | Ga0207695_10273131 | 3300025913 | Bacteria | 1586 |
| 481 | Ga0207695_10446680 | 3300025913 | Bacteria | 1176 |
| 482 | Ga0207671_10117481 | 3300025914 | Bacteria | 2030 |
| 483 | Ga0207671_10193003 | 3300025914 | Bacteria | 1589 |
| 484 | Ga0207671_10337122 | 3300025914 | Bacteria | 1195 |
| 485 | Ga0207671_10357077 | 3300025914 | Bacteria | 1159 |
| 486 | Ga0207671_10590255 | 3300025914 | Bacteria | 885 |
| 487 | Ga0207671_10924872 | 3300025914 | Bacteria | 689 |
| 488 | Ga0207693_10007651 | 3300025915 | Bacteria | 8871 |
| 489 | Ga0207693_10011694 | 3300025915 | Bacteria | 7102 |
| 490 | Ga0207693_10027350 | 3300025915 | Bacteria | 4510 |
| 491 | Ga0207693_10126980 | 3300025915 | Bacteria | 2005 |
| 492 | Ga0207693_10180540 | 3300025915 | Bacteria | 1661 |
| 493 | Ga0207693_10272266 | 3300025915 | Bacteria | 1327 |
| 494 | Ga0207693_10489288 | 3300025915 | Bacteria | 961 |
| 495 | Ga0207663_10007481 | 3300025916 | Bacteria | 5666 |
| 496 | Ga0207663_10032758 | 3300025916 | Bacteria | 3088 |
| 497 | Ga0207663_10032999 | 3300025916 | Bacteria | 3079 |
| 498 | Ga0207663_10918655 | 3300025916 | Bacteria | 700 |
| 499 | Ga0207660_10032733 | 3300025917 | Bacteria | 3590 |
| 500 | Ga0207660_10074168 | 3300025917 | Bacteria | 2482 |
| 501 | Ga0207660_10230213 | 3300025917 | Bacteria | 1457 |
| 502 | Ga0207657_10002580 | 3300025919 | Bacteria | 19599 |
| 503 | Ga0207657_10215974 | 3300025919 | Bacteria | 1538 |
| 504 | Ga0207649_10076679 | 3300025920 | Bacteria | 2152 |
| 505 | Ga0207649_10114372 | 3300025920 | Bacteria | 1808 |
| 506 | Ga0207652_10007221 | 3300025921 | Bacteria | 8959 |
| 507 | Ga0207652_10014787 | 3300025921 | Bacteria | 6326 |
| 508 | Ga0207652_10024999 | 3300025921 | Bacteria | 4960 |
| 509 | Ga0207652_10062755 | 3300025921 | Bacteria | 3211 |
| 510 | Ga0207652_10230571 | 3300025921 | Bacteria | 1669 |
| 511 | Ga0207652_10343884 | 3300025921 | Bacteria | 1347 |
| 512 | Ga0207646_10239429 | 3300025922 | Bacteria | 1639 |
| 513 | Ga0207681_10000248 | 3300025923 | Bacteria | 41061 |
| 514 | Ga0207694_10033330 | 3300025924 | Bacteria | 3945 |
| 515 | Ga0207694_10078105 | 3300025924 | Bacteria | 2594 |
| 516 | Ga0207694_10146877 | 3300025924 | Bacteria | 1898 |
| 517 | Ga0207694_10538059 | 3300025924 | Bacteria | 980 |
| 518 | Ga0207694_10654411 | 3300025924 | Bacteria | 885 |
| 519 | Ga0207694_10658396 | 3300025924 | Bacteria | 882 |
| 520 | Ga0207694_10721508 | 3300025924 | Bacteria | 841 |
| 521 | Ga0207694_11085778 | 3300025924 | Bacteria | 677 |
| 522 | Ga0207650_11137700 | 3300025925 | Bacteria | 664 |
| 523 | Ga0207659_10057464 | 3300025926 | Bacteria | 2790 |
| 524 | Ga0207687_10111760 | 3300025927 | Bacteria | 2029 |
| 525 | Ga0207687_10147633 | 3300025927 | Bacteria | 1790 |
| 526 | Ga0207687_10491869 | 3300025927 | Bacteria | 1023 |
| 527 | Ga0207687_10496593 | 3300025927 | Bacteria | 1018 |
| 528 | Ga0207700_10003283 | 3300025928 | Bacteria | 9361 |
| 529 | Ga0207700_10041218 | 3300025928 | Bacteria | 3377 |
| 530 | Ga0207700_10068583 | 3300025928 | Bacteria | 2719 |
| 531 | Ga0207700_10096383 | 3300025928 | Bacteria | 2349 |
| 532 | Ga0207700_10219871 | 3300025928 | Bacteria | 1610 |
| 533 | Ga0207700_10237564 | 3300025928 | Bacteria | 1552 |
| 534 | Ga0207700_11344719 | 3300025928 | Bacteria | 636 |
| 535 | Ga0207664_10022106 | 3300025929 | Bacteria | 4743 |
| 536 | Ga0207664_10055824 | 3300025929 | Bacteria | 3135 |
| 537 | Ga0207664_10066442 | 3300025929 | Bacteria | 2891 |
| 538 | Ga0207664_10230436 | 3300025929 | Bacteria | 1610 |
| 539 | Ga0207664_10295012 | 3300025929 | Bacteria | 1425 |
| 540 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 541 | Ga0207644_10005101 | 3300025931 | Bacteria | 8577 |
| 542 | Ga0207690_11276313 | 3300025932 | Bacteria | 614 |
| 543 | Ga0207706_10063847 | 3300025933 | Bacteria | 3242 |
| 544 | Ga0207706_10232732 | 3300025933 | Bacteria | 1612 |
| 545 | Ga0207706_11090466 | 3300025933 | Bacteria | 667 |
| 546 | Ga0207686_10411884 | 3300025934 | Bacteria | 1032 |
| 547 | Ga0207686_10519596 | 3300025934 | Bacteria | 926 |
| 548 | Ga0207686_11018575 | 3300025934 | Bacteria | 672 |
| 549 | Ga0207709_10108126 | 3300025935 | Bacteria | 1854 |
| 550 | Ga0207709_10186625 | 3300025935 | Bacteria | 1469 |
| 551 | Ga0207709_10392342 | 3300025935 | Bacteria | 1059 |
| 552 | Ga0207670_10001223 | 3300025936 | Bacteria | 13568 |
| 553 | Ga0207670_10061119 | 3300025936 | Bacteria | 2570 |
| 554 | Ga0207669_10119491 | 3300025937 | Bacteria | 1785 |
| 555 | Ga0207669_10226526 | 3300025937 | Bacteria | 1376 |
| 556 | Ga0207669_11080566 | 3300025937 | Bacteria | 677 |
| 557 | Ga0207704_10079310 | 3300025938 | Bacteria | 2115 |
| 558 | Ga0207704_10701116 | 3300025938 | Bacteria | 838 |
| 559 | Ga0207704_10973690 | 3300025938 | Bacteria | 716 |
| 560 | Ga0207665_10007232 | 3300025939 | Bacteria | 7345 |
| 561 | Ga0207665_10029943 | 3300025939 | Bacteria | 3596 |
| 562 | Ga0207665_10258544 | 3300025939 | Bacteria | 1289 |
| 563 | Ga0207665_10445960 | 3300025939 | Bacteria | 992 |
| 564 | Ga0207665_10627619 | 3300025939 | Bacteria | 841 |
| 565 | Ga0207665_11122585 | 3300025939 | Bacteria | 627 |
| 566 | Ga0207691_10111293 | 3300025940 | Bacteria | 2435 |
| 567 | Ga0207691_10177730 | 3300025940 | Bacteria | 1861 |
| 568 | Ga0207691_11337186 | 3300025940 | Bacteria | 591 |
| 569 | Ga0207711_10028582 | 3300025941 | Bacteria | 4694 |
| 570 | Ga0207711_10484600 | 3300025941 | Bacteria | 1152 |
| 571 | Ga0207711_10491080 | 3300025941 | Bacteria | 1144 |
| 572 | Ga0207711_10541428 | 3300025941 | Bacteria | 1086 |
| 573 | Ga0207711_10956781 | 3300025941 | Bacteria | 795 |
| 574 | Ga0207689_10061700 | 3300025942 | Bacteria | 3083 |
| 575 | Ga0207689_10710456 | 3300025942 | Bacteria | 848 |
| 576 | Ga0207661_10000889 | 3300025944 | Bacteria | 19622 |
| 577 | Ga0207661_10073195 | 3300025944 | Bacteria | 2805 |
| 578 | Ga0207661_10739204 | 3300025944 | Bacteria | 905 |
| 579 | Ga0207679_10256917 | 3300025945 | Bacteria | 1488 |
| 580 | Ga0207667_10002818 | 3300025949 | Bacteria | 21556 |
| 581 | Ga0207667_10011892 | 3300025949 | Bacteria | 10079 |
| 582 | Ga0207667_10018462 | 3300025949 | Bacteria | 7820 |
| 583 | Ga0207667_10050257 | 3300025949 | Bacteria | 4399 |
| 584 | Ga0207667_10054977 | 3300025949 | Bacteria | 4186 |
| 585 | Ga0207667_10167961 | 3300025949 | Bacteria | 2255 |
| 586 | Ga0207651_10103843 | 3300025960 | Bacteria | 2116 |
| 587 | Ga0207712_10113006 | 3300025961 | Bacteria | 2041 |
| 588 | Ga0207712_10303325 | 3300025961 | Bacteria | 1311 |
| 589 | Ga0207712_10351548 | 3300025961 | Bacteria | 1225 |
| 590 | Ga0207712_10805158 | 3300025961 | Bacteria | 826 |
| 591 | Ga0207712_11246689 | 3300025961 | Bacteria | 664 |
| 592 | Ga0207668_10028354 | 3300025972 | Bacteria | 3660 |
| 593 | Ga0207668_10042250 | 3300025972 | Bacteria | 3087 |
| 594 | Ga0207668_10056374 | 3300025972 | Bacteria | 2736 |
| 595 | Ga0207668_10191358 | 3300025972 | Bacteria | 1621 |
| 596 | Ga0207668_10215697 | 3300025972 | Bacteria | 1537 |
| 597 | Ga0207668_10390743 | 3300025972 | Bacteria | 1173 |
| 598 | Ga0207668_10458159 | 3300025972 | Bacteria | 1090 |
| 599 | Ga0207668_10923667 | 3300025972 | Bacteria | 777 |
| 600 | Ga0207640_10169884 | 3300025981 | Bacteria | 1624 |
| 601 | Ga0207658_10027233 | 3300025986 | Bacteria | 4014 |
| 602 | Ga0207658_12115809 | 3300025986 | Bacteria | 511 |
| 603 | Ga0207677_10010857 | 3300026023 | Bacteria | 5168 |
| 604 | Ga0207677_10116864 | 3300026023 | Bacteria | 1998 |
| 605 | Ga0207677_10185918 | 3300026023 | Bacteria | 1639 |
| 606 | Ga0207677_10267149 | 3300026023 | Bacteria | 1397 |
| 607 | Ga0207703_10011714 | 3300026035 | Bacteria | 6825 |
| 608 | Ga0207703_10020479 | 3300026035 | Bacteria | 5173 |
| 609 | Ga0207703_10177458 | 3300026035 | Bacteria | 1878 |
| 610 | Ga0207703_10256204 | 3300026035 | Bacteria | 1580 |
| 611 | Ga0207703_11630469 | 3300026035 | Bacteria | 621 |
| 612 | Ga0207639_10096777 | 3300026041 | Bacteria | 2375 |
| 613 | Ga0207639_10132349 | 3300026041 | Bacteria | 2066 |
| 614 | Ga0207639_10220992 | 3300026041 | Bacteria | 1636 |
| 615 | Ga0207639_10280171 | 3300026041 | Bacteria | 1466 |
| 616 | Ga0207639_10341575 | 3300026041 | Bacteria | 1335 |
| 617 | Ga0207639_10525913 | 3300026041 | Bacteria | 1083 |
| 618 | Ga0207639_10591691 | 3300026041 | Bacteria | 1022 |
| 619 | Ga0207678_10014567 | 3300026067 | Bacteria | 6918 |
| 620 | Ga0207678_10055860 | 3300026067 | Bacteria | 3400 |
| 621 | Ga0207678_10490963 | 3300026067 | Bacteria | 1070 |
| 622 | Ga0207678_11556491 | 3300026067 | Bacteria | 583 |
| 623 | Ga0207708_10808472 | 3300026075 | Bacteria | 807 |
| 624 | Ga0207708_10851534 | 3300026075 | Bacteria | 787 |
| 625 | Ga0207702_10000433 | 3300026078 | Bacteria | 47747 |
| 626 | Ga0207702_10156956 | 3300026078 | Bacteria | 2075 |
| 627 | Ga0207702_10195760 | 3300026078 | Bacteria | 1871 |
| 628 | Ga0207702_10336092 | 3300026078 | Bacteria | 1442 |
| 629 | Ga0207702_10460574 | 3300026078 | Bacteria | 1235 |
| 630 | Ga0207702_10724608 | 3300026078 | Bacteria | 981 |
| 631 | Ga0207702_11344313 | 3300026078 | Bacteria | 708 |
| 632 | Ga0207641_10432417 | 3300026088 | Bacteria | 1269 |
| 633 | Ga0207641_10732202 | 3300026088 | Bacteria | 975 |
| 634 | Ga0207641_10862902 | 3300026088 | Bacteria | 898 |
| 635 | Ga0207648_10112313 | 3300026089 | Bacteria | 2393 |
| 636 | Ga0207648_10335180 | 3300026089 | Bacteria | 1361 |
| 637 | Ga0207648_10415874 | 3300026089 | Bacteria | 1220 |
| 638 | Ga0207676_10046581 | 3300026095 | Bacteria | 3356 |
| 639 | Ga0207676_10054381 | 3300026095 | Bacteria | 3138 |
| 640 | Ga0207676_10152956 | 3300026095 | Bacteria | 1989 |
| 641 | Ga0207674_10020134 | 3300026116 | Bacteria | 7216 |
| 642 | Ga0207674_10047317 | 3300026116 | Bacteria | 4410 |
| 643 | Ga0207674_11420874 | 3300026116 | Bacteria | 663 |
| 644 | Ga0207675_100141319 | 3300026118 | Bacteria | 2287 |
| 645 | Ga0207675_100218915 | 3300026118 | Bacteria | 1834 |
| 646 | Ga0207675_100448463 | 3300026118 | Bacteria | 1278 |
| 647 | Ga0207675_100455596 | 3300026118 | Bacteria | 1268 |
| 648 | Ga0207675_100676936 | 3300026118 | Bacteria | 1039 |
| 649 | Ga0207683_10022491 | 3300026121 | Bacteria | 5412 |
| 650 | Ga0207683_10027057 | 3300026121 | Bacteria | 4956 |
| 651 | Ga0207683_10166017 | 3300026121 | Bacteria | 1997 |
| 652 | Ga0207683_10289502 | 3300026121 | Bacteria | 1498 |
| 653 | Ga0207683_10446288 | 3300026121 | Bacteria | 1192 |
| 654 | Ga0207683_10550524 | 3300026121 | Bacteria | 1067 |
| 655 | Ga0207683_10652695 | 3300026121 | Bacteria | 975 |
| 656 | Ga0207683_10986456 | 3300026121 | Bacteria | 782 |
| 657 | Ga0207698_10168949 | 3300026142 | Bacteria | 1923 |
| 658 | Ga0207698_10189323 | 3300026142 | Bacteria | 1831 |
| 659 | Ga0207698_10195622 | 3300026142 | Bacteria | 1806 |
| 660 | Ga0207698_10667585 | 3300026142 | Bacteria | 1031 |
| 661 | Ga0207698_11186307 | 3300026142 | Bacteria | 777 |
| 662 | Ga0207698_11492278 | 3300026142 | Bacteria | 691 |
| 663 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 664 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 665 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 666 | Ga0209588_1062957 | 3300027671 | Bacteria | 1199 |
| 667 | Ga0209813_10231557 | 3300027866 | Bacteria | 695 |
| 668 | Ga0207428_10796907 | 3300027907 | Bacteria | 671 |
| 669 | Ga0268266_10000446 | 3300028379 | Bacteria | 61283 |
| 670 | Ga0268266_10000670 | 3300028379 | Bacteria | 46181 |
| 671 | Ga0268266_10039605 | 3300028379 | Bacteria | 4014 |
| 672 | Ga0268266_10315190 | 3300028379 | Bacteria | 1462 |
| 673 | Ga0268266_10330383 | 3300028379 | Bacteria | 1429 |
| 674 | Ga0268266_10440412 | 3300028379 | Bacteria | 1237 |
| 675 | Ga0268266_10571470 | 3300028379 | Bacteria | 1084 |
| 676 | Ga0268266_10818337 | 3300028379 | Bacteria | 900 |
| 677 | Ga0268266_11201458 | 3300028379 | Bacteria | 733 |
| 678 | Ga0268266_11520113 | 3300028379 | Bacteria | 645 |
| 679 | Ga0268266_11631259 | 3300028379 | Bacteria | 620 |
| 680 | Ga0268265_10046888 | 3300028380 | Bacteria | 3233 |
| 681 | Ga0268265_10078046 | 3300028380 | Bacteria | 2603 |
| 682 | Ga0268265_10332438 | 3300028380 | Bacteria | 1380 |
| 683 | Ga0268265_10409715 | 3300028380 | Bacteria | 1255 |
| 684 | Ga0268265_10635320 | 3300028380 | Bacteria | 1024 |
| 685 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 686 | Ga0268264_10086929 | 3300028381 | Bacteria | 2687 |
| 687 | Ga0268264_10582119 | 3300028381 | Bacteria | 1101 |
| 688 | Ga0268264_12189523 | 3300028381 | Bacteria | 561 |
| 689 | Ga0265334_10009203 | 3300028573 | Bacteria | 4183 |
| 690 | Ga0307517_10000512 | 3300028786 | Bacteria | 66501 |
| 691 | Ga0307517_10085793 | 3300028786 | Bacteria | 2634 |
| 692 | Ga0307515_10007488 | 3300028794 | Bacteria | 21572 |
| 693 | Ga0307515_10426051 | 3300028794 | Bacteria | 946 |
| 694 | Ga0265338_10369397 | 3300028800 | Bacteria | 1028 |
| 695 | Ga0265330_10042318 | 3300031235 | Bacteria | 2019 |
| 696 | Ga0265330_10046855 | 3300031235 | Bacteria | 1904 |
| 697 | Ga0265332_10017124 | 3300031238 | Bacteria | 3197 |
| 698 | Ga0265340_10075050 | 3300031247 | Bacteria | 1598 |
| 699 | Ga0265339_10004935 | 3300031249 | Bacteria | 8990 |
| 700 | Ga0265331_10099006 | 3300031250 | Bacteria | 1343 |
| 701 | Ga0307513_10052398 | 3300031456 | Bacteria | 4395 |
| 702 | Ga0307513_10066917 | 3300031456 | Bacteria | 3773 |
| 703 | Ga0307509_10362884 | 3300031507 | Bacteria | 1167 |
| 704 | Ga0307509_10555128 | 3300031507 | Bacteria | 826 |
| 705 | Ga0307408_100274895 | 3300031548 | Bacteria | 1400 |
| 706 | Ga0307408_100536531 | 3300031548 | Bacteria | 1030 |
| 707 | Ga0307408_100694832 | 3300031548 | Bacteria | 914 |
| 708 | Ga0307508_10000514 | 3300031616 | Bacteria | 46387 |
| 709 | Ga0307508_10009664 | 3300031616 | Bacteria | 8855 |
| 710 | Ga0307508_10359193 | 3300031616 | Bacteria | 1048 |
| 711 | Ga0265314_10011527 | 3300031711 | Bacteria | 7282 |
| 712 | Ga0307516_10011779 | 3300031730 | Bacteria | 9485 |
| 713 | Ga0307516_10018988 | 3300031730 | Bacteria | 7135 |
| 714 | Ga0307516_10089872 | 3300031730 | Bacteria | 2901 |
| 715 | Ga0307516_10146281 | 3300031730 | Bacteria | 2128 |
| 716 | Ga0307516_10268754 | 3300031730 | Bacteria | 1392 |
| 717 | Ga0307413_10041245 | 3300031824 | Bacteria | 2701 |
| 718 | Ga0307406_10092079 | 3300031901 | Bacteria | 2043 |
| 719 | Ga0307406_10151527 | 3300031901 | Bacteria | 1655 |
| 720 | Ga0307407_10350353 | 3300031903 | Bacteria | 1045 |
| 721 | Ga0307407_10540635 | 3300031903 | Bacteria | 860 |
| 722 | Ga0307412_10070318 | 3300031911 | Bacteria | 2385 |
| 723 | Ga0307412_10135144 | 3300031911 | Bacteria | 1798 |
| 724 | Ga0307409_101208873 | 3300031995 | Bacteria | 779 |
| 725 | Ga0307416_100091588 | 3300032002 | Bacteria | 2612 |
| 726 | Ga0307416_100793386 | 3300032002 | Bacteria | 1042 |
| 727 | Ga0307411_10076751 | 3300032005 | Bacteria | 2285 |
| 728 | Ga0307411_10113101 | 3300032005 | Bacteria | 1947 |
| 729 | Ga0307411_10609426 | 3300032005 | Bacteria | 940 |
| 730 | Ga0307415_100075103 | 3300032126 | Bacteria | 2391 |
| 731 | Ga0307415_100560061 | 3300032126 | Bacteria | 1010 |
| 732 | Ga0307415_100635159 | 3300032126 | Bacteria | 955 |
| 733 | Ga0307415_101548922 | 3300032126 | Bacteria | 635 |
| 734 | Ga0307507_10010286 | 3300033179 | Bacteria | 12137 |
| 735 | Ga0307507_10036548 | 3300033179 | Bacteria | 5018 |
| 736 | Ga0307507_10310088 | 3300033179 | Bacteria | 959 |
| 737 | Ga0307510_10019030 | 3300033180 | Bacteria | 8059 |
| 738 | Ga0307510_10023408 | 3300033180 | Bacteria | 7160 |
| 739 | Ga0307510_10256328 | 3300033180 | Bacteria | 1233 |
| 740 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 741 | Ga0316215_1004581 | 3300033544 | Bacteria | 1326 |
| 742 | Ga0373930_0007018 | 3300034816 | Bacteria | 1923 |
| 743 | Ga0373938_0067420 | 3300034957 | Bacteria | 849 |
| 744 | Ga0373926_0228054 | 3300035083 | Bacteria | 719 |
| 745 | Ga0373934_0002376 | 3300035086 | Bacteria | 6925 |
| 746 | Ga0373934_0011722 | 3300035086 | Bacteria | 3301 |
| 747 | Ga0373940_0208698 | 3300035088 | Bacteria | 645 |
| 748 | Ga0373944_0045956 | 3300035089 | Bacteria | 1364 |
| 749 | Ga0373951_0069421 | 3300035091 | Bacteria | 896 |
| 750 | Ga0373952_0105437 | 3300035092 | Bacteria | 748 |
| 751 | Ga0373952_0171208 | 3300035092 | Bacteria | 621 |
| 752 | Ga0373923_0001881 | 3300035111 | Bacteria | 6252 |
| 753 | Ga0373923_0234047 | 3300035111 | Bacteria | 856 |
| 754 | Ga0373932_0019441 | 3300035112 | Bacteria | 1770 |
| 755 | Ga0373936_0002974 | 3300035113 | Bacteria | 6342 |
| 756 | Ga0373936_0102137 | 3300035113 | Bacteria | 1210 |
| 757 | Ga0373945_0007983 | 3300035116 | Bacteria | 3436 |
| 758 | Ga0373945_0009494 | 3300035116 | Bacteria | 3189 |
| 759 | Ga0373945_0194375 | 3300035116 | Bacteria | 840 |
| 760 | Ga0373953_0003113 | 3300035117 | Bacteria | 5112 |
| 761 | Ga0373953_0020937 | 3300035117 | Bacteria | 2448 |
| 762 | Ga0373954_0013120 | 3300035118 | Bacteria | 3689 |
| 763 | Ga0373954_0147565 | 3300035118 | Bacteria | 1148 |
| 764 | Ga0373956_0005493 | 3300035119 | Bacteria | 5074 |
| 765 | Ga0373956_0024429 | 3300035119 | Bacteria | 2604 |
| 766 | Ga0373956_0030747 | 3300035119 | Bacteria | 2349 |
| 767 | Ga0373957_0004852 | 3300035120 | Bacteria | 4125 |
| 768 | Ga0373957_0031440 | 3300035120 | Bacteria | 1951 |
| 769 | Ga0373960_0096433 | 3300035121 | Bacteria | 953 |
| 770 | Ga0373943_0023841 | 3300035170 | Bacteria | 2848 |
| 771 | Ga0373943_0071292 | 3300035170 | Bacteria | 1760 |
| 772 | Ga0373946_0012423 | 3300035171 | Bacteria | 3188 |
| 773 | Ga0373946_0106178 | 3300035171 | Bacteria | 1265 |
| 774 | Ga0373955_0022371 | 3300035172 | Bacteria | 3206 |
| 775 | Ga0373942_0262401 | 3300035207 | Bacteria | 590 |
| 776 | Ga0373962_0057167 | 3300035242 | Bacteria | 1138 |
| 777 | Ga0373924_0003075 | 3300035410 | Bacteria | 5694 |
| 778 | Ga0373931_0025121 | 3300035691 | Bacteria | 3025 |
| 779 | Ga0373931_0892161 | 3300035691 | Bacteria | 597 |
| 780 | Ga0373935_0001637 | 3300035692 | Bacteria | 12510 |
| 781 | Ga0373935_0111842 | 3300035692 | Bacteria | 1814 |
| 782 | Ga0373935_0523525 | 3300035692 | Bacteria | 862 |
| 783 | Ga0373935_0666612 | 3300035692 | Bacteria | 764 |
| 784 | Ga0373927_0000331 | 3300035695 | Bacteria | 37139 |
| 785 | Ga0373927_0005361 | 3300035695 | Bacteria | 8859 |
| 786 | Ga0373927_0018601 | 3300035695 | Bacteria | 4562 |
| 787 | Ga0373927_0023227 | 3300035695 | Bacteria | 4062 |
| 788 | Ga0373927_0075809 | 3300035695 | Bacteria | 2178 |
| 789 | Ga0373927_0203910 | 3300035695 | Bacteria | 1298 |
| 790 | Ga0373927_0829994 | 3300035695 | Bacteria | 610 |
| 791 | Ga0373933_0000377 | 3300035724 | Bacteria | 28626 |
| 792 | Ga0373933_0024966 | 3300035724 | Bacteria | 3424 |
| 793 | Ga0373933_0042940 | 3300035724 | Bacteria | 2673 |
| 794 | Ga0373933_0709833 | 3300035724 | Bacteria | 661 |
| 795 | Ga0373947_0005852 | 3300035725 | Bacteria | 7161 |
| 796 | Ga0373947_0015963 | 3300035725 | Bacteria | 4314 |
| 797 | Ga0373947_0032326 | 3300035725 | Bacteria | 3083 |
| 798 | Ga0373947_0037473 | 3300035725 | Bacteria | 2878 |
| 799 | Ga0373947_0207262 | 3300035725 | Bacteria | 1285 |
| 800 | Ga0373947_0522125 | 3300035725 | Bacteria | 807 |
| 801 | Ga0373947_0568811 | 3300035725 | Bacteria | 772 |
| 802 | Ga0373937_0015924 | 3300036401 | Bacteria | 6667 |
| 803 | Ga0373937_0027279 | 3300036401 | Bacteria | 5164 |
| 804 | Ga0373937_0085815 | 3300036401 | Bacteria | 2913 |
| 805 | Ga0373925_0008062 | 3300037068 | Bacteria | 7672 |
| 806 | Ga0373925_0029052 | 3300037068 | Bacteria | 4055 |
| 807 | Ga0373925_0106942 | 3300037068 | Bacteria | 2157 |
| 808 | Ga0373925_0374049 | 3300037068 | Bacteria | 1159 |
| 809 | Ga0373925_0666181 | 3300037068 | Bacteria | 858 |
| 810 | Ga0373925_1751887 | 3300037068 | Bacteria | 507 |
| 811 | Ga0395899_0009172 | 3300037312 | Bacteria | 7597 |
| 812 | Ga0395899_0138097 | 3300037312 | Bacteria | 1736 |
| 813 | Ga0395900_0398370 | 3300037418 | Bacteria | 1341 |
| 814 | Ga0395898_0554086 | 3300037466 | Bacteria | 1092 |
| 815 | Ga0395905_0647711 | 3300037471 | Bacteria | 958 |
| 816 | Ga0395905_0961284 | 3300037471 | Bacteria | 757 |
| 817 | Ga0436364_0001304 | 3300037853 | Bacteria | 3853 |
| 818 | Ga0436364_0072718 | 3300037853 | Bacteria | 1414 |
| 819 | Ga0436364_0942302 | 3300037853 | Bacteria | 1221 |
| 820 | Ga0436364_1436174 | 3300037853 | Bacteria | 1133 |
| 821 | Ga0395901_0054356 | 3300038443 | Bacteria | 4162 |
| 822 | Ga0395901_0084781 | 3300038443 | Bacteria | 3311 |
| 823 | Ga0395901_0436586 | 3300038443 | Bacteria | 1341 |
| 824 | Ga0436365_0979043 | 3300039437 | Bacteria | 5376 |
| 825 | Ga0436365_1662883 | 3300039437 | Bacteria | 2836 |
| 826 | Ga0436365_1666053 | 3300039437 | Bacteria | 2525 |
| 827 | Ga0436360_0321210 | 3300039438 | Bacteria | 1728 |
| 828 | Ga0436360_0805252 | 3300039438 | Bacteria | 2065 |
| 829 | Ga0436361_0106883 | 3300039447 | Bacteria | 662 |
| 830 | Ga0436361_0114609 | 3300039447 | Bacteria | 1346 |
| 831 | Ga0436361_0453764 | 3300039447 | Bacteria | 1074 |
| 832 | Ga0436361_0621214 | 3300039447 | Bacteria | 1937 |
| 833 | Ga0436363_0475902 | 3300039450 | Bacteria | 7324 |
| 834 | Ga0436363_0726196 | 3300039450 | Bacteria | 3219 |
| 835 | Ga0436363_1489761 | 3300039450 | Bacteria | 1179 |
| 836 | Ga0439465_0060773 | 3300041413 | Bacteria | 1252 |
| 837 | Ga0451789_1131362 | 3300041443 | Bacteria | 875 |
| 838 | Ga0451793_1643059 | 3300041452 | Bacteria | 835 |
| 839 | Ga0451800_1272588 | 3300041459 | Bacteria | 553 |
| 840 | Ga0451804_0577402 | 3300041463 | Bacteria | 691 |
| 841 | Ga0451847_0078248 | 3300041503 | Bacteria | 916 |
| 842 | Ga0451843_1327502 | 3300041509 | Bacteria | 782 |
| 843 | Ga0451853_3406428 | 3300041512 | Bacteria | 604 |
| 844 | Ga0439431_0235909 | 3300041997 | Bacteria | 540 |
| 845 | Ga0439448_0140871 | 3300042005 | Bacteria | 835 |
| 846 | Ga0439463_156452 | 3300042016 | Bacteria | 591 |
| 847 | Ga0466963_0427356 | 3300044694 | Bacteria | 934 |
| 848 | Ga0466964_0088277 | 3300044706 | Bacteria | 1345 |
| 849 | Ga0453684_0057660 | 3300044712 | Bacteria | 5024 |
| 850 | Ga0466970_0107661 | 3300044765 | Bacteria | 1521 |
| 851 | Ga0466957_0062703 | 3300044842 | Bacteria | 2284 |
| 852 | Ga0466959_0149442 | 3300045049 | Bacteria | 1647 |
| 853 | Ga0466967_0838165 | 3300045976 | Bacteria | 913 |
| 854 | Ga0466967_1260624 | 3300045976 | Bacteria | 736 |
| 855 | Ga0495617_037019 | 3300046452 | Bacteria | 1635 |
| 856 | Ga0495592_0033915 | 3300046454 | Bacteria | 3849 |
| 857 | Ga0495592_0127916 | 3300046454 | Bacteria | 1779 |
| 858 | Ga0495603_0015303 | 3300046455 | Bacteria | 4641 |
| 859 | Ga0495603_0036252 | 3300046455 | Bacteria | 2961 |
| 860 | Ga0495603_0039904 | 3300046455 | Bacteria | 2811 |
| 861 | Ga0495603_0053664 | 3300046455 | Bacteria | 2391 |
| 862 | Ga0495603_0116164 | 3300046455 | Bacteria | 1560 |
| 863 | Ga0495603_0127432 | 3300046455 | Bacteria | 1483 |
| 864 | Ga0495590_0080715 | 3300046457 | Bacteria | 1146 |
| 865 | Ga0495590_0151116 | 3300046457 | Bacteria | 842 |
| 866 | Ga0495629_0001243 | 3300046459 | Bacteria | 20022 |
| 867 | Ga0495629_0012109 | 3300046459 | Bacteria | 6253 |
| 868 | Ga0495629_0044686 | 3300046459 | Bacteria | 3109 |
| 869 | Ga0495629_0152799 | 3300046459 | Bacteria | 1604 |
| 870 | Ga0495629_0261096 | 3300046459 | Bacteria | 1191 |
| 871 | Ga0495638_0015230 | 3300046460 | Bacteria | 5169 |
| 872 | Ga0495641_0004926 | 3300046461 | Bacteria | 9243 |
| 873 | Ga0495641_0062919 | 3300046461 | Bacteria | 1673 |
| 874 | Ga0495641_0153169 | 3300046461 | Bacteria | 1031 |
| 875 | Ga0495641_0242368 | 3300046461 | Bacteria | 810 |
| 876 | Ga0495651_0007131 | 3300046462 | Bacteria | 8547 |
| 877 | Ga0495651_0086681 | 3300046462 | Bacteria | 2355 |
| 878 | Ga0495651_0641549 | 3300046462 | Bacteria | 666 |
| 879 | Ga0495651_0690597 | 3300046462 | Bacteria | 637 |
| 880 | Ga0495653_0011097 | 3300046463 | Bacteria | 7365 |
| 881 | Ga0495650_0132169 | 3300046471 | Bacteria | 909 |
| 882 | Ga0495580_0001284 | 3300046472 | Bacteria | 22130 |
| 883 | Ga0495580_0085993 | 3300046472 | Bacteria | 2190 |
| 884 | Ga0495580_0149952 | 3300046472 | Bacteria | 1615 |
| 885 | Ga0495580_0282542 | 3300046472 | Bacteria | 1132 |
| 886 | Ga0495580_0355421 | 3300046472 | Bacteria | 992 |
| 887 | Ga0495580_0794910 | 3300046472 | Bacteria | 614 |
| 888 | Ga0495582_0000166 | 3300046473 | Bacteria | 35616 |
| 889 | Ga0495582_0031855 | 3300046473 | Bacteria | 2899 |
| 890 | Ga0495582_0423108 | 3300046473 | Bacteria | 769 |
| 891 | Ga0495605_0185320 | 3300046474 | Bacteria | 913 |
| 892 | Ga0495605_0255034 | 3300046474 | Bacteria | 750 |
| 893 | Ga0495639_0001186 | 3300046475 | Bacteria | 11769 |
| 894 | Ga0495639_0021762 | 3300046475 | Bacteria | 2808 |
| 895 | Ga0495639_0124318 | 3300046475 | Bacteria | 1232 |
| 896 | Ga0495639_0137106 | 3300046475 | Bacteria | 1174 |
| 897 | Ga0495639_0182924 | 3300046475 | Bacteria | 1021 |
| 898 | Ga0495662_0000887 | 3300046476 | Bacteria | 14644 |
| 899 | Ga0495662_0027805 | 3300046476 | Bacteria | 2732 |
| 900 | Ga0495664_0003804 | 3300046477 | Bacteria | 8233 |
| 901 | Ga0495664_0071918 | 3300046477 | Bacteria | 2066 |
| 902 | Ga0495664_0081855 | 3300046477 | Bacteria | 1935 |
| 903 | Ga0495584_0100895 | 3300046491 | Bacteria | 1459 |
| 904 | Ga0495584_0467286 | 3300046491 | Bacteria | 642 |
| 905 | Ga0495584_0590203 | 3300046491 | Bacteria | 566 |
| 906 | Ga0495585_0064003 | 3300046492 | Bacteria | 2017 |
| 907 | Ga0495585_0066562 | 3300046492 | Bacteria | 1972 |
| 908 | Ga0495594_0000692 | 3300046499 | Bacteria | 17377 |
| 909 | Ga0495594_0173126 | 3300046499 | Bacteria | 1228 |
| 910 | Ga0495594_0266004 | 3300046499 | Bacteria | 977 |
| 911 | Ga0495596_0066003 | 3300046500 | Bacteria | 1407 |
| 912 | Ga0495596_0228539 | 3300046500 | Bacteria | 722 |
| 913 | Ga0495607_0182075 | 3300046501 | Bacteria | 1053 |
| 914 | Ga0495583_0177577 | 3300046506 | Bacteria | 873 |
| 915 | Ga0495606_0000939 | 3300046507 | Bacteria | 42966 |
| 916 | Ga0495606_0133935 | 3300046507 | Bacteria | 1470 |
| 917 | Ga0495606_0221452 | 3300046507 | Bacteria | 1066 |
| 918 | Ga0495606_0394206 | 3300046507 | Bacteria | 723 |
| 919 | Ga0495608_0140480 | 3300046511 | Bacteria | 1542 |
| 920 | Ga0495608_0565267 | 3300046511 | Bacteria | 684 |
| 921 | Ga0495616_0349604 | 3300046513 | Bacteria | 616 |
| 922 | Ga0495618_0011851 | 3300046514 | Bacteria | 5291 |
| 923 | Ga0495618_0063817 | 3300046514 | Bacteria | 2340 |
| 924 | Ga0495620_0073085 | 3300046515 | Bacteria | 1399 |
| 925 | Ga0495620_0113333 | 3300046515 | Bacteria | 1073 |
| 926 | Ga0495628_0074488 | 3300046516 | Bacteria | 2644 |
| 927 | Ga0495628_0405478 | 3300046516 | Bacteria | 995 |
| 928 | Ga0495630_0007555 | 3300046517 | Bacteria | 7770 |
| 929 | Ga0495630_0021452 | 3300046517 | Bacteria | 4769 |
| 930 | Ga0495630_0256802 | 3300046517 | Bacteria | 1335 |
| 931 | Ga0495630_0851161 | 3300046517 | Bacteria | 695 |
| 932 | Ga0495631_0056972 | 3300046518 | Bacteria | 1701 |
| 933 | Ga0495631_0385414 | 3300046518 | Bacteria | 597 |
| 934 | Ga0495637_0217915 | 3300046520 | Bacteria | 696 |
| 935 | Ga0495643_0229534 | 3300046522 | Bacteria | 876 |
| 936 | Ga0495644_0027751 | 3300046523 | Bacteria | 2144 |
| 937 | Ga0495648_0315100 | 3300046524 | Bacteria | 727 |
| 938 | Ga0495666_0009552 | 3300046526 | Bacteria | 4847 |
| 939 | Ga0495666_0027403 | 3300046526 | Bacteria | 2804 |
| 940 | Ga0495642_0076392 | 3300046528 | Bacteria | 1406 |
| 941 | Ga0495652_0070679 | 3300046529 | Bacteria | 2916 |
| 942 | Ga0495652_0204026 | 3300046529 | Bacteria | 1498 |
| 943 | Ga0495652_0299249 | 3300046529 | Bacteria | 1170 |
| 944 | Ga0495652_1109266 | 3300046529 | Bacteria | 513 |
| 945 | Ga0495665_0000104 | 3300046531 | Bacteria | 39624 |
| 946 | Ga0495665_0196497 | 3300046531 | Bacteria | 1046 |
| 947 | Ga0495665_0438462 | 3300046531 | Bacteria | 661 |
| 948 | Ga0495665_0620360 | 3300046531 | Bacteria | 540 |
| 949 | Ga0495640_0006908 | 3300046533 | Bacteria | 8939 |
| 950 | Ga0495640_0008638 | 3300046533 | Bacteria | 7984 |
| 951 | Ga0495586_0160223 | 3300046535 | Bacteria | 1269 |
| 952 | Ga0495587_0003522 | 3300046536 | Bacteria | 10425 |
| 953 | Ga0495598_0060743 | 3300046537 | Bacteria | 1165 |
| 954 | Ga0495609_0100951 | 3300046538 | Bacteria | 1250 |
| 955 | Ga0495609_0222961 | 3300046538 | Bacteria | 782 |
| 956 | Ga0495597_0174386 | 3300046542 | Bacteria | 871 |
| 957 | Ga0495645_0034120 | 3300046543 | Bacteria | 3713 |
| 958 | Ga0495645_0452616 | 3300046543 | Bacteria | 809 |
| 959 | Ga0495622_0040003 | 3300046557 | Bacteria | 2183 |
| 960 | Ga0495622_0064799 | 3300046557 | Bacteria | 1690 |
| 961 | Ga0495622_0072642 | 3300046557 | Bacteria | 1587 |
| 962 | Ga0495622_0091511 | 3300046557 | Bacteria | 1397 |
| 963 | Ga0495656_0019569 | 3300046615 | Bacteria | 2614 |
| 964 | Ga0495656_0037417 | 3300046615 | Bacteria | 2004 |
| 965 | Ga0495656_0105143 | 3300046615 | Bacteria | 1312 |
| 966 | Ga0495656_0340495 | 3300046615 | Bacteria | 775 |
| 967 | Ga0495668_0045553 | 3300046616 | Bacteria | 2439 |
| 968 | Ga0495668_0302103 | 3300046616 | Bacteria | 877 |
| 969 | Ga0495668_0339777 | 3300046616 | Bacteria | 824 |
| 970 | Ga0495634_0004417 | 3300046642 | Bacteria | 11047 |
| 971 | Ga0495634_0018689 | 3300046642 | Bacteria | 4931 |
| 972 | Ga0495634_0045434 | 3300046642 | Bacteria | 2969 |
| 973 | Ga0495611_0027449 | 3300046648 | Bacteria | 2488 |
| 974 | Ga0495611_0061366 | 3300046648 | Bacteria | 1709 |
| 975 | Ga0495611_0178178 | 3300046648 | Bacteria | 993 |
| 976 | Ga0495625_0275271 | 3300046660 | Bacteria | 1085 |
| 977 | Ga0495625_0353919 | 3300046660 | Bacteria | 927 |
| 978 | Ga0495625_0415652 | 3300046660 | Bacteria | 837 |
| 979 | Ga0495635_0001205 | 3300046663 | Bacteria | 17261 |
| 980 | Ga0495635_0008253 | 3300046663 | Bacteria | 7268 |
| 981 | Ga0495635_0199189 | 3300046663 | Bacteria | 1358 |
| 982 | Ga0495635_0240697 | 3300046663 | Bacteria | 1221 |
| 983 | Ga0495659_0012710 | 3300046664 | Bacteria | 2732 |
| 984 | Ga0495659_0239144 | 3300046664 | Bacteria | 754 |
| 985 | Ga0495661_0314960 | 3300046665 | Bacteria | 779 |
| 986 | Ga0495588_0038217 | 3300046674 | Bacteria | 2441 |
| 987 | Ga0495588_0590551 | 3300046674 | Bacteria | 582 |
| 988 | Ga0495657_0009562 | 3300046675 | Bacteria | 7344 |
| 989 | Ga0495599_0000673 | 3300046678 | Bacteria | 19348 |
| 990 | Ga0495599_0299464 | 3300046678 | Bacteria | 971 |
| 991 | Ga0495599_0762684 | 3300046678 | Bacteria | 554 |
| 992 | Ga0495623_0101404 | 3300046679 | Bacteria | 1753 |
| 993 | Ga0495623_0296622 | 3300046679 | Bacteria | 895 |
| 994 | Ga0495646_0002999 | 3300046680 | Bacteria | 10471 |
| 995 | Ga0495646_0003385 | 3300046680 | Bacteria | 9913 |
| 996 | Ga0495646_0112349 | 3300046680 | Bacteria | 1550 |
| 997 | Ga0495647_0005695 | 3300046681 | Bacteria | 4095 |
| 998 | Ga0495647_0070261 | 3300046681 | Bacteria | 1400 |
| 999 | Ga0495647_0272558 | 3300046681 | Bacteria | 758 |
| 1000 | Ga0495658_0002138 | 3300046683 | Bacteria | 10005 |
| 1001 | Ga0495658_0006603 | 3300046683 | Bacteria | 5700 |
| 1002 | Ga0495658_0179652 | 3300046683 | Bacteria | 1313 |
| 1003 | Ga0495658_0256238 | 3300046683 | Bacteria | 1101 |
| 1004 | Ga0495669_0022881 | 3300046684 | Bacteria | 2716 |
| 1005 | Ga0495669_0037766 | 3300046684 | Bacteria | 2138 |
| 1006 | Ga0495669_0216925 | 3300046684 | Bacteria | 917 |
| 1007 | Ga0495669_0256870 | 3300046684 | Bacteria | 839 |
| 1008 | Ga0495669_0412982 | 3300046684 | Bacteria | 654 |
| 1009 | Ga0495613_0018203 | 3300046689 | Bacteria | 5238 |
| 1010 | Ga0495613_0025996 | 3300046689 | Bacteria | 4361 |
| 1011 | Ga0495613_0051891 | 3300046689 | Bacteria | 3022 |
| 1012 | Ga0495613_0090693 | 3300046689 | Bacteria | 2214 |
| 1013 | Ga0495624_0002866 | 3300046690 | Bacteria | 12914 |
| 1014 | Ga0495624_0194679 | 3300046690 | Bacteria | 1232 |
| 1015 | Ga0495624_0400748 | 3300046690 | Bacteria | 824 |
| 1016 | Ga0495624_0403886 | 3300046690 | Bacteria | 820 |
| 1017 | Ga0495624_0461862 | 3300046690 | Bacteria | 760 |
| 1018 | Ga0495671_0432509 | 3300046692 | Bacteria | 629 |
| 1019 | Ga0495589_0083491 | 3300046794 | Bacteria | 1553 |
| 1020 | Ga0495589_0120484 | 3300046794 | Bacteria | 1263 |
| 1021 | Ga0495600_0007219 | 3300046809 | Bacteria | 6781 |
| 1022 | Ga0495600_0121962 | 3300046809 | Bacteria | 1695 |
| 1023 | Ga0495600_0454079 | 3300046809 | Bacteria | 792 |
| 1024 | Ga0495600_0631648 | 3300046809 | Bacteria | 649 |
| 1025 | Ga0495581_0000391 | 3300047315 | Bacteria | 22000 |
| 1026 | Ga0495581_0027928 | 3300047315 | Bacteria | 3272 |
| 1027 | Ga0495581_0123057 | 3300047315 | Bacteria | 1510 |
| 1028 | Ga0495581_0283999 | 3300047315 | Bacteria | 967 |
| 1029 | Ga0495604_0139733 | 3300047317 | Bacteria | 1731 |
| 1030 | Ga0495604_0193262 | 3300047317 | Bacteria | 1417 |
| 1031 | Ga0495604_0307764 | 3300047317 | Bacteria | 1062 |
| 1032 | Ga0495636_0264687 | 3300047318 | Bacteria | 798 |
| 1033 | Ga0495674_0002721 | 3300047319 | Bacteria | 17181 |
| 1034 | Ga0495674_0017714 | 3300047319 | Bacteria | 6632 |
| 1035 | Ga0495674_0017899 | 3300047319 | Bacteria | 6597 |
| 1036 | Ga0495674_0235436 | 3300047319 | Bacteria | 1510 |
| 1037 | Ga0495672_0025901 | 3300047320 | Bacteria | 3749 |
| 1038 | Ga0495672_0034475 | 3300047320 | Bacteria | 3127 |
| 1039 | Ga0495676_0007448 | 3300047321 | Bacteria | 10042 |
| 1040 | Ga0495676_0411718 | 3300047321 | Bacteria | 896 |
| 1041 | Ga0495680_0008673 | 3300047322 | Bacteria | 9225 |
| 1042 | Ga0495680_0482529 | 3300047322 | Bacteria | 844 |
| 1043 | Ga0495683_0305327 | 3300047323 | Bacteria | 682 |
| 1044 | Ga0495677_0067499 | 3300047445 | Bacteria | 1331 |
| 1045 | Ga0495679_042227 | 3300047446 | Bacteria | 1408 |
| 1046 | Ga0495685_138946 | 3300047447 | Bacteria | 792 |
| 1047 | Ga0495673_0019681 | 3300047469 | Bacteria | 3379 |
| 1048 | Ga0495684_0001891 | 3300047471 | Bacteria | 16776 |
| 1049 | Ga0495684_0019909 | 3300047471 | Bacteria | 5171 |
| 1050 | Ga0495684_0298594 | 3300047471 | Bacteria | 1157 |
| 1051 | Ga0495686_0357552 | 3300047472 | Bacteria | 792 |
| 1052 | Ga0495686_0485115 | 3300047472 | Bacteria | 653 |
| 1053 | Ga0495593_0000180 | 3300047673 | Bacteria | 32786 |
| 1054 | Ga0495593_0010159 | 3300047673 | Bacteria | 5447 |
| 1055 | Ga0495593_0065947 | 3300047673 | Bacteria | 1887 |
| 1056 | Ga0495593_0549964 | 3300047673 | Bacteria | 579 |
| 1057 | Ga0495593_0609991 | 3300047673 | Bacteria | 548 |
| 1058 | Ga0495602_0473934 | 3300048088 | Bacteria | 879 |
| 1059 | Ga0495602_0538584 | 3300048088 | Bacteria | 811 |
| 1060 | Ga0495602_0742213 | 3300048088 | Bacteria | 663 |
| 1061 | Ga0496100_0012270 | 3300048903 | Bacteria | 4907 |
| 1062 | Ga0496100_0136693 | 3300048903 | Bacteria | 1732 |
| 1063 | Ga0496100_0150574 | 3300048903 | Bacteria | 1659 |
| 1064 | Ga0496100_0742383 | 3300048903 | Bacteria | 767 |
| 1065 | Ga0496100_0971189 | 3300048903 | Bacteria | 668 |
| 1066 | Ga0496101_0005995 | 3300048904 | Bacteria | 7793 |
| 1067 | Ga0496101_0032497 | 3300048904 | Bacteria | 3674 |
| 1068 | Ga0496101_0082969 | 3300048904 | Bacteria | 2372 |
| 1069 | Ga0496101_0434221 | 3300048904 | Bacteria | 1036 |
| 1070 | Ga0496101_0565000 | 3300048904 | Bacteria | 899 |
| 1071 | Ga0496101_0745524 | 3300048904 | Bacteria | 773 |
| 1072 | Ga0496102_0001773 | 3300048905 | Bacteria | 18732 |
| 1073 | Ga0496102_0068054 | 3300048905 | Bacteria | 3267 |
| 1074 | Ga0496102_0084900 | 3300048905 | Bacteria | 2923 |
| 1075 | Ga0496102_0138305 | 3300048905 | Bacteria | 2282 |
| 1076 | Ga0496102_0152079 | 3300048905 | Bacteria | 2175 |
| 1077 | Ga0496102_0183964 | 3300048905 | Bacteria | 1969 |
| 1078 | Ga0496102_0727129 | 3300048905 | Bacteria | 915 |
| 1079 | Ga0496102_0967551 | 3300048905 | Bacteria | 772 |
| 1080 | Ga0496103_0015686 | 3300048906 | Bacteria | 4516 |
| 1081 | Ga0496103_0129438 | 3300048906 | Bacteria | 1611 |
| 1082 | Ga0496103_0513245 | 3300048906 | Bacteria | 766 |
| 1083 | Ga0496103_0553048 | 3300048906 | Bacteria | 735 |
| 1084 | Ga0496104_0023762 | 3300048907 | Bacteria | 5636 |
| 1085 | Ga0496104_0209282 | 3300048907 | Bacteria | 1862 |
| 1086 | Ga0496104_0309445 | 3300048907 | Bacteria | 1492 |
| 1087 | Ga0496104_0356795 | 3300048907 | Bacteria | 1374 |
| 1088 | Ga0496104_0385952 | 3300048907 | Bacteria | 1313 |
| 1089 | Ga0496104_0442951 | 3300048907 | Bacteria | 1211 |
| 1090 | Ga0496104_1559642 | 3300048907 | Bacteria | 563 |
| 1091 | Ga0496105_0032232 | 3300048908 | Bacteria | 4299 |
| 1092 | Ga0496105_0080378 | 3300048908 | Bacteria | 2692 |
| 1093 | Ga0496105_0138424 | 3300048908 | Bacteria | 2004 |
| 1094 | Ga0496105_0176526 | 3300048908 | Bacteria | 1750 |
| 1095 | Ga0496105_0985179 | 3300048908 | Bacteria | 631 |
| 1096 | Ga0496106_0006597 | 3300048909 | Bacteria | 8591 |
| 1097 | Ga0496106_0035076 | 3300048909 | Bacteria | 3749 |
| 1098 | Ga0496106_0064146 | 3300048909 | Bacteria | 2794 |
| 1099 | Ga0496106_0137608 | 3300048909 | Bacteria | 1919 |
| 1100 | Ga0496106_0334597 | 3300048909 | Bacteria | 1216 |
| 1101 | Ga0496106_0358600 | 3300048909 | Bacteria | 1171 |
| 1102 | Ga0496106_0602940 | 3300048909 | Bacteria | 879 |
| 1103 | Ga0496106_1119527 | 3300048909 | Bacteria | 616 |
| 1104 | Ga0496107_0008230 | 3300048910 | Bacteria | 7214 |
| 1105 | Ga0496107_0015115 | 3300048910 | Bacteria | 5407 |
| 1106 | Ga0496107_0141467 | 3300048910 | Bacteria | 1778 |
| 1107 | Ga0496107_0318792 | 3300048910 | Bacteria | 1157 |
| 1108 | Ga0496107_0484829 | 3300048910 | Bacteria | 917 |
| 1109 | Ga0496107_0705796 | 3300048910 | Bacteria | 742 |
| 1110 | Ga0496108_0146822 | 3300048911 | Bacteria | 2034 |
| 1111 | Ga0496108_0154186 | 3300048911 | Bacteria | 1983 |
| 1112 | Ga0496108_0196399 | 3300048911 | Bacteria | 1750 |
| 1113 | Ga0496108_0469433 | 3300048911 | Bacteria | 1099 |
| 1114 | Ga0496108_0557672 | 3300048911 | Bacteria | 999 |
| 1115 | Ga0496108_0579652 | 3300048911 | Bacteria | 978 |
| 1116 | Ga0496108_0725204 | 3300048911 | Bacteria | 861 |
| 1117 | Ga0496109_0028952 | 3300048912 | Bacteria | 4959 |
| 1118 | Ga0496109_0051059 | 3300048912 | Bacteria | 3766 |
| 1119 | Ga0496109_0146281 | 3300048912 | Bacteria | 2211 |
| 1120 | Ga0496109_0679986 | 3300048912 | Bacteria | 966 |
| 1121 | Ga0496109_0790578 | 3300048912 | Bacteria | 887 |
| 1122 | Ga0496109_0799271 | 3300048912 | Bacteria | 881 |
| 1123 | Ga0496110_0027369 | 3300048913 | Bacteria | 4888 |
| 1124 | Ga0496110_0046887 | 3300048913 | Bacteria | 3781 |
| 1125 | Ga0496110_0164782 | 3300048913 | Bacteria | 2010 |
| 1126 | Ga0496110_0334107 | 3300048913 | Bacteria | 1380 |
| 1127 | Ga0496110_0615742 | 3300048913 | Bacteria | 984 |
| 1128 | Ga0496111_0039133 | 3300048914 | Bacteria | 3399 |
| 1129 | Ga0496111_0041641 | 3300048914 | Bacteria | 3297 |
| 1130 | Ga0496111_0047722 | 3300048914 | Bacteria | 3084 |
| 1131 | Ga0496111_0063998 | 3300048914 | Bacteria | 2668 |
| 1132 | Ga0496111_0104351 | 3300048914 | Bacteria | 2085 |
| 1133 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 1134 | Ga0496112_0033990 | 3300048915 | Bacteria | 4960 |
| 1135 | Ga0496112_0055956 | 3300048915 | Bacteria | 3881 |
| 1136 | Ga0496112_0120658 | 3300048915 | Bacteria | 2591 |
| 1137 | Ga0496112_0290937 | 3300048915 | Bacteria | 1579 |
| 1138 | Ga0496112_0353035 | 3300048915 | Bacteria | 1413 |
| 1139 | Ga0496112_0357056 | 3300048915 | Bacteria | 1404 |
| 1140 | Ga0496113_0000807 | 3300048916 | Bacteria | 16247 |
| 1141 | Ga0496113_0018950 | 3300048916 | Bacteria | 4804 |
| 1142 | Ga0496113_0072749 | 3300048916 | Bacteria | 2617 |
| 1143 | Ga0496113_0429768 | 3300048916 | Bacteria | 1061 |
| 1144 | Ga0496113_0469984 | 3300048916 | Bacteria | 1010 |
| 1145 | Ga0496113_0683672 | 3300048916 | Bacteria | 820 |
| 1146 | Ga0496113_0773826 | 3300048916 | Bacteria | 763 |
| 1147 | Ga0496113_0909668 | 3300048916 | Bacteria | 696 |
| 1148 | Ga0496114_0050365 | 3300048917 | Bacteria | 3466 |
| 1149 | Ga0496114_0073391 | 3300048917 | Bacteria | 2879 |
| 1150 | Ga0496114_0124263 | 3300048917 | Bacteria | 2222 |
| 1151 | Ga0496114_1158739 | 3300048917 | Bacteria | 659 |
| 1152 | Ga0496115_0001360 | 3300048918 | Bacteria | 17447 |
| 1153 | Ga0496115_0009296 | 3300048918 | Bacteria | 7305 |
| 1154 | Ga0496115_0033069 | 3300048918 | Bacteria | 4082 |
| 1155 | Ga0496115_0133276 | 3300048918 | Bacteria | 2048 |
| 1156 | Ga0496115_0191841 | 3300048918 | Bacteria | 1688 |
| 1157 | Ga0496115_0203602 | 3300048918 | Bacteria | 1635 |
| 1158 | Ga0496115_0262435 | 3300048918 | Bacteria | 1420 |
| 1159 | Ga0496115_0464273 | 3300048918 | Bacteria | 1021 |
| 1160 | Ga0496117_0038054 | 3300048920 | Bacteria | 3574 |
| 1161 | Ga0496117_0102516 | 3300048920 | Bacteria | 1806 |
| 1162 | Ga0496118_0054264 | 3300048921 | Bacteria | 3037 |
| 1163 | Ga0496119_0219518 | 3300048922 | Bacteria | 974 |
| 1164 | Ga0496120_0305628 | 3300048923 | Bacteria | 727 |
| 1165 | Ga0496121_0000365 | 3300048924 | Bacteria | 92822 |
| 1166 | Ga0496121_0018687 | 3300048924 | Bacteria | 6976 |
| 1167 | Ga0496121_0031262 | 3300048924 | Bacteria | 4866 |
| 1168 | Ga0496121_0057162 | 3300048924 | Bacteria | 3235 |
| 1169 | Ga0496121_0091621 | 3300048924 | Bacteria | 2373 |
| 1170 | Ga0496121_0125113 | 3300048924 | Bacteria | 1934 |
| 1171 | Ga0496121_0145875 | 3300048924 | Bacteria | 1749 |
| 1172 | Ga0496121_0362348 | 3300048924 | Bacteria | 962 |
| 1173 | Ga0496121_0389533 | 3300048924 | Bacteria | 916 |
| 1174 | Ga0496121_0424582 | 3300048924 | Bacteria | 864 |
| 1175 | Ga0496121_0652824 | 3300048924 | Bacteria | 640 |
| 1176 | Ga0496124_0008072 | 3300048927 | Bacteria | 11068 |
| 1177 | Ga0496125_0121266 | 3300048928 | Bacteria | 1865 |
| 1178 | Ga0496125_0315756 | 3300048928 | Bacteria | 950 |
| 1179 | Ga0496126_0000483 | 3300048929 | Bacteria | 78885 |
| 1180 | Ga0496126_0002146 | 3300048929 | Bacteria | 27491 |
| 1181 | Ga0496126_0009701 | 3300048929 | Bacteria | 10197 |
| 1182 | Ga0496126_0027923 | 3300048929 | Bacteria | 5382 |
| 1183 | Ga0496126_0036970 | 3300048929 | Bacteria | 4561 |
| 1184 | Ga0496126_0104306 | 3300048929 | Bacteria | 2477 |
| 1185 | Ga0496126_0221971 | 3300048929 | Bacteria | 1587 |
| 1186 | Ga0496126_0222017 | 3300048929 | Bacteria | 1587 |
| 1187 | Ga0496126_0910664 | 3300048929 | Bacteria | 666 |
| 1188 | Ga0501046_0074602 | 3300049580 | Bacteria | 2632 |
| 1189 | Ga0501047_0124858 | 3300049581 | Bacteria | 2454 |
| 1190 | Ga0501047_0256777 | 3300049581 | Bacteria | 1596 |
| 1191 | Ga0501067_0643987 | 3300049583 | Bacteria | 595 |
| 1192 | Ga0501069_0199298 | 3300049585 | Bacteria | 1160 |
| 1193 | Ga0501070_0040505 | 3300049586 | Bacteria | 3884 |
| 1194 | Ga0501073_0072930 | 3300049589 | Bacteria | 2391 |
| 1195 | Ga0501074_0031172 | 3300049590 | Bacteria | 3863 |
| 1196 | Ga0501257_208515 | 3300049686 | Bacteria | 565 |
| 1197 | Ga0501080_0002786 | 3300049742 | Bacteria | 15345 |
| 1198 | Ga0501044_0143390 | 3300049823 | Bacteria | 2376 |
| 1199 | Ga0501045_0252455 | 3300049824 | Bacteria | 1313 |
| 1200 | nmdc:mga03683_281711_c1 | 3300050489 | Bacteria | 777 |
| 1201 | nmdc:mga03683_3240_c1 | 3300050489 | Bacteria | 5213 |
| 1202 | nmdc:mga03683_368666_c1 | 3300050489 | Bacteria | 682 |
| 1203 | nmdc:mga03683_85452_c1 | 3300050489 | Bacteria | 1368 |
| 1204 | nmdc:mga03n38_216364_c1 | 3300050490 | Bacteria | 998 |
| 1205 | nmdc:mga03n38_46_c2 | 3300050490 | Bacteria | 15402 |
| 1206 | nmdc:mga03n38_86131_c1 | 3300050490 | Bacteria | 1486 |
| 1207 | nmdc:mga03n38_982484_c1 | 3300050490 | Bacteria | 500 |
| 1208 | nmdc:mga00v17_528839_c1 | 3300050491 | Bacteria | 763 |
| 1209 | nmdc:mga0yw44_17722_c1 | 3300050492 | Bacteria | 3883 |
| 1210 | nmdc:mga0yw44_17809_c1 | 3300050492 | Bacteria | 3556 |
| 1211 | nmdc:mga0yw44_319403_c1 | 3300050492 | Bacteria | 1042 |
| 1212 | nmdc:mga0yw44_367800_c1 | 3300050492 | Bacteria | 970 |
| 1213 | nmdc:mga0yw44_521170_c1 | 3300050492 | Bacteria | 807 |
| 1214 | nmdc:mga0k408_390542_c1 | 3300050493 | Bacteria | 829 |
| 1215 | nmdc:mga0k408_408114_c1 | 3300050493 | Bacteria | 808 |
| 1216 | nmdc:mga0k408_685693_c1 | 3300050493 | Bacteria | 601 |
| 1217 | nmdc:mga0k408_699396_c1 | 3300050493 | Bacteria | 594 |
| 1218 | nmdc:mga06z11_258422_c1 | 3300050494 | Bacteria | 1027 |
| 1219 | nmdc:mga06z11_264442_c1 | 3300050494 | Bacteria | 1016 |
| 1220 | nmdc:mga06z11_367178_c1 | 3300050494 | Bacteria | 863 |
| 1221 | nmdc:mga06z11_39880_c1 | 3300050494 | Bacteria | 2340 |
| 1222 | nmdc:mga04h51_165031_c1 | 3300050495 | Bacteria | 854 |
| 1223 | nmdc:mga04h51_217474_c1 | 3300050495 | Bacteria | 756 |
| 1224 | nmdc:mga07m45_319458_c1 | 3300050496 | Bacteria | 903 |
| 1225 | nmdc:mga07m45_473359_c1 | 3300050496 | Bacteria | 726 |
| 1226 | nmdc:mga07m45_49471_c1 | 3300050496 | Bacteria | 2366 |
| 1227 | nmdc:mga07m45_7364_c1 | 3300050496 | Bacteria | 5620 |
| 1228 | nmdc:mga05p37_950515_c1 | 3300050507 | Bacteria | 920 |
| 1229 | nmdc:mga08y16_1263167_c1 | 3300050511 | Bacteria | 707 |
| 1230 | nmdc:mga08y16_490127_c1 | 3300050511 | Bacteria | 1250 |
| 1231 | nmdc:mga08y16_712514_c1 | 3300050511 | Bacteria | 1002 |
| 1232 | nmdc:mga0n895_3688_c1 | 3300050512 | Bacteria | 12376 |
| 1233 | nmdc:mga0rr50_164437_c1 | 3300050513 | Bacteria | 1803 |
| 1234 | nmdc:mga0rr50_573382_c1 | 3300050513 | Bacteria | 961 |
| 1235 | nmdc:mga08x19_427671_c1 | 3300050514 | Bacteria | 930 |
| 1236 | nmdc:mga0a205_657650_c1 | 3300050515 | Bacteria | 899 |
| 1237 | Ga0495601_0063657 | 3300053077 | Bacteria | 2344 |
| 1238 | Ga0495601_0391578 | 3300053077 | Bacteria | 901 |
| 1239 | Ga0495601_0685458 | 3300053077 | Bacteria | 654 |
| 1240 | Ga0495612_0142454 | 3300053078 | Bacteria | 1040 |
| 1241 | Ga0495612_0264823 | 3300053078 | Bacteria | 766 |
| 1242 | Ga0500610_0196747 | 3300053079 | Bacteria | 975 |
| 1243 | Ga0500635_0085889 | 3300053080 | Bacteria | 1137 |
| 1244 | Ga0495655_0135701 | 3300053083 | Bacteria | 762 |
| 1245 | Ga0495595_0004220 | 3300053084 | Bacteria | 5777 |
| 1246 | Ga0495595_0005357 | 3300053084 | Bacteria | 5193 |
| 1247 | Ga0495619_0006724 | 3300053085 | Bacteria | 7274 |
| 1248 | Ga0495619_0102371 | 3300053085 | Bacteria | 1950 |
| 1249 | Ga0495619_0185770 | 3300053085 | Bacteria | 1438 |
| 1250 | Ga0495619_0800022 | 3300053085 | Bacteria | 638 |
| 1251 | Ga0500578_0465841 | 3300053086 | Bacteria | 717 |
| 1252 | Ga0500643_057151 | 3300053087 | Bacteria | 1102 |
| 1253 | Ga0500646_0244868 | 3300053090 | Bacteria | 629 |
| 1254 | Ga0500647_0183288 | 3300053091 | Bacteria | 959 |
| 1255 | Ga0500647_0221418 | 3300053091 | Bacteria | 847 |
| 1256 | Ga0500583_0045097 | 3300053092 | Bacteria | 2022 |
| 1257 | Ga0500566_0000122 | 3300053094 | Bacteria | 40534 |
| 1258 | Ga0500566_0024142 | 3300053094 | Bacteria | 3571 |
| 1259 | Ga0500566_0165900 | 3300053094 | Bacteria | 1146 |
| 1260 | Ga0500566_0205436 | 3300053094 | Bacteria | 991 |
| 1261 | Ga0500640_008021 | 3300053095 | Bacteria | 4150 |
| 1262 | Ga0500641_0047587 | 3300053096 | Bacteria | 1754 |
| 1263 | Ga0500641_0061416 | 3300053096 | Bacteria | 1565 |
| 1264 | Ga0500648_158071 | 3300053097 | Bacteria | 1196 |
| 1265 | Ga0500554_000582 | 3300053102 | Bacteria | 7454 |
| 1266 | Ga0500554_004983 | 3300053102 | Bacteria | 2861 |
| 1267 | Ga0500562_141756 | 3300053108 | Bacteria | 655 |
| 1268 | Ga0500572_000053 | 3300053111 | Bacteria | 34807 |
| 1269 | Ga0500580_148560 | 3300053113 | Bacteria | 849 |
| 1270 | Ga0500594_0094413 | 3300053118 | Bacteria | 912 |
| 1271 | Ga0500595_002485 | 3300053119 | Bacteria | 9121 |
| 1272 | Ga0500595_018947 | 3300053119 | Bacteria | 2506 |
| 1273 | Ga0500595_019042 | 3300053119 | Bacteria | 2497 |
| 1274 | Ga0500595_152212 | 3300053119 | Bacteria | 646 |
| 1275 | Ga0500608_024872 | 3300053122 | Bacteria | 2799 |
| 1276 | Ga0500621_185844 | 3300053126 | Bacteria | 749 |
| 1277 | Ga0500655_007445 | 3300053133 | Bacteria | 1970 |
| 1278 | Ga0500658_0141496 | 3300053134 | Bacteria | 1079 |
| 1279 | Ga0500559_0001445 | 3300053136 | Bacteria | 13484 |
| 1280 | Ga0500559_0065370 | 3300053136 | Bacteria | 1629 |
| 1281 | Ga0500568_0011478 | 3300053139 | Bacteria | 4108 |
| 1282 | Ga0500568_0081886 | 3300053139 | Bacteria | 1225 |
| 1283 | Ga0500573_0039597 | 3300053140 | Bacteria | 2722 |
| 1284 | Ga0500585_168518 | 3300053144 | Bacteria | 752 |
| 1285 | Ga0500589_066930 | 3300053147 | Bacteria | 1633 |
| 1286 | Ga0500589_096267 | 3300053147 | Bacteria | 1294 |
| 1287 | Ga0500590_079068 | 3300053148 | Bacteria | 1619 |
| 1288 | Ga0500590_192021 | 3300053148 | Bacteria | 874 |
| 1289 | Ga0500603_000341 | 3300053150 | Bacteria | 12188 |
| 1290 | Ga0500603_001366 | 3300053150 | Bacteria | 5572 |
| 1291 | Ga0500603_246965 | 3300053150 | Bacteria | 573 |
| 1292 | Ga0500627_0116618 | 3300053158 | Bacteria | 1203 |
| 1293 | Ga0500630_003299 | 3300053159 | Bacteria | 7821 |
| 1294 | Ga0500633_0133672 | 3300053160 | Bacteria | 927 |
| 1295 | Ga0500634_0112173 | 3300053161 | Bacteria | 1343 |
| 1296 | Ga0500638_001838 | 3300053162 | Bacteria | 7001 |
| 1297 | Ga0500638_006669 | 3300053162 | Bacteria | 4752 |
| 1298 | Ga0500638_164379 | 3300053162 | Bacteria | 974 |
| 1299 | Ga0500639_000008 | 3300053163 | Bacteria | 143238 |
| 1300 | Ga0500639_054379 | 3300053163 | Bacteria | 2080 |
| 1301 | Ga0500636_0027580 | 3300053177 | Bacteria | 3355 |
| 1302 | Ga0500637_0000070 | 3300053178 | Bacteria | 36880 |
| 1303 | Ga0500637_0001409 | 3300053178 | Bacteria | 10235 |
| 1304 | Ga0500637_0049099 | 3300053178 | Bacteria | 2401 |
| 1305 | Ga0500657_162072 | 3300053728 | Bacteria | 809 |
| 1306 | Ga0500657_175293 | 3300053728 | Bacteria | 753 |
| 1307 | Ga0500609_013392 | 3300053731 | Bacteria | 1110 |
| 1308 | Ga0500596_002311 | 3300053735 | Bacteria | 3773 |
| 1309 | Ga0500596_002931 | 3300053735 | Bacteria | 3305 |
| 1310 | Ga0500587_024005 | 3300053739 | Bacteria | 808 |
| 1311 | Ga0500661_000295 | 3300055283 | Bacteria | 9047 |
| 1312 | Ga0587114_088110 | 3300059655 | Bacteria | 588 |
| 1313 | Ga0466962_0401363 | 3300061719 | Bacteria | 686 |
| 1314 | Ga0530510_0776700 | 3300061734 | Bacteria | 731 |
| 1315 | Ga0530510_1220340 | 3300061734 | Bacteria | 577 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2903748898 | 2903753254 | 125 |
| 2 | 3300037068 | Ga0373925_1751887 | Ga0373925_1751887_46_450 | 133 |
| 3 | 3300005340 | Ga0070689_100002458 | Ga0070689_10000245811 | 137 |
| 4 | 3300025936 | Ga0207670_10001223 | Ga0207670_100012233 | 137 |
| 5 | 3300005328 | Ga0070676_10895108 | Ga0070676_108951082 | 144 |
| 6 | 3300046513 | Ga0495616_0349604 | Ga0495616_0349604_160_594 | 144 |
| 7 | 3300046515 | Ga0495620_0073085 | Ga0495620_0073085_13_447 | 144 |
| 8 | 3300046615 | Ga0495656_0340495 | Ga0495656_0340495_22_456 | 144 |
| 9 | 3300049686 | Ga0501257_208515 | Ga0501257_208515_11_445 | 144 |
| 10 | 3300049824 | Ga0501045_0252455 | Ga0501045_0252455_784_1218 | 144 |
| 11 | 3300053126 | Ga0500621_185844 | Ga0500621_185844_17_451 | 144 |
| 12 | 3300053134 | Ga0500658_0141496 | Ga0500658_0141496_16_450 | 144 |
| 13 | 3300046681 | Ga0495647_0272558 | Ga0495647_0272558_10_450 | 145 |
| 14 | 3300033179 | Ga0307507_10310088 | Ga0307507_103100882 | 149 |
| 15 | 3300048906 | Ga0496103_0513245 | Ga0496103_0513245_118_570 | 149 |
| 16 | 3300009094 | Ga0111539_11578324 | Ga0111539_115783242 | 152 |
| 17 | 3300027907 | Ga0207428_10796907 | Ga0207428_107969072 | 152 |
| 18 | 3300050511 | nmdc:mga08y16_1263167_c1 | nmdc:mga08y16_1263167_c1_206_667 | 152 |
| 19 | 3300031456 | Ga0307513_10052398 | Ga0307513_100523984 | 153 |
| 20 | 3300028379 | Ga0268266_11201458 | Ga0268266_112014581 | 154 |
| 21 | iso_pu_bacteria | 2513237101 | 2513693301 | 154 |
| 22 | iso_pu_bacteria | 2721755755 | 2723848211 | 154 |
| 23 | iso_pu_bacteria | 2791355199 | 2793081994 | 154 |
| 24 | iso_pu_bacteria | 2874604998 | 2874608801 | 154 |
| 25 | iso_pu_bacteria | 2876808645 | 2876813859 | 154 |
| 26 | iso_pu_bacteria | 2879110137 | 2879115470 | 154 |
| 27 | iso_pu_bacteria | 2889033259 | 2889037272 | 154 |
| 28 | iso_pu_bacteria | 2922361189 | 2922361406 | 154 |
| 29 | iso_pu_bacteria | 2922386360 | 2922393022 | 154 |
| 30 | iso_pu_bacteria | 8006964411 | 8006970845 | 154 |
| 31 | iso_pu_bacteria | 8006984368 | 8006985264 | 154 |
| 32 | iso_pu_bacteria | 8006994254 | 8006998583 | 154 |
| 33 | iso_pu_bacteria | 8056673599 | 8056675883 | 154 |
| 34 | 3300053085 | Ga0495619_0102371 | Ga0495619_0102371_577_1068 | 155 |
| 35 | iso_pu_bacteria | 2513237098 | 2513672789 | 155 |
| 36 | iso_pu_bacteria | 2524023210 | 2524471603 | 155 |
| 37 | iso_pu_bacteria | 2524023228 | 2524535865 | 155 |
| 38 | iso_pu_bacteria | 2667528175 | 2671124406 | 155 |
| 39 | iso_pu_bacteria | 2885374607 | 2885377720 | 155 |
| 40 | iso_pu_bacteria | 2885383462 | 2885391563 | 155 |
| 41 | iso_pu_bacteria | 2894772417 | 2894772966 | 155 |
| 42 | iso_pu_bacteria | 2903768456 | 2903776862 | 155 |
| 43 | iso_pu_bacteria | 2904690495 | 2904691509 | 155 |
| 44 | iso_pu_bacteria | 2904699407 | 2904701364 | 155 |
| 45 | iso_pu_bacteria | 2908739725 | 2908744136 | 155 |
| 46 | iso_pu_bacteria | 2908756301 | 2908761678 | 155 |
| 47 | iso_pu_bacteria | 8006933436 | 8006942503 | 155 |
| 48 | iso_pu_bacteria | 8006973647 | 8006982227 | 155 |
| 49 | iso_pu_bacteria | 8056681323 | 8056689049 | 155 |
| 50 | iso_pu_bacteria | 8056689827 | 8056695986 | 155 |
| 51 | 3300003316 | rootH1_10096066 | rootH1_100960663 | 156 |
| 52 | 3300003322 | rootL2_10051549 | rootL2_100515493 | 156 |
| 53 | 3300005548 | Ga0070665_100611798 | Ga0070665_1006117982 | 156 |
| 54 | 3300025924 | Ga0207694_11085778 | Ga0207694_110857782 | 156 |
| 55 | 3300026078 | Ga0207702_10724608 | Ga0207702_107246082 | 156 |
| 56 | 3300028379 | Ga0268266_10315190 | Ga0268266_103151902 | 156 |
| 57 | 3300035116 | Ga0373945_0194375 | Ga0373945_0194375_175_654 | 156 |
| 58 | 3300046455 | Ga0495603_0116164 | Ga0495603_0116164_582_1061 | 156 |
| 59 | 3300046457 | Ga0495590_0151116 | Ga0495590_0151116_159_638 | 156 |
| 60 | 3300046474 | Ga0495605_0255034 | Ga0495605_0255034_178_657 | 156 |
| 61 | 3300046475 | Ga0495639_0137106 | Ga0495639_0137106_241_720 | 156 |
| 62 | 3300046499 | Ga0495594_0173126 | Ga0495594_0173126_378_857 | 156 |
| 63 | 3300046507 | Ga0495606_0394206 | Ga0495606_0394206_20_499 | 156 |
| 64 | 3300046531 | Ga0495665_0196497 | Ga0495665_0196497_172_651 | 156 |
| 65 | 3300046616 | Ga0495668_0045553 | Ga0495668_0045553_740_1219 | 156 |
| 66 | 3300046681 | Ga0495647_0070261 | Ga0495647_0070261_361_840 | 156 |
| 67 | 3300046683 | Ga0495658_0179652 | Ga0495658_0179652_199_678 | 156 |
| 68 | 3300046684 | Ga0495669_0216925 | Ga0495669_0216925_65_544 | 156 |
| 69 | 3300050511 | nmdc:mga08y16_712514_c1 | nmdc:mga08y16_712514_c1_473_946 | 156 |
| 70 | 3300059655 | Ga0587114_088110 | Ga0587114_088110_63_542 | 156 |
| 71 | iso_pu_bacteria | 2513237096 | 2513659322 | 156 |
| 72 | iso_pu_bacteria | 2513237137 | 2513861759 | 156 |
| 73 | iso_pu_bacteria | 2513237145 | 2513921416 | 156 |
| 74 | iso_pu_bacteria | 2517572143 | 2517893734 | 156 |
| 75 | iso_pu_bacteria | 2728368998 | 2728752886 | 156 |
| 76 | iso_pu_bacteria | 2791355197 | 2793070764 | 156 |
| 77 | iso_pu_bacteria | 2906610324 | 2906610612 | 156 |
| 78 | iso_pu_bacteria | 2906635258 | 2906641932 | 156 |
| 79 | iso_pu_bacteria | 2906660503 | 2906666123 | 156 |
| 80 | iso_pu_bacteria | 2922425934 | 2922428712 | 156 |
| 81 | iso_pu_bacteria | 2935630451 | 2935634684 | 156 |
| 82 | iso_pu_bacteria | 2941507105 | 2941509170 | 156 |
| 83 | iso_pu_bacteria | 2941515067 | 2941516999 | 156 |
| 84 | iso_pu_bacteria | 2941523033 | 2941524906 | 156 |
| 85 | iso_pu_bacteria | 3005474847 | 3005478845 | 156 |
| 86 | iso_pu_bacteria | 8019555841 | 8019558264 | 156 |
| 87 | iso_pu_bacteria | 8019565922 | 8019567034 | 156 |
| 88 | 3300005617 | Ga0068859_100000028 | Ga0068859_10000002881 | 157 |
| 89 | 3300005937 | Ga0081455_10076848 | Ga0081455_100768482 | 157 |
| 90 | 3300005985 | Ga0081539_10127058 | Ga0081539_101270582 | 157 |
| 91 | 3300006038 | Ga0075365_10172876 | Ga0075365_101728762 | 157 |
| 92 | 3300006177 | Ga0075362_10002833 | Ga0075362_100028334 | 157 |
| 93 | 3300006931 | Ga0097620_100000028 | Ga0097620_10000002881 | 157 |
| 94 | 3300009101 | Ga0105247_10000988 | Ga0105247_100009886 | 157 |
| 95 | 3300011119 | Ga0105246_10917949 | Ga0105246_109179491 | 157 |
| 96 | 3300021361 | Ga0213872_10340844 | Ga0213872_103408442 | 157 |
| 97 | 3300025934 | Ga0207686_11018575 | Ga0207686_110185752 | 157 |
| 98 | 3300026035 | Ga0207703_11630469 | Ga0207703_116304691 | 157 |
| 99 | 3300031235 | Ga0265330_10046855 | Ga0265330_100468552 | 157 |
| 100 | 3300031247 | Ga0265340_10075050 | Ga0265340_100750502 | 157 |
| 101 | 3300031249 | Ga0265339_10004935 | Ga0265339_100049351 | 157 |
| 102 | 3300031250 | Ga0265331_10099006 | Ga0265331_100990062 | 157 |
| 103 | 3300031901 | Ga0307406_10092079 | Ga0307406_100920793 | 157 |
| 104 | 3300033179 | Ga0307507_10036548 | Ga0307507_100365484 | 157 |
| 105 | 3300039447 | Ga0436361_0114609 | Ga0436361_0114609_725_1201 | 157 |
| 106 | 3300047445 | Ga0495677_0067499 | Ga0495677_0067499_381_863 | 157 |
| 107 | 3300048928 | Ga0496125_0121266 | Ga0496125_0121266_961_1437 | 157 |
| 108 | 3300050489 | nmdc:mga03683_3240_c1 | nmdc:mga03683_3240_c1_3897_4376 | 157 |
| 109 | 3300003215 | JGI25153J46596_10004964 | JGI25153J46596_100049643 | 158 |
| 110 | 3300003659 | JGI25404J52841_10005977 | JGI25404J52841_100059772 | 158 |
| 111 | 3300005327 | Ga0070658_10523972 | Ga0070658_105239722 | 158 |
| 112 | 3300005327 | Ga0070658_11196780 | Ga0070658_111967801 | 158 |
| 113 | 3300005331 | Ga0070670_100679750 | Ga0070670_1006797502 | 158 |
| 114 | 3300005334 | Ga0068869_100275915 | Ga0068869_1002759151 | 158 |
| 115 | 3300005335 | Ga0070666_10155323 | Ga0070666_101553232 | 158 |
| 116 | 3300005335 | Ga0070666_10433589 | Ga0070666_104335892 | 158 |
| 117 | 3300005335 | Ga0070666_11106615 | Ga0070666_111066151 | 158 |
| 118 | 3300005337 | Ga0070682_100104816 | Ga0070682_1001048162 | 158 |
| 119 | 3300005337 | Ga0070682_100887369 | Ga0070682_1008873691 | 158 |
| 120 | 3300005338 | Ga0068868_100047327 | Ga0068868_1000473271 | 158 |
| 121 | 3300005338 | Ga0068868_100807001 | Ga0068868_1008070012 | 158 |
| 122 | 3300005338 | Ga0068868_101009649 | Ga0068868_1010096492 | 158 |
| 123 | 3300005339 | Ga0070660_100197578 | Ga0070660_1001975782 | 158 |
| 124 | 3300005340 | Ga0070689_100090584 | Ga0070689_1000905842 | 158 |
| 125 | 3300005341 | Ga0070691_10262217 | Ga0070691_102622172 | 158 |
| 126 | 3300005344 | Ga0070661_100204859 | Ga0070661_1002048592 | 158 |
| 127 | 3300005347 | Ga0070668_100040084 | Ga0070668_1000400843 | 158 |
| 128 | 3300005347 | Ga0070668_100047147 | Ga0070668_1000471473 | 158 |
| 129 | 3300005347 | Ga0070668_100088409 | Ga0070668_1000884092 | 158 |
| 130 | 3300005347 | Ga0070668_100511776 | Ga0070668_1005117762 | 158 |
| 131 | 3300005347 | Ga0070668_100593062 | Ga0070668_1005930622 | 158 |
| 132 | 3300005347 | Ga0070668_100594096 | Ga0070668_1005940962 | 158 |
| 133 | 3300005347 | Ga0070668_100696650 | Ga0070668_1006966502 | 158 |
| 134 | 3300005347 | Ga0070668_101157946 | Ga0070668_1011579461 | 158 |
| 135 | 3300005353 | Ga0070669_100000514 | Ga0070669_10000051412 | 158 |
| 136 | 3300005353 | Ga0070669_100117540 | Ga0070669_1001175402 | 158 |
| 137 | 3300005354 | Ga0070675_101216544 | Ga0070675_1012165441 | 158 |
| 138 | 3300005355 | Ga0070671_100000067 | Ga0070671_10000006727 | 158 |
| 139 | 3300005355 | Ga0070671_100007781 | Ga0070671_1000077817 | 158 |
| 140 | 3300005355 | Ga0070671_100059926 | Ga0070671_1000599262 | 158 |
| 141 | 3300005355 | Ga0070671_100202729 | Ga0070671_1002027292 | 158 |
| 142 | 3300005355 | Ga0070671_100290042 | Ga0070671_1002900422 | 158 |
| 143 | 3300005355 | Ga0070671_100719657 | Ga0070671_1007196572 | 158 |
| 144 | 3300005356 | Ga0070674_100035366 | Ga0070674_1000353662 | 158 |
| 145 | 3300005356 | Ga0070674_100142635 | Ga0070674_1001426352 | 158 |
| 146 | 3300005365 | Ga0070688_100486508 | Ga0070688_1004865082 | 158 |
| 147 | 3300005367 | Ga0070667_100333628 | Ga0070667_1003336282 | 158 |
| 148 | 3300005367 | Ga0070667_100729876 | Ga0070667_1007298761 | 158 |
| 149 | 3300005406 | Ga0070703_10303195 | Ga0070703_103031951 | 158 |
| 150 | 3300005438 | Ga0070701_10326152 | Ga0070701_103261522 | 158 |
| 151 | 3300005441 | Ga0070700_100362108 | Ga0070700_1003621082 | 158 |
| 152 | 3300005441 | Ga0070700_100690139 | Ga0070700_1006901392 | 158 |
| 153 | 3300005455 | Ga0070663_100004258 | Ga0070663_1000042587 | 158 |
| 154 | 3300005455 | Ga0070663_100165928 | Ga0070663_1001659282 | 158 |
| 155 | 3300005455 | Ga0070663_100486520 | Ga0070663_1004865201 | 158 |
| 156 | 3300005455 | Ga0070663_100909677 | Ga0070663_1009096772 | 158 |
| 157 | 3300005455 | Ga0070663_101250232 | Ga0070663_1012502321 | 158 |
| 158 | 3300005456 | Ga0070678_100222512 | Ga0070678_1002225122 | 158 |
| 159 | 3300005457 | Ga0070662_100102169 | Ga0070662_1001021692 | 158 |
| 160 | 3300005457 | Ga0070662_101404043 | Ga0070662_1014040431 | 158 |
| 161 | 3300005459 | Ga0068867_100133578 | Ga0068867_1001335782 | 158 |
| 162 | 3300005459 | Ga0068867_100781647 | Ga0068867_1007816472 | 158 |
| 163 | 3300005467 | Ga0070706_100686668 | Ga0070706_1006866682 | 158 |
| 164 | 3300005518 | Ga0070699_100499672 | Ga0070699_1004996721 | 158 |
| 165 | 3300005539 | Ga0068853_100714351 | Ga0068853_1007143512 | 158 |
| 166 | 3300005543 | Ga0070672_100234660 | Ga0070672_1002346602 | 158 |
| 167 | 3300005544 | Ga0070686_100030509 | Ga0070686_1000305092 | 158 |
| 168 | 3300005544 | Ga0070686_100282868 | Ga0070686_1002828682 | 158 |
| 169 | 3300005544 | Ga0070686_100824072 | Ga0070686_1008240722 | 158 |
| 170 | 3300005544 | Ga0070686_100948640 | Ga0070686_1009486401 | 158 |
| 171 | 3300005546 | Ga0070696_100225976 | Ga0070696_1002259762 | 158 |
| 172 | 3300005546 | Ga0070696_100550148 | Ga0070696_1005501481 | 158 |
| 173 | 3300005547 | Ga0070693_100042981 | Ga0070693_1000429813 | 158 |
| 174 | 3300005547 | Ga0070693_100220775 | Ga0070693_1002207752 | 158 |
| 175 | 3300005548 | Ga0070665_100057106 | Ga0070665_1000571062 | 158 |
| 176 | 3300005548 | Ga0070665_100069254 | Ga0070665_1000692542 | 158 |
| 177 | 3300005548 | Ga0070665_100171529 | Ga0070665_1001715293 | 158 |
| 178 | 3300005548 | Ga0070665_100636708 | Ga0070665_1006367082 | 158 |
| 179 | 3300005548 | Ga0070665_101002409 | Ga0070665_1010024092 | 158 |
| 180 | 3300005563 | Ga0068855_100000994 | Ga0068855_10000099415 | 158 |
| 181 | 3300005563 | Ga0068855_100023587 | Ga0068855_1000235872 | 158 |
| 182 | 3300005563 | Ga0068855_100286670 | Ga0068855_1002866702 | 158 |
| 183 | 3300005563 | Ga0068855_102075284 | Ga0068855_1020752842 | 158 |
| 184 | 3300005564 | Ga0070664_100346944 | Ga0070664_1003469442 | 158 |
| 185 | 3300005578 | Ga0068854_100565285 | Ga0068854_1005652852 | 158 |
| 186 | 3300005578 | Ga0068854_100985186 | Ga0068854_1009851862 | 158 |
| 187 | 3300005614 | Ga0068856_100627006 | Ga0068856_1006270062 | 158 |
| 188 | 3300005614 | Ga0068856_101718419 | Ga0068856_1017184191 | 158 |
| 189 | 3300005615 | Ga0070702_100298427 | Ga0070702_1002984272 | 158 |
| 190 | 3300005615 | Ga0070702_100350477 | Ga0070702_1003504771 | 158 |
| 191 | 3300005616 | Ga0068852_100067025 | Ga0068852_1000670252 | 158 |
| 192 | 3300005616 | Ga0068852_100242251 | Ga0068852_1002422512 | 158 |
| 193 | 3300005616 | Ga0068852_101016554 | Ga0068852_1010165542 | 158 |
| 194 | 3300005616 | Ga0068852_101209859 | Ga0068852_1012098592 | 158 |
| 195 | 3300005617 | Ga0068859_100007456 | Ga0068859_10000745610 | 158 |
| 196 | 3300005617 | Ga0068859_100063326 | Ga0068859_1000633262 | 158 |
| 197 | 3300005617 | Ga0068859_101696236 | Ga0068859_1016962362 | 158 |
| 198 | 3300005618 | Ga0068864_100029724 | Ga0068864_1000297243 | 158 |
| 199 | 3300005618 | Ga0068864_100144519 | Ga0068864_1001445192 | 158 |
| 200 | 3300005718 | Ga0068866_10420738 | Ga0068866_104207382 | 158 |
| 201 | 3300005719 | Ga0068861_100436972 | Ga0068861_1004369722 | 158 |
| 202 | 3300005719 | Ga0068861_101451533 | Ga0068861_1014515332 | 158 |
| 203 | 3300005841 | Ga0068863_100023157 | Ga0068863_1000231575 | 158 |
| 204 | 3300005841 | Ga0068863_100231953 | Ga0068863_1002319532 | 158 |
| 205 | 3300005841 | Ga0068863_100744649 | Ga0068863_1007446492 | 158 |
| 206 | 3300005841 | Ga0068863_101228515 | Ga0068863_1012285152 | 158 |
| 207 | 3300005842 | Ga0068858_100019652 | Ga0068858_1000196523 | 158 |
| 208 | 3300005842 | Ga0068858_100354095 | Ga0068858_1003540952 | 158 |
| 209 | 3300005842 | Ga0068858_101101733 | Ga0068858_1011017332 | 158 |
| 210 | 3300005843 | Ga0068860_100021301 | Ga0068860_1000213016 | 158 |
| 211 | 3300005843 | Ga0068860_100285965 | Ga0068860_1002859652 | 158 |
| 212 | 3300005843 | Ga0068860_100920649 | Ga0068860_1009206492 | 158 |
| 213 | 3300005844 | Ga0068862_100102556 | Ga0068862_1001025562 | 158 |
| 214 | 3300005844 | Ga0068862_100152077 | Ga0068862_1001520772 | 158 |
| 215 | 3300005844 | Ga0068862_100297237 | Ga0068862_1002972372 | 158 |
| 216 | 3300005844 | Ga0068862_100640216 | Ga0068862_1006402162 | 158 |
| 217 | 3300005844 | Ga0068862_100694043 | Ga0068862_1006940432 | 158 |
| 218 | 3300005937 | Ga0081455_10036376 | Ga0081455_100363764 | 158 |
| 219 | 3300005937 | Ga0081455_10095062 | Ga0081455_100950624 | 158 |
| 220 | 3300005983 | Ga0081540_1001273 | Ga0081540_100127325 | 158 |
| 221 | 3300005983 | Ga0081540_1004433 | Ga0081540_10044339 | 158 |
| 222 | 3300005983 | Ga0081540_1007588 | Ga0081540_100758810 | 158 |
| 223 | 3300005983 | Ga0081540_1029423 | Ga0081540_10294232 | 158 |
| 224 | 3300005985 | Ga0081539_10119548 | Ga0081539_101195482 | 158 |
| 225 | 3300006038 | Ga0075365_10004788 | Ga0075365_100047882 | 158 |
| 226 | 3300006038 | Ga0075365_10122121 | Ga0075365_101221212 | 158 |
| 227 | 3300006042 | Ga0075368_10317224 | Ga0075368_103172242 | 158 |
| 228 | 3300006048 | Ga0075363_100005068 | Ga0075363_1000050683 | 158 |
| 229 | 3300006051 | Ga0075364_10243222 | Ga0075364_102432222 | 158 |
| 230 | 3300006051 | Ga0075364_10348156 | Ga0075364_103481562 | 158 |
| 231 | 3300006058 | Ga0075432_10101437 | Ga0075432_101014372 | 158 |
| 232 | 3300006163 | Ga0070715_10232644 | Ga0070715_102326442 | 158 |
| 233 | 3300006175 | Ga0070712_100525035 | Ga0070712_1005250352 | 158 |
| 234 | 3300006177 | Ga0075362_10477687 | Ga0075362_104776871 | 158 |
| 235 | 3300006178 | Ga0075367_10006819 | Ga0075367_100068194 | 158 |
| 236 | 3300006178 | Ga0075367_10136490 | Ga0075367_101364902 | 158 |
| 237 | 3300006178 | Ga0075367_10404420 | Ga0075367_104044201 | 158 |
| 238 | 3300006178 | Ga0075367_10435364 | Ga0075367_104353641 | 158 |
| 239 | 3300006195 | Ga0075366_10645420 | Ga0075366_106454201 | 158 |
| 240 | 3300006195 | Ga0075366_10660925 | Ga0075366_106609252 | 158 |
| 241 | 3300006237 | Ga0097621_100499621 | Ga0097621_1004996212 | 158 |
| 242 | 3300006353 | Ga0075370_10028134 | Ga0075370_100281342 | 158 |
| 243 | 3300006353 | Ga0075370_10155586 | Ga0075370_101555862 | 158 |
| 244 | 3300006353 | Ga0075370_10464034 | Ga0075370_104640342 | 158 |
| 245 | 3300006358 | Ga0068871_100275487 | Ga0068871_1002754872 | 158 |
| 246 | 3300006844 | Ga0075428_100726299 | Ga0075428_1007262992 | 158 |
| 247 | 3300006881 | Ga0068865_100067502 | Ga0068865_1000675022 | 158 |
| 248 | 3300006881 | Ga0068865_100441924 | Ga0068865_1004419242 | 158 |
| 249 | 3300006881 | Ga0068865_100628287 | Ga0068865_1006282872 | 158 |
| 250 | 3300006931 | Ga0097620_100007456 | Ga0097620_1000074562 | 158 |
| 251 | 3300006931 | Ga0097620_100063328 | Ga0097620_1000633282 | 158 |
| 252 | 3300006931 | Ga0097620_101696533 | Ga0097620_1016965332 | 158 |
| 253 | 3300007076 | Ga0075435_100147933 | Ga0075435_1001479332 | 158 |
| 254 | 3300009036 | Ga0105244_10268305 | Ga0105244_102683052 | 158 |
| 255 | 3300009092 | Ga0105250_10260498 | Ga0105250_102604982 | 158 |
| 256 | 3300009093 | Ga0105240_10446739 | Ga0105240_104467392 | 158 |
| 257 | 3300009094 | Ga0111539_10463556 | Ga0111539_104635562 | 158 |
| 258 | 3300009094 | Ga0111539_10554387 | Ga0111539_105543872 | 158 |
| 259 | 3300009098 | Ga0105245_10139110 | Ga0105245_101391102 | 158 |
| 260 | 3300009098 | Ga0105245_11235466 | Ga0105245_112354662 | 158 |
| 261 | 3300009098 | Ga0105245_12614679 | Ga0105245_126146791 | 158 |
| 262 | 3300009101 | Ga0105247_10113322 | Ga0105247_101133222 | 158 |
| 263 | 3300009101 | Ga0105247_10219304 | Ga0105247_102193042 | 158 |
| 264 | 3300009101 | Ga0105247_10507400 | Ga0105247_105074002 | 158 |
| 265 | 3300009101 | Ga0105247_10578478 | Ga0105247_105784782 | 158 |
| 266 | 3300009147 | Ga0114129_10827321 | Ga0114129_108273212 | 158 |
| 267 | 3300009148 | Ga0105243_10407528 | Ga0105243_104075282 | 158 |
| 268 | 3300009148 | Ga0105243_10708577 | Ga0105243_107085772 | 158 |
| 269 | 3300009174 | Ga0105241_10035235 | Ga0105241_100352352 | 158 |
| 270 | 3300009174 | Ga0105241_10535063 | Ga0105241_105350632 | 158 |
| 271 | 3300009174 | Ga0105241_10620129 | Ga0105241_106201292 | 158 |
| 272 | 3300009176 | Ga0105242_10398312 | Ga0105242_103983122 | 158 |
| 273 | 3300009176 | Ga0105242_11491921 | Ga0105242_114919212 | 158 |
| 274 | 3300009176 | Ga0105242_11496406 | Ga0105242_114964062 | 158 |
| 275 | 3300009177 | Ga0105248_10047570 | Ga0105248_100475703 | 158 |
| 276 | 3300009177 | Ga0105248_10114790 | Ga0105248_101147902 | 158 |
| 277 | 3300009177 | Ga0105248_10378607 | Ga0105248_103786072 | 158 |
| 278 | 3300009177 | Ga0105248_10640216 | Ga0105248_106402162 | 158 |
| 279 | 3300009177 | Ga0105248_10858805 | Ga0105248_108588052 | 158 |
| 280 | 3300009177 | Ga0105248_10895067 | Ga0105248_108950672 | 158 |
| 281 | 3300009545 | Ga0105237_10100303 | Ga0105237_101003032 | 158 |
| 282 | 3300009545 | Ga0105237_10104870 | Ga0105237_101048702 | 158 |
| 283 | 3300009551 | Ga0105238_10419151 | Ga0105238_104191512 | 158 |
| 284 | 3300009551 | Ga0105238_10579086 | Ga0105238_105790862 | 158 |
| 285 | 3300009551 | Ga0105238_10779032 | Ga0105238_107790322 | 158 |
| 286 | 3300009553 | Ga0105249_10131543 | Ga0105249_101315432 | 158 |
| 287 | 3300009553 | Ga0105249_10386945 | Ga0105249_103869452 | 158 |
| 288 | 3300009553 | Ga0105249_10416484 | Ga0105249_104164842 | 158 |
| 289 | 3300009553 | Ga0105249_10521675 | Ga0105249_105216752 | 158 |
| 290 | 3300009553 | Ga0105249_10531777 | Ga0105249_105317772 | 158 |
| 291 | 3300009553 | Ga0105249_11462716 | Ga0105249_114627162 | 158 |
| 292 | 3300010375 | Ga0105239_10094432 | Ga0105239_100944323 | 158 |
| 293 | 3300010375 | Ga0105239_10188851 | Ga0105239_101888512 | 158 |
| 294 | 3300010375 | Ga0105239_11018154 | Ga0105239_110181542 | 158 |
| 295 | 3300010375 | Ga0105239_11278588 | Ga0105239_112785881 | 158 |
| 296 | 3300010375 | Ga0105239_11521608 | Ga0105239_115216081 | 158 |
| 297 | 3300011119 | Ga0105246_10044167 | Ga0105246_100441672 | 158 |
| 298 | 3300011119 | Ga0105246_10418940 | Ga0105246_104189402 | 158 |
| 299 | 3300011119 | Ga0105246_10620219 | Ga0105246_106202192 | 158 |
| 300 | 3300011119 | Ga0105246_10669029 | Ga0105246_106690292 | 158 |
| 301 | 3300013102 | Ga0157371_10652389 | Ga0157371_106523892 | 158 |
| 302 | 3300013296 | Ga0157374_10042146 | Ga0157374_100421465 | 158 |
| 303 | 3300013296 | Ga0157374_10370458 | Ga0157374_103704582 | 158 |
| 304 | 3300013296 | Ga0157374_12274556 | Ga0157374_122745561 | 158 |
| 305 | 3300013297 | Ga0157378_10124203 | Ga0157378_101242032 | 158 |
| 306 | 3300013297 | Ga0157378_11059528 | Ga0157378_110595282 | 158 |
| 307 | 3300013306 | Ga0163162_10070625 | Ga0163162_100706254 | 158 |
| 308 | 3300013306 | Ga0163162_10746522 | Ga0163162_107465222 | 158 |
| 309 | 3300013306 | Ga0163162_10806919 | Ga0163162_108069191 | 158 |
| 310 | 3300013306 | Ga0163162_11718944 | Ga0163162_117189442 | 158 |
| 311 | 3300013308 | Ga0157375_10667029 | Ga0157375_106670292 | 158 |
| 312 | 3300013308 | Ga0157375_10668897 | Ga0157375_106688972 | 158 |
| 313 | 3300014325 | Ga0163163_10396842 | Ga0163163_103968422 | 158 |
| 314 | 3300014325 | Ga0163163_10520501 | Ga0163163_105205012 | 158 |
| 315 | 3300014326 | Ga0157380_10060148 | Ga0157380_100601482 | 158 |
| 316 | 3300014326 | Ga0157380_10186435 | Ga0157380_101864352 | 158 |
| 317 | 3300014326 | Ga0157380_10234153 | Ga0157380_102341532 | 158 |
| 318 | 3300014326 | Ga0157380_10949387 | Ga0157380_109493872 | 158 |
| 319 | 3300014326 | Ga0157380_11031643 | Ga0157380_110316432 | 158 |
| 320 | 3300014968 | Ga0157379_10157257 | Ga0157379_101572572 | 158 |
| 321 | 3300014968 | Ga0157379_10279604 | Ga0157379_102796042 | 158 |
| 322 | 3300014968 | Ga0157379_11242506 | Ga0157379_112425062 | 158 |
| 323 | 3300014968 | Ga0157379_11719451 | Ga0157379_117194511 | 158 |
| 324 | 3300014969 | Ga0157376_10533785 | Ga0157376_105337852 | 158 |
| 325 | 3300020082 | Ga0206353_11984242 | Ga0206353_119842422 | 158 |
| 326 | 3300025315 | Ga0207697_10058295 | Ga0207697_100582952 | 158 |
| 327 | 3300025315 | Ga0207697_10120431 | Ga0207697_101204312 | 158 |
| 328 | 3300025315 | Ga0207697_10279151 | Ga0207697_102791511 | 158 |
| 329 | 3300025711 | Ga0207696_1084892 | Ga0207696_10848922 | 158 |
| 330 | 3300025899 | Ga0207642_10020577 | Ga0207642_100205772 | 158 |
| 331 | 3300025899 | Ga0207642_10478528 | Ga0207642_104785282 | 158 |
| 332 | 3300025900 | Ga0207710_10071617 | Ga0207710_100716172 | 158 |
| 333 | 3300025900 | Ga0207710_10182256 | Ga0207710_101822562 | 158 |
| 334 | 3300025900 | Ga0207710_10399755 | Ga0207710_103997552 | 158 |
| 335 | 3300025901 | Ga0207688_10028174 | Ga0207688_100281743 | 158 |
| 336 | 3300025901 | Ga0207688_10333094 | Ga0207688_103330942 | 158 |
| 337 | 3300025903 | Ga0207680_10139088 | Ga0207680_101390882 | 158 |
| 338 | 3300025903 | Ga0207680_10342479 | Ga0207680_103424792 | 158 |
| 339 | 3300025907 | Ga0207645_10717171 | Ga0207645_107171712 | 158 |
| 340 | 3300025908 | Ga0207643_10463358 | Ga0207643_104633582 | 158 |
| 341 | 3300025909 | Ga0207705_10141395 | Ga0207705_101413952 | 158 |
| 342 | 3300025909 | Ga0207705_10154531 | Ga0207705_101545312 | 158 |
| 343 | 3300025909 | Ga0207705_10358941 | Ga0207705_103589412 | 158 |
| 344 | 3300025911 | Ga0207654_10055630 | Ga0207654_100556302 | 158 |
| 345 | 3300025911 | Ga0207654_10246746 | Ga0207654_102467462 | 158 |
| 346 | 3300025911 | Ga0207654_10774201 | Ga0207654_107742012 | 158 |
| 347 | 3300025914 | Ga0207671_10337122 | Ga0207671_103371222 | 158 |
| 348 | 3300025914 | Ga0207671_10924872 | Ga0207671_109248722 | 158 |
| 349 | 3300025915 | Ga0207693_10180540 | Ga0207693_101805402 | 158 |
| 350 | 3300025915 | Ga0207693_10489288 | Ga0207693_104892882 | 158 |
| 351 | 3300025919 | Ga0207657_10215974 | Ga0207657_102159742 | 158 |
| 352 | 3300025920 | Ga0207649_10076679 | Ga0207649_100766792 | 158 |
| 353 | 3300025923 | Ga0207681_10000248 | Ga0207681_1000024823 | 158 |
| 354 | 3300025924 | Ga0207694_10658396 | Ga0207694_106583961 | 158 |
| 355 | 3300025925 | Ga0207650_11137700 | Ga0207650_111377002 | 158 |
| 356 | 3300025927 | Ga0207687_10111760 | Ga0207687_101117602 | 158 |
| 357 | 3300025927 | Ga0207687_10147633 | Ga0207687_101476332 | 158 |
| 358 | 3300025927 | Ga0207687_10491869 | Ga0207687_104918692 | 158 |
| 359 | 3300025928 | Ga0207700_11344719 | Ga0207700_113447192 | 158 |
| 360 | 3300025931 | Ga0207644_10000004 | Ga0207644_1000000434 | 158 |
| 361 | 3300025931 | Ga0207644_10005101 | Ga0207644_100051017 | 158 |
| 362 | 3300025932 | Ga0207690_11276313 | Ga0207690_112763132 | 158 |
| 363 | 3300025933 | Ga0207706_10063847 | Ga0207706_100638473 | 158 |
| 364 | 3300025933 | Ga0207706_10232732 | Ga0207706_102327322 | 158 |
| 365 | 3300025933 | Ga0207706_11090466 | Ga0207706_110904662 | 158 |
| 366 | 3300025934 | Ga0207686_10411884 | Ga0207686_104118842 | 158 |
| 367 | 3300025934 | Ga0207686_10519596 | Ga0207686_105195962 | 158 |
| 368 | 3300025935 | Ga0207709_10108126 | Ga0207709_101081262 | 158 |
| 369 | 3300025935 | Ga0207709_10392342 | Ga0207709_103923422 | 158 |
| 370 | 3300025936 | Ga0207670_10061119 | Ga0207670_100611193 | 158 |
| 371 | 3300025937 | Ga0207669_10119491 | Ga0207669_101194912 | 158 |
| 372 | 3300025937 | Ga0207669_10226526 | Ga0207669_102265262 | 158 |
| 373 | 3300025937 | Ga0207669_11080566 | Ga0207669_110805661 | 158 |
| 374 | 3300025938 | Ga0207704_10079310 | Ga0207704_100793102 | 158 |
| 375 | 3300025938 | Ga0207704_10701116 | Ga0207704_107011161 | 158 |
| 376 | 3300025938 | Ga0207704_10973690 | Ga0207704_109736901 | 158 |
| 377 | 3300025940 | Ga0207691_10177730 | Ga0207691_101777303 | 158 |
| 378 | 3300025940 | Ga0207691_11337186 | Ga0207691_113371861 | 158 |
| 379 | 3300025941 | Ga0207711_10028582 | Ga0207711_100285822 | 158 |
| 380 | 3300025941 | Ga0207711_10484600 | Ga0207711_104846002 | 158 |
| 381 | 3300025941 | Ga0207711_10491080 | Ga0207711_104910802 | 158 |
| 382 | 3300025941 | Ga0207711_10541428 | Ga0207711_105414282 | 158 |
| 383 | 3300025942 | Ga0207689_10061700 | Ga0207689_100617003 | 158 |
| 384 | 3300025942 | Ga0207689_10710456 | Ga0207689_107104562 | 158 |
| 385 | 3300025949 | Ga0207667_10002818 | Ga0207667_100028187 | 158 |
| 386 | 3300025949 | Ga0207667_10018462 | Ga0207667_100184627 | 158 |
| 387 | 3300025949 | Ga0207667_10050257 | Ga0207667_100502572 | 158 |
| 388 | 3300025961 | Ga0207712_10113006 | Ga0207712_101130062 | 158 |
| 389 | 3300025961 | Ga0207712_10303325 | Ga0207712_103033252 | 158 |
| 390 | 3300025961 | Ga0207712_10351548 | Ga0207712_103515482 | 158 |
| 391 | 3300025961 | Ga0207712_10805158 | Ga0207712_108051582 | 158 |
| 392 | 3300025961 | Ga0207712_11246689 | Ga0207712_112466892 | 158 |
| 393 | 3300025972 | Ga0207668_10028354 | Ga0207668_100283543 | 158 |
| 394 | 3300025972 | Ga0207668_10042250 | Ga0207668_100422502 | 158 |
| 395 | 3300025972 | Ga0207668_10056374 | Ga0207668_100563743 | 158 |
| 396 | 3300025972 | Ga0207668_10191358 | Ga0207668_101913582 | 158 |
| 397 | 3300025972 | Ga0207668_10215697 | Ga0207668_102156972 | 158 |
| 398 | 3300025972 | Ga0207668_10390743 | Ga0207668_103907432 | 158 |
| 399 | 3300025972 | Ga0207668_10458159 | Ga0207668_104581592 | 158 |
| 400 | 3300025972 | Ga0207668_10923667 | Ga0207668_109236672 | 158 |
| 401 | 3300025981 | Ga0207640_10169884 | Ga0207640_101698841 | 158 |
| 402 | 3300025986 | Ga0207658_10027233 | Ga0207658_100272335 | 158 |
| 403 | 3300025986 | Ga0207658_12115809 | Ga0207658_121158091 | 158 |
| 404 | 3300026023 | Ga0207677_10116864 | Ga0207677_101168643 | 158 |
| 405 | 3300026023 | Ga0207677_10185918 | Ga0207677_101859181 | 158 |
| 406 | 3300026023 | Ga0207677_10267149 | Ga0207677_102671492 | 158 |
| 407 | 3300026035 | Ga0207703_10011714 | Ga0207703_100117142 | 158 |
| 408 | 3300026035 | Ga0207703_10020479 | Ga0207703_100204792 | 158 |
| 409 | 3300026035 | Ga0207703_10177458 | Ga0207703_101774583 | 158 |
| 410 | 3300026035 | Ga0207703_10256204 | Ga0207703_102562042 | 158 |
| 411 | 3300026041 | Ga0207639_10132349 | Ga0207639_101323492 | 158 |
| 412 | 3300026041 | Ga0207639_10220992 | Ga0207639_102209922 | 158 |
| 413 | 3300026067 | Ga0207678_10014567 | Ga0207678_100145672 | 158 |
| 414 | 3300026067 | Ga0207678_10055860 | Ga0207678_100558603 | 158 |
| 415 | 3300026067 | Ga0207678_10490963 | Ga0207678_104909632 | 158 |
| 416 | 3300026067 | Ga0207678_11556491 | Ga0207678_115564911 | 158 |
| 417 | 3300026075 | Ga0207708_10808472 | Ga0207708_108084722 | 158 |
| 418 | 3300026075 | Ga0207708_10851534 | Ga0207708_108515342 | 158 |
| 419 | 3300026078 | Ga0207702_10195760 | Ga0207702_101957602 | 158 |
| 420 | 3300026078 | Ga0207702_10460574 | Ga0207702_104605742 | 158 |
| 421 | 3300026088 | Ga0207641_10432417 | Ga0207641_104324172 | 158 |
| 422 | 3300026088 | Ga0207641_10862902 | Ga0207641_108629021 | 158 |
| 423 | 3300026089 | Ga0207648_10112313 | Ga0207648_101123132 | 158 |
| 424 | 3300026089 | Ga0207648_10335180 | Ga0207648_103351802 | 158 |
| 425 | 3300026089 | Ga0207648_10415874 | Ga0207648_104158743 | 158 |
| 426 | 3300026095 | Ga0207676_10046581 | Ga0207676_100465812 | 158 |
| 427 | 3300026095 | Ga0207676_10054381 | Ga0207676_100543814 | 158 |
| 428 | 3300026095 | Ga0207676_10152956 | Ga0207676_101529562 | 158 |
| 429 | 3300026116 | Ga0207674_11420874 | Ga0207674_114208741 | 158 |
| 430 | 3300026118 | Ga0207675_100141319 | Ga0207675_1001413191 | 158 |
| 431 | 3300026118 | Ga0207675_100448463 | Ga0207675_1004484632 | 158 |
| 432 | 3300026118 | Ga0207675_100455596 | Ga0207675_1004555962 | 158 |
| 433 | 3300026118 | Ga0207675_100676936 | Ga0207675_1006769361 | 158 |
| 434 | 3300026121 | Ga0207683_10166017 | Ga0207683_101660172 | 158 |
| 435 | 3300026121 | Ga0207683_10289502 | Ga0207683_102895022 | 158 |
| 436 | 3300026121 | Ga0207683_10446288 | Ga0207683_104462881 | 158 |
| 437 | 3300026142 | Ga0207698_10189323 | Ga0207698_101893232 | 158 |
| 438 | 3300026142 | Ga0207698_10667585 | Ga0207698_106675852 | 158 |
| 439 | 3300028379 | Ga0268266_10000446 | Ga0268266_1000044629 | 158 |
| 440 | 3300028379 | Ga0268266_10000670 | Ga0268266_1000067016 | 158 |
| 441 | 3300028379 | Ga0268266_10039605 | Ga0268266_100396052 | 158 |
| 442 | 3300028379 | Ga0268266_10440412 | Ga0268266_104404122 | 158 |
| 443 | 3300028379 | Ga0268266_10571470 | Ga0268266_105714702 | 158 |
| 444 | 3300028379 | Ga0268266_11520113 | Ga0268266_115201132 | 158 |
| 445 | 3300028380 | Ga0268265_10046888 | Ga0268265_100468883 | 158 |
| 446 | 3300028380 | Ga0268265_10078046 | Ga0268265_100780462 | 158 |
| 447 | 3300028380 | Ga0268265_10332438 | Ga0268265_103324382 | 158 |
| 448 | 3300028380 | Ga0268265_10409715 | Ga0268265_104097152 | 158 |
| 449 | 3300028380 | Ga0268265_10635320 | Ga0268265_106353201 | 158 |
| 450 | 3300028381 | Ga0268264_10086929 | Ga0268264_100869291 | 158 |
| 451 | 3300028381 | Ga0268264_12189523 | Ga0268264_121895231 | 158 |
| 452 | 3300028786 | Ga0307517_10085793 | Ga0307517_100857932 | 158 |
| 453 | 3300028794 | Ga0307515_10426051 | Ga0307515_104260512 | 158 |
| 454 | 3300031548 | Ga0307408_100536531 | Ga0307408_1005365312 | 158 |
| 455 | 3300031548 | Ga0307408_100694832 | Ga0307408_1006948322 | 158 |
| 456 | 3300031616 | Ga0307508_10009664 | Ga0307508_100096647 | 158 |
| 457 | 3300031616 | Ga0307508_10359193 | Ga0307508_103591931 | 158 |
| 458 | 3300031730 | Ga0307516_10089872 | Ga0307516_100898723 | 158 |
| 459 | 3300031824 | Ga0307413_10041245 | Ga0307413_100412452 | 158 |
| 460 | 3300031903 | Ga0307407_10350353 | Ga0307407_103503532 | 158 |
| 461 | 3300031911 | Ga0307412_10135144 | Ga0307412_101351442 | 158 |
| 462 | 3300031995 | Ga0307409_101208873 | Ga0307409_1012088732 | 158 |
| 463 | 3300032002 | Ga0307416_100793386 | Ga0307416_1007933862 | 158 |
| 464 | 3300032005 | Ga0307411_10076751 | Ga0307411_100767513 | 158 |
| 465 | 3300032005 | Ga0307411_10113101 | Ga0307411_101131012 | 158 |
| 466 | 3300032126 | Ga0307415_100075103 | Ga0307415_1000751032 | 158 |
| 467 | 3300032126 | Ga0307415_100560061 | Ga0307415_1005600612 | 158 |
| 468 | 3300032126 | Ga0307415_101548922 | Ga0307415_1015489221 | 158 |
| 469 | 3300033180 | Ga0307510_10019030 | Ga0307510_100190303 | 158 |
| 470 | 3300033180 | Ga0307510_10256328 | Ga0307510_102563282 | 158 |
| 471 | 3300034816 | Ga0373930_0007018 | Ga0373930_0007018_723_1199 | 158 |
| 472 | 3300034957 | Ga0373938_0067420 | Ga0373938_0067420_236_712 | 158 |
| 473 | 3300035092 | Ga0373952_0171208 | Ga0373952_0171208_13_489 | 158 |
| 474 | 3300035112 | Ga0373932_0019441 | Ga0373932_0019441_190_666 | 158 |
| 475 | 3300035119 | Ga0373956_0024429 | Ga0373956_0024429_37_519 | 158 |
| 476 | 3300035121 | Ga0373960_0096433 | Ga0373960_0096433_156_632 | 158 |
| 477 | 3300035207 | Ga0373942_0262401 | Ga0373942_0262401_60_536 | 158 |
| 478 | 3300035242 | Ga0373962_0057167 | Ga0373962_0057167_329_805 | 158 |
| 479 | 3300035691 | Ga0373931_0025121 | Ga0373931_0025121_2112_2588 | 158 |
| 480 | 3300035691 | Ga0373931_0892161 | Ga0373931_0892161_88_564 | 158 |
| 481 | 3300035692 | Ga0373935_0111842 | Ga0373935_0111842_438_914 | 158 |
| 482 | 3300035725 | Ga0373947_0207262 | Ga0373947_0207262_532_1008 | 158 |
| 483 | 3300035725 | Ga0373947_0568811 | Ga0373947_0568811_117_593 | 158 |
| 484 | 3300041413 | Ga0439465_0060773 | Ga0439465_0060773_386_862 | 158 |
| 485 | 3300041443 | Ga0451789_1131362 | Ga0451789_1131362_74_550 | 158 |
| 486 | 3300041452 | Ga0451793_1643059 | Ga0451793_1643059_131_613 | 158 |
| 487 | 3300041459 | Ga0451800_1272588 | Ga0451800_1272588_31_507 | 158 |
| 488 | 3300041463 | Ga0451804_0577402 | Ga0451804_0577402_52_549 | 158 |
| 489 | 3300041509 | Ga0451843_1327502 | Ga0451843_1327502_117_593 | 158 |
| 490 | 3300041997 | Ga0439431_0235909 | Ga0439431_0235909_52_528 | 158 |
| 491 | 3300042005 | Ga0439448_0140871 | Ga0439448_0140871_173_649 | 158 |
| 492 | 3300042016 | Ga0439463_156452 | Ga0439463_156452_43_519 | 158 |
| 493 | 3300044712 | Ga0453684_0057660 | Ga0453684_0057660_4091_4573 | 158 |
| 494 | 3300046452 | Ga0495617_037019 | Ga0495617_037019_38_514 | 158 |
| 495 | 3300046455 | Ga0495603_0036252 | Ga0495603_0036252_1913_2389 | 158 |
| 496 | 3300046457 | Ga0495590_0080715 | Ga0495590_0080715_638_1114 | 158 |
| 497 | 3300046459 | Ga0495629_0152799 | Ga0495629_0152799_165_641 | 158 |
| 498 | 3300046460 | Ga0495638_0015230 | Ga0495638_0015230_3970_4446 | 158 |
| 499 | 3300046461 | Ga0495641_0062919 | Ga0495641_0062919_811_1287 | 158 |
| 500 | 3300046471 | Ga0495650_0132169 | Ga0495650_0132169_391_867 | 158 |
| 501 | 3300046472 | Ga0495580_0794910 | Ga0495580_0794910_117_593 | 158 |
| 502 | 3300046473 | Ga0495582_0423108 | Ga0495582_0423108_234_710 | 158 |
| 503 | 3300046474 | Ga0495605_0185320 | Ga0495605_0185320_364_840 | 158 |
| 504 | 3300046475 | Ga0495639_0182924 | Ga0495639_0182924_139_615 | 158 |
| 505 | 3300046491 | Ga0495584_0100895 | Ga0495584_0100895_397_873 | 158 |
| 506 | 3300046491 | Ga0495584_0467286 | Ga0495584_0467286_154_630 | 158 |
| 507 | 3300046491 | Ga0495584_0590203 | Ga0495584_0590203_55_531 | 158 |
| 508 | 3300046492 | Ga0495585_0064003 | Ga0495585_0064003_1008_1499 | 158 |
| 509 | 3300046492 | Ga0495585_0066562 | Ga0495585_0066562_160_636 | 158 |
| 510 | 3300046500 | Ga0495596_0066003 | Ga0495596_0066003_18_494 | 158 |
| 511 | 3300046500 | Ga0495596_0228539 | Ga0495596_0228539_91_567 | 158 |
| 512 | 3300046501 | Ga0495607_0182075 | Ga0495607_0182075_565_1041 | 158 |
| 513 | 3300046506 | Ga0495583_0177577 | Ga0495583_0177577_226_702 | 158 |
| 514 | 3300046507 | Ga0495606_0133935 | Ga0495606_0133935_124_600 | 158 |
| 515 | 3300046507 | Ga0495606_0221452 | Ga0495606_0221452_394_870 | 158 |
| 516 | 3300046515 | Ga0495620_0113333 | Ga0495620_0113333_161_637 | 158 |
| 517 | 3300046517 | Ga0495630_0851161 | Ga0495630_0851161_101_577 | 158 |
| 518 | 3300046518 | Ga0495631_0056972 | Ga0495631_0056972_728_1204 | 158 |
| 519 | 3300046518 | Ga0495631_0385414 | Ga0495631_0385414_76_552 | 158 |
| 520 | 3300046520 | Ga0495637_0217915 | Ga0495637_0217915_164_640 | 158 |
| 521 | 3300046522 | Ga0495643_0229534 | Ga0495643_0229534_256_732 | 158 |
| 522 | 3300046523 | Ga0495644_0027751 | Ga0495644_0027751_1520_2011 | 158 |
| 523 | 3300046524 | Ga0495648_0315100 | Ga0495648_0315100_134_610 | 158 |
| 524 | 3300046528 | Ga0495642_0076392 | Ga0495642_0076392_404_895 | 158 |
| 525 | 3300046529 | Ga0495652_1109266 | Ga0495652_1109266_12_488 | 158 |
| 526 | 3300046537 | Ga0495598_0060743 | Ga0495598_0060743_201_677 | 158 |
| 527 | 3300046538 | Ga0495609_0100951 | Ga0495609_0100951_207_683 | 158 |
| 528 | 3300046538 | Ga0495609_0222961 | Ga0495609_0222961_140_631 | 158 |
| 529 | 3300046542 | Ga0495597_0174386 | Ga0495597_0174386_237_713 | 158 |
| 530 | 3300046557 | Ga0495622_0040003 | Ga0495622_0040003_791_1267 | 158 |
| 531 | 3300046615 | Ga0495656_0019569 | Ga0495656_0019569_1797_2273 | 158 |
| 532 | 3300046615 | Ga0495656_0037417 | Ga0495656_0037417_1300_1791 | 158 |
| 533 | 3300046616 | Ga0495668_0302103 | Ga0495668_0302103_391_867 | 158 |
| 534 | 3300046648 | Ga0495611_0027449 | Ga0495611_0027449_1806_2282 | 158 |
| 535 | 3300046648 | Ga0495611_0061366 | Ga0495611_0061366_613_1089 | 158 |
| 536 | 3300046648 | Ga0495611_0178178 | Ga0495611_0178178_112_588 | 158 |
| 537 | 3300046660 | Ga0495625_0353919 | Ga0495625_0353919_106_582 | 158 |
| 538 | 3300046660 | Ga0495625_0415652 | Ga0495625_0415652_56_532 | 158 |
| 539 | 3300046663 | Ga0495635_0240697 | Ga0495635_0240697_552_1028 | 158 |
| 540 | 3300046664 | Ga0495659_0012710 | Ga0495659_0012710_1807_2298 | 158 |
| 541 | 3300046664 | Ga0495659_0239144 | Ga0495659_0239144_42_518 | 158 |
| 542 | 3300046665 | Ga0495661_0314960 | Ga0495661_0314960_91_567 | 158 |
| 543 | 3300046683 | Ga0495658_0256238 | Ga0495658_0256238_254_730 | 158 |
| 544 | 3300046684 | Ga0495669_0022881 | Ga0495669_0022881_661_1137 | 158 |
| 545 | 3300046684 | Ga0495669_0037766 | Ga0495669_0037766_1133_1609 | 158 |
| 546 | 3300046684 | Ga0495669_0256870 | Ga0495669_0256870_13_489 | 158 |
| 547 | 3300046692 | Ga0495671_0432509 | Ga0495671_0432509_47_523 | 158 |
| 548 | 3300046794 | Ga0495589_0120484 | Ga0495589_0120484_353_829 | 158 |
| 549 | 3300047315 | Ga0495581_0027928 | Ga0495581_0027928_2669_3145 | 158 |
| 550 | 3300047317 | Ga0495604_0193262 | Ga0495604_0193262_548_1024 | 158 |
| 551 | 3300047319 | Ga0495674_0235436 | Ga0495674_0235436_741_1217 | 158 |
| 552 | 3300047320 | Ga0495672_0034475 | Ga0495672_0034475_2081_2557 | 158 |
| 553 | 3300047322 | Ga0495680_0482529 | Ga0495680_0482529_232_708 | 158 |
| 554 | 3300047323 | Ga0495683_0305327 | Ga0495683_0305327_128_604 | 158 |
| 555 | 3300047446 | Ga0495679_042227 | Ga0495679_042227_148_624 | 158 |
| 556 | 3300047447 | Ga0495685_138946 | Ga0495685_138946_226_717 | 158 |
| 557 | 3300047472 | Ga0495686_0357552 | Ga0495686_0357552_218_694 | 158 |
| 558 | 3300047472 | Ga0495686_0485115 | Ga0495686_0485115_107_583 | 158 |
| 559 | 3300048903 | Ga0496100_0136693 | Ga0496100_0136693_503_979 | 158 |
| 560 | 3300048903 | Ga0496100_0150574 | Ga0496100_0150574_1107_1583 | 158 |
| 561 | 3300048904 | Ga0496101_0005995 | Ga0496101_0005995_6310_6798 | 158 |
| 562 | 3300048904 | Ga0496101_0082969 | Ga0496101_0082969_1284_1760 | 158 |
| 563 | 3300048904 | Ga0496101_0434221 | Ga0496101_0434221_109_585 | 158 |
| 564 | 3300048904 | Ga0496101_0565000 | Ga0496101_0565000_349_825 | 158 |
| 565 | 3300048905 | Ga0496102_0068054 | Ga0496102_0068054_1067_1543 | 158 |
| 566 | 3300048905 | Ga0496102_0084900 | Ga0496102_0084900_275_751 | 158 |
| 567 | 3300048905 | Ga0496102_0138305 | Ga0496102_0138305_459_947 | 158 |
| 568 | 3300048905 | Ga0496102_0152079 | Ga0496102_0152079_531_1007 | 158 |
| 569 | 3300048905 | Ga0496102_0727129 | Ga0496102_0727129_373_849 | 158 |
| 570 | 3300048905 | Ga0496102_0967551 | Ga0496102_0967551_139_615 | 158 |
| 571 | 3300048906 | Ga0496103_0015686 | Ga0496103_0015686_4014_4490 | 158 |
| 572 | 3300048906 | Ga0496103_0129438 | Ga0496103_0129438_224_712 | 158 |
| 573 | 3300048906 | Ga0496103_0553048 | Ga0496103_0553048_125_601 | 158 |
| 574 | 3300048907 | Ga0496104_0309445 | Ga0496104_0309445_264_752 | 158 |
| 575 | 3300048907 | Ga0496104_0356795 | Ga0496104_0356795_84_560 | 158 |
| 576 | 3300048907 | Ga0496104_0385952 | Ga0496104_0385952_122_598 | 158 |
| 577 | 3300048907 | Ga0496104_1559642 | Ga0496104_1559642_57_533 | 158 |
| 578 | 3300048908 | Ga0496105_0080378 | Ga0496105_0080378_1434_1910 | 158 |
| 579 | 3300048908 | Ga0496105_0138424 | Ga0496105_0138424_933_1421 | 158 |
| 580 | 3300048908 | Ga0496105_0985179 | Ga0496105_0985179_59_535 | 158 |
| 581 | 3300048909 | Ga0496106_0064146 | Ga0496106_0064146_118_594 | 158 |
| 582 | 3300048909 | Ga0496106_0137608 | Ga0496106_0137608_1295_1771 | 158 |
| 583 | 3300048909 | Ga0496106_0358600 | Ga0496106_0358600_531_1007 | 158 |
| 584 | 3300048909 | Ga0496106_0602940 | Ga0496106_0602940_217_693 | 158 |
| 585 | 3300048909 | Ga0496106_1119527 | Ga0496106_1119527_113_589 | 158 |
| 586 | 3300048910 | Ga0496107_0015115 | Ga0496107_0015115_222_710 | 158 |
| 587 | 3300048910 | Ga0496107_0141467 | Ga0496107_0141467_1167_1643 | 158 |
| 588 | 3300048910 | Ga0496107_0484829 | Ga0496107_0484829_25_501 | 158 |
| 589 | 3300048911 | Ga0496108_0146822 | Ga0496108_0146822_248_736 | 158 |
| 590 | 3300048911 | Ga0496108_0154186 | Ga0496108_0154186_369_845 | 158 |
| 591 | 3300048911 | Ga0496108_0469433 | Ga0496108_0469433_140_616 | 158 |
| 592 | 3300048911 | Ga0496108_0557672 | Ga0496108_0557672_258_746 | 158 |
| 593 | 3300048912 | Ga0496109_0028952 | Ga0496109_0028952_1652_2128 | 158 |
| 594 | 3300048912 | Ga0496109_0146281 | Ga0496109_0146281_954_1430 | 158 |
| 595 | 3300048912 | Ga0496109_0799271 | Ga0496109_0799271_292_768 | 158 |
| 596 | 3300048913 | Ga0496110_0027369 | Ga0496110_0027369_1562_2050 | 158 |
| 597 | 3300048913 | Ga0496110_0046887 | Ga0496110_0046887_1164_1640 | 158 |
| 598 | 3300048913 | Ga0496110_0615742 | Ga0496110_0615742_164_640 | 158 |
| 599 | 3300048914 | Ga0496111_0041641 | Ga0496111_0041641_745_1221 | 158 |
| 600 | 3300048914 | Ga0496111_0104351 | Ga0496111_0104351_1153_1641 | 158 |
| 601 | 3300048915 | Ga0496112_0033990 | Ga0496112_0033990_615_1091 | 158 |
| 602 | 3300048915 | Ga0496112_0055956 | Ga0496112_0055956_2321_2797 | 158 |
| 603 | 3300048915 | Ga0496112_0290937 | Ga0496112_0290937_231_719 | 158 |
| 604 | 3300048916 | Ga0496113_0000807 | Ga0496113_0000807_2703_3191 | 158 |
| 605 | 3300048916 | Ga0496113_0018950 | Ga0496113_0018950_4251_4727 | 158 |
| 606 | 3300048916 | Ga0496113_0469984 | Ga0496113_0469984_183_659 | 158 |
| 607 | 3300048916 | Ga0496113_0683672 | Ga0496113_0683672_226_714 | 158 |
| 608 | 3300048916 | Ga0496113_0773826 | Ga0496113_0773826_60_536 | 158 |
| 609 | 3300048916 | Ga0496113_0909668 | Ga0496113_0909668_90_566 | 158 |
| 610 | 3300048917 | Ga0496114_0050365 | Ga0496114_0050365_2248_2736 | 158 |
| 611 | 3300048917 | Ga0496114_0124263 | Ga0496114_0124263_598_1074 | 158 |
| 612 | 3300048917 | Ga0496114_1158739 | Ga0496114_1158739_26_502 | 158 |
| 613 | 3300048918 | Ga0496115_0009296 | Ga0496115_0009296_1272_1748 | 158 |
| 614 | 3300048918 | Ga0496115_0191841 | Ga0496115_0191841_968_1456 | 158 |
| 615 | 3300048918 | Ga0496115_0262435 | Ga0496115_0262435_595_1071 | 158 |
| 616 | 3300048918 | Ga0496115_0464273 | Ga0496115_0464273_153_629 | 158 |
| 617 | 3300048920 | Ga0496117_0102516 | Ga0496117_0102516_1084_1560 | 158 |
| 618 | 3300048924 | Ga0496121_0091621 | Ga0496121_0091621_1072_1548 | 158 |
| 619 | 3300048924 | Ga0496121_0125113 | Ga0496121_0125113_1258_1734 | 158 |
| 620 | 3300048924 | Ga0496121_0389533 | Ga0496121_0389533_246_722 | 158 |
| 621 | 3300048924 | Ga0496121_0424582 | Ga0496121_0424582_205_693 | 158 |
| 622 | 3300048924 | Ga0496121_0652824 | Ga0496121_0652824_141_617 | 158 |
| 623 | 3300048928 | Ga0496125_0315756 | Ga0496125_0315756_386_874 | 158 |
| 624 | 3300048929 | Ga0496126_0000483 | Ga0496126_0000483_43277_43765 | 158 |
| 625 | 3300048929 | Ga0496126_0009701 | Ga0496126_0009701_6484_6960 | 158 |
| 626 | 3300049583 | Ga0501067_0643987 | Ga0501067_0643987_101_577 | 158 |
| 627 | 3300049585 | Ga0501069_0199298 | Ga0501069_0199298_59_535 | 158 |
| 628 | 3300050489 | nmdc:mga03683_85452_c1 | nmdc:mga03683_85452_c1_132_608 | 158 |
| 629 | 3300050490 | nmdc:mga03n38_216364_c1 | nmdc:mga03n38_216364_c1_357_833 | 158 |
| 630 | 3300050490 | nmdc:mga03n38_46_c2 | nmdc:mga03n38_46_c2_12164_12640 | 158 |
| 631 | 3300050490 | nmdc:mga03n38_982484_c1 | nmdc:mga03n38_982484_c1_14_490 | 158 |
| 632 | 3300050492 | nmdc:mga0yw44_17722_c1 | nmdc:mga0yw44_17722_c1_238_714 | 158 |
| 633 | 3300050492 | nmdc:mga0yw44_319403_c1 | nmdc:mga0yw44_319403_c1_78_554 | 158 |
| 634 | 3300050492 | nmdc:mga0yw44_367800_c1 | nmdc:mga0yw44_367800_c1_262_738 | 158 |
| 635 | 3300050492 | nmdc:mga0yw44_521170_c1 | nmdc:mga0yw44_521170_c1_51_527 | 158 |
| 636 | 3300050493 | nmdc:mga0k408_390542_c1 | nmdc:mga0k408_390542_c1_156_632 | 158 |
| 637 | 3300050493 | nmdc:mga0k408_408114_c1 | nmdc:mga0k408_408114_c1_206_682 | 158 |
| 638 | 3300050493 | nmdc:mga0k408_685693_c1 | nmdc:mga0k408_685693_c1_24_500 | 158 |
| 639 | 3300050494 | nmdc:mga06z11_264442_c1 | nmdc:mga06z11_264442_c1_156_632 | 158 |
| 640 | 3300050494 | nmdc:mga06z11_39880_c1 | nmdc:mga06z11_39880_c1_557_1033 | 158 |
| 641 | 3300050495 | nmdc:mga04h51_217474_c1 | nmdc:mga04h51_217474_c1_121_597 | 158 |
| 642 | 3300050496 | nmdc:mga07m45_319458_c1 | nmdc:mga07m45_319458_c1_243_719 | 158 |
| 643 | 3300050496 | nmdc:mga07m45_49471_c1 | nmdc:mga07m45_49471_c1_55_531 | 158 |
| 644 | 3300050496 | nmdc:mga07m45_7364_c1 | nmdc:mga07m45_7364_c1_1570_2046 | 158 |
| 645 | 3300050507 | nmdc:mga05p37_950515_c1 | nmdc:mga05p37_950515_c1_184_660 | 158 |
| 646 | 3300050511 | nmdc:mga08y16_490127_c1 | nmdc:mga08y16_490127_c1_245_721 | 158 |
| 647 | 3300050515 | nmdc:mga0a205_657650_c1 | nmdc:mga0a205_657650_c1_384_860 | 158 |
| 648 | 3300053086 | Ga0500578_0465841 | Ga0500578_0465841_161_637 | 158 |
| 649 | 3300053087 | Ga0500643_057151 | Ga0500643_057151_549_1025 | 158 |
| 650 | 3300053090 | Ga0500646_0244868 | Ga0500646_0244868_90_566 | 158 |
| 651 | 3300053092 | Ga0500583_0045097 | Ga0500583_0045097_769_1245 | 158 |
| 652 | 3300053094 | Ga0500566_0205436 | Ga0500566_0205436_23_499 | 158 |
| 653 | 3300053096 | Ga0500641_0047587 | Ga0500641_0047587_1115_1591 | 158 |
| 654 | 3300053096 | Ga0500641_0061416 | Ga0500641_0061416_1047_1523 | 158 |
| 655 | 3300053108 | Ga0500562_141756 | Ga0500562_141756_106_582 | 158 |
| 656 | 3300053118 | Ga0500594_0094413 | Ga0500594_0094413_214_690 | 158 |
| 657 | 3300053119 | Ga0500595_018947 | Ga0500595_018947_997_1473 | 158 |
| 658 | 3300053119 | Ga0500595_152212 | Ga0500595_152212_21_497 | 158 |
| 659 | 3300053133 | Ga0500655_007445 | Ga0500655_007445_880_1356 | 158 |
| 660 | 3300053139 | Ga0500568_0081886 | Ga0500568_0081886_166_642 | 158 |
| 661 | 3300053147 | Ga0500589_066930 | Ga0500589_066930_1093_1569 | 158 |
| 662 | 3300053147 | Ga0500589_096267 | Ga0500589_096267_56_532 | 158 |
| 663 | 3300053158 | Ga0500627_0116618 | Ga0500627_0116618_587_1063 | 158 |
| 664 | 3300053160 | Ga0500633_0133672 | Ga0500633_0133672_77_553 | 158 |
| 665 | 3300053161 | Ga0500634_0112173 | Ga0500634_0112173_400_876 | 158 |
| 666 | 3300053731 | Ga0500609_013392 | Ga0500609_013392_428_904 | 158 |
| 667 | 3300053739 | Ga0500587_024005 | Ga0500587_024005_127_603 | 158 |
| 668 | 3300061734 | Ga0530510_0776700 | Ga0530510_0776700_54_530 | 158 |
| 669 | 3300003203 | JGI25406J46586_10000009 | JGI25406J46586_1000000947 | 159 |
| 670 | 3300003659 | JGI25404J52841_10020452 | JGI25404J52841_100204522 | 159 |
| 671 | 3300003659 | JGI25404J52841_10091040 | JGI25404J52841_100910401 | 159 |
| 672 | 3300005327 | Ga0070658_10007845 | Ga0070658_100078455 | 159 |
| 673 | 3300005327 | Ga0070658_10068198 | Ga0070658_100681981 | 159 |
| 674 | 3300005329 | Ga0070683_100021476 | Ga0070683_1000214762 | 159 |
| 675 | 3300005329 | Ga0070683_100119491 | Ga0070683_1001194913 | 159 |
| 676 | 3300005329 | Ga0070683_100282679 | Ga0070683_1002826792 | 159 |
| 677 | 3300005336 | Ga0070680_100001803 | Ga0070680_1000018033 | 159 |
| 678 | 3300005336 | Ga0070680_100011799 | Ga0070680_1000117993 | 159 |
| 679 | 3300005336 | Ga0070680_100433827 | Ga0070680_1004338272 | 159 |
| 680 | 3300005336 | Ga0070680_100493238 | Ga0070680_1004932382 | 159 |
| 681 | 3300005337 | Ga0070682_100104401 | Ga0070682_1001044012 | 159 |
| 682 | 3300005338 | Ga0068868_100041686 | Ga0068868_1000416863 | 159 |
| 683 | 3300005339 | Ga0070660_100011735 | Ga0070660_1000117354 | 159 |
| 684 | 3300005341 | Ga0070691_10001192 | Ga0070691_100011922 | 159 |
| 685 | 3300005341 | Ga0070691_10089264 | Ga0070691_100892642 | 159 |
| 686 | 3300005355 | Ga0070671_101090832 | Ga0070671_1010908321 | 159 |
| 687 | 3300005356 | Ga0070674_100114276 | Ga0070674_1001142763 | 159 |
| 688 | 3300005364 | Ga0070673_100635591 | Ga0070673_1006355912 | 159 |
| 689 | 3300005434 | Ga0070709_10003808 | Ga0070709_100038081 | 159 |
| 690 | 3300005434 | Ga0070709_10007552 | Ga0070709_100075525 | 159 |
| 691 | 3300005434 | Ga0070709_10057714 | Ga0070709_100577142 | 159 |
| 692 | 3300005434 | Ga0070709_11067153 | Ga0070709_110671531 | 159 |
| 693 | 3300005435 | Ga0070714_100028634 | Ga0070714_1000286342 | 159 |
| 694 | 3300005435 | Ga0070714_100093490 | Ga0070714_1000934903 | 159 |
| 695 | 3300005435 | Ga0070714_100160852 | Ga0070714_1001608522 | 159 |
| 696 | 3300005435 | Ga0070714_100249116 | Ga0070714_1002491162 | 159 |
| 697 | 3300005435 | Ga0070714_100882843 | Ga0070714_1008828431 | 159 |
| 698 | 3300005436 | Ga0070713_100002435 | Ga0070713_1000024352 | 159 |
| 699 | 3300005436 | Ga0070713_100073158 | Ga0070713_1000731582 | 159 |
| 700 | 3300005436 | Ga0070713_100131735 | Ga0070713_1001317352 | 159 |
| 701 | 3300005436 | Ga0070713_100258840 | Ga0070713_1002588402 | 159 |
| 702 | 3300005436 | Ga0070713_100286853 | Ga0070713_1002868532 | 159 |
| 703 | 3300005437 | Ga0070710_10002245 | Ga0070710_1000224511 | 159 |
| 704 | 3300005437 | Ga0070710_10006209 | Ga0070710_100062092 | 159 |
| 705 | 3300005437 | Ga0070710_10260683 | Ga0070710_102606832 | 159 |
| 706 | 3300005437 | Ga0070710_10456928 | Ga0070710_104569282 | 159 |
| 707 | 3300005439 | Ga0070711_100002514 | Ga0070711_10000251411 | 159 |
| 708 | 3300005439 | Ga0070711_100024311 | Ga0070711_1000243112 | 159 |
| 709 | 3300005439 | Ga0070711_100039210 | Ga0070711_1000392104 | 159 |
| 710 | 3300005439 | Ga0070711_100342004 | Ga0070711_1003420042 | 159 |
| 711 | 3300005445 | Ga0070708_100735694 | Ga0070708_1007356942 | 159 |
| 712 | 3300005455 | Ga0070663_100164013 | Ga0070663_1001640132 | 159 |
| 713 | 3300005456 | Ga0070678_100029826 | Ga0070678_1000298264 | 159 |
| 714 | 3300005456 | Ga0070678_100062529 | Ga0070678_1000625293 | 159 |
| 715 | 3300005458 | Ga0070681_10009096 | Ga0070681_100090968 | 159 |
| 716 | 3300005458 | Ga0070681_10147974 | Ga0070681_101479742 | 159 |
| 717 | 3300005458 | Ga0070681_10155196 | Ga0070681_101551962 | 159 |
| 718 | 3300005458 | Ga0070681_10225037 | Ga0070681_102250372 | 159 |
| 719 | 3300005458 | Ga0070681_10715255 | Ga0070681_107152552 | 159 |
| 720 | 3300005468 | Ga0070707_100131402 | Ga0070707_1001314023 | 159 |
| 721 | 3300005471 | Ga0070698_100293524 | Ga0070698_1002935242 | 159 |
| 722 | 3300005518 | Ga0070699_101436602 | Ga0070699_1014366021 | 159 |
| 723 | 3300005530 | Ga0070679_100005316 | Ga0070679_10000531611 | 159 |
| 724 | 3300005535 | Ga0070684_100018865 | Ga0070684_1000188652 | 159 |
| 725 | 3300005535 | Ga0070684_100040283 | Ga0070684_1000402833 | 159 |
| 726 | 3300005535 | Ga0070684_100191844 | Ga0070684_1001918441 | 159 |
| 727 | 3300005539 | Ga0068853_100021395 | Ga0068853_1000213953 | 159 |
| 728 | 3300005539 | Ga0068853_100141746 | Ga0068853_1001417462 | 159 |
| 729 | 3300005539 | Ga0068853_100248758 | Ga0068853_1002487583 | 159 |
| 730 | 3300005543 | Ga0070672_100257256 | Ga0070672_1002572562 | 159 |
| 731 | 3300005543 | Ga0070672_101140541 | Ga0070672_1011405411 | 159 |
| 732 | 3300005548 | Ga0070665_100044811 | Ga0070665_1000448111 | 159 |
| 733 | 3300005548 | Ga0070665_100549915 | Ga0070665_1005499152 | 159 |
| 734 | 3300005548 | Ga0070665_100784671 | Ga0070665_1007846712 | 159 |
| 735 | 3300005548 | Ga0070665_101924692 | Ga0070665_1019246921 | 159 |
| 736 | 3300005563 | Ga0068855_100032725 | Ga0068855_1000327252 | 159 |
| 737 | 3300005563 | Ga0068855_100056856 | Ga0068855_1000568564 | 159 |
| 738 | 3300005563 | Ga0068855_100065587 | Ga0068855_1000655875 | 159 |
| 739 | 3300005563 | Ga0068855_100170343 | Ga0068855_1001703432 | 159 |
| 740 | 3300005563 | Ga0068855_100186786 | Ga0068855_1001867862 | 159 |
| 741 | 3300005563 | Ga0068855_100691188 | Ga0068855_1006911882 | 159 |
| 742 | 3300005564 | Ga0070664_100245982 | Ga0070664_1002459822 | 159 |
| 743 | 3300005564 | Ga0070664_100797496 | Ga0070664_1007974962 | 159 |
| 744 | 3300005564 | Ga0070664_101482409 | Ga0070664_1014824091 | 159 |
| 745 | 3300005577 | Ga0068857_100013137 | Ga0068857_1000131373 | 159 |
| 746 | 3300005577 | Ga0068857_100051455 | Ga0068857_1000514552 | 159 |
| 747 | 3300005614 | Ga0068856_100006491 | Ga0068856_10000649111 | 159 |
| 748 | 3300005614 | Ga0068856_100147819 | Ga0068856_1001478192 | 159 |
| 749 | 3300005614 | Ga0068856_100245946 | Ga0068856_1002459462 | 159 |
| 750 | 3300005614 | Ga0068856_100266581 | Ga0068856_1002665812 | 159 |
| 751 | 3300005614 | Ga0068856_100702331 | Ga0068856_1007023312 | 159 |
| 752 | 3300005614 | Ga0068856_101172716 | Ga0068856_1011727162 | 159 |
| 753 | 3300005616 | Ga0068852_100575395 | Ga0068852_1005753952 | 159 |
| 754 | 3300005617 | Ga0068859_100214710 | Ga0068859_1002147103 | 159 |
| 755 | 3300005718 | Ga0068866_10164293 | Ga0068866_101642932 | 159 |
| 756 | 3300005719 | Ga0068861_101164855 | Ga0068861_1011648552 | 159 |
| 757 | 3300005834 | Ga0068851_10034114 | Ga0068851_100341143 | 159 |
| 758 | 3300005840 | Ga0068870_10300733 | Ga0068870_103007332 | 159 |
| 759 | 3300005842 | Ga0068858_101009146 | Ga0068858_1010091462 | 159 |
| 760 | 3300005843 | Ga0068860_100320673 | Ga0068860_1003206732 | 159 |
| 761 | 3300005937 | Ga0081455_10000633 | Ga0081455_1000063336 | 159 |
| 762 | 3300005937 | Ga0081455_10007244 | Ga0081455_100072447 | 159 |
| 763 | 3300005937 | Ga0081455_10144769 | Ga0081455_101447692 | 159 |
| 764 | 3300005983 | Ga0081540_1004295 | Ga0081540_10042957 | 159 |
| 765 | 3300005983 | Ga0081540_1015480 | Ga0081540_10154805 | 159 |
| 766 | 3300005983 | Ga0081540_1020000 | Ga0081540_10200002 | 159 |
| 767 | 3300005983 | Ga0081540_1114366 | Ga0081540_11143662 | 159 |
| 768 | 3300005983 | Ga0081540_1147325 | Ga0081540_11473252 | 159 |
| 769 | 3300005985 | Ga0081539_10000048 | Ga0081539_10000048100 | 159 |
| 770 | 3300005985 | Ga0081539_10000203 | Ga0081539_10000203135 | 159 |
| 771 | 3300006028 | Ga0070717_10001217 | Ga0070717_1000121711 | 159 |
| 772 | 3300006028 | Ga0070717_10033689 | Ga0070717_100336892 | 159 |
| 773 | 3300006028 | Ga0070717_10711403 | Ga0070717_107114032 | 159 |
| 774 | 3300006028 | Ga0070717_10793140 | Ga0070717_107931402 | 159 |
| 775 | 3300006028 | Ga0070717_10901607 | Ga0070717_109016072 | 159 |
| 776 | 3300006038 | Ga0075365_10057450 | Ga0075365_100574502 | 159 |
| 777 | 3300006048 | Ga0075363_100094048 | Ga0075363_1000940482 | 159 |
| 778 | 3300006051 | Ga0075364_10669074 | Ga0075364_106690742 | 159 |
| 779 | 3300006163 | Ga0070715_10241348 | Ga0070715_102413482 | 159 |
| 780 | 3300006163 | Ga0070715_10398088 | Ga0070715_103980881 | 159 |
| 781 | 3300006173 | Ga0070716_100017080 | Ga0070716_1000170802 | 159 |
| 782 | 3300006173 | Ga0070716_100044733 | Ga0070716_1000447334 | 159 |
| 783 | 3300006173 | Ga0070716_100351381 | Ga0070716_1003513812 | 159 |
| 784 | 3300006173 | Ga0070716_100445426 | Ga0070716_1004454262 | 159 |
| 785 | 3300006175 | Ga0070712_100010424 | Ga0070712_1000104242 | 159 |
| 786 | 3300006175 | Ga0070712_100027750 | Ga0070712_1000277501 | 159 |
| 787 | 3300006175 | Ga0070712_100117209 | Ga0070712_1001172092 | 159 |
| 788 | 3300006175 | Ga0070712_100473801 | Ga0070712_1004738012 | 159 |
| 789 | 3300006175 | Ga0070712_100566390 | Ga0070712_1005663902 | 159 |
| 790 | 3300006178 | Ga0075367_10152067 | Ga0075367_101520672 | 159 |
| 791 | 3300006178 | Ga0075367_10231237 | Ga0075367_102312371 | 159 |
| 792 | 3300006178 | Ga0075367_10418586 | Ga0075367_104185862 | 159 |
| 793 | 3300006358 | Ga0068871_100315755 | Ga0068871_1003157552 | 159 |
| 794 | 3300006358 | Ga0068871_100540174 | Ga0068871_1005401742 | 159 |
| 795 | 3300006871 | Ga0075434_100028126 | Ga0075434_1000281264 | 159 |
| 796 | 3300006931 | Ga0097620_100214708 | Ga0097620_1002147083 | 159 |
| 797 | 3300006941 | Ga0099825_1036353 | Ga0099825_10363532 | 159 |
| 798 | 3300006942 | Ga0099824_1012432 | Ga0099824_10124327 | 159 |
| 799 | 3300006943 | Ga0099822_1000676 | Ga0099822_10006768 | 159 |
| 800 | 3300007076 | Ga0075435_100033061 | Ga0075435_1000330612 | 159 |
| 801 | 3300007076 | Ga0075435_100570463 | Ga0075435_1005704632 | 159 |
| 802 | 3300007788 | Ga0099795_10018379 | Ga0099795_100183792 | 159 |
| 803 | 3300007788 | Ga0099795_10150933 | Ga0099795_101509332 | 159 |
| 804 | 3300009093 | Ga0105240_10010432 | Ga0105240_100104328 | 159 |
| 805 | 3300009093 | Ga0105240_10022388 | Ga0105240_100223887 | 159 |
| 806 | 3300009093 | Ga0105240_10052813 | Ga0105240_100528135 | 159 |
| 807 | 3300009093 | Ga0105240_10488562 | Ga0105240_104885622 | 159 |
| 808 | 3300009093 | Ga0105240_10961608 | Ga0105240_109616082 | 159 |
| 809 | 3300009093 | Ga0105240_11643168 | Ga0105240_116431682 | 159 |
| 810 | 3300009098 | Ga0105245_11955993 | Ga0105245_119559932 | 159 |
| 811 | 3300009174 | Ga0105241_10822697 | Ga0105241_108226972 | 159 |
| 812 | 3300009176 | Ga0105242_11506969 | Ga0105242_115069691 | 159 |
| 813 | 3300009177 | Ga0105248_11436330 | Ga0105248_114363302 | 159 |
| 814 | 3300009545 | Ga0105237_10127776 | Ga0105237_101277762 | 159 |
| 815 | 3300009545 | Ga0105237_10227928 | Ga0105237_102279283 | 159 |
| 816 | 3300009551 | Ga0105238_10054676 | Ga0105238_100546762 | 159 |
| 817 | 3300009551 | Ga0105238_10220793 | Ga0105238_102207932 | 159 |
| 818 | 3300009551 | Ga0105238_10657626 | Ga0105238_106576262 | 159 |
| 819 | 3300010159 | Ga0099796_10058628 | Ga0099796_100586282 | 159 |
| 820 | 3300010159 | Ga0099796_10309674 | Ga0099796_103096741 | 159 |
| 821 | 3300010375 | Ga0105239_10057882 | Ga0105239_100578823 | 159 |
| 822 | 3300010375 | Ga0105239_10158415 | Ga0105239_101584153 | 159 |
| 823 | 3300010375 | Ga0105239_10547140 | Ga0105239_105471402 | 159 |
| 824 | 3300010375 | Ga0105239_11595024 | Ga0105239_115950242 | 159 |
| 825 | 3300010375 | Ga0105239_13011793 | Ga0105239_130117931 | 159 |
| 826 | 3300011119 | Ga0105246_10031311 | Ga0105246_100313114 | 159 |
| 827 | 3300013100 | Ga0157373_10258670 | Ga0157373_102586701 | 159 |
| 828 | 3300013104 | Ga0157370_10136478 | Ga0157370_101364782 | 159 |
| 829 | 3300013104 | Ga0157370_10237235 | Ga0157370_102372351 | 159 |
| 830 | 3300013104 | Ga0157370_10314118 | Ga0157370_103141182 | 159 |
| 831 | 3300013104 | Ga0157370_10946928 | Ga0157370_109469281 | 159 |
| 832 | 3300013105 | Ga0157369_10121716 | Ga0157369_101217162 | 159 |
| 833 | 3300013105 | Ga0157369_10246166 | Ga0157369_102461662 | 159 |
| 834 | 3300013105 | Ga0157369_10335635 | Ga0157369_103356352 | 159 |
| 835 | 3300013296 | Ga0157374_10071292 | Ga0157374_100712921 | 159 |
| 836 | 3300013296 | Ga0157374_10085422 | Ga0157374_100854222 | 159 |
| 837 | 3300013296 | Ga0157374_11006947 | Ga0157374_110069472 | 159 |
| 838 | 3300013297 | Ga0157378_10059778 | Ga0157378_100597783 | 159 |
| 839 | 3300013297 | Ga0157378_10557641 | Ga0157378_105576412 | 159 |
| 840 | 3300013306 | Ga0163162_10162094 | Ga0163162_101620942 | 159 |
| 841 | 3300013306 | Ga0163162_10798576 | Ga0163162_107985762 | 159 |
| 842 | 3300013308 | Ga0157375_10165114 | Ga0157375_101651142 | 159 |
| 843 | 3300014325 | Ga0163163_10048338 | Ga0163163_100483382 | 159 |
| 844 | 3300014969 | Ga0157376_10037168 | Ga0157376_100371684 | 159 |
| 845 | 3300014969 | Ga0157376_11981849 | Ga0157376_119818491 | 159 |
| 846 | 3300017792 | Ga0163161_10480318 | Ga0163161_104803182 | 159 |
| 847 | 3300020069 | Ga0197907_10033556 | Ga0197907_100335562 | 159 |
| 848 | 3300020078 | Ga0206352_10877984 | Ga0206352_108779842 | 159 |
| 849 | 3300020082 | Ga0206353_10274628 | Ga0206353_102746282 | 159 |
| 850 | 3300021377 | Ga0213874_10064230 | Ga0213874_100642302 | 159 |
| 851 | 3300021384 | Ga0213876_10085041 | Ga0213876_100850412 | 159 |
| 852 | 3300021388 | Ga0213875_10022449 | Ga0213875_100224492 | 159 |
| 853 | 3300025321 | Ga0207656_10037335 | Ga0207656_100373352 | 159 |
| 854 | 3300025898 | Ga0207692_10051478 | Ga0207692_100514782 | 159 |
| 855 | 3300025898 | Ga0207692_10052673 | Ga0207692_100526733 | 159 |
| 856 | 3300025898 | Ga0207692_10381735 | Ga0207692_103817352 | 159 |
| 857 | 3300025898 | Ga0207692_10542414 | Ga0207692_105424142 | 159 |
| 858 | 3300025905 | Ga0207685_10045309 | Ga0207685_100453092 | 159 |
| 859 | 3300025905 | Ga0207685_10068327 | Ga0207685_100683272 | 159 |
| 860 | 3300025906 | Ga0207699_10007093 | Ga0207699_100070935 | 159 |
| 861 | 3300025906 | Ga0207699_10014450 | Ga0207699_100144502 | 159 |
| 862 | 3300025906 | Ga0207699_10066405 | Ga0207699_100664053 | 159 |
| 863 | 3300025909 | Ga0207705_10034900 | Ga0207705_100349003 | 159 |
| 864 | 3300025909 | Ga0207705_10063236 | Ga0207705_100632362 | 159 |
| 865 | 3300025910 | Ga0207684_10558205 | Ga0207684_105582052 | 159 |
| 866 | 3300025910 | Ga0207684_10926391 | Ga0207684_109263912 | 159 |
| 867 | 3300025912 | Ga0207707_10008752 | Ga0207707_100087526 | 159 |
| 868 | 3300025912 | Ga0207707_10013145 | Ga0207707_100131456 | 159 |
| 869 | 3300025912 | Ga0207707_10219273 | Ga0207707_102192732 | 159 |
| 870 | 3300025912 | Ga0207707_10367627 | Ga0207707_103676272 | 159 |
| 871 | 3300025912 | Ga0207707_10551254 | Ga0207707_105512541 | 159 |
| 872 | 3300025913 | Ga0207695_10078385 | Ga0207695_100783853 | 159 |
| 873 | 3300025913 | Ga0207695_10241413 | Ga0207695_102414132 | 159 |
| 874 | 3300025913 | Ga0207695_10273131 | Ga0207695_102731312 | 159 |
| 875 | 3300025913 | Ga0207695_10446680 | Ga0207695_104466802 | 159 |
| 876 | 3300025914 | Ga0207671_10117481 | Ga0207671_101174812 | 159 |
| 877 | 3300025914 | Ga0207671_10357077 | Ga0207671_103570772 | 159 |
| 878 | 3300025914 | Ga0207671_10590255 | Ga0207671_105902552 | 159 |
| 879 | 3300025915 | Ga0207693_10007651 | Ga0207693_100076512 | 159 |
| 880 | 3300025915 | Ga0207693_10011694 | Ga0207693_100116948 | 159 |
| 881 | 3300025915 | Ga0207693_10027350 | Ga0207693_100273502 | 159 |
| 882 | 3300025915 | Ga0207693_10126980 | Ga0207693_101269803 | 159 |
| 883 | 3300025915 | Ga0207693_10272266 | Ga0207693_102722661 | 159 |
| 884 | 3300025916 | Ga0207663_10007481 | Ga0207663_100074812 | 159 |
| 885 | 3300025916 | Ga0207663_10032758 | Ga0207663_100327582 | 159 |
| 886 | 3300025916 | Ga0207663_10032999 | Ga0207663_100329993 | 159 |
| 887 | 3300025916 | Ga0207663_10918655 | Ga0207663_109186552 | 159 |
| 888 | 3300025917 | Ga0207660_10032733 | Ga0207660_100327333 | 159 |
| 889 | 3300025917 | Ga0207660_10074168 | Ga0207660_100741682 | 159 |
| 890 | 3300025919 | Ga0207657_10002580 | Ga0207657_1000258016 | 159 |
| 891 | 3300025920 | Ga0207649_10114372 | Ga0207649_101143722 | 159 |
| 892 | 3300025921 | Ga0207652_10007221 | Ga0207652_100072213 | 159 |
| 893 | 3300025921 | Ga0207652_10014787 | Ga0207652_100147875 | 159 |
| 894 | 3300025921 | Ga0207652_10230571 | Ga0207652_102305712 | 159 |
| 895 | 3300025921 | Ga0207652_10343884 | Ga0207652_103438842 | 159 |
| 896 | 3300025922 | Ga0207646_10239429 | Ga0207646_102394292 | 159 |
| 897 | 3300025924 | Ga0207694_10033330 | Ga0207694_100333302 | 159 |
| 898 | 3300025924 | Ga0207694_10078105 | Ga0207694_100781052 | 159 |
| 899 | 3300025924 | Ga0207694_10146877 | Ga0207694_101468772 | 159 |
| 900 | 3300025924 | Ga0207694_10538059 | Ga0207694_105380592 | 159 |
| 901 | 3300025924 | Ga0207694_10654411 | Ga0207694_106544112 | 159 |
| 902 | 3300025924 | Ga0207694_10721508 | Ga0207694_107215082 | 159 |
| 903 | 3300025926 | Ga0207659_10057464 | Ga0207659_100574643 | 159 |
| 904 | 3300025927 | Ga0207687_10496593 | Ga0207687_104965932 | 159 |
| 905 | 3300025928 | Ga0207700_10003283 | Ga0207700_100032835 | 159 |
| 906 | 3300025928 | Ga0207700_10041218 | Ga0207700_100412183 | 159 |
| 907 | 3300025928 | Ga0207700_10068583 | Ga0207700_100685832 | 159 |
| 908 | 3300025928 | Ga0207700_10096383 | Ga0207700_100963832 | 159 |
| 909 | 3300025928 | Ga0207700_10219871 | Ga0207700_102198712 | 159 |
| 910 | 3300025928 | Ga0207700_10237564 | Ga0207700_102375642 | 159 |
| 911 | 3300025929 | Ga0207664_10022106 | Ga0207664_100221062 | 159 |
| 912 | 3300025929 | Ga0207664_10055824 | Ga0207664_100558243 | 159 |
| 913 | 3300025929 | Ga0207664_10066442 | Ga0207664_100664422 | 159 |
| 914 | 3300025929 | Ga0207664_10230436 | Ga0207664_102304362 | 159 |
| 915 | 3300025929 | Ga0207664_10295012 | Ga0207664_102950122 | 159 |
| 916 | 3300025935 | Ga0207709_10186625 | Ga0207709_101866252 | 159 |
| 917 | 3300025939 | Ga0207665_10007232 | Ga0207665_100072322 | 159 |
| 918 | 3300025939 | Ga0207665_10029943 | Ga0207665_100299433 | 159 |
| 919 | 3300025939 | Ga0207665_10258544 | Ga0207665_102585442 | 159 |
| 920 | 3300025939 | Ga0207665_10445960 | Ga0207665_104459602 | 159 |
| 921 | 3300025939 | Ga0207665_10627619 | Ga0207665_106276192 | 159 |
| 922 | 3300025939 | Ga0207665_11122585 | Ga0207665_111225851 | 159 |
| 923 | 3300025940 | Ga0207691_10111293 | Ga0207691_101112932 | 159 |
| 924 | 3300025941 | Ga0207711_10956781 | Ga0207711_109567812 | 159 |
| 925 | 3300025944 | Ga0207661_10000889 | Ga0207661_100008898 | 159 |
| 926 | 3300025944 | Ga0207661_10073195 | Ga0207661_100731952 | 159 |
| 927 | 3300025944 | Ga0207661_10739204 | Ga0207661_107392042 | 159 |
| 928 | 3300025945 | Ga0207679_10256917 | Ga0207679_102569172 | 159 |
| 929 | 3300025949 | Ga0207667_10011892 | Ga0207667_100118925 | 159 |
| 930 | 3300025949 | Ga0207667_10054977 | Ga0207667_100549773 | 159 |
| 931 | 3300025949 | Ga0207667_10167961 | Ga0207667_101679612 | 159 |
| 932 | 3300025960 | Ga0207651_10103843 | Ga0207651_101038433 | 159 |
| 933 | 3300026023 | Ga0207677_10010857 | Ga0207677_100108574 | 159 |
| 934 | 3300026041 | Ga0207639_10096777 | Ga0207639_100967772 | 159 |
| 935 | 3300026041 | Ga0207639_10280171 | Ga0207639_102801712 | 159 |
| 936 | 3300026041 | Ga0207639_10341575 | Ga0207639_103415752 | 159 |
| 937 | 3300026041 | Ga0207639_10525913 | Ga0207639_105259132 | 159 |
| 938 | 3300026041 | Ga0207639_10591691 | Ga0207639_105916912 | 159 |
| 939 | 3300026078 | Ga0207702_10000433 | Ga0207702_1000043348 | 159 |
| 940 | 3300026078 | Ga0207702_10156956 | Ga0207702_101569562 | 159 |
| 941 | 3300026078 | Ga0207702_10336092 | Ga0207702_103360922 | 159 |
| 942 | 3300026078 | Ga0207702_11344313 | Ga0207702_113443132 | 159 |
| 943 | 3300026116 | Ga0207674_10020134 | Ga0207674_100201343 | 159 |
| 944 | 3300026116 | Ga0207674_10047317 | Ga0207674_100473174 | 159 |
| 945 | 3300026118 | Ga0207675_100218915 | Ga0207675_1002189151 | 159 |
| 946 | 3300026121 | Ga0207683_10022491 | Ga0207683_100224912 | 159 |
| 947 | 3300026121 | Ga0207683_10027057 | Ga0207683_100270571 | 159 |
| 948 | 3300026121 | Ga0207683_10550524 | Ga0207683_105505242 | 159 |
| 949 | 3300026121 | Ga0207683_10652695 | Ga0207683_106526952 | 159 |
| 950 | 3300026121 | Ga0207683_10986456 | Ga0207683_109864561 | 159 |
| 951 | 3300026142 | Ga0207698_10168949 | Ga0207698_101689492 | 159 |
| 952 | 3300026142 | Ga0207698_10195622 | Ga0207698_101956222 | 159 |
| 953 | 3300026142 | Ga0207698_11186307 | Ga0207698_111863072 | 159 |
| 954 | 3300026142 | Ga0207698_11492278 | Ga0207698_114922782 | 159 |
| 955 | 3300027357 | Ga0209589_1000009 | Ga0209589_1000009197 | 159 |
| 956 | 3300027361 | Ga0209489_100010 | Ga0209489_10001073 | 159 |
| 957 | 3300027363 | Ga0209700_100017 | Ga0209700_10001773 | 159 |
| 958 | 3300027866 | Ga0209813_10231557 | Ga0209813_102315571 | 159 |
| 959 | 3300028379 | Ga0268266_10330383 | Ga0268266_103303832 | 159 |
| 960 | 3300028379 | Ga0268266_10818337 | Ga0268266_108183371 | 159 |
| 961 | 3300028379 | Ga0268266_11631259 | Ga0268266_116312591 | 159 |
| 962 | 3300028381 | Ga0268264_10582119 | Ga0268264_105821192 | 159 |
| 963 | 3300028573 | Ga0265334_10009203 | Ga0265334_100092032 | 159 |
| 964 | 3300028786 | Ga0307517_10000512 | Ga0307517_1000051244 | 159 |
| 965 | 3300028794 | Ga0307515_10007488 | Ga0307515_1000748815 | 159 |
| 966 | 3300028800 | Ga0265338_10369397 | Ga0265338_103693971 | 159 |
| 967 | 3300031235 | Ga0265330_10042318 | Ga0265330_100423182 | 159 |
| 968 | 3300031238 | Ga0265332_10017124 | Ga0265332_100171242 | 159 |
| 969 | 3300031456 | Ga0307513_10066917 | Ga0307513_100669172 | 159 |
| 970 | 3300031507 | Ga0307509_10362884 | Ga0307509_103628842 | 159 |
| 971 | 3300031507 | Ga0307509_10555128 | Ga0307509_105551281 | 159 |
| 972 | 3300031548 | Ga0307408_100274895 | Ga0307408_1002748952 | 159 |
| 973 | 3300031616 | Ga0307508_10000514 | Ga0307508_1000051436 | 159 |
| 974 | 3300031711 | Ga0265314_10011527 | Ga0265314_100115275 | 159 |
| 975 | 3300031730 | Ga0307516_10011779 | Ga0307516_100117797 | 159 |
| 976 | 3300031730 | Ga0307516_10268754 | Ga0307516_102687542 | 159 |
| 977 | 3300031901 | Ga0307406_10151527 | Ga0307406_101515272 | 159 |
| 978 | 3300031903 | Ga0307407_10540635 | Ga0307407_105406352 | 159 |
| 979 | 3300031911 | Ga0307412_10070318 | Ga0307412_100703182 | 159 |
| 980 | 3300032002 | Ga0307416_100091588 | Ga0307416_1000915882 | 159 |
| 981 | 3300032005 | Ga0307411_10609426 | Ga0307411_106094261 | 159 |
| 982 | 3300032126 | Ga0307415_100635159 | Ga0307415_1006351592 | 159 |
| 983 | 3300033180 | Ga0307510_10023408 | Ga0307510_100234082 | 159 |
| 984 | 3300033544 | Ga0316215_1004581 | Ga0316215_10045812 | 159 |
| 985 | 3300035088 | Ga0373940_0208698 | Ga0373940_0208698_132_629 | 159 |
| 986 | 3300035089 | Ga0373944_0045956 | Ga0373944_0045956_308_790 | 159 |
| 987 | 3300035091 | Ga0373951_0069421 | Ga0373951_0069421_83_565 | 159 |
| 988 | 3300035092 | Ga0373952_0105437 | Ga0373952_0105437_254_736 | 159 |
| 989 | 3300035113 | Ga0373936_0002974 | Ga0373936_0002974_2736_3218 | 159 |
| 990 | 3300035116 | Ga0373945_0009494 | Ga0373945_0009494_456_938 | 159 |
| 991 | 3300035117 | Ga0373953_0003113 | Ga0373953_0003113_4527_5009 | 159 |
| 992 | 3300035120 | Ga0373957_0004852 | Ga0373957_0004852_306_788 | 159 |
| 993 | 3300035170 | Ga0373943_0023841 | Ga0373943_0023841_1688_2170 | 159 |
| 994 | 3300035171 | Ga0373946_0012423 | Ga0373946_0012423_2523_3005 | 159 |
| 995 | 3300035171 | Ga0373946_0106178 | Ga0373946_0106178_730_1212 | 159 |
| 996 | 3300035692 | Ga0373935_0001637 | Ga0373935_0001637_2421_2903 | 159 |
| 997 | 3300035692 | Ga0373935_0666612 | Ga0373935_0666612_219_701 | 159 |
| 998 | 3300035695 | Ga0373927_0000331 | Ga0373927_0000331_31858_32340 | 159 |
| 999 | 3300035695 | Ga0373927_0005361 | Ga0373927_0005361_5359_5841 | 159 |
| 1000 | 3300035695 | Ga0373927_0018601 | Ga0373927_0018601_2145_2627 | 159 |
| 1001 | 3300035695 | Ga0373927_0075809 | Ga0373927_0075809_50_532 | 159 |
| 1002 | 3300035695 | Ga0373927_0829994 | Ga0373927_0829994_52_531 | 159 |
| 1003 | 3300035724 | Ga0373933_0000377 | Ga0373933_0000377_3854_4336 | 159 |
| 1004 | 3300035724 | Ga0373933_0024966 | Ga0373933_0024966_2509_2991 | 159 |
| 1005 | 3300035724 | Ga0373933_0709833 | Ga0373933_0709833_120_602 | 159 |
| 1006 | 3300035725 | Ga0373947_0005852 | Ga0373947_0005852_3794_4276 | 159 |
| 1007 | 3300035725 | Ga0373947_0015963 | Ga0373947_0015963_3227_3709 | 159 |
| 1008 | 3300035725 | Ga0373947_0032326 | Ga0373947_0032326_2308_2790 | 159 |
| 1009 | 3300035725 | Ga0373947_0037473 | Ga0373947_0037473_1183_1665 | 159 |
| 1010 | 3300036401 | Ga0373937_0015924 | Ga0373937_0015924_3394_3876 | 159 |
| 1011 | 3300037068 | Ga0373925_0029052 | Ga0373925_0029052_299_781 | 159 |
| 1012 | 3300037068 | Ga0373925_0374049 | Ga0373925_0374049_151_633 | 159 |
| 1013 | 3300037068 | Ga0373925_0666181 | Ga0373925_0666181_73_564 | 159 |
| 1014 | 3300037312 | Ga0395899_0009172 | Ga0395899_0009172_6161_6643 | 159 |
| 1015 | 3300037312 | Ga0395899_0138097 | Ga0395899_0138097_497_979 | 159 |
| 1016 | 3300037418 | Ga0395900_0398370 | Ga0395900_0398370_198_680 | 159 |
| 1017 | 3300037466 | Ga0395898_0554086 | Ga0395898_0554086_12_494 | 159 |
| 1018 | 3300037471 | Ga0395905_0647711 | Ga0395905_0647711_279_761 | 159 |
| 1019 | 3300037471 | Ga0395905_0961284 | Ga0395905_0961284_47_541 | 159 |
| 1020 | 3300037853 | Ga0436364_0001304 | Ga0436364_0001304_1832_2314 | 159 |
| 1021 | 3300037853 | Ga0436364_0072718 | Ga0436364_0072718_365_853 | 159 |
| 1022 | 3300037853 | Ga0436364_0942302 | Ga0436364_0942302_578_1060 | 159 |
| 1023 | 3300037853 | Ga0436364_1436174 | Ga0436364_1436174_515_997 | 159 |
| 1024 | 3300038443 | Ga0395901_0054356 | Ga0395901_0054356_1281_1763 | 159 |
| 1025 | 3300038443 | Ga0395901_0084781 | Ga0395901_0084781_359_841 | 159 |
| 1026 | 3300038443 | Ga0395901_0436586 | Ga0395901_0436586_372_854 | 159 |
| 1027 | 3300039437 | Ga0436365_0979043 | Ga0436365_0979043_3995_4477 | 159 |
| 1028 | 3300039437 | Ga0436365_1662883 | Ga0436365_1662883_1188_1670 | 159 |
| 1029 | 3300039437 | Ga0436365_1666053 | Ga0436365_1666053_1988_2470 | 159 |
| 1030 | 3300039438 | Ga0436360_0321210 | Ga0436360_0321210_149_631 | 159 |
| 1031 | 3300039438 | Ga0436360_0805252 | Ga0436360_0805252_245_727 | 159 |
| 1032 | 3300039447 | Ga0436361_0106883 | Ga0436361_0106883_20_502 | 159 |
| 1033 | 3300039447 | Ga0436361_0621214 | Ga0436361_0621214_1319_1801 | 159 |
| 1034 | 3300039450 | Ga0436363_0475902 | Ga0436363_0475902_6735_7262 | 159 |
| 1035 | 3300039450 | Ga0436363_0726196 | Ga0436363_0726196_1846_2328 | 159 |
| 1036 | 3300039450 | Ga0436363_1489761 | Ga0436363_1489761_53_535 | 159 |
| 1037 | 3300041503 | Ga0451847_0078248 | Ga0451847_0078248_311_793 | 159 |
| 1038 | 3300041512 | Ga0451853_3406428 | Ga0451853_3406428_89_568 | 159 |
| 1039 | 3300044694 | Ga0466963_0427356 | Ga0466963_0427356_35_517 | 159 |
| 1040 | 3300044706 | Ga0466964_0088277 | Ga0466964_0088277_678_1160 | 159 |
| 1041 | 3300044765 | Ga0466970_0107661 | Ga0466970_0107661_1007_1489 | 159 |
| 1042 | 3300044842 | Ga0466957_0062703 | Ga0466957_0062703_147_629 | 159 |
| 1043 | 3300045049 | Ga0466959_0149442 | Ga0466959_0149442_231_713 | 159 |
| 1044 | 3300045976 | Ga0466967_0838165 | Ga0466967_0838165_29_511 | 159 |
| 1045 | 3300045976 | Ga0466967_1260624 | Ga0466967_1260624_123_605 | 159 |
| 1046 | 3300046454 | Ga0495592_0033915 | Ga0495592_0033915_2113_2595 | 159 |
| 1047 | 3300046454 | Ga0495592_0127916 | Ga0495592_0127916_1082_1564 | 159 |
| 1048 | 3300046455 | Ga0495603_0015303 | Ga0495603_0015303_4022_4504 | 159 |
| 1049 | 3300046455 | Ga0495603_0039904 | Ga0495603_0039904_294_776 | 159 |
| 1050 | 3300046455 | Ga0495603_0053664 | Ga0495603_0053664_707_1189 | 159 |
| 1051 | 3300046455 | Ga0495603_0127432 | Ga0495603_0127432_104_586 | 159 |
| 1052 | 3300046459 | Ga0495629_0001243 | Ga0495629_0001243_9477_9959 | 159 |
| 1053 | 3300046461 | Ga0495641_0004926 | Ga0495641_0004926_6024_6506 | 159 |
| 1054 | 3300046461 | Ga0495641_0153169 | Ga0495641_0153169_175_657 | 159 |
| 1055 | 3300046462 | Ga0495651_0086681 | Ga0495651_0086681_1719_2201 | 159 |
| 1056 | 3300046462 | Ga0495651_0641549 | Ga0495651_0641549_121_603 | 159 |
| 1057 | 3300046462 | Ga0495651_0690597 | Ga0495651_0690597_115_597 | 159 |
| 1058 | 3300046463 | Ga0495653_0011097 | Ga0495653_0011097_4796_5278 | 159 |
| 1059 | 3300046472 | Ga0495580_0001284 | Ga0495580_0001284_9262_9744 | 159 |
| 1060 | 3300046472 | Ga0495580_0085993 | Ga0495580_0085993_1161_1643 | 159 |
| 1061 | 3300046472 | Ga0495580_0282542 | Ga0495580_0282542_357_839 | 159 |
| 1062 | 3300046472 | Ga0495580_0355421 | Ga0495580_0355421_376_858 | 159 |
| 1063 | 3300046473 | Ga0495582_0000166 | Ga0495582_0000166_9338_9820 | 159 |
| 1064 | 3300046475 | Ga0495639_0001186 | Ga0495639_0001186_9337_9819 | 159 |
| 1065 | 3300046476 | Ga0495662_0000887 | Ga0495662_0000887_8142_8624 | 159 |
| 1066 | 3300046477 | Ga0495664_0071918 | Ga0495664_0071918_1152_1634 | 159 |
| 1067 | 3300046477 | Ga0495664_0081855 | Ga0495664_0081855_1187_1669 | 159 |
| 1068 | 3300046499 | Ga0495594_0000692 | Ga0495594_0000692_9306_9788 | 159 |
| 1069 | 3300046499 | Ga0495594_0266004 | Ga0495594_0266004_244_726 | 159 |
| 1070 | 3300046507 | Ga0495606_0000939 | Ga0495606_0000939_13651_14133 | 159 |
| 1071 | 3300046511 | Ga0495608_0140480 | Ga0495608_0140480_625_1107 | 159 |
| 1072 | 3300046514 | Ga0495618_0063817 | Ga0495618_0063817_1545_2027 | 159 |
| 1073 | 3300046516 | Ga0495628_0074488 | Ga0495628_0074488_1343_1825 | 159 |
| 1074 | 3300046517 | Ga0495630_0007555 | Ga0495630_0007555_829_1311 | 159 |
| 1075 | 3300046526 | Ga0495666_0027403 | Ga0495666_0027403_1735_2217 | 159 |
| 1076 | 3300046529 | Ga0495652_0204026 | Ga0495652_0204026_162_644 | 159 |
| 1077 | 3300046531 | Ga0495665_0000104 | Ga0495665_0000104_33886_34368 | 159 |
| 1078 | 3300046531 | Ga0495665_0620360 | Ga0495665_0620360_27_509 | 159 |
| 1079 | 3300046533 | Ga0495640_0008638 | Ga0495640_0008638_4416_4898 | 159 |
| 1080 | 3300046543 | Ga0495645_0034120 | Ga0495645_0034120_852_1334 | 159 |
| 1081 | 3300046557 | Ga0495622_0064799 | Ga0495622_0064799_1105_1587 | 159 |
| 1082 | 3300046615 | Ga0495656_0105143 | Ga0495656_0105143_580_1062 | 159 |
| 1083 | 3300046616 | Ga0495668_0339777 | Ga0495668_0339777_252_734 | 159 |
| 1084 | 3300046642 | Ga0495634_0004417 | Ga0495634_0004417_5417_5899 | 159 |
| 1085 | 3300046642 | Ga0495634_0018689 | Ga0495634_0018689_40_522 | 159 |
| 1086 | 3300046660 | Ga0495625_0275271 | Ga0495625_0275271_475_954 | 159 |
| 1087 | 3300046663 | Ga0495635_0001205 | Ga0495635_0001205_12576_13058 | 159 |
| 1088 | 3300046663 | Ga0495635_0008253 | Ga0495635_0008253_4811_5293 | 159 |
| 1089 | 3300046674 | Ga0495588_0038217 | Ga0495588_0038217_1635_2117 | 159 |
| 1090 | 3300046678 | Ga0495599_0762684 | Ga0495599_0762684_17_499 | 159 |
| 1091 | 3300046679 | Ga0495623_0296622 | Ga0495623_0296622_121_603 | 159 |
| 1092 | 3300046680 | Ga0495646_0002999 | Ga0495646_0002999_9652_10134 | 159 |
| 1093 | 3300046680 | Ga0495646_0003385 | Ga0495646_0003385_7622_8104 | 159 |
| 1094 | 3300046681 | Ga0495647_0005695 | Ga0495647_0005695_466_948 | 159 |
| 1095 | 3300046683 | Ga0495658_0002138 | Ga0495658_0002138_2999_3481 | 159 |
| 1096 | 3300046684 | Ga0495669_0412982 | Ga0495669_0412982_72_566 | 159 |
| 1097 | 3300046689 | Ga0495613_0025996 | Ga0495613_0025996_3625_4107 | 159 |
| 1098 | 3300046689 | Ga0495613_0051891 | Ga0495613_0051891_1965_2447 | 159 |
| 1099 | 3300046690 | Ga0495624_0002866 | Ga0495624_0002866_8225_8707 | 159 |
| 1100 | 3300046690 | Ga0495624_0400748 | Ga0495624_0400748_178_660 | 159 |
| 1101 | 3300046690 | Ga0495624_0403886 | Ga0495624_0403886_292_774 | 159 |
| 1102 | 3300046690 | Ga0495624_0461862 | Ga0495624_0461862_210_692 | 159 |
| 1103 | 3300046794 | Ga0495589_0083491 | Ga0495589_0083491_1022_1516 | 159 |
| 1104 | 3300046809 | Ga0495600_0121962 | Ga0495600_0121962_689_1171 | 159 |
| 1105 | 3300046809 | Ga0495600_0454079 | Ga0495600_0454079_230_712 | 159 |
| 1106 | 3300046809 | Ga0495600_0631648 | Ga0495600_0631648_21_503 | 159 |
| 1107 | 3300047315 | Ga0495581_0000391 | Ga0495581_0000391_9337_9819 | 159 |
| 1108 | 3300047315 | Ga0495581_0123057 | Ga0495581_0123057_426_923 | 159 |
| 1109 | 3300047318 | Ga0495636_0264687 | Ga0495636_0264687_129_611 | 159 |
| 1110 | 3300047319 | Ga0495674_0002721 | Ga0495674_0002721_8475_8957 | 159 |
| 1111 | 3300047319 | Ga0495674_0017714 | Ga0495674_0017714_4333_4815 | 159 |
| 1112 | 3300047320 | Ga0495672_0025901 | Ga0495672_0025901_3095_3577 | 159 |
| 1113 | 3300047321 | Ga0495676_0411718 | Ga0495676_0411718_41_523 | 159 |
| 1114 | 3300047469 | Ga0495673_0019681 | Ga0495673_0019681_1064_1546 | 159 |
| 1115 | 3300047471 | Ga0495684_0001891 | Ga0495684_0001891_13849_14331 | 159 |
| 1116 | 3300047471 | Ga0495684_0298594 | Ga0495684_0298594_369_851 | 159 |
| 1117 | 3300047673 | Ga0495593_0000180 | Ga0495593_0000180_9333_9815 | 159 |
| 1118 | 3300047673 | Ga0495593_0010159 | Ga0495593_0010159_337_819 | 159 |
| 1119 | 3300047673 | Ga0495593_0609991 | Ga0495593_0609991_48_530 | 159 |
| 1120 | 3300048088 | Ga0495602_0538584 | Ga0495602_0538584_207_689 | 159 |
| 1121 | 3300048088 | Ga0495602_0742213 | Ga0495602_0742213_98_580 | 159 |
| 1122 | 3300048903 | Ga0496100_0012270 | Ga0496100_0012270_1388_1870 | 159 |
| 1123 | 3300048903 | Ga0496100_0742383 | Ga0496100_0742383_186_668 | 159 |
| 1124 | 3300048903 | Ga0496100_0971189 | Ga0496100_0971189_17_499 | 159 |
| 1125 | 3300048904 | Ga0496101_0032497 | Ga0496101_0032497_1347_1829 | 159 |
| 1126 | 3300048904 | Ga0496101_0745524 | Ga0496101_0745524_121_615 | 159 |
| 1127 | 3300048905 | Ga0496102_0001773 | Ga0496102_0001773_12751_13233 | 159 |
| 1128 | 3300048905 | Ga0496102_0183964 | Ga0496102_0183964_27_509 | 159 |
| 1129 | 3300048907 | Ga0496104_0023762 | Ga0496104_0023762_3612_4094 | 159 |
| 1130 | 3300048907 | Ga0496104_0209282 | Ga0496104_0209282_1025_1507 | 159 |
| 1131 | 3300048907 | Ga0496104_0442951 | Ga0496104_0442951_624_1118 | 159 |
| 1132 | 3300048908 | Ga0496105_0032232 | Ga0496105_0032232_2129_2611 | 159 |
| 1133 | 3300048908 | Ga0496105_0176526 | Ga0496105_0176526_324_806 | 159 |
| 1134 | 3300048909 | Ga0496106_0006597 | Ga0496106_0006597_909_1391 | 159 |
| 1135 | 3300048909 | Ga0496106_0035076 | Ga0496106_0035076_3197_3679 | 159 |
| 1136 | 3300048909 | Ga0496106_0334597 | Ga0496106_0334597_298_780 | 159 |
| 1137 | 3300048910 | Ga0496107_0008230 | Ga0496107_0008230_6312_6794 | 159 |
| 1138 | 3300048910 | Ga0496107_0318792 | Ga0496107_0318792_652_1146 | 159 |
| 1139 | 3300048910 | Ga0496107_0705796 | Ga0496107_0705796_106_588 | 159 |
| 1140 | 3300048911 | Ga0496108_0196399 | Ga0496108_0196399_344_826 | 159 |
| 1141 | 3300048911 | Ga0496108_0579652 | Ga0496108_0579652_41_523 | 159 |
| 1142 | 3300048911 | Ga0496108_0725204 | Ga0496108_0725204_344_838 | 159 |
| 1143 | 3300048912 | Ga0496109_0051059 | Ga0496109_0051059_1719_2201 | 159 |
| 1144 | 3300048912 | Ga0496109_0679986 | Ga0496109_0679986_375_857 | 159 |
| 1145 | 3300048912 | Ga0496109_0790578 | Ga0496109_0790578_88_582 | 159 |
| 1146 | 3300048913 | Ga0496110_0164782 | Ga0496110_0164782_331_813 | 159 |
| 1147 | 3300048913 | Ga0496110_0334107 | Ga0496110_0334107_414_896 | 159 |
| 1148 | 3300048914 | Ga0496111_0039133 | Ga0496111_0039133_314_796 | 159 |
| 1149 | 3300048914 | Ga0496111_0047722 | Ga0496111_0047722_560_1042 | 159 |
| 1150 | 3300048914 | Ga0496111_0063998 | Ga0496111_0063998_1903_2385 | 159 |
| 1151 | 3300048915 | Ga0496112_0000019 | Ga0496112_0000019_176481_176963 | 159 |
| 1152 | 3300048915 | Ga0496112_0120658 | Ga0496112_0120658_1158_1640 | 159 |
| 1153 | 3300048915 | Ga0496112_0353035 | Ga0496112_0353035_507_1001 | 159 |
| 1154 | 3300048915 | Ga0496112_0357056 | Ga0496112_0357056_349_831 | 159 |
| 1155 | 3300048916 | Ga0496113_0072749 | Ga0496113_0072749_422_904 | 159 |
| 1156 | 3300048916 | Ga0496113_0429768 | Ga0496113_0429768_177_659 | 159 |
| 1157 | 3300048917 | Ga0496114_0073391 | Ga0496114_0073391_279_761 | 159 |
| 1158 | 3300048918 | Ga0496115_0001360 | Ga0496115_0001360_6612_7094 | 159 |
| 1159 | 3300048918 | Ga0496115_0033069 | Ga0496115_0033069_384_866 | 159 |
| 1160 | 3300048918 | Ga0496115_0133276 | Ga0496115_0133276_437_919 | 159 |
| 1161 | 3300048918 | Ga0496115_0203602 | Ga0496115_0203602_897_1379 | 159 |
| 1162 | 3300048920 | Ga0496117_0038054 | Ga0496117_0038054_3038_3559 | 159 |
| 1163 | 3300048921 | Ga0496118_0054264 | Ga0496118_0054264_807_1289 | 159 |
| 1164 | 3300048922 | Ga0496119_0219518 | Ga0496119_0219518_59_580 | 159 |
| 1165 | 3300048924 | Ga0496121_0000365 | Ga0496121_0000365_83006_83488 | 159 |
| 1166 | 3300048924 | Ga0496121_0018687 | Ga0496121_0018687_109_591 | 159 |
| 1167 | 3300048924 | Ga0496121_0031262 | Ga0496121_0031262_3999_4481 | 159 |
| 1168 | 3300048924 | Ga0496121_0057162 | Ga0496121_0057162_872_1354 | 159 |
| 1169 | 3300048924 | Ga0496121_0145875 | Ga0496121_0145875_817_1299 | 159 |
| 1170 | 3300048924 | Ga0496121_0362348 | Ga0496121_0362348_153_650 | 159 |
| 1171 | 3300048927 | Ga0496124_0008072 | Ga0496124_0008072_3896_4378 | 159 |
| 1172 | 3300048929 | Ga0496126_0002146 | Ga0496126_0002146_2620_3117 | 159 |
| 1173 | 3300048929 | Ga0496126_0027923 | Ga0496126_0027923_4190_4672 | 159 |
| 1174 | 3300048929 | Ga0496126_0036970 | Ga0496126_0036970_430_912 | 159 |
| 1175 | 3300048929 | Ga0496126_0104306 | Ga0496126_0104306_546_1028 | 159 |
| 1176 | 3300048929 | Ga0496126_0221971 | Ga0496126_0221971_961_1443 | 159 |
| 1177 | 3300048929 | Ga0496126_0222017 | Ga0496126_0222017_579_1061 | 159 |
| 1178 | 3300048929 | Ga0496126_0910664 | Ga0496126_0910664_47_529 | 159 |
| 1179 | 3300049580 | Ga0501046_0074602 | Ga0501046_0074602_2114_2596 | 159 |
| 1180 | 3300049581 | Ga0501047_0124858 | Ga0501047_0124858_1896_2378 | 159 |
| 1181 | 3300049581 | Ga0501047_0256777 | Ga0501047_0256777_614_1096 | 159 |
| 1182 | 3300049586 | Ga0501070_0040505 | Ga0501070_0040505_53_535 | 159 |
| 1183 | 3300049589 | Ga0501073_0072930 | Ga0501073_0072930_73_555 | 159 |
| 1184 | 3300049590 | Ga0501074_0031172 | Ga0501074_0031172_60_542 | 159 |
| 1185 | 3300049742 | Ga0501080_0002786 | Ga0501080_0002786_14791_15273 | 159 |
| 1186 | 3300049823 | Ga0501044_0143390 | Ga0501044_0143390_67_549 | 159 |
| 1187 | 3300050489 | nmdc:mga03683_281711_c1 | nmdc:mga03683_281711_c1_190_672 | 159 |
| 1188 | 3300050489 | nmdc:mga03683_368666_c1 | nmdc:mga03683_368666_c1_145_627 | 159 |
| 1189 | 3300050490 | nmdc:mga03n38_86131_c1 | nmdc:mga03n38_86131_c1_928_1410 | 159 |
| 1190 | 3300050491 | nmdc:mga00v17_528839_c1 | nmdc:mga00v17_528839_c1_114_596 | 159 |
| 1191 | 3300050492 | nmdc:mga0yw44_17809_c1 | nmdc:mga0yw44_17809_c1_544_1026 | 159 |
| 1192 | 3300050493 | nmdc:mga0k408_699396_c1 | nmdc:mga0k408_699396_c1_47_541 | 159 |
| 1193 | 3300050494 | nmdc:mga06z11_258422_c1 | nmdc:mga06z11_258422_c1_232_714 | 159 |
| 1194 | 3300050494 | nmdc:mga06z11_367178_c1 | nmdc:mga06z11_367178_c1_47_568 | 159 |
| 1195 | 3300050495 | nmdc:mga04h51_165031_c1 | nmdc:mga04h51_165031_c1_26_508 | 159 |
| 1196 | 3300050496 | nmdc:mga07m45_473359_c1 | nmdc:mga07m45_473359_c1_54_533 | 159 |
| 1197 | 3300050512 | nmdc:mga0n895_3688_c1 | nmdc:mga0n895_3688_c1_9599_10090 | 159 |
| 1198 | 3300050513 | nmdc:mga0rr50_164437_c1 | nmdc:mga0rr50_164437_c1_992_1486 | 159 |
| 1199 | 3300050513 | nmdc:mga0rr50_573382_c1 | nmdc:mga0rr50_573382_c1_469_951 | 159 |
| 1200 | 3300050514 | nmdc:mga08x19_427671_c1 | nmdc:mga08x19_427671_c1_124_606 | 159 |
| 1201 | 3300053077 | Ga0495601_0391578 | Ga0495601_0391578_285_767 | 159 |
| 1202 | 3300053077 | Ga0495601_0685458 | Ga0495601_0685458_12_494 | 159 |
| 1203 | 3300053078 | Ga0495612_0142454 | Ga0495612_0142454_348_830 | 159 |
| 1204 | 3300053079 | Ga0500610_0196747 | Ga0500610_0196747_358_837 | 159 |
| 1205 | 3300053080 | Ga0500635_0085889 | Ga0500635_0085889_498_980 | 159 |
| 1206 | 3300053083 | Ga0495655_0135701 | Ga0495655_0135701_104_586 | 159 |
| 1207 | 3300053084 | Ga0495595_0004220 | Ga0495595_0004220_4704_5186 | 159 |
| 1208 | 3300053084 | Ga0495595_0005357 | Ga0495595_0005357_4047_4529 | 159 |
| 1209 | 3300053085 | Ga0495619_0185770 | Ga0495619_0185770_249_731 | 159 |
| 1210 | 3300053091 | Ga0500647_0183288 | Ga0500647_0183288_317_799 | 159 |
| 1211 | 3300053091 | Ga0500647_0221418 | Ga0500647_0221418_221_703 | 159 |
| 1212 | 3300053094 | Ga0500566_0000122 | Ga0500566_0000122_19149_19631 | 159 |
| 1213 | 3300053094 | Ga0500566_0024142 | Ga0500566_0024142_145_627 | 159 |
| 1214 | 3300053095 | Ga0500640_008021 | Ga0500640_008021_2590_3072 | 159 |
| 1215 | 3300053097 | Ga0500648_158071 | Ga0500648_158071_136_618 | 159 |
| 1216 | 3300053102 | Ga0500554_000582 | Ga0500554_000582_4286_4768 | 159 |
| 1217 | 3300053102 | Ga0500554_004983 | Ga0500554_004983_221_703 | 159 |
| 1218 | 3300053111 | Ga0500572_000053 | Ga0500572_000053_27793_28275 | 159 |
| 1219 | 3300053113 | Ga0500580_148560 | Ga0500580_148560_87_569 | 159 |
| 1220 | 3300053119 | Ga0500595_002485 | Ga0500595_002485_6471_6953 | 159 |
| 1221 | 3300053119 | Ga0500595_019042 | Ga0500595_019042_310_792 | 159 |
| 1222 | 3300053122 | Ga0500608_024872 | Ga0500608_024872_705_1187 | 159 |
| 1223 | 3300053136 | Ga0500559_0001445 | Ga0500559_0001445_12110_12592 | 159 |
| 1224 | 3300053136 | Ga0500559_0065370 | Ga0500559_0065370_435_917 | 159 |
| 1225 | 3300053139 | Ga0500568_0011478 | Ga0500568_0011478_381_863 | 159 |
| 1226 | 3300053140 | Ga0500573_0039597 | Ga0500573_0039597_1591_2073 | 159 |
| 1227 | 3300053144 | Ga0500585_168518 | Ga0500585_168518_219_701 | 159 |
| 1228 | 3300053148 | Ga0500590_079068 | Ga0500590_079068_813_1295 | 159 |
| 1229 | 3300053148 | Ga0500590_192021 | Ga0500590_192021_382_864 | 159 |
| 1230 | 3300053150 | Ga0500603_000341 | Ga0500603_000341_9102_9584 | 159 |
| 1231 | 3300053150 | Ga0500603_001366 | Ga0500603_001366_3664_4146 | 159 |
| 1232 | 3300053150 | Ga0500603_246965 | Ga0500603_246965_75_557 | 159 |
| 1233 | 3300053159 | Ga0500630_003299 | Ga0500630_003299_3756_4238 | 159 |
| 1234 | 3300053162 | Ga0500638_001838 | Ga0500638_001838_3634_4116 | 159 |
| 1235 | 3300053162 | Ga0500638_006669 | Ga0500638_006669_223_705 | 159 |
| 1236 | 3300053162 | Ga0500638_164379 | Ga0500638_164379_312_794 | 159 |
| 1237 | 3300053163 | Ga0500639_000008 | Ga0500639_000008_47808_48290 | 159 |
| 1238 | 3300053163 | Ga0500639_054379 | Ga0500639_054379_1438_1920 | 159 |
| 1239 | 3300053177 | Ga0500636_0027580 | Ga0500636_0027580_132_614 | 159 |
| 1240 | 3300053178 | Ga0500637_0000070 | Ga0500637_0000070_6234_6716 | 159 |
| 1241 | 3300053178 | Ga0500637_0001409 | Ga0500637_0001409_9299_9781 | 159 |
| 1242 | 3300053178 | Ga0500637_0049099 | Ga0500637_0049099_429_911 | 159 |
| 1243 | 3300053728 | Ga0500657_162072 | Ga0500657_162072_170_652 | 159 |
| 1244 | 3300053735 | Ga0500596_002311 | Ga0500596_002311_2273_2755 | 159 |
| 1245 | 3300053735 | Ga0500596_002931 | Ga0500596_002931_1181_1663 | 159 |
| 1246 | 3300055283 | Ga0500661_000295 | Ga0500661_000295_5438_5920 | 159 |
| 1247 | 3300061719 | Ga0466962_0401363 | Ga0466962_0401363_173_655 | 159 |
| 1248 | 3300061734 | Ga0530510_1220340 | Ga0530510_1220340_80_559 | 159 |
| 1249 | 3300002067 | JGI24735J21928_10174835 | JGI24735J21928_101748351 | 160 |
| 1250 | 3300005337 | Ga0070682_100334348 | Ga0070682_1003343482 | 160 |
| 1251 | 3300005458 | Ga0070681_10760630 | Ga0070681_107606301 | 160 |
| 1252 | 3300005530 | Ga0070679_100119450 | Ga0070679_1001194502 | 160 |
| 1253 | 3300005530 | Ga0070679_100288199 | Ga0070679_1002881992 | 160 |
| 1254 | 3300005718 | Ga0068866_10932502 | Ga0068866_109325021 | 160 |
| 1255 | 3300005841 | Ga0068863_100386800 | Ga0068863_1003868001 | 160 |
| 1256 | 3300005843 | Ga0068860_100012742 | Ga0068860_1000127425 | 160 |
| 1257 | 3300006237 | Ga0097621_100664082 | Ga0097621_1006640822 | 160 |
| 1258 | 3300006358 | Ga0068871_100340216 | Ga0068871_1003402162 | 160 |
| 1259 | 3300007265 | Ga0099794_10090494 | Ga0099794_100904942 | 160 |
| 1260 | 3300009101 | Ga0105247_10059204 | Ga0105247_100592042 | 160 |
| 1261 | 3300009545 | Ga0105237_10097302 | Ga0105237_100973022 | 160 |
| 1262 | 3300009988 | Ga0105035_116225 | Ga0105035_1162252 | 160 |
| 1263 | 3300010159 | Ga0099796_10061146 | Ga0099796_100611462 | 160 |
| 1264 | 3300013105 | Ga0157369_12170976 | Ga0157369_121709761 | 160 |
| 1265 | 3300013297 | Ga0157378_10269721 | Ga0157378_102697212 | 160 |
| 1266 | 3300021361 | Ga0213872_10162189 | Ga0213872_101621892 | 160 |
| 1267 | 3300025261 | Ga0209233_1003513 | Ga0209233_10035134 | 160 |
| 1268 | 3300025900 | Ga0207710_10025072 | Ga0207710_100250722 | 160 |
| 1269 | 3300025912 | Ga0207707_10000852 | Ga0207707_1000085214 | 160 |
| 1270 | 3300025914 | Ga0207671_10193003 | Ga0207671_101930032 | 160 |
| 1271 | 3300025917 | Ga0207660_10230213 | Ga0207660_102302132 | 160 |
| 1272 | 3300025921 | Ga0207652_10024999 | Ga0207652_100249992 | 160 |
| 1273 | 3300025921 | Ga0207652_10062755 | Ga0207652_100627552 | 160 |
| 1274 | 3300026088 | Ga0207641_10732202 | Ga0207641_107322022 | 160 |
| 1275 | 3300027671 | Ga0209588_1062957 | Ga0209588_10629572 | 160 |
| 1276 | 3300028381 | Ga0268264_10000038 | Ga0268264_1000003865 | 160 |
| 1277 | 3300031730 | Ga0307516_10018988 | Ga0307516_100189886 | 160 |
| 1278 | 3300031730 | Ga0307516_10146281 | Ga0307516_101462812 | 160 |
| 1279 | 3300033179 | Ga0307507_10010286 | Ga0307507_100102868 | 160 |
| 1280 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009318 | 160 |
| 1281 | 3300035083 | Ga0373926_0228054 | Ga0373926_0228054_77_574 | 160 |
| 1282 | 3300035086 | Ga0373934_0002376 | Ga0373934_0002376_4702_5199 | 160 |
| 1283 | 3300035086 | Ga0373934_0011722 | Ga0373934_0011722_2322_2819 | 160 |
| 1284 | 3300035111 | Ga0373923_0001881 | Ga0373923_0001881_108_605 | 160 |
| 1285 | 3300035111 | Ga0373923_0234047 | Ga0373923_0234047_147_644 | 160 |
| 1286 | 3300035113 | Ga0373936_0102137 | Ga0373936_0102137_566_1063 | 160 |
| 1287 | 3300035116 | Ga0373945_0007983 | Ga0373945_0007983_1108_1605 | 160 |
| 1288 | 3300035117 | Ga0373953_0020937 | Ga0373953_0020937_1805_2302 | 160 |
| 1289 | 3300035118 | Ga0373954_0013120 | Ga0373954_0013120_1074_1571 | 160 |
| 1290 | 3300035118 | Ga0373954_0147565 | Ga0373954_0147565_562_1059 | 160 |
| 1291 | 3300035119 | Ga0373956_0005493 | Ga0373956_0005493_94_591 | 160 |
| 1292 | 3300035119 | Ga0373956_0030747 | Ga0373956_0030747_756_1253 | 160 |
| 1293 | 3300035120 | Ga0373957_0031440 | Ga0373957_0031440_179_676 | 160 |
| 1294 | 3300035170 | Ga0373943_0071292 | Ga0373943_0071292_50_547 | 160 |
| 1295 | 3300035172 | Ga0373955_0022371 | Ga0373955_0022371_66_563 | 160 |
| 1296 | 3300035410 | Ga0373924_0003075 | Ga0373924_0003075_4850_5347 | 160 |
| 1297 | 3300035692 | Ga0373935_0523525 | Ga0373935_0523525_50_547 | 160 |
| 1298 | 3300035695 | Ga0373927_0023227 | Ga0373927_0023227_677_1174 | 160 |
| 1299 | 3300035695 | Ga0373927_0203910 | Ga0373927_0203910_782_1279 | 160 |
| 1300 | 3300035724 | Ga0373933_0042940 | Ga0373933_0042940_773_1270 | 160 |
| 1301 | 3300035725 | Ga0373947_0522125 | Ga0373947_0522125_59_556 | 160 |
| 1302 | 3300036401 | Ga0373937_0027279 | Ga0373937_0027279_4314_4811 | 160 |
| 1303 | 3300036401 | Ga0373937_0085815 | Ga0373937_0085815_106_603 | 160 |
| 1304 | 3300037068 | Ga0373925_0008062 | Ga0373925_0008062_1445_1942 | 160 |
| 1305 | 3300037068 | Ga0373925_0106942 | Ga0373925_0106942_465_962 | 160 |
| 1306 | 3300039447 | Ga0436361_0453764 | Ga0436361_0453764_313_795 | 160 |
| 1307 | 3300046459 | Ga0495629_0012109 | Ga0495629_0012109_4560_5057 | 160 |
| 1308 | 3300046459 | Ga0495629_0044686 | Ga0495629_0044686_1257_1754 | 160 |
| 1309 | 3300046459 | Ga0495629_0261096 | Ga0495629_0261096_464_961 | 160 |
| 1310 | 3300046461 | Ga0495641_0242368 | Ga0495641_0242368_186_683 | 160 |
| 1311 | 3300046462 | Ga0495651_0007131 | Ga0495651_0007131_6725_7222 | 160 |
| 1312 | 3300046472 | Ga0495580_0149952 | Ga0495580_0149952_782_1279 | 160 |
| 1313 | 3300046473 | Ga0495582_0031855 | Ga0495582_0031855_189_686 | 160 |
| 1314 | 3300046475 | Ga0495639_0021762 | Ga0495639_0021762_187_684 | 160 |
| 1315 | 3300046475 | Ga0495639_0124318 | Ga0495639_0124318_460_957 | 160 |
| 1316 | 3300046476 | Ga0495662_0027805 | Ga0495662_0027805_920_1417 | 160 |
| 1317 | 3300046477 | Ga0495664_0003804 | Ga0495664_0003804_5792_6289 | 160 |
| 1318 | 3300046511 | Ga0495608_0565267 | Ga0495608_0565267_66_563 | 160 |
| 1319 | 3300046514 | Ga0495618_0011851 | Ga0495618_0011851_2429_2926 | 160 |
| 1320 | 3300046516 | Ga0495628_0405478 | Ga0495628_0405478_340_837 | 160 |
| 1321 | 3300046517 | Ga0495630_0021452 | Ga0495630_0021452_798_1295 | 160 |
| 1322 | 3300046517 | Ga0495630_0256802 | Ga0495630_0256802_481_978 | 160 |
| 1323 | 3300046526 | Ga0495666_0009552 | Ga0495666_0009552_4297_4794 | 160 |
| 1324 | 3300046529 | Ga0495652_0070679 | Ga0495652_0070679_1858_2355 | 160 |
| 1325 | 3300046529 | Ga0495652_0299249 | Ga0495652_0299249_483_980 | 160 |
| 1326 | 3300046531 | Ga0495665_0438462 | Ga0495665_0438462_21_518 | 160 |
| 1327 | 3300046533 | Ga0495640_0006908 | Ga0495640_0006908_121_618 | 160 |
| 1328 | 3300046535 | Ga0495586_0160223 | Ga0495586_0160223_59_556 | 160 |
| 1329 | 3300046536 | Ga0495587_0003522 | Ga0495587_0003522_8607_9104 | 160 |
| 1330 | 3300046543 | Ga0495645_0452616 | Ga0495645_0452616_237_734 | 160 |
| 1331 | 3300046557 | Ga0495622_0072642 | Ga0495622_0072642_141_638 | 160 |
| 1332 | 3300046557 | Ga0495622_0091511 | Ga0495622_0091511_227_724 | 160 |
| 1333 | 3300046642 | Ga0495634_0045434 | Ga0495634_0045434_53_550 | 160 |
| 1334 | 3300046663 | Ga0495635_0199189 | Ga0495635_0199189_714_1211 | 160 |
| 1335 | 3300046674 | Ga0495588_0590551 | Ga0495588_0590551_74_571 | 160 |
| 1336 | 3300046675 | Ga0495657_0009562 | Ga0495657_0009562_6726_7223 | 160 |
| 1337 | 3300046678 | Ga0495599_0000673 | Ga0495599_0000673_588_1085 | 160 |
| 1338 | 3300046678 | Ga0495599_0299464 | Ga0495599_0299464_392_889 | 160 |
| 1339 | 3300046679 | Ga0495623_0101404 | Ga0495623_0101404_66_563 | 160 |
| 1340 | 3300046680 | Ga0495646_0112349 | Ga0495646_0112349_102_599 | 160 |
| 1341 | 3300046683 | Ga0495658_0006603 | Ga0495658_0006603_1182_1679 | 160 |
| 1342 | 3300046689 | Ga0495613_0018203 | Ga0495613_0018203_4441_4938 | 160 |
| 1343 | 3300046689 | Ga0495613_0090693 | Ga0495613_0090693_1199_1696 | 160 |
| 1344 | 3300046690 | Ga0495624_0194679 | Ga0495624_0194679_340_837 | 160 |
| 1345 | 3300046809 | Ga0495600_0007219 | Ga0495600_0007219_4826_5323 | 160 |
| 1346 | 3300047315 | Ga0495581_0283999 | Ga0495581_0283999_156_653 | 160 |
| 1347 | 3300047317 | Ga0495604_0139733 | Ga0495604_0139733_66_563 | 160 |
| 1348 | 3300047317 | Ga0495604_0307764 | Ga0495604_0307764_368_865 | 160 |
| 1349 | 3300047319 | Ga0495674_0017899 | Ga0495674_0017899_2576_3073 | 160 |
| 1350 | 3300047321 | Ga0495676_0007448 | Ga0495676_0007448_222_719 | 160 |
| 1351 | 3300047322 | Ga0495680_0008673 | Ga0495680_0008673_8607_9104 | 160 |
| 1352 | 3300047471 | Ga0495684_0019909 | Ga0495684_0019909_2931_3428 | 160 |
| 1353 | 3300047673 | Ga0495593_0065947 | Ga0495593_0065947_171_668 | 160 |
| 1354 | 3300047673 | Ga0495593_0549964 | Ga0495593_0549964_21_557 | 160 |
| 1355 | 3300048088 | Ga0495602_0473934 | Ga0495602_0473934_66_563 | 160 |
| 1356 | 3300048923 | Ga0496120_0305628 | Ga0496120_0305628_40_531 | 160 |
| 1357 | 3300053077 | Ga0495601_0063657 | Ga0495601_0063657_1590_2087 | 160 |
| 1358 | 3300053078 | Ga0495612_0264823 | Ga0495612_0264823_35_532 | 160 |
| 1359 | 3300053085 | Ga0495619_0006724 | Ga0495619_0006724_1156_1653 | 160 |
| 1360 | 3300053085 | Ga0495619_0800022 | Ga0495619_0800022_106_603 | 160 |
| 1361 | 3300053094 | Ga0500566_0165900 | Ga0500566_0165900_570_1067 | 160 |
| 1362 | 3300053728 | Ga0500657_175293 | Ga0500657_175293_246_743 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9771 | 2 | 156 |
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.9738 | 1 | 156 |
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.972 | 3 | 155 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9707 | 3 | 156 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9698 | 5 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9876 | 2 | 76 | 3.10.20.30 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9791 | 81 | 155 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9776 | 81 | 155 | 1.10.150.120 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9767 | 3 | 78 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9675 | 2 | 78 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A160TUD5-F1-model_v4 | Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4) | 0.9955 | 1 | 156 |
GO:0004854
GO:0046872 GO:0051537 |
| AF-A0A382B5I4-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.9952 | 4 | 156 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A177QCX2-F1-model_v4 | Ferredoxin | 0.9948 | 1 | 155 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A519QHK6-F1-model_v4 | (2Fe-2S)-binding protein | 0.9941 | 1 | 159 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A3D5FJQ6-F1-model_v4 | Ferredoxin | 0.9934 | 1 | 143 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar