F493341

General Info

Members Datasets Scaffolds Average Seq Length
1362 524 1315 160

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10097302|Ga0105237_100973022
Length 178
Sequence LPSPPGALEDIEIMAKLHVSTTINGEPVEYLCEPNDTMLDALRGPLGLTGSKEGCASGDCGACSITLDDRLVCSCLMLAAEAAGRRVGTIEGMAKGGKLHPLQQAFLEMAALQCGICTSGMLIASEALLKKNPQPNEEEVRFWLAGNLCRCTGYDKVVRAVLEAAAEMREQGIKESWQ

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2791355199
14 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
15 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
19 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
20 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
21 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
22 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
23 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
24 2904699407
25 2906610324
26 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
27 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
28 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
29 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
30 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
31 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
32 2922425934
33 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
34 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
35 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
36 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
37 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
131 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
132 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
135 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
151 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
174 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
241 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
242 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
243 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
245 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
250 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
251 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
254 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
255 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
264 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
269 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
273 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
274 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
275 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
276 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
277 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
278 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
279 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
280 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
281 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
282 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
283 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
284 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
286 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
289 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
290 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
291 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
292 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
293 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
294 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
295 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
296 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
297 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
298 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
303 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
316 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
317 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
318 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
319 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
320 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
321 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
322 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
323 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
324 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
325 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
326 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
327 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
328 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
329 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
330 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
334 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
341 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
342 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
343 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
344 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
345 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
354 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
355 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
364 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
365 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
366 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
370 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
371 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
372 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
373 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
374 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
375 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
376 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
377 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
378 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
379 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
380 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
381 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
382 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
383 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
384 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
385 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
386 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
387 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
394 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
395 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
398 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
399 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
400 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
401 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
402 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
403 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
404 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
405 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
406 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
407 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
408 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
409 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
410 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
411 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
412 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
413 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
414 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
415 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
416 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
417 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
418 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
419 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
420 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
421 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
422 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
423 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
424 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
425 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
426 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
429 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
430 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
431 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
432 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
433 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
434 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
435 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
436 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
437 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
438 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
439 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
440 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
444 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
445 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
446 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
447 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
448 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
449 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
452 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
453 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
454 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
458 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
461 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
462 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
463 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
464 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
465 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
466 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
467 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
468 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
469 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
470 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
471 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
474 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
475 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
476 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
477 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
478 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
479 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
480 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
481 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
482 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
485 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
486 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
487 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
488 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
489 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
490 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
491 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
492 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
493 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
494 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
495 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
496 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
497 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
498 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
499 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
500 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
501 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
502 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
503 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
504 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
505 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
506 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
507 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
508 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
509 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
510 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
511 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
512 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
514 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
515 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
516 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
517 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
518 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
519 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
520 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
521 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
522 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
523 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
524 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0.37
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.66
Nodule 2.86
Rhizoplane 7.64
Rhizosphere 74.82
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10174835 3300002067 Bacteria 621
2 JGI25406J46586_10000009 3300003203 Bacteria 109818
3 JGI25153J46596_10004964 3300003215 Bacteria 7066
4 rootH1_10096066 3300003316 Bacteria 1748
5 rootL2_10051549 3300003322 Bacteria 2021
6 JGI25404J52841_10005977 3300003659 Bacteria 2529
7 JGI25404J52841_10020452 3300003659 Bacteria 1433
8 JGI25404J52841_10091040 3300003659 Bacteria 638
9 Ga0070658_10007845 3300005327 Bacteria 8600
10 Ga0070658_10068198 3300005327 Bacteria 2907
11 Ga0070658_10523972 3300005327 Bacteria 1025
12 Ga0070658_11196780 3300005327 Bacteria 661
13 Ga0070676_10895108 3300005328 Bacteria 661
14 Ga0070683_100021476 3300005329 Bacteria 5763
15 Ga0070683_100119491 3300005329 Bacteria 2489
16 Ga0070683_100282679 3300005329 Bacteria 1578
17 Ga0070670_100679750 3300005331 Bacteria 925
18 Ga0068869_100275915 3300005334 Bacteria 1350
19 Ga0070666_10155323 3300005335 Bacteria 1598
20 Ga0070666_10433589 3300005335 Bacteria 948
21 Ga0070666_11106615 3300005335 Bacteria 589
22 Ga0070680_100001803 3300005336 Bacteria 15723
23 Ga0070680_100011799 3300005336 Bacteria 6777
24 Ga0070680_100433827 3300005336 Bacteria 1121
25 Ga0070680_100493238 3300005336 Bacteria 1047
26 Ga0070682_100104401 3300005337 Bacteria 1877
27 Ga0070682_100104816 3300005337 Bacteria 1873
28 Ga0070682_100334348 3300005337 Bacteria 1124
29 Ga0070682_100887369 3300005337 Bacteria 732
30 Ga0068868_100041686 3300005338 Bacteria 3577
31 Ga0068868_100047327 3300005338 Bacteria 3369
32 Ga0068868_100807001 3300005338 Bacteria 847
33 Ga0068868_101009649 3300005338 Bacteria 761
34 Ga0070660_100011735 3300005339 Bacteria 6238
35 Ga0070660_100197578 3300005339 Bacteria 1631
36 Ga0070689_100002458 3300005340 Bacteria 12116
37 Ga0070689_100090584 3300005340 Bacteria 2410
38 Ga0070691_10001192 3300005341 Bacteria 10895
39 Ga0070691_10089264 3300005341 Bacteria 1518
40 Ga0070691_10262217 3300005341 Bacteria 931
41 Ga0070661_100204859 3300005344 Bacteria 1508
42 Ga0070668_100040084 3300005347 Bacteria 3583
43 Ga0070668_100047147 3300005347 Bacteria 3312
44 Ga0070668_100088409 3300005347 Bacteria 2439
45 Ga0070668_100511776 3300005347 Bacteria 1040
46 Ga0070668_100593062 3300005347 Bacteria 968
47 Ga0070668_100594096 3300005347 Bacteria 968
48 Ga0070668_100696650 3300005347 Bacteria 896
49 Ga0070668_101157946 3300005347 Bacteria 699
50 Ga0070669_100000514 3300005353 Bacteria 29157
51 Ga0070669_100117540 3300005353 Bacteria 2024
52 Ga0070675_101216544 3300005354 Bacteria 694
53 Ga0070671_100000067 3300005355 Bacteria 70750
54 Ga0070671_100007781 3300005355 Bacteria 8562
55 Ga0070671_100059926 3300005355 Bacteria 3168
56 Ga0070671_100202729 3300005355 Bacteria 1682
57 Ga0070671_100290042 3300005355 Bacteria 1392
58 Ga0070671_100719657 3300005355 Bacteria 866
59 Ga0070671_101090832 3300005355 Bacteria 701
60 Ga0070674_100035366 3300005356 Bacteria 3345
61 Ga0070674_100114276 3300005356 Bacteria 1988
62 Ga0070674_100142635 3300005356 Bacteria 1799
63 Ga0070673_100635591 3300005364 Bacteria 976
64 Ga0070688_100486508 3300005365 Bacteria 928
65 Ga0070667_100333628 3300005367 Bacteria 1370
66 Ga0070667_100729876 3300005367 Bacteria 918
67 Ga0070703_10303195 3300005406 Bacteria 667
68 Ga0070709_10003808 3300005434 Bacteria 8112
69 Ga0070709_10007552 3300005434 Bacteria 5966
70 Ga0070709_10057714 3300005434 Bacteria 2459
71 Ga0070709_11067153 3300005434 Bacteria 645
72 Ga0070714_100028634 3300005435 Bacteria 4624
73 Ga0070714_100093490 3300005435 Bacteria 2637
74 Ga0070714_100160852 3300005435 Bacteria 2031
75 Ga0070714_100249116 3300005435 Bacteria 1642
76 Ga0070714_100882843 3300005435 Bacteria 868
77 Ga0070713_100002435 3300005436 Bacteria 12135
78 Ga0070713_100073158 3300005436 Bacteria 2901
79 Ga0070713_100131735 3300005436 Bacteria 2206
80 Ga0070713_100258840 3300005436 Bacteria 1590
81 Ga0070713_100286853 3300005436 Bacteria 1512
82 Ga0070710_10002245 3300005437 Bacteria 9143
83 Ga0070710_10006209 3300005437 Bacteria 5721
84 Ga0070710_10260683 3300005437 Bacteria 1117
85 Ga0070710_10456928 3300005437 Bacteria 867
86 Ga0070701_10326152 3300005438 Bacteria 951
87 Ga0070711_100002514 3300005439 Bacteria 10473
88 Ga0070711_100024311 3300005439 Bacteria 3950
89 Ga0070711_100039210 3300005439 Bacteria 3189
90 Ga0070711_100342004 3300005439 Bacteria 1201
91 Ga0070700_100362108 3300005441 Bacteria 1079
92 Ga0070700_100690139 3300005441 Bacteria 810
93 Ga0070708_100735694 3300005445 Bacteria 928
94 Ga0070663_100004258 3300005455 Bacteria 8374
95 Ga0070663_100164013 3300005455 Bacteria 1712
96 Ga0070663_100165928 3300005455 Bacteria 1703
97 Ga0070663_100486520 3300005455 Bacteria 1022
98 Ga0070663_100909677 3300005455 Bacteria 760
99 Ga0070663_101250232 3300005455 Bacteria 654
100 Ga0070678_100029826 3300005456 Bacteria 3740
101 Ga0070678_100062529 3300005456 Bacteria 2749
102 Ga0070678_100222512 3300005456 Bacteria 1569
103 Ga0070662_100102169 3300005457 Bacteria 2171
104 Ga0070662_101404043 3300005457 Bacteria 602
105 Ga0070681_10009096 3300005458 Bacteria 9761
106 Ga0070681_10147974 3300005458 Bacteria 2276
107 Ga0070681_10155196 3300005458 Bacteria 2215
108 Ga0070681_10225037 3300005458 Bacteria 1791
109 Ga0070681_10715255 3300005458 Bacteria 917
110 Ga0070681_10760630 3300005458 Bacteria 885
111 Ga0068867_100133578 3300005459 Bacteria 1931
112 Ga0068867_100781647 3300005459 Bacteria 850
113 Ga0070706_100686668 3300005467 Bacteria 950
114 Ga0070707_100131402 3300005468 Bacteria 2435
115 Ga0070698_100293524 3300005471 Bacteria 1557
116 Ga0070699_100499672 3300005518 Bacteria 1105
117 Ga0070699_101436602 3300005518 Bacteria 633
118 Ga0070679_100005316 3300005530 Bacteria 11917
119 Ga0070679_100119450 3300005530 Bacteria 2621
120 Ga0070679_100288199 3300005530 Bacteria 1594
121 Ga0070684_100018865 3300005535 Bacteria 5694
122 Ga0070684_100040283 3300005535 Bacteria 4022
123 Ga0070684_100191844 3300005535 Bacteria 1859
124 Ga0068853_100021395 3300005539 Bacteria 5392
125 Ga0068853_100141746 3300005539 Bacteria 2158
126 Ga0068853_100248758 3300005539 Bacteria 1631
127 Ga0068853_100714351 3300005539 Bacteria 956
128 Ga0070672_100234660 3300005543 Bacteria 1542
129 Ga0070672_100257256 3300005543 Bacteria 1472
130 Ga0070672_101140541 3300005543 Bacteria 693
131 Ga0070686_100030509 3300005544 Bacteria 3289
132 Ga0070686_100282868 3300005544 Bacteria 1224
133 Ga0070686_100824072 3300005544 Bacteria 749
134 Ga0070686_100948640 3300005544 Bacteria 703
135 Ga0070696_100225976 3300005546 Bacteria 1406
136 Ga0070696_100550148 3300005546 Bacteria 925
137 Ga0070693_100042981 3300005547 Bacteria 2550
138 Ga0070693_100220775 3300005547 Bacteria 1242
139 Ga0070665_100044811 3300005548 Bacteria 4441
140 Ga0070665_100057106 3300005548 Bacteria 3913
141 Ga0070665_100069254 3300005548 Bacteria 3536
142 Ga0070665_100171529 3300005548 Bacteria 2170
143 Ga0070665_100549915 3300005548 Bacteria 1167
144 Ga0070665_100611798 3300005548 Bacteria 1103
145 Ga0070665_100636708 3300005548 Bacteria 1079
146 Ga0070665_100784671 3300005548 Bacteria 966
147 Ga0070665_101002409 3300005548 Bacteria 847
148 Ga0070665_101924692 3300005548 Bacteria 597
149 Ga0068855_100000994 3300005563 Bacteria 35284
150 Ga0068855_100023587 3300005563 Bacteria 7368
151 Ga0068855_100032725 3300005563 Bacteria 6208
152 Ga0068855_100056856 3300005563 Bacteria 4587
153 Ga0068855_100065587 3300005563 Bacteria 4233
154 Ga0068855_100170343 3300005563 Bacteria 2466
155 Ga0068855_100186786 3300005563 Bacteria 2340
156 Ga0068855_100286670 3300005563 Bacteria 1826
157 Ga0068855_100691188 3300005563 Bacteria 1092
158 Ga0068855_102075284 3300005563 Bacteria 573
159 Ga0070664_100245982 3300005564 Bacteria 1606
160 Ga0070664_100346944 3300005564 Bacteria 1349
161 Ga0070664_100797496 3300005564 Bacteria 883
162 Ga0070664_101482409 3300005564 Bacteria 642
163 Ga0068857_100013137 3300005577 Bacteria 7216
164 Ga0068857_100051455 3300005577 Bacteria 3655
165 Ga0068854_100565285 3300005578 Bacteria 966
166 Ga0068854_100985186 3300005578 Bacteria 746
167 Ga0068856_100006491 3300005614 Bacteria 11469
168 Ga0068856_100147819 3300005614 Bacteria 2357
169 Ga0068856_100245946 3300005614 Bacteria 1804
170 Ga0068856_100266581 3300005614 Bacteria 1729
171 Ga0068856_100627006 3300005614 Bacteria 1096
172 Ga0068856_100702331 3300005614 Bacteria 1032
173 Ga0068856_101172716 3300005614 Bacteria 785
174 Ga0068856_101718419 3300005614 Bacteria 640
175 Ga0070702_100298427 3300005615 Bacteria 1113
176 Ga0070702_100350477 3300005615 Bacteria 1040
177 Ga0068852_100067025 3300005616 Bacteria 3138
178 Ga0068852_100242251 3300005616 Bacteria 1724
179 Ga0068852_100575395 3300005616 Bacteria 1129
180 Ga0068852_101016554 3300005616 Bacteria 848
181 Ga0068852_101209859 3300005616 Bacteria 776
182 Ga0068859_100000028 3300005617 Bacteria 180121
183 Ga0068859_100007456 3300005617 Bacteria 11105
184 Ga0068859_100063326 3300005617 Bacteria 3729
185 Ga0068859_100214710 3300005617 Bacteria 2011
186 Ga0068859_101696236 3300005617 Bacteria 698
187 Ga0068864_100029724 3300005618 Bacteria 4630
188 Ga0068864_100144519 3300005618 Bacteria 2149
189 Ga0068866_10164293 3300005718 Bacteria 1297
190 Ga0068866_10420738 3300005718 Bacteria 867
191 Ga0068866_10932502 3300005718 Bacteria 613
192 Ga0068861_100436972 3300005719 Bacteria 1169
193 Ga0068861_101164855 3300005719 Bacteria 744
194 Ga0068861_101451533 3300005719 Bacteria 672
195 Ga0068851_10034114 3300005834 Bacteria 2539
196 Ga0068870_10300733 3300005840 Bacteria 1013
197 Ga0068863_100023157 3300005841 Bacteria 5936
198 Ga0068863_100231953 3300005841 Bacteria 1780
199 Ga0068863_100386800 3300005841 Bacteria 1366
200 Ga0068863_100744649 3300005841 Bacteria 975
201 Ga0068863_101228515 3300005841 Bacteria 755
202 Ga0068858_100019652 3300005842 Bacteria 6315
203 Ga0068858_100354095 3300005842 Bacteria 1406
204 Ga0068858_101009146 3300005842 Bacteria 816
205 Ga0068858_101101733 3300005842 Bacteria 780
206 Ga0068860_100012742 3300005843 Bacteria 8270
207 Ga0068860_100021301 3300005843 Bacteria 6279
208 Ga0068860_100285965 3300005843 Bacteria 1612
209 Ga0068860_100320673 3300005843 Bacteria 1521
210 Ga0068860_100920649 3300005843 Bacteria 891
211 Ga0068862_100102556 3300005844 Bacteria 2504
212 Ga0068862_100152077 3300005844 Bacteria 2060
213 Ga0068862_100297237 3300005844 Bacteria 1484
214 Ga0068862_100640216 3300005844 Bacteria 1024
215 Ga0068862_100694043 3300005844 Bacteria 985
216 Ga0081455_10000633 3300005937 Bacteria 45582
217 Ga0081455_10007244 3300005937 Bacteria 11710
218 Ga0081455_10036376 3300005937 Bacteria 4384
219 Ga0081455_10076848 3300005937 Bacteria 2749
220 Ga0081455_10095062 3300005937 Bacteria 2406
221 Ga0081455_10144769 3300005937 Bacteria 1840
222 Ga0081540_1001273 3300005983 Bacteria 21971
223 Ga0081540_1004295 3300005983 Bacteria 10918
224 Ga0081540_1004433 3300005983 Bacteria 10710
225 Ga0081540_1007588 3300005983 Bacteria 7707
226 Ga0081540_1015480 3300005983 Bacteria 4828
227 Ga0081540_1020000 3300005983 Bacteria 4045
228 Ga0081540_1029423 3300005983 Bacteria 3060
229 Ga0081540_1114366 3300005983 Bacteria 1133
230 Ga0081540_1147325 3300005983 Bacteria 935
231 Ga0081539_10000048 3300005985 Bacteria 272906
232 Ga0081539_10000203 3300005985 Bacteria 138096
233 Ga0081539_10119548 3300005985 Bacteria 1311
234 Ga0081539_10127058 3300005985 Bacteria 1258
235 Ga0070717_10001217 3300006028 Bacteria 17468
236 Ga0070717_10033689 3300006028 Bacteria 4134
237 Ga0070717_10711403 3300006028 Bacteria 913
238 Ga0070717_10793140 3300006028 Bacteria 862
239 Ga0070717_10901607 3300006028 Bacteria 805
240 Ga0075365_10004788 3300006038 Bacteria 7222
241 Ga0075365_10057450 3300006038 Bacteria 2588
242 Ga0075365_10122121 3300006038 Bacteria 1797
243 Ga0075365_10172876 3300006038 Bacteria 1508
244 Ga0075368_10317224 3300006042 Bacteria 675
245 Ga0075363_100005068 3300006048 Bacteria 5827
246 Ga0075363_100094048 3300006048 Bacteria 1652
247 Ga0075364_10243222 3300006051 Bacteria 1222
248 Ga0075364_10348156 3300006051 Bacteria 1010
249 Ga0075364_10669074 3300006051 Bacteria 709
250 Ga0075432_10101437 3300006058 Bacteria 1064
251 Ga0070715_10232644 3300006163 Bacteria 954
252 Ga0070715_10241348 3300006163 Bacteria 940
253 Ga0070715_10398088 3300006163 Bacteria 765
254 Ga0070716_100017080 3300006173 Bacteria 3756
255 Ga0070716_100044733 3300006173 Bacteria 2481
256 Ga0070716_100351381 3300006173 Bacteria 1044
257 Ga0070716_100445426 3300006173 Bacteria 943
258 Ga0070712_100010424 3300006175 Bacteria 5863
259 Ga0070712_100027750 3300006175 Bacteria 3783
260 Ga0070712_100117209 3300006175 Bacteria 1998
261 Ga0070712_100473801 3300006175 Bacteria 1046
262 Ga0070712_100525035 3300006175 Bacteria 995
263 Ga0070712_100566390 3300006175 Bacteria 959
264 Ga0075362_10002833 3300006177 Bacteria 5915
265 Ga0075362_10477687 3300006177 Bacteria 635
266 Ga0075367_10006819 3300006178 Bacteria 5804
267 Ga0075367_10136490 3300006178 Bacteria 1518
268 Ga0075367_10152067 3300006178 Bacteria 1437
269 Ga0075367_10231237 3300006178 Bacteria 1158
270 Ga0075367_10404420 3300006178 Bacteria 864
271 Ga0075367_10418586 3300006178 Bacteria 848
272 Ga0075367_10435364 3300006178 Bacteria 831
273 Ga0075366_10645420 3300006195 Bacteria 657
274 Ga0075366_10660925 3300006195 Bacteria 648
275 Ga0097621_100499621 3300006237 Bacteria 1101
276 Ga0097621_100664082 3300006237 Bacteria 957
277 Ga0075370_10028134 3300006353 Bacteria 3123
278 Ga0075370_10155586 3300006353 Bacteria 1340
279 Ga0075370_10464034 3300006353 Bacteria 762
280 Ga0068871_100275487 3300006358 Bacteria 1470
281 Ga0068871_100315755 3300006358 Bacteria 1375
282 Ga0068871_100340216 3300006358 Bacteria 1325
283 Ga0068871_100540174 3300006358 Bacteria 1055
284 Ga0075428_100726299 3300006844 Bacteria 1057
285 Ga0075434_100028126 3300006871 Bacteria 5523
286 Ga0068865_100067502 3300006881 Bacteria 2526
287 Ga0068865_100441924 3300006881 Bacteria 1073
288 Ga0068865_100628287 3300006881 Bacteria 910
289 Ga0097620_100000028 3300006931 Bacteria 180121
290 Ga0097620_100007456 3300006931 Bacteria 11105
291 Ga0097620_100063328 3300006931 Bacteria 3729
292 Ga0097620_100214708 3300006931 Bacteria 2011
293 Ga0097620_101696533 3300006931 Bacteria 698
294 Ga0099825_1036353 3300006941 Bacteria 1700
295 Ga0099824_1012432 3300006942 Bacteria 9280
296 Ga0099822_1000676 3300006943 Bacteria 34395
297 Ga0075435_100033061 3300007076 Bacteria 4088
298 Ga0075435_100147933 3300007076 Bacteria 1973
299 Ga0075435_100570463 3300007076 Bacteria 981
300 Ga0099794_10090494 3300007265 Bacteria 1518
301 Ga0099795_10018379 3300007788 Bacteria 2246
302 Ga0099795_10150933 3300007788 Bacteria 952
303 Ga0105244_10268305 3300009036 Bacteria 793
304 Ga0105250_10260498 3300009092 Bacteria 742
305 Ga0105240_10010432 3300009093 Bacteria 13052
306 Ga0105240_10022388 3300009093 Bacteria 8377
307 Ga0105240_10052813 3300009093 Bacteria 5106
308 Ga0105240_10446739 3300009093 Bacteria 1448
309 Ga0105240_10488562 3300009093 Bacteria 1371
310 Ga0105240_10961608 3300009093 Bacteria 915
311 Ga0105240_11643168 3300009093 Bacteria 672
312 Ga0111539_10463556 3300009094 Bacteria 1475
313 Ga0111539_10554387 3300009094 Bacteria 1339
314 Ga0111539_11578324 3300009094 Bacteria 761
315 Ga0105245_10139110 3300009098 Bacteria 2285
316 Ga0105245_11235466 3300009098 Bacteria 795
317 Ga0105245_11955993 3300009098 Bacteria 640
318 Ga0105245_12614679 3300009098 Bacteria 558
319 Ga0105247_10000988 3300009101 Bacteria 21435
320 Ga0105247_10059204 3300009101 Bacteria 2371
321 Ga0105247_10113322 3300009101 Bacteria 1748
322 Ga0105247_10219304 3300009101 Bacteria 1287
323 Ga0105247_10507400 3300009101 Bacteria 880
324 Ga0105247_10578478 3300009101 Bacteria 830
325 Ga0114129_10827321 3300009147 Bacteria 1179
326 Ga0105243_10407528 3300009148 Bacteria 1265
327 Ga0105243_10708577 3300009148 Bacteria 982
328 Ga0105241_10035235 3300009174 Bacteria 3764
329 Ga0105241_10535063 3300009174 Bacteria 1050
330 Ga0105241_10620129 3300009174 Bacteria 979
331 Ga0105241_10822697 3300009174 Bacteria 857
332 Ga0105242_10398312 3300009176 Bacteria 1284
333 Ga0105242_11491921 3300009176 Bacteria 706
334 Ga0105242_11496406 3300009176 Bacteria 706
335 Ga0105242_11506969 3300009176 Bacteria 703
336 Ga0105248_10047570 3300009177 Bacteria 4811
337 Ga0105248_10114790 3300009177 Bacteria 3037
338 Ga0105248_10378607 3300009177 Bacteria 1593
339 Ga0105248_10640216 3300009177 Bacteria 1200
340 Ga0105248_10858805 3300009177 Bacteria 1024
341 Ga0105248_10895067 3300009177 Bacteria 1002
342 Ga0105248_11436330 3300009177 Bacteria 781
343 Ga0105237_10097302 3300009545 Bacteria 2933
344 Ga0105237_10100303 3300009545 Bacteria 2886
345 Ga0105237_10104870 3300009545 Bacteria 2818
346 Ga0105237_10127776 3300009545 Bacteria 2536
347 Ga0105237_10227928 3300009545 Bacteria 1864
348 Ga0105238_10054676 3300009551 Bacteria 4008
349 Ga0105238_10220793 3300009551 Bacteria 1871
350 Ga0105238_10419151 3300009551 Bacteria 1333
351 Ga0105238_10579086 3300009551 Bacteria 1129
352 Ga0105238_10657626 3300009551 Bacteria 1058
353 Ga0105238_10779032 3300009551 Bacteria 971
354 Ga0105249_10131543 3300009553 Bacteria 2390
355 Ga0105249_10386945 3300009553 Bacteria 1426
356 Ga0105249_10416484 3300009553 Bacteria 1376
357 Ga0105249_10521675 3300009553 Bacteria 1235
358 Ga0105249_10531777 3300009553 Bacteria 1224
359 Ga0105249_11462716 3300009553 Bacteria 755
360 Ga0105035_116225 3300009988 Bacteria 687
361 Ga0099796_10058628 3300010159 Bacteria 1358
362 Ga0099796_10061146 3300010159 Bacteria 1335
363 Ga0099796_10309674 3300010159 Bacteria 671
364 Ga0105239_10057882 3300010375 Bacteria 4252
365 Ga0105239_10094432 3300010375 Bacteria 3304
366 Ga0105239_10158415 3300010375 Bacteria 2529
367 Ga0105239_10188851 3300010375 Bacteria 2306
368 Ga0105239_10547140 3300010375 Bacteria 1318
369 Ga0105239_11018154 3300010375 Bacteria 952
370 Ga0105239_11278588 3300010375 Bacteria 846
371 Ga0105239_11521608 3300010375 Bacteria 773
372 Ga0105239_11595024 3300010375 Bacteria 755
373 Ga0105239_13011793 3300010375 Bacteria 549
374 Ga0105246_10031311 3300011119 Bacteria 3520
375 Ga0105246_10044167 3300011119 Bacteria 3027
376 Ga0105246_10418940 3300011119 Bacteria 1117
377 Ga0105246_10620219 3300011119 Bacteria 937
378 Ga0105246_10669029 3300011119 Bacteria 906
379 Ga0105246_10917949 3300011119 Bacteria 787
380 Ga0157373_10258670 3300013100 Bacteria 1232
381 Ga0157371_10652389 3300013102 Bacteria 785
382 Ga0157370_10136478 3300013104 Bacteria 2286
383 Ga0157370_10237235 3300013104 Bacteria 1688
384 Ga0157370_10314118 3300013104 Bacteria 1446
385 Ga0157370_10946928 3300013104 Bacteria 781
386 Ga0157369_10121716 3300013105 Bacteria 2768
387 Ga0157369_10246166 3300013105 Bacteria 1866
388 Ga0157369_10335635 3300013105 Bacteria 1570
389 Ga0157369_12170976 3300013105 Bacteria 563
390 Ga0157374_10042146 3300013296 Bacteria 4210
391 Ga0157374_10071292 3300013296 Bacteria 3276
392 Ga0157374_10085422 3300013296 Bacteria 3001
393 Ga0157374_10370458 3300013296 Bacteria 1425
394 Ga0157374_11006947 3300013296 Bacteria 852
395 Ga0157374_12274556 3300013296 Bacteria 569
396 Ga0157378_10059778 3300013297 Bacteria 3401
397 Ga0157378_10124203 3300013297 Bacteria 2383
398 Ga0157378_10269721 3300013297 Bacteria 1636
399 Ga0157378_10557641 3300013297 Bacteria 1152
400 Ga0157378_11059528 3300013297 Bacteria 847
401 Ga0163162_10070625 3300013306 Bacteria 3543
402 Ga0163162_10162094 3300013306 Bacteria 2358
403 Ga0163162_10746522 3300013306 Bacteria 1098
404 Ga0163162_10798576 3300013306 Bacteria 1061
405 Ga0163162_10806919 3300013306 Bacteria 1056
406 Ga0163162_11718944 3300013306 Bacteria 717
407 Ga0157375_10165114 3300013308 Bacteria 2358
408 Ga0157375_10667029 3300013308 Bacteria 1195
409 Ga0157375_10668897 3300013308 Bacteria 1193
410 Ga0163163_10048338 3300014325 Bacteria 4183
411 Ga0163163_10396842 3300014325 Bacteria 1437
412 Ga0163163_10520501 3300014325 Bacteria 1252
413 Ga0157380_10060148 3300014326 Bacteria 3034
414 Ga0157380_10186435 3300014326 Bacteria 1828
415 Ga0157380_10234153 3300014326 Bacteria 1651
416 Ga0157380_10949387 3300014326 Bacteria 890
417 Ga0157380_11031643 3300014326 Bacteria 858
418 Ga0157379_10157257 3300014968 Bacteria 2051
419 Ga0157379_10279604 3300014968 Bacteria 1519
420 Ga0157379_11242506 3300014968 Bacteria 718
421 Ga0157379_11719451 3300014968 Bacteria 615
422 Ga0157376_10037168 3300014969 Bacteria 3950
423 Ga0157376_10533785 3300014969 Bacteria 1158
424 Ga0157376_11981849 3300014969 Bacteria 620
425 Ga0163161_10480318 3300017792 Bacteria 1009
426 Ga0197907_10033556 3300020069 Bacteria 2637
427 Ga0206352_10877984 3300020078 Bacteria 880
428 Ga0206353_10274628 3300020082 Bacteria 1847
429 Ga0206353_11984242 3300020082 Bacteria 985
430 Ga0213872_10162189 3300021361 Bacteria 972
431 Ga0213872_10340844 3300021361 Bacteria 616
432 Ga0213874_10064230 3300021377 Bacteria 1157
433 Ga0213876_10085041 3300021384 Bacteria 1673
434 Ga0213875_10022449 3300021388 Bacteria 3017
435 Ga0209233_1003513 3300025261 Bacteria 5509
436 Ga0207697_10058295 3300025315 Bacteria 1604
437 Ga0207697_10120431 3300025315 Bacteria 1129
438 Ga0207697_10279151 3300025315 Bacteria 740
439 Ga0207656_10037335 3300025321 Bacteria 2043
440 Ga0207696_1084892 3300025711 Bacteria 872
441 Ga0207692_10051478 3300025898 Bacteria 2088
442 Ga0207692_10052673 3300025898 Bacteria 2069
443 Ga0207692_10381735 3300025898 Bacteria 875
444 Ga0207692_10542414 3300025898 Bacteria 742
445 Ga0207642_10020577 3300025899 Bacteria 2579
446 Ga0207642_10478528 3300025899 Bacteria 759
447 Ga0207710_10025072 3300025900 Bacteria 2572
448 Ga0207710_10071617 3300025900 Bacteria 1590
449 Ga0207710_10182256 3300025900 Bacteria 1031
450 Ga0207710_10399755 3300025900 Bacteria 705
451 Ga0207688_10028174 3300025901 Bacteria 3091
452 Ga0207688_10333094 3300025901 Bacteria 933
453 Ga0207680_10139088 3300025903 Bacteria 1608
454 Ga0207680_10342479 3300025903 Bacteria 1049
455 Ga0207685_10045309 3300025905 Bacteria 1667
456 Ga0207685_10068327 3300025905 Bacteria 1431
457 Ga0207699_10007093 3300025906 Bacteria 5463
458 Ga0207699_10014450 3300025906 Bacteria 4071
459 Ga0207699_10066405 3300025906 Bacteria 2190
460 Ga0207645_10717171 3300025907 Bacteria 680
461 Ga0207643_10463358 3300025908 Bacteria 807
462 Ga0207705_10034900 3300025909 Bacteria 3598
463 Ga0207705_10063236 3300025909 Bacteria 2674
464 Ga0207705_10141395 3300025909 Bacteria 1798
465 Ga0207705_10154531 3300025909 Bacteria 1721
466 Ga0207705_10358941 3300025909 Bacteria 1124
467 Ga0207684_10558205 3300025910 Bacteria 979
468 Ga0207684_10926391 3300025910 Bacteria 731
469 Ga0207654_10055630 3300025911 Bacteria 2292
470 Ga0207654_10246746 3300025911 Bacteria 1195
471 Ga0207654_10774201 3300025911 Bacteria 692
472 Ga0207707_10000852 3300025912 Bacteria 29744
473 Ga0207707_10008752 3300025912 Bacteria 8785
474 Ga0207707_10013145 3300025912 Bacteria 7214
475 Ga0207707_10219273 3300025912 Bacteria 1656
476 Ga0207707_10367627 3300025912 Bacteria 1238
477 Ga0207707_10551254 3300025912 Bacteria 979
478 Ga0207695_10078385 3300025913 Bacteria 3352
479 Ga0207695_10241413 3300025913 Bacteria 1708
480 Ga0207695_10273131 3300025913 Bacteria 1586
481 Ga0207695_10446680 3300025913 Bacteria 1176
482 Ga0207671_10117481 3300025914 Bacteria 2030
483 Ga0207671_10193003 3300025914 Bacteria 1589
484 Ga0207671_10337122 3300025914 Bacteria 1195
485 Ga0207671_10357077 3300025914 Bacteria 1159
486 Ga0207671_10590255 3300025914 Bacteria 885
487 Ga0207671_10924872 3300025914 Bacteria 689
488 Ga0207693_10007651 3300025915 Bacteria 8871
489 Ga0207693_10011694 3300025915 Bacteria 7102
490 Ga0207693_10027350 3300025915 Bacteria 4510
491 Ga0207693_10126980 3300025915 Bacteria 2005
492 Ga0207693_10180540 3300025915 Bacteria 1661
493 Ga0207693_10272266 3300025915 Bacteria 1327
494 Ga0207693_10489288 3300025915 Bacteria 961
495 Ga0207663_10007481 3300025916 Bacteria 5666
496 Ga0207663_10032758 3300025916 Bacteria 3088
497 Ga0207663_10032999 3300025916 Bacteria 3079
498 Ga0207663_10918655 3300025916 Bacteria 700
499 Ga0207660_10032733 3300025917 Bacteria 3590
500 Ga0207660_10074168 3300025917 Bacteria 2482
501 Ga0207660_10230213 3300025917 Bacteria 1457
502 Ga0207657_10002580 3300025919 Bacteria 19599
503 Ga0207657_10215974 3300025919 Bacteria 1538
504 Ga0207649_10076679 3300025920 Bacteria 2152
505 Ga0207649_10114372 3300025920 Bacteria 1808
506 Ga0207652_10007221 3300025921 Bacteria 8959
507 Ga0207652_10014787 3300025921 Bacteria 6326
508 Ga0207652_10024999 3300025921 Bacteria 4960
509 Ga0207652_10062755 3300025921 Bacteria 3211
510 Ga0207652_10230571 3300025921 Bacteria 1669
511 Ga0207652_10343884 3300025921 Bacteria 1347
512 Ga0207646_10239429 3300025922 Bacteria 1639
513 Ga0207681_10000248 3300025923 Bacteria 41061
514 Ga0207694_10033330 3300025924 Bacteria 3945
515 Ga0207694_10078105 3300025924 Bacteria 2594
516 Ga0207694_10146877 3300025924 Bacteria 1898
517 Ga0207694_10538059 3300025924 Bacteria 980
518 Ga0207694_10654411 3300025924 Bacteria 885
519 Ga0207694_10658396 3300025924 Bacteria 882
520 Ga0207694_10721508 3300025924 Bacteria 841
521 Ga0207694_11085778 3300025924 Bacteria 677
522 Ga0207650_11137700 3300025925 Bacteria 664
523 Ga0207659_10057464 3300025926 Bacteria 2790
524 Ga0207687_10111760 3300025927 Bacteria 2029
525 Ga0207687_10147633 3300025927 Bacteria 1790
526 Ga0207687_10491869 3300025927 Bacteria 1023
527 Ga0207687_10496593 3300025927 Bacteria 1018
528 Ga0207700_10003283 3300025928 Bacteria 9361
529 Ga0207700_10041218 3300025928 Bacteria 3377
530 Ga0207700_10068583 3300025928 Bacteria 2719
531 Ga0207700_10096383 3300025928 Bacteria 2349
532 Ga0207700_10219871 3300025928 Bacteria 1610
533 Ga0207700_10237564 3300025928 Bacteria 1552
534 Ga0207700_11344719 3300025928 Bacteria 636
535 Ga0207664_10022106 3300025929 Bacteria 4743
536 Ga0207664_10055824 3300025929 Bacteria 3135
537 Ga0207664_10066442 3300025929 Bacteria 2891
538 Ga0207664_10230436 3300025929 Bacteria 1610
539 Ga0207664_10295012 3300025929 Bacteria 1425
540 Ga0207644_10000004 3300025931 Bacteria 566613
541 Ga0207644_10005101 3300025931 Bacteria 8577
542 Ga0207690_11276313 3300025932 Bacteria 614
543 Ga0207706_10063847 3300025933 Bacteria 3242
544 Ga0207706_10232732 3300025933 Bacteria 1612
545 Ga0207706_11090466 3300025933 Bacteria 667
546 Ga0207686_10411884 3300025934 Bacteria 1032
547 Ga0207686_10519596 3300025934 Bacteria 926
548 Ga0207686_11018575 3300025934 Bacteria 672
549 Ga0207709_10108126 3300025935 Bacteria 1854
550 Ga0207709_10186625 3300025935 Bacteria 1469
551 Ga0207709_10392342 3300025935 Bacteria 1059
552 Ga0207670_10001223 3300025936 Bacteria 13568
553 Ga0207670_10061119 3300025936 Bacteria 2570
554 Ga0207669_10119491 3300025937 Bacteria 1785
555 Ga0207669_10226526 3300025937 Bacteria 1376
556 Ga0207669_11080566 3300025937 Bacteria 677
557 Ga0207704_10079310 3300025938 Bacteria 2115
558 Ga0207704_10701116 3300025938 Bacteria 838
559 Ga0207704_10973690 3300025938 Bacteria 716
560 Ga0207665_10007232 3300025939 Bacteria 7345
561 Ga0207665_10029943 3300025939 Bacteria 3596
562 Ga0207665_10258544 3300025939 Bacteria 1289
563 Ga0207665_10445960 3300025939 Bacteria 992
564 Ga0207665_10627619 3300025939 Bacteria 841
565 Ga0207665_11122585 3300025939 Bacteria 627
566 Ga0207691_10111293 3300025940 Bacteria 2435
567 Ga0207691_10177730 3300025940 Bacteria 1861
568 Ga0207691_11337186 3300025940 Bacteria 591
569 Ga0207711_10028582 3300025941 Bacteria 4694
570 Ga0207711_10484600 3300025941 Bacteria 1152
571 Ga0207711_10491080 3300025941 Bacteria 1144
572 Ga0207711_10541428 3300025941 Bacteria 1086
573 Ga0207711_10956781 3300025941 Bacteria 795
574 Ga0207689_10061700 3300025942 Bacteria 3083
575 Ga0207689_10710456 3300025942 Bacteria 848
576 Ga0207661_10000889 3300025944 Bacteria 19622
577 Ga0207661_10073195 3300025944 Bacteria 2805
578 Ga0207661_10739204 3300025944 Bacteria 905
579 Ga0207679_10256917 3300025945 Bacteria 1488
580 Ga0207667_10002818 3300025949 Bacteria 21556
581 Ga0207667_10011892 3300025949 Bacteria 10079
582 Ga0207667_10018462 3300025949 Bacteria 7820
583 Ga0207667_10050257 3300025949 Bacteria 4399
584 Ga0207667_10054977 3300025949 Bacteria 4186
585 Ga0207667_10167961 3300025949 Bacteria 2255
586 Ga0207651_10103843 3300025960 Bacteria 2116
587 Ga0207712_10113006 3300025961 Bacteria 2041
588 Ga0207712_10303325 3300025961 Bacteria 1311
589 Ga0207712_10351548 3300025961 Bacteria 1225
590 Ga0207712_10805158 3300025961 Bacteria 826
591 Ga0207712_11246689 3300025961 Bacteria 664
592 Ga0207668_10028354 3300025972 Bacteria 3660
593 Ga0207668_10042250 3300025972 Bacteria 3087
594 Ga0207668_10056374 3300025972 Bacteria 2736
595 Ga0207668_10191358 3300025972 Bacteria 1621
596 Ga0207668_10215697 3300025972 Bacteria 1537
597 Ga0207668_10390743 3300025972 Bacteria 1173
598 Ga0207668_10458159 3300025972 Bacteria 1090
599 Ga0207668_10923667 3300025972 Bacteria 777
600 Ga0207640_10169884 3300025981 Bacteria 1624
601 Ga0207658_10027233 3300025986 Bacteria 4014
602 Ga0207658_12115809 3300025986 Bacteria 511
603 Ga0207677_10010857 3300026023 Bacteria 5168
604 Ga0207677_10116864 3300026023 Bacteria 1998
605 Ga0207677_10185918 3300026023 Bacteria 1639
606 Ga0207677_10267149 3300026023 Bacteria 1397
607 Ga0207703_10011714 3300026035 Bacteria 6825
608 Ga0207703_10020479 3300026035 Bacteria 5173
609 Ga0207703_10177458 3300026035 Bacteria 1878
610 Ga0207703_10256204 3300026035 Bacteria 1580
611 Ga0207703_11630469 3300026035 Bacteria 621
612 Ga0207639_10096777 3300026041 Bacteria 2375
613 Ga0207639_10132349 3300026041 Bacteria 2066
614 Ga0207639_10220992 3300026041 Bacteria 1636
615 Ga0207639_10280171 3300026041 Bacteria 1466
616 Ga0207639_10341575 3300026041 Bacteria 1335
617 Ga0207639_10525913 3300026041 Bacteria 1083
618 Ga0207639_10591691 3300026041 Bacteria 1022
619 Ga0207678_10014567 3300026067 Bacteria 6918
620 Ga0207678_10055860 3300026067 Bacteria 3400
621 Ga0207678_10490963 3300026067 Bacteria 1070
622 Ga0207678_11556491 3300026067 Bacteria 583
623 Ga0207708_10808472 3300026075 Bacteria 807
624 Ga0207708_10851534 3300026075 Bacteria 787
625 Ga0207702_10000433 3300026078 Bacteria 47747
626 Ga0207702_10156956 3300026078 Bacteria 2075
627 Ga0207702_10195760 3300026078 Bacteria 1871
628 Ga0207702_10336092 3300026078 Bacteria 1442
629 Ga0207702_10460574 3300026078 Bacteria 1235
630 Ga0207702_10724608 3300026078 Bacteria 981
631 Ga0207702_11344313 3300026078 Bacteria 708
632 Ga0207641_10432417 3300026088 Bacteria 1269
633 Ga0207641_10732202 3300026088 Bacteria 975
634 Ga0207641_10862902 3300026088 Bacteria 898
635 Ga0207648_10112313 3300026089 Bacteria 2393
636 Ga0207648_10335180 3300026089 Bacteria 1361
637 Ga0207648_10415874 3300026089 Bacteria 1220
638 Ga0207676_10046581 3300026095 Bacteria 3356
639 Ga0207676_10054381 3300026095 Bacteria 3138
640 Ga0207676_10152956 3300026095 Bacteria 1989
641 Ga0207674_10020134 3300026116 Bacteria 7216
642 Ga0207674_10047317 3300026116 Bacteria 4410
643 Ga0207674_11420874 3300026116 Bacteria 663
644 Ga0207675_100141319 3300026118 Bacteria 2287
645 Ga0207675_100218915 3300026118 Bacteria 1834
646 Ga0207675_100448463 3300026118 Bacteria 1278
647 Ga0207675_100455596 3300026118 Bacteria 1268
648 Ga0207675_100676936 3300026118 Bacteria 1039
649 Ga0207683_10022491 3300026121 Bacteria 5412
650 Ga0207683_10027057 3300026121 Bacteria 4956
651 Ga0207683_10166017 3300026121 Bacteria 1997
652 Ga0207683_10289502 3300026121 Bacteria 1498
653 Ga0207683_10446288 3300026121 Bacteria 1192
654 Ga0207683_10550524 3300026121 Bacteria 1067
655 Ga0207683_10652695 3300026121 Bacteria 975
656 Ga0207683_10986456 3300026121 Bacteria 782
657 Ga0207698_10168949 3300026142 Bacteria 1923
658 Ga0207698_10189323 3300026142 Bacteria 1831
659 Ga0207698_10195622 3300026142 Bacteria 1806
660 Ga0207698_10667585 3300026142 Bacteria 1031
661 Ga0207698_11186307 3300026142 Bacteria 777
662 Ga0207698_11492278 3300026142 Bacteria 691
663 Ga0209589_1000009 3300027357 Bacteria 252104
664 Ga0209489_100010 3300027361 Bacteria 252139
665 Ga0209700_100017 3300027363 Bacteria 252104
666 Ga0209588_1062957 3300027671 Bacteria 1199
667 Ga0209813_10231557 3300027866 Bacteria 695
668 Ga0207428_10796907 3300027907 Bacteria 671
669 Ga0268266_10000446 3300028379 Bacteria 61283
670 Ga0268266_10000670 3300028379 Bacteria 46181
671 Ga0268266_10039605 3300028379 Bacteria 4014
672 Ga0268266_10315190 3300028379 Bacteria 1462
673 Ga0268266_10330383 3300028379 Bacteria 1429
674 Ga0268266_10440412 3300028379 Bacteria 1237
675 Ga0268266_10571470 3300028379 Bacteria 1084
676 Ga0268266_10818337 3300028379 Bacteria 900
677 Ga0268266_11201458 3300028379 Bacteria 733
678 Ga0268266_11520113 3300028379 Bacteria 645
679 Ga0268266_11631259 3300028379 Bacteria 620
680 Ga0268265_10046888 3300028380 Bacteria 3233
681 Ga0268265_10078046 3300028380 Bacteria 2603
682 Ga0268265_10332438 3300028380 Bacteria 1380
683 Ga0268265_10409715 3300028380 Bacteria 1255
684 Ga0268265_10635320 3300028380 Bacteria 1024
685 Ga0268264_10000038 3300028381 Bacteria 383623
686 Ga0268264_10086929 3300028381 Bacteria 2687
687 Ga0268264_10582119 3300028381 Bacteria 1101
688 Ga0268264_12189523 3300028381 Bacteria 561
689 Ga0265334_10009203 3300028573 Bacteria 4183
690 Ga0307517_10000512 3300028786 Bacteria 66501
691 Ga0307517_10085793 3300028786 Bacteria 2634
692 Ga0307515_10007488 3300028794 Bacteria 21572
693 Ga0307515_10426051 3300028794 Bacteria 946
694 Ga0265338_10369397 3300028800 Bacteria 1028
695 Ga0265330_10042318 3300031235 Bacteria 2019
696 Ga0265330_10046855 3300031235 Bacteria 1904
697 Ga0265332_10017124 3300031238 Bacteria 3197
698 Ga0265340_10075050 3300031247 Bacteria 1598
699 Ga0265339_10004935 3300031249 Bacteria 8990
700 Ga0265331_10099006 3300031250 Bacteria 1343
701 Ga0307513_10052398 3300031456 Bacteria 4395
702 Ga0307513_10066917 3300031456 Bacteria 3773
703 Ga0307509_10362884 3300031507 Bacteria 1167
704 Ga0307509_10555128 3300031507 Bacteria 826
705 Ga0307408_100274895 3300031548 Bacteria 1400
706 Ga0307408_100536531 3300031548 Bacteria 1030
707 Ga0307408_100694832 3300031548 Bacteria 914
708 Ga0307508_10000514 3300031616 Bacteria 46387
709 Ga0307508_10009664 3300031616 Bacteria 8855
710 Ga0307508_10359193 3300031616 Bacteria 1048
711 Ga0265314_10011527 3300031711 Bacteria 7282
712 Ga0307516_10011779 3300031730 Bacteria 9485
713 Ga0307516_10018988 3300031730 Bacteria 7135
714 Ga0307516_10089872 3300031730 Bacteria 2901
715 Ga0307516_10146281 3300031730 Bacteria 2128
716 Ga0307516_10268754 3300031730 Bacteria 1392
717 Ga0307413_10041245 3300031824 Bacteria 2701
718 Ga0307406_10092079 3300031901 Bacteria 2043
719 Ga0307406_10151527 3300031901 Bacteria 1655
720 Ga0307407_10350353 3300031903 Bacteria 1045
721 Ga0307407_10540635 3300031903 Bacteria 860
722 Ga0307412_10070318 3300031911 Bacteria 2385
723 Ga0307412_10135144 3300031911 Bacteria 1798
724 Ga0307409_101208873 3300031995 Bacteria 779
725 Ga0307416_100091588 3300032002 Bacteria 2612
726 Ga0307416_100793386 3300032002 Bacteria 1042
727 Ga0307411_10076751 3300032005 Bacteria 2285
728 Ga0307411_10113101 3300032005 Bacteria 1947
729 Ga0307411_10609426 3300032005 Bacteria 940
730 Ga0307415_100075103 3300032126 Bacteria 2391
731 Ga0307415_100560061 3300032126 Bacteria 1010
732 Ga0307415_100635159 3300032126 Bacteria 955
733 Ga0307415_101548922 3300032126 Bacteria 635
734 Ga0307507_10010286 3300033179 Bacteria 12137
735 Ga0307507_10036548 3300033179 Bacteria 5018
736 Ga0307507_10310088 3300033179 Bacteria 959
737 Ga0307510_10019030 3300033180 Bacteria 8059
738 Ga0307510_10023408 3300033180 Bacteria 7160
739 Ga0307510_10256328 3300033180 Bacteria 1233
740 Ga0315911_1000009 3300033442 Bacteria 379354
741 Ga0316215_1004581 3300033544 Bacteria 1326
742 Ga0373930_0007018 3300034816 Bacteria 1923
743 Ga0373938_0067420 3300034957 Bacteria 849
744 Ga0373926_0228054 3300035083 Bacteria 719
745 Ga0373934_0002376 3300035086 Bacteria 6925
746 Ga0373934_0011722 3300035086 Bacteria 3301
747 Ga0373940_0208698 3300035088 Bacteria 645
748 Ga0373944_0045956 3300035089 Bacteria 1364
749 Ga0373951_0069421 3300035091 Bacteria 896
750 Ga0373952_0105437 3300035092 Bacteria 748
751 Ga0373952_0171208 3300035092 Bacteria 621
752 Ga0373923_0001881 3300035111 Bacteria 6252
753 Ga0373923_0234047 3300035111 Bacteria 856
754 Ga0373932_0019441 3300035112 Bacteria 1770
755 Ga0373936_0002974 3300035113 Bacteria 6342
756 Ga0373936_0102137 3300035113 Bacteria 1210
757 Ga0373945_0007983 3300035116 Bacteria 3436
758 Ga0373945_0009494 3300035116 Bacteria 3189
759 Ga0373945_0194375 3300035116 Bacteria 840
760 Ga0373953_0003113 3300035117 Bacteria 5112
761 Ga0373953_0020937 3300035117 Bacteria 2448
762 Ga0373954_0013120 3300035118 Bacteria 3689
763 Ga0373954_0147565 3300035118 Bacteria 1148
764 Ga0373956_0005493 3300035119 Bacteria 5074
765 Ga0373956_0024429 3300035119 Bacteria 2604
766 Ga0373956_0030747 3300035119 Bacteria 2349
767 Ga0373957_0004852 3300035120 Bacteria 4125
768 Ga0373957_0031440 3300035120 Bacteria 1951
769 Ga0373960_0096433 3300035121 Bacteria 953
770 Ga0373943_0023841 3300035170 Bacteria 2848
771 Ga0373943_0071292 3300035170 Bacteria 1760
772 Ga0373946_0012423 3300035171 Bacteria 3188
773 Ga0373946_0106178 3300035171 Bacteria 1265
774 Ga0373955_0022371 3300035172 Bacteria 3206
775 Ga0373942_0262401 3300035207 Bacteria 590
776 Ga0373962_0057167 3300035242 Bacteria 1138
777 Ga0373924_0003075 3300035410 Bacteria 5694
778 Ga0373931_0025121 3300035691 Bacteria 3025
779 Ga0373931_0892161 3300035691 Bacteria 597
780 Ga0373935_0001637 3300035692 Bacteria 12510
781 Ga0373935_0111842 3300035692 Bacteria 1814
782 Ga0373935_0523525 3300035692 Bacteria 862
783 Ga0373935_0666612 3300035692 Bacteria 764
784 Ga0373927_0000331 3300035695 Bacteria 37139
785 Ga0373927_0005361 3300035695 Bacteria 8859
786 Ga0373927_0018601 3300035695 Bacteria 4562
787 Ga0373927_0023227 3300035695 Bacteria 4062
788 Ga0373927_0075809 3300035695 Bacteria 2178
789 Ga0373927_0203910 3300035695 Bacteria 1298
790 Ga0373927_0829994 3300035695 Bacteria 610
791 Ga0373933_0000377 3300035724 Bacteria 28626
792 Ga0373933_0024966 3300035724 Bacteria 3424
793 Ga0373933_0042940 3300035724 Bacteria 2673
794 Ga0373933_0709833 3300035724 Bacteria 661
795 Ga0373947_0005852 3300035725 Bacteria 7161
796 Ga0373947_0015963 3300035725 Bacteria 4314
797 Ga0373947_0032326 3300035725 Bacteria 3083
798 Ga0373947_0037473 3300035725 Bacteria 2878
799 Ga0373947_0207262 3300035725 Bacteria 1285
800 Ga0373947_0522125 3300035725 Bacteria 807
801 Ga0373947_0568811 3300035725 Bacteria 772
802 Ga0373937_0015924 3300036401 Bacteria 6667
803 Ga0373937_0027279 3300036401 Bacteria 5164
804 Ga0373937_0085815 3300036401 Bacteria 2913
805 Ga0373925_0008062 3300037068 Bacteria 7672
806 Ga0373925_0029052 3300037068 Bacteria 4055
807 Ga0373925_0106942 3300037068 Bacteria 2157
808 Ga0373925_0374049 3300037068 Bacteria 1159
809 Ga0373925_0666181 3300037068 Bacteria 858
810 Ga0373925_1751887 3300037068 Bacteria 507
811 Ga0395899_0009172 3300037312 Bacteria 7597
812 Ga0395899_0138097 3300037312 Bacteria 1736
813 Ga0395900_0398370 3300037418 Bacteria 1341
814 Ga0395898_0554086 3300037466 Bacteria 1092
815 Ga0395905_0647711 3300037471 Bacteria 958
816 Ga0395905_0961284 3300037471 Bacteria 757
817 Ga0436364_0001304 3300037853 Bacteria 3853
818 Ga0436364_0072718 3300037853 Bacteria 1414
819 Ga0436364_0942302 3300037853 Bacteria 1221
820 Ga0436364_1436174 3300037853 Bacteria 1133
821 Ga0395901_0054356 3300038443 Bacteria 4162
822 Ga0395901_0084781 3300038443 Bacteria 3311
823 Ga0395901_0436586 3300038443 Bacteria 1341
824 Ga0436365_0979043 3300039437 Bacteria 5376
825 Ga0436365_1662883 3300039437 Bacteria 2836
826 Ga0436365_1666053 3300039437 Bacteria 2525
827 Ga0436360_0321210 3300039438 Bacteria 1728
828 Ga0436360_0805252 3300039438 Bacteria 2065
829 Ga0436361_0106883 3300039447 Bacteria 662
830 Ga0436361_0114609 3300039447 Bacteria 1346
831 Ga0436361_0453764 3300039447 Bacteria 1074
832 Ga0436361_0621214 3300039447 Bacteria 1937
833 Ga0436363_0475902 3300039450 Bacteria 7324
834 Ga0436363_0726196 3300039450 Bacteria 3219
835 Ga0436363_1489761 3300039450 Bacteria 1179
836 Ga0439465_0060773 3300041413 Bacteria 1252
837 Ga0451789_1131362 3300041443 Bacteria 875
838 Ga0451793_1643059 3300041452 Bacteria 835
839 Ga0451800_1272588 3300041459 Bacteria 553
840 Ga0451804_0577402 3300041463 Bacteria 691
841 Ga0451847_0078248 3300041503 Bacteria 916
842 Ga0451843_1327502 3300041509 Bacteria 782
843 Ga0451853_3406428 3300041512 Bacteria 604
844 Ga0439431_0235909 3300041997 Bacteria 540
845 Ga0439448_0140871 3300042005 Bacteria 835
846 Ga0439463_156452 3300042016 Bacteria 591
847 Ga0466963_0427356 3300044694 Bacteria 934
848 Ga0466964_0088277 3300044706 Bacteria 1345
849 Ga0453684_0057660 3300044712 Bacteria 5024
850 Ga0466970_0107661 3300044765 Bacteria 1521
851 Ga0466957_0062703 3300044842 Bacteria 2284
852 Ga0466959_0149442 3300045049 Bacteria 1647
853 Ga0466967_0838165 3300045976 Bacteria 913
854 Ga0466967_1260624 3300045976 Bacteria 736
855 Ga0495617_037019 3300046452 Bacteria 1635
856 Ga0495592_0033915 3300046454 Bacteria 3849
857 Ga0495592_0127916 3300046454 Bacteria 1779
858 Ga0495603_0015303 3300046455 Bacteria 4641
859 Ga0495603_0036252 3300046455 Bacteria 2961
860 Ga0495603_0039904 3300046455 Bacteria 2811
861 Ga0495603_0053664 3300046455 Bacteria 2391
862 Ga0495603_0116164 3300046455 Bacteria 1560
863 Ga0495603_0127432 3300046455 Bacteria 1483
864 Ga0495590_0080715 3300046457 Bacteria 1146
865 Ga0495590_0151116 3300046457 Bacteria 842
866 Ga0495629_0001243 3300046459 Bacteria 20022
867 Ga0495629_0012109 3300046459 Bacteria 6253
868 Ga0495629_0044686 3300046459 Bacteria 3109
869 Ga0495629_0152799 3300046459 Bacteria 1604
870 Ga0495629_0261096 3300046459 Bacteria 1191
871 Ga0495638_0015230 3300046460 Bacteria 5169
872 Ga0495641_0004926 3300046461 Bacteria 9243
873 Ga0495641_0062919 3300046461 Bacteria 1673
874 Ga0495641_0153169 3300046461 Bacteria 1031
875 Ga0495641_0242368 3300046461 Bacteria 810
876 Ga0495651_0007131 3300046462 Bacteria 8547
877 Ga0495651_0086681 3300046462 Bacteria 2355
878 Ga0495651_0641549 3300046462 Bacteria 666
879 Ga0495651_0690597 3300046462 Bacteria 637
880 Ga0495653_0011097 3300046463 Bacteria 7365
881 Ga0495650_0132169 3300046471 Bacteria 909
882 Ga0495580_0001284 3300046472 Bacteria 22130
883 Ga0495580_0085993 3300046472 Bacteria 2190
884 Ga0495580_0149952 3300046472 Bacteria 1615
885 Ga0495580_0282542 3300046472 Bacteria 1132
886 Ga0495580_0355421 3300046472 Bacteria 992
887 Ga0495580_0794910 3300046472 Bacteria 614
888 Ga0495582_0000166 3300046473 Bacteria 35616
889 Ga0495582_0031855 3300046473 Bacteria 2899
890 Ga0495582_0423108 3300046473 Bacteria 769
891 Ga0495605_0185320 3300046474 Bacteria 913
892 Ga0495605_0255034 3300046474 Bacteria 750
893 Ga0495639_0001186 3300046475 Bacteria 11769
894 Ga0495639_0021762 3300046475 Bacteria 2808
895 Ga0495639_0124318 3300046475 Bacteria 1232
896 Ga0495639_0137106 3300046475 Bacteria 1174
897 Ga0495639_0182924 3300046475 Bacteria 1021
898 Ga0495662_0000887 3300046476 Bacteria 14644
899 Ga0495662_0027805 3300046476 Bacteria 2732
900 Ga0495664_0003804 3300046477 Bacteria 8233
901 Ga0495664_0071918 3300046477 Bacteria 2066
902 Ga0495664_0081855 3300046477 Bacteria 1935
903 Ga0495584_0100895 3300046491 Bacteria 1459
904 Ga0495584_0467286 3300046491 Bacteria 642
905 Ga0495584_0590203 3300046491 Bacteria 566
906 Ga0495585_0064003 3300046492 Bacteria 2017
907 Ga0495585_0066562 3300046492 Bacteria 1972
908 Ga0495594_0000692 3300046499 Bacteria 17377
909 Ga0495594_0173126 3300046499 Bacteria 1228
910 Ga0495594_0266004 3300046499 Bacteria 977
911 Ga0495596_0066003 3300046500 Bacteria 1407
912 Ga0495596_0228539 3300046500 Bacteria 722
913 Ga0495607_0182075 3300046501 Bacteria 1053
914 Ga0495583_0177577 3300046506 Bacteria 873
915 Ga0495606_0000939 3300046507 Bacteria 42966
916 Ga0495606_0133935 3300046507 Bacteria 1470
917 Ga0495606_0221452 3300046507 Bacteria 1066
918 Ga0495606_0394206 3300046507 Bacteria 723
919 Ga0495608_0140480 3300046511 Bacteria 1542
920 Ga0495608_0565267 3300046511 Bacteria 684
921 Ga0495616_0349604 3300046513 Bacteria 616
922 Ga0495618_0011851 3300046514 Bacteria 5291
923 Ga0495618_0063817 3300046514 Bacteria 2340
924 Ga0495620_0073085 3300046515 Bacteria 1399
925 Ga0495620_0113333 3300046515 Bacteria 1073
926 Ga0495628_0074488 3300046516 Bacteria 2644
927 Ga0495628_0405478 3300046516 Bacteria 995
928 Ga0495630_0007555 3300046517 Bacteria 7770
929 Ga0495630_0021452 3300046517 Bacteria 4769
930 Ga0495630_0256802 3300046517 Bacteria 1335
931 Ga0495630_0851161 3300046517 Bacteria 695
932 Ga0495631_0056972 3300046518 Bacteria 1701
933 Ga0495631_0385414 3300046518 Bacteria 597
934 Ga0495637_0217915 3300046520 Bacteria 696
935 Ga0495643_0229534 3300046522 Bacteria 876
936 Ga0495644_0027751 3300046523 Bacteria 2144
937 Ga0495648_0315100 3300046524 Bacteria 727
938 Ga0495666_0009552 3300046526 Bacteria 4847
939 Ga0495666_0027403 3300046526 Bacteria 2804
940 Ga0495642_0076392 3300046528 Bacteria 1406
941 Ga0495652_0070679 3300046529 Bacteria 2916
942 Ga0495652_0204026 3300046529 Bacteria 1498
943 Ga0495652_0299249 3300046529 Bacteria 1170
944 Ga0495652_1109266 3300046529 Bacteria 513
945 Ga0495665_0000104 3300046531 Bacteria 39624
946 Ga0495665_0196497 3300046531 Bacteria 1046
947 Ga0495665_0438462 3300046531 Bacteria 661
948 Ga0495665_0620360 3300046531 Bacteria 540
949 Ga0495640_0006908 3300046533 Bacteria 8939
950 Ga0495640_0008638 3300046533 Bacteria 7984
951 Ga0495586_0160223 3300046535 Bacteria 1269
952 Ga0495587_0003522 3300046536 Bacteria 10425
953 Ga0495598_0060743 3300046537 Bacteria 1165
954 Ga0495609_0100951 3300046538 Bacteria 1250
955 Ga0495609_0222961 3300046538 Bacteria 782
956 Ga0495597_0174386 3300046542 Bacteria 871
957 Ga0495645_0034120 3300046543 Bacteria 3713
958 Ga0495645_0452616 3300046543 Bacteria 809
959 Ga0495622_0040003 3300046557 Bacteria 2183
960 Ga0495622_0064799 3300046557 Bacteria 1690
961 Ga0495622_0072642 3300046557 Bacteria 1587
962 Ga0495622_0091511 3300046557 Bacteria 1397
963 Ga0495656_0019569 3300046615 Bacteria 2614
964 Ga0495656_0037417 3300046615 Bacteria 2004
965 Ga0495656_0105143 3300046615 Bacteria 1312
966 Ga0495656_0340495 3300046615 Bacteria 775
967 Ga0495668_0045553 3300046616 Bacteria 2439
968 Ga0495668_0302103 3300046616 Bacteria 877
969 Ga0495668_0339777 3300046616 Bacteria 824
970 Ga0495634_0004417 3300046642 Bacteria 11047
971 Ga0495634_0018689 3300046642 Bacteria 4931
972 Ga0495634_0045434 3300046642 Bacteria 2969
973 Ga0495611_0027449 3300046648 Bacteria 2488
974 Ga0495611_0061366 3300046648 Bacteria 1709
975 Ga0495611_0178178 3300046648 Bacteria 993
976 Ga0495625_0275271 3300046660 Bacteria 1085
977 Ga0495625_0353919 3300046660 Bacteria 927
978 Ga0495625_0415652 3300046660 Bacteria 837
979 Ga0495635_0001205 3300046663 Bacteria 17261
980 Ga0495635_0008253 3300046663 Bacteria 7268
981 Ga0495635_0199189 3300046663 Bacteria 1358
982 Ga0495635_0240697 3300046663 Bacteria 1221
983 Ga0495659_0012710 3300046664 Bacteria 2732
984 Ga0495659_0239144 3300046664 Bacteria 754
985 Ga0495661_0314960 3300046665 Bacteria 779
986 Ga0495588_0038217 3300046674 Bacteria 2441
987 Ga0495588_0590551 3300046674 Bacteria 582
988 Ga0495657_0009562 3300046675 Bacteria 7344
989 Ga0495599_0000673 3300046678 Bacteria 19348
990 Ga0495599_0299464 3300046678 Bacteria 971
991 Ga0495599_0762684 3300046678 Bacteria 554
992 Ga0495623_0101404 3300046679 Bacteria 1753
993 Ga0495623_0296622 3300046679 Bacteria 895
994 Ga0495646_0002999 3300046680 Bacteria 10471
995 Ga0495646_0003385 3300046680 Bacteria 9913
996 Ga0495646_0112349 3300046680 Bacteria 1550
997 Ga0495647_0005695 3300046681 Bacteria 4095
998 Ga0495647_0070261 3300046681 Bacteria 1400
999 Ga0495647_0272558 3300046681 Bacteria 758
1000 Ga0495658_0002138 3300046683 Bacteria 10005
1001 Ga0495658_0006603 3300046683 Bacteria 5700
1002 Ga0495658_0179652 3300046683 Bacteria 1313
1003 Ga0495658_0256238 3300046683 Bacteria 1101
1004 Ga0495669_0022881 3300046684 Bacteria 2716
1005 Ga0495669_0037766 3300046684 Bacteria 2138
1006 Ga0495669_0216925 3300046684 Bacteria 917
1007 Ga0495669_0256870 3300046684 Bacteria 839
1008 Ga0495669_0412982 3300046684 Bacteria 654
1009 Ga0495613_0018203 3300046689 Bacteria 5238
1010 Ga0495613_0025996 3300046689 Bacteria 4361
1011 Ga0495613_0051891 3300046689 Bacteria 3022
1012 Ga0495613_0090693 3300046689 Bacteria 2214
1013 Ga0495624_0002866 3300046690 Bacteria 12914
1014 Ga0495624_0194679 3300046690 Bacteria 1232
1015 Ga0495624_0400748 3300046690 Bacteria 824
1016 Ga0495624_0403886 3300046690 Bacteria 820
1017 Ga0495624_0461862 3300046690 Bacteria 760
1018 Ga0495671_0432509 3300046692 Bacteria 629
1019 Ga0495589_0083491 3300046794 Bacteria 1553
1020 Ga0495589_0120484 3300046794 Bacteria 1263
1021 Ga0495600_0007219 3300046809 Bacteria 6781
1022 Ga0495600_0121962 3300046809 Bacteria 1695
1023 Ga0495600_0454079 3300046809 Bacteria 792
1024 Ga0495600_0631648 3300046809 Bacteria 649
1025 Ga0495581_0000391 3300047315 Bacteria 22000
1026 Ga0495581_0027928 3300047315 Bacteria 3272
1027 Ga0495581_0123057 3300047315 Bacteria 1510
1028 Ga0495581_0283999 3300047315 Bacteria 967
1029 Ga0495604_0139733 3300047317 Bacteria 1731
1030 Ga0495604_0193262 3300047317 Bacteria 1417
1031 Ga0495604_0307764 3300047317 Bacteria 1062
1032 Ga0495636_0264687 3300047318 Bacteria 798
1033 Ga0495674_0002721 3300047319 Bacteria 17181
1034 Ga0495674_0017714 3300047319 Bacteria 6632
1035 Ga0495674_0017899 3300047319 Bacteria 6597
1036 Ga0495674_0235436 3300047319 Bacteria 1510
1037 Ga0495672_0025901 3300047320 Bacteria 3749
1038 Ga0495672_0034475 3300047320 Bacteria 3127
1039 Ga0495676_0007448 3300047321 Bacteria 10042
1040 Ga0495676_0411718 3300047321 Bacteria 896
1041 Ga0495680_0008673 3300047322 Bacteria 9225
1042 Ga0495680_0482529 3300047322 Bacteria 844
1043 Ga0495683_0305327 3300047323 Bacteria 682
1044 Ga0495677_0067499 3300047445 Bacteria 1331
1045 Ga0495679_042227 3300047446 Bacteria 1408
1046 Ga0495685_138946 3300047447 Bacteria 792
1047 Ga0495673_0019681 3300047469 Bacteria 3379
1048 Ga0495684_0001891 3300047471 Bacteria 16776
1049 Ga0495684_0019909 3300047471 Bacteria 5171
1050 Ga0495684_0298594 3300047471 Bacteria 1157
1051 Ga0495686_0357552 3300047472 Bacteria 792
1052 Ga0495686_0485115 3300047472 Bacteria 653
1053 Ga0495593_0000180 3300047673 Bacteria 32786
1054 Ga0495593_0010159 3300047673 Bacteria 5447
1055 Ga0495593_0065947 3300047673 Bacteria 1887
1056 Ga0495593_0549964 3300047673 Bacteria 579
1057 Ga0495593_0609991 3300047673 Bacteria 548
1058 Ga0495602_0473934 3300048088 Bacteria 879
1059 Ga0495602_0538584 3300048088 Bacteria 811
1060 Ga0495602_0742213 3300048088 Bacteria 663
1061 Ga0496100_0012270 3300048903 Bacteria 4907
1062 Ga0496100_0136693 3300048903 Bacteria 1732
1063 Ga0496100_0150574 3300048903 Bacteria 1659
1064 Ga0496100_0742383 3300048903 Bacteria 767
1065 Ga0496100_0971189 3300048903 Bacteria 668
1066 Ga0496101_0005995 3300048904 Bacteria 7793
1067 Ga0496101_0032497 3300048904 Bacteria 3674
1068 Ga0496101_0082969 3300048904 Bacteria 2372
1069 Ga0496101_0434221 3300048904 Bacteria 1036
1070 Ga0496101_0565000 3300048904 Bacteria 899
1071 Ga0496101_0745524 3300048904 Bacteria 773
1072 Ga0496102_0001773 3300048905 Bacteria 18732
1073 Ga0496102_0068054 3300048905 Bacteria 3267
1074 Ga0496102_0084900 3300048905 Bacteria 2923
1075 Ga0496102_0138305 3300048905 Bacteria 2282
1076 Ga0496102_0152079 3300048905 Bacteria 2175
1077 Ga0496102_0183964 3300048905 Bacteria 1969
1078 Ga0496102_0727129 3300048905 Bacteria 915
1079 Ga0496102_0967551 3300048905 Bacteria 772
1080 Ga0496103_0015686 3300048906 Bacteria 4516
1081 Ga0496103_0129438 3300048906 Bacteria 1611
1082 Ga0496103_0513245 3300048906 Bacteria 766
1083 Ga0496103_0553048 3300048906 Bacteria 735
1084 Ga0496104_0023762 3300048907 Bacteria 5636
1085 Ga0496104_0209282 3300048907 Bacteria 1862
1086 Ga0496104_0309445 3300048907 Bacteria 1492
1087 Ga0496104_0356795 3300048907 Bacteria 1374
1088 Ga0496104_0385952 3300048907 Bacteria 1313
1089 Ga0496104_0442951 3300048907 Bacteria 1211
1090 Ga0496104_1559642 3300048907 Bacteria 563
1091 Ga0496105_0032232 3300048908 Bacteria 4299
1092 Ga0496105_0080378 3300048908 Bacteria 2692
1093 Ga0496105_0138424 3300048908 Bacteria 2004
1094 Ga0496105_0176526 3300048908 Bacteria 1750
1095 Ga0496105_0985179 3300048908 Bacteria 631
1096 Ga0496106_0006597 3300048909 Bacteria 8591
1097 Ga0496106_0035076 3300048909 Bacteria 3749
1098 Ga0496106_0064146 3300048909 Bacteria 2794
1099 Ga0496106_0137608 3300048909 Bacteria 1919
1100 Ga0496106_0334597 3300048909 Bacteria 1216
1101 Ga0496106_0358600 3300048909 Bacteria 1171
1102 Ga0496106_0602940 3300048909 Bacteria 879
1103 Ga0496106_1119527 3300048909 Bacteria 616
1104 Ga0496107_0008230 3300048910 Bacteria 7214
1105 Ga0496107_0015115 3300048910 Bacteria 5407
1106 Ga0496107_0141467 3300048910 Bacteria 1778
1107 Ga0496107_0318792 3300048910 Bacteria 1157
1108 Ga0496107_0484829 3300048910 Bacteria 917
1109 Ga0496107_0705796 3300048910 Bacteria 742
1110 Ga0496108_0146822 3300048911 Bacteria 2034
1111 Ga0496108_0154186 3300048911 Bacteria 1983
1112 Ga0496108_0196399 3300048911 Bacteria 1750
1113 Ga0496108_0469433 3300048911 Bacteria 1099
1114 Ga0496108_0557672 3300048911 Bacteria 999
1115 Ga0496108_0579652 3300048911 Bacteria 978
1116 Ga0496108_0725204 3300048911 Bacteria 861
1117 Ga0496109_0028952 3300048912 Bacteria 4959
1118 Ga0496109_0051059 3300048912 Bacteria 3766
1119 Ga0496109_0146281 3300048912 Bacteria 2211
1120 Ga0496109_0679986 3300048912 Bacteria 966
1121 Ga0496109_0790578 3300048912 Bacteria 887
1122 Ga0496109_0799271 3300048912 Bacteria 881
1123 Ga0496110_0027369 3300048913 Bacteria 4888
1124 Ga0496110_0046887 3300048913 Bacteria 3781
1125 Ga0496110_0164782 3300048913 Bacteria 2010
1126 Ga0496110_0334107 3300048913 Bacteria 1380
1127 Ga0496110_0615742 3300048913 Bacteria 984
1128 Ga0496111_0039133 3300048914 Bacteria 3399
1129 Ga0496111_0041641 3300048914 Bacteria 3297
1130 Ga0496111_0047722 3300048914 Bacteria 3084
1131 Ga0496111_0063998 3300048914 Bacteria 2668
1132 Ga0496111_0104351 3300048914 Bacteria 2085
1133 Ga0496112_0000019 3300048915 Bacteria 185531
1134 Ga0496112_0033990 3300048915 Bacteria 4960
1135 Ga0496112_0055956 3300048915 Bacteria 3881
1136 Ga0496112_0120658 3300048915 Bacteria 2591
1137 Ga0496112_0290937 3300048915 Bacteria 1579
1138 Ga0496112_0353035 3300048915 Bacteria 1413
1139 Ga0496112_0357056 3300048915 Bacteria 1404
1140 Ga0496113_0000807 3300048916 Bacteria 16247
1141 Ga0496113_0018950 3300048916 Bacteria 4804
1142 Ga0496113_0072749 3300048916 Bacteria 2617
1143 Ga0496113_0429768 3300048916 Bacteria 1061
1144 Ga0496113_0469984 3300048916 Bacteria 1010
1145 Ga0496113_0683672 3300048916 Bacteria 820
1146 Ga0496113_0773826 3300048916 Bacteria 763
1147 Ga0496113_0909668 3300048916 Bacteria 696
1148 Ga0496114_0050365 3300048917 Bacteria 3466
1149 Ga0496114_0073391 3300048917 Bacteria 2879
1150 Ga0496114_0124263 3300048917 Bacteria 2222
1151 Ga0496114_1158739 3300048917 Bacteria 659
1152 Ga0496115_0001360 3300048918 Bacteria 17447
1153 Ga0496115_0009296 3300048918 Bacteria 7305
1154 Ga0496115_0033069 3300048918 Bacteria 4082
1155 Ga0496115_0133276 3300048918 Bacteria 2048
1156 Ga0496115_0191841 3300048918 Bacteria 1688
1157 Ga0496115_0203602 3300048918 Bacteria 1635
1158 Ga0496115_0262435 3300048918 Bacteria 1420
1159 Ga0496115_0464273 3300048918 Bacteria 1021
1160 Ga0496117_0038054 3300048920 Bacteria 3574
1161 Ga0496117_0102516 3300048920 Bacteria 1806
1162 Ga0496118_0054264 3300048921 Bacteria 3037
1163 Ga0496119_0219518 3300048922 Bacteria 974
1164 Ga0496120_0305628 3300048923 Bacteria 727
1165 Ga0496121_0000365 3300048924 Bacteria 92822
1166 Ga0496121_0018687 3300048924 Bacteria 6976
1167 Ga0496121_0031262 3300048924 Bacteria 4866
1168 Ga0496121_0057162 3300048924 Bacteria 3235
1169 Ga0496121_0091621 3300048924 Bacteria 2373
1170 Ga0496121_0125113 3300048924 Bacteria 1934
1171 Ga0496121_0145875 3300048924 Bacteria 1749
1172 Ga0496121_0362348 3300048924 Bacteria 962
1173 Ga0496121_0389533 3300048924 Bacteria 916
1174 Ga0496121_0424582 3300048924 Bacteria 864
1175 Ga0496121_0652824 3300048924 Bacteria 640
1176 Ga0496124_0008072 3300048927 Bacteria 11068
1177 Ga0496125_0121266 3300048928 Bacteria 1865
1178 Ga0496125_0315756 3300048928 Bacteria 950
1179 Ga0496126_0000483 3300048929 Bacteria 78885
1180 Ga0496126_0002146 3300048929 Bacteria 27491
1181 Ga0496126_0009701 3300048929 Bacteria 10197
1182 Ga0496126_0027923 3300048929 Bacteria 5382
1183 Ga0496126_0036970 3300048929 Bacteria 4561
1184 Ga0496126_0104306 3300048929 Bacteria 2477
1185 Ga0496126_0221971 3300048929 Bacteria 1587
1186 Ga0496126_0222017 3300048929 Bacteria 1587
1187 Ga0496126_0910664 3300048929 Bacteria 666
1188 Ga0501046_0074602 3300049580 Bacteria 2632
1189 Ga0501047_0124858 3300049581 Bacteria 2454
1190 Ga0501047_0256777 3300049581 Bacteria 1596
1191 Ga0501067_0643987 3300049583 Bacteria 595
1192 Ga0501069_0199298 3300049585 Bacteria 1160
1193 Ga0501070_0040505 3300049586 Bacteria 3884
1194 Ga0501073_0072930 3300049589 Bacteria 2391
1195 Ga0501074_0031172 3300049590 Bacteria 3863
1196 Ga0501257_208515 3300049686 Bacteria 565
1197 Ga0501080_0002786 3300049742 Bacteria 15345
1198 Ga0501044_0143390 3300049823 Bacteria 2376
1199 Ga0501045_0252455 3300049824 Bacteria 1313
1200 nmdc:mga03683_281711_c1 3300050489 Bacteria 777
1201 nmdc:mga03683_3240_c1 3300050489 Bacteria 5213
1202 nmdc:mga03683_368666_c1 3300050489 Bacteria 682
1203 nmdc:mga03683_85452_c1 3300050489 Bacteria 1368
1204 nmdc:mga03n38_216364_c1 3300050490 Bacteria 998
1205 nmdc:mga03n38_46_c2 3300050490 Bacteria 15402
1206 nmdc:mga03n38_86131_c1 3300050490 Bacteria 1486
1207 nmdc:mga03n38_982484_c1 3300050490 Bacteria 500
1208 nmdc:mga00v17_528839_c1 3300050491 Bacteria 763
1209 nmdc:mga0yw44_17722_c1 3300050492 Bacteria 3883
1210 nmdc:mga0yw44_17809_c1 3300050492 Bacteria 3556
1211 nmdc:mga0yw44_319403_c1 3300050492 Bacteria 1042
1212 nmdc:mga0yw44_367800_c1 3300050492 Bacteria 970
1213 nmdc:mga0yw44_521170_c1 3300050492 Bacteria 807
1214 nmdc:mga0k408_390542_c1 3300050493 Bacteria 829
1215 nmdc:mga0k408_408114_c1 3300050493 Bacteria 808
1216 nmdc:mga0k408_685693_c1 3300050493 Bacteria 601
1217 nmdc:mga0k408_699396_c1 3300050493 Bacteria 594
1218 nmdc:mga06z11_258422_c1 3300050494 Bacteria 1027
1219 nmdc:mga06z11_264442_c1 3300050494 Bacteria 1016
1220 nmdc:mga06z11_367178_c1 3300050494 Bacteria 863
1221 nmdc:mga06z11_39880_c1 3300050494 Bacteria 2340
1222 nmdc:mga04h51_165031_c1 3300050495 Bacteria 854
1223 nmdc:mga04h51_217474_c1 3300050495 Bacteria 756
1224 nmdc:mga07m45_319458_c1 3300050496 Bacteria 903
1225 nmdc:mga07m45_473359_c1 3300050496 Bacteria 726
1226 nmdc:mga07m45_49471_c1 3300050496 Bacteria 2366
1227 nmdc:mga07m45_7364_c1 3300050496 Bacteria 5620
1228 nmdc:mga05p37_950515_c1 3300050507 Bacteria 920
1229 nmdc:mga08y16_1263167_c1 3300050511 Bacteria 707
1230 nmdc:mga08y16_490127_c1 3300050511 Bacteria 1250
1231 nmdc:mga08y16_712514_c1 3300050511 Bacteria 1002
1232 nmdc:mga0n895_3688_c1 3300050512 Bacteria 12376
1233 nmdc:mga0rr50_164437_c1 3300050513 Bacteria 1803
1234 nmdc:mga0rr50_573382_c1 3300050513 Bacteria 961
1235 nmdc:mga08x19_427671_c1 3300050514 Bacteria 930
1236 nmdc:mga0a205_657650_c1 3300050515 Bacteria 899
1237 Ga0495601_0063657 3300053077 Bacteria 2344
1238 Ga0495601_0391578 3300053077 Bacteria 901
1239 Ga0495601_0685458 3300053077 Bacteria 654
1240 Ga0495612_0142454 3300053078 Bacteria 1040
1241 Ga0495612_0264823 3300053078 Bacteria 766
1242 Ga0500610_0196747 3300053079 Bacteria 975
1243 Ga0500635_0085889 3300053080 Bacteria 1137
1244 Ga0495655_0135701 3300053083 Bacteria 762
1245 Ga0495595_0004220 3300053084 Bacteria 5777
1246 Ga0495595_0005357 3300053084 Bacteria 5193
1247 Ga0495619_0006724 3300053085 Bacteria 7274
1248 Ga0495619_0102371 3300053085 Bacteria 1950
1249 Ga0495619_0185770 3300053085 Bacteria 1438
1250 Ga0495619_0800022 3300053085 Bacteria 638
1251 Ga0500578_0465841 3300053086 Bacteria 717
1252 Ga0500643_057151 3300053087 Bacteria 1102
1253 Ga0500646_0244868 3300053090 Bacteria 629
1254 Ga0500647_0183288 3300053091 Bacteria 959
1255 Ga0500647_0221418 3300053091 Bacteria 847
1256 Ga0500583_0045097 3300053092 Bacteria 2022
1257 Ga0500566_0000122 3300053094 Bacteria 40534
1258 Ga0500566_0024142 3300053094 Bacteria 3571
1259 Ga0500566_0165900 3300053094 Bacteria 1146
1260 Ga0500566_0205436 3300053094 Bacteria 991
1261 Ga0500640_008021 3300053095 Bacteria 4150
1262 Ga0500641_0047587 3300053096 Bacteria 1754
1263 Ga0500641_0061416 3300053096 Bacteria 1565
1264 Ga0500648_158071 3300053097 Bacteria 1196
1265 Ga0500554_000582 3300053102 Bacteria 7454
1266 Ga0500554_004983 3300053102 Bacteria 2861
1267 Ga0500562_141756 3300053108 Bacteria 655
1268 Ga0500572_000053 3300053111 Bacteria 34807
1269 Ga0500580_148560 3300053113 Bacteria 849
1270 Ga0500594_0094413 3300053118 Bacteria 912
1271 Ga0500595_002485 3300053119 Bacteria 9121
1272 Ga0500595_018947 3300053119 Bacteria 2506
1273 Ga0500595_019042 3300053119 Bacteria 2497
1274 Ga0500595_152212 3300053119 Bacteria 646
1275 Ga0500608_024872 3300053122 Bacteria 2799
1276 Ga0500621_185844 3300053126 Bacteria 749
1277 Ga0500655_007445 3300053133 Bacteria 1970
1278 Ga0500658_0141496 3300053134 Bacteria 1079
1279 Ga0500559_0001445 3300053136 Bacteria 13484
1280 Ga0500559_0065370 3300053136 Bacteria 1629
1281 Ga0500568_0011478 3300053139 Bacteria 4108
1282 Ga0500568_0081886 3300053139 Bacteria 1225
1283 Ga0500573_0039597 3300053140 Bacteria 2722
1284 Ga0500585_168518 3300053144 Bacteria 752
1285 Ga0500589_066930 3300053147 Bacteria 1633
1286 Ga0500589_096267 3300053147 Bacteria 1294
1287 Ga0500590_079068 3300053148 Bacteria 1619
1288 Ga0500590_192021 3300053148 Bacteria 874
1289 Ga0500603_000341 3300053150 Bacteria 12188
1290 Ga0500603_001366 3300053150 Bacteria 5572
1291 Ga0500603_246965 3300053150 Bacteria 573
1292 Ga0500627_0116618 3300053158 Bacteria 1203
1293 Ga0500630_003299 3300053159 Bacteria 7821
1294 Ga0500633_0133672 3300053160 Bacteria 927
1295 Ga0500634_0112173 3300053161 Bacteria 1343
1296 Ga0500638_001838 3300053162 Bacteria 7001
1297 Ga0500638_006669 3300053162 Bacteria 4752
1298 Ga0500638_164379 3300053162 Bacteria 974
1299 Ga0500639_000008 3300053163 Bacteria 143238
1300 Ga0500639_054379 3300053163 Bacteria 2080
1301 Ga0500636_0027580 3300053177 Bacteria 3355
1302 Ga0500637_0000070 3300053178 Bacteria 36880
1303 Ga0500637_0001409 3300053178 Bacteria 10235
1304 Ga0500637_0049099 3300053178 Bacteria 2401
1305 Ga0500657_162072 3300053728 Bacteria 809
1306 Ga0500657_175293 3300053728 Bacteria 753
1307 Ga0500609_013392 3300053731 Bacteria 1110
1308 Ga0500596_002311 3300053735 Bacteria 3773
1309 Ga0500596_002931 3300053735 Bacteria 3305
1310 Ga0500587_024005 3300053739 Bacteria 808
1311 Ga0500661_000295 3300055283 Bacteria 9047
1312 Ga0587114_088110 3300059655 Bacteria 588
1313 Ga0466962_0401363 3300061719 Bacteria 686
1314 Ga0530510_0776700 3300061734 Bacteria 731
1315 Ga0530510_1220340 3300061734 Bacteria 577

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2903748898 2903753254 125
2 3300037068 Ga0373925_1751887 Ga0373925_1751887_46_450 133
3 3300005340 Ga0070689_100002458 Ga0070689_10000245811 137
4 3300025936 Ga0207670_10001223 Ga0207670_100012233 137
5 3300005328 Ga0070676_10895108 Ga0070676_108951082 144
6 3300046513 Ga0495616_0349604 Ga0495616_0349604_160_594 144
7 3300046515 Ga0495620_0073085 Ga0495620_0073085_13_447 144
8 3300046615 Ga0495656_0340495 Ga0495656_0340495_22_456 144
9 3300049686 Ga0501257_208515 Ga0501257_208515_11_445 144
10 3300049824 Ga0501045_0252455 Ga0501045_0252455_784_1218 144
11 3300053126 Ga0500621_185844 Ga0500621_185844_17_451 144
12 3300053134 Ga0500658_0141496 Ga0500658_0141496_16_450 144
13 3300046681 Ga0495647_0272558 Ga0495647_0272558_10_450 145
14 3300033179 Ga0307507_10310088 Ga0307507_103100882 149
15 3300048906 Ga0496103_0513245 Ga0496103_0513245_118_570 149
16 3300009094 Ga0111539_11578324 Ga0111539_115783242 152
17 3300027907 Ga0207428_10796907 Ga0207428_107969072 152
18 3300050511 nmdc:mga08y16_1263167_c1 nmdc:mga08y16_1263167_c1_206_667 152
19 3300031456 Ga0307513_10052398 Ga0307513_100523984 153
20 3300028379 Ga0268266_11201458 Ga0268266_112014581 154
21 iso_pu_bacteria 2513237101 2513693301 154
22 iso_pu_bacteria 2721755755 2723848211 154
23 iso_pu_bacteria 2791355199 2793081994 154
24 iso_pu_bacteria 2874604998 2874608801 154
25 iso_pu_bacteria 2876808645 2876813859 154
26 iso_pu_bacteria 2879110137 2879115470 154
27 iso_pu_bacteria 2889033259 2889037272 154
28 iso_pu_bacteria 2922361189 2922361406 154
29 iso_pu_bacteria 2922386360 2922393022 154
30 iso_pu_bacteria 8006964411 8006970845 154
31 iso_pu_bacteria 8006984368 8006985264 154
32 iso_pu_bacteria 8006994254 8006998583 154
33 iso_pu_bacteria 8056673599 8056675883 154
34 3300053085 Ga0495619_0102371 Ga0495619_0102371_577_1068 155
35 iso_pu_bacteria 2513237098 2513672789 155
36 iso_pu_bacteria 2524023210 2524471603 155
37 iso_pu_bacteria 2524023228 2524535865 155
38 iso_pu_bacteria 2667528175 2671124406 155
39 iso_pu_bacteria 2885374607 2885377720 155
40 iso_pu_bacteria 2885383462 2885391563 155
41 iso_pu_bacteria 2894772417 2894772966 155
42 iso_pu_bacteria 2903768456 2903776862 155
43 iso_pu_bacteria 2904690495 2904691509 155
44 iso_pu_bacteria 2904699407 2904701364 155
45 iso_pu_bacteria 2908739725 2908744136 155
46 iso_pu_bacteria 2908756301 2908761678 155
47 iso_pu_bacteria 8006933436 8006942503 155
48 iso_pu_bacteria 8006973647 8006982227 155
49 iso_pu_bacteria 8056681323 8056689049 155
50 iso_pu_bacteria 8056689827 8056695986 155
51 3300003316 rootH1_10096066 rootH1_100960663 156
52 3300003322 rootL2_10051549 rootL2_100515493 156
53 3300005548 Ga0070665_100611798 Ga0070665_1006117982 156
54 3300025924 Ga0207694_11085778 Ga0207694_110857782 156
55 3300026078 Ga0207702_10724608 Ga0207702_107246082 156
56 3300028379 Ga0268266_10315190 Ga0268266_103151902 156
57 3300035116 Ga0373945_0194375 Ga0373945_0194375_175_654 156
58 3300046455 Ga0495603_0116164 Ga0495603_0116164_582_1061 156
59 3300046457 Ga0495590_0151116 Ga0495590_0151116_159_638 156
60 3300046474 Ga0495605_0255034 Ga0495605_0255034_178_657 156
61 3300046475 Ga0495639_0137106 Ga0495639_0137106_241_720 156
62 3300046499 Ga0495594_0173126 Ga0495594_0173126_378_857 156
63 3300046507 Ga0495606_0394206 Ga0495606_0394206_20_499 156
64 3300046531 Ga0495665_0196497 Ga0495665_0196497_172_651 156
65 3300046616 Ga0495668_0045553 Ga0495668_0045553_740_1219 156
66 3300046681 Ga0495647_0070261 Ga0495647_0070261_361_840 156
67 3300046683 Ga0495658_0179652 Ga0495658_0179652_199_678 156
68 3300046684 Ga0495669_0216925 Ga0495669_0216925_65_544 156
69 3300050511 nmdc:mga08y16_712514_c1 nmdc:mga08y16_712514_c1_473_946 156
70 3300059655 Ga0587114_088110 Ga0587114_088110_63_542 156
71 iso_pu_bacteria 2513237096 2513659322 156
72 iso_pu_bacteria 2513237137 2513861759 156
73 iso_pu_bacteria 2513237145 2513921416 156
74 iso_pu_bacteria 2517572143 2517893734 156
75 iso_pu_bacteria 2728368998 2728752886 156
76 iso_pu_bacteria 2791355197 2793070764 156
77 iso_pu_bacteria 2906610324 2906610612 156
78 iso_pu_bacteria 2906635258 2906641932 156
79 iso_pu_bacteria 2906660503 2906666123 156
80 iso_pu_bacteria 2922425934 2922428712 156
81 iso_pu_bacteria 2935630451 2935634684 156
82 iso_pu_bacteria 2941507105 2941509170 156
83 iso_pu_bacteria 2941515067 2941516999 156
84 iso_pu_bacteria 2941523033 2941524906 156
85 iso_pu_bacteria 3005474847 3005478845 156
86 iso_pu_bacteria 8019555841 8019558264 156
87 iso_pu_bacteria 8019565922 8019567034 156
88 3300005617 Ga0068859_100000028 Ga0068859_10000002881 157
89 3300005937 Ga0081455_10076848 Ga0081455_100768482 157
90 3300005985 Ga0081539_10127058 Ga0081539_101270582 157
91 3300006038 Ga0075365_10172876 Ga0075365_101728762 157
92 3300006177 Ga0075362_10002833 Ga0075362_100028334 157
93 3300006931 Ga0097620_100000028 Ga0097620_10000002881 157
94 3300009101 Ga0105247_10000988 Ga0105247_100009886 157
95 3300011119 Ga0105246_10917949 Ga0105246_109179491 157
96 3300021361 Ga0213872_10340844 Ga0213872_103408442 157
97 3300025934 Ga0207686_11018575 Ga0207686_110185752 157
98 3300026035 Ga0207703_11630469 Ga0207703_116304691 157
99 3300031235 Ga0265330_10046855 Ga0265330_100468552 157
100 3300031247 Ga0265340_10075050 Ga0265340_100750502 157
101 3300031249 Ga0265339_10004935 Ga0265339_100049351 157
102 3300031250 Ga0265331_10099006 Ga0265331_100990062 157
103 3300031901 Ga0307406_10092079 Ga0307406_100920793 157
104 3300033179 Ga0307507_10036548 Ga0307507_100365484 157
105 3300039447 Ga0436361_0114609 Ga0436361_0114609_725_1201 157
106 3300047445 Ga0495677_0067499 Ga0495677_0067499_381_863 157
107 3300048928 Ga0496125_0121266 Ga0496125_0121266_961_1437 157
108 3300050489 nmdc:mga03683_3240_c1 nmdc:mga03683_3240_c1_3897_4376 157
109 3300003215 JGI25153J46596_10004964 JGI25153J46596_100049643 158
110 3300003659 JGI25404J52841_10005977 JGI25404J52841_100059772 158
111 3300005327 Ga0070658_10523972 Ga0070658_105239722 158
112 3300005327 Ga0070658_11196780 Ga0070658_111967801 158
113 3300005331 Ga0070670_100679750 Ga0070670_1006797502 158
114 3300005334 Ga0068869_100275915 Ga0068869_1002759151 158
115 3300005335 Ga0070666_10155323 Ga0070666_101553232 158
116 3300005335 Ga0070666_10433589 Ga0070666_104335892 158
117 3300005335 Ga0070666_11106615 Ga0070666_111066151 158
118 3300005337 Ga0070682_100104816 Ga0070682_1001048162 158
119 3300005337 Ga0070682_100887369 Ga0070682_1008873691 158
120 3300005338 Ga0068868_100047327 Ga0068868_1000473271 158
121 3300005338 Ga0068868_100807001 Ga0068868_1008070012 158
122 3300005338 Ga0068868_101009649 Ga0068868_1010096492 158
123 3300005339 Ga0070660_100197578 Ga0070660_1001975782 158
124 3300005340 Ga0070689_100090584 Ga0070689_1000905842 158
125 3300005341 Ga0070691_10262217 Ga0070691_102622172 158
126 3300005344 Ga0070661_100204859 Ga0070661_1002048592 158
127 3300005347 Ga0070668_100040084 Ga0070668_1000400843 158
128 3300005347 Ga0070668_100047147 Ga0070668_1000471473 158
129 3300005347 Ga0070668_100088409 Ga0070668_1000884092 158
130 3300005347 Ga0070668_100511776 Ga0070668_1005117762 158
131 3300005347 Ga0070668_100593062 Ga0070668_1005930622 158
132 3300005347 Ga0070668_100594096 Ga0070668_1005940962 158
133 3300005347 Ga0070668_100696650 Ga0070668_1006966502 158
134 3300005347 Ga0070668_101157946 Ga0070668_1011579461 158
135 3300005353 Ga0070669_100000514 Ga0070669_10000051412 158
136 3300005353 Ga0070669_100117540 Ga0070669_1001175402 158
137 3300005354 Ga0070675_101216544 Ga0070675_1012165441 158
138 3300005355 Ga0070671_100000067 Ga0070671_10000006727 158
139 3300005355 Ga0070671_100007781 Ga0070671_1000077817 158
140 3300005355 Ga0070671_100059926 Ga0070671_1000599262 158
141 3300005355 Ga0070671_100202729 Ga0070671_1002027292 158
142 3300005355 Ga0070671_100290042 Ga0070671_1002900422 158
143 3300005355 Ga0070671_100719657 Ga0070671_1007196572 158
144 3300005356 Ga0070674_100035366 Ga0070674_1000353662 158
145 3300005356 Ga0070674_100142635 Ga0070674_1001426352 158
146 3300005365 Ga0070688_100486508 Ga0070688_1004865082 158
147 3300005367 Ga0070667_100333628 Ga0070667_1003336282 158
148 3300005367 Ga0070667_100729876 Ga0070667_1007298761 158
149 3300005406 Ga0070703_10303195 Ga0070703_103031951 158
150 3300005438 Ga0070701_10326152 Ga0070701_103261522 158
151 3300005441 Ga0070700_100362108 Ga0070700_1003621082 158
152 3300005441 Ga0070700_100690139 Ga0070700_1006901392 158
153 3300005455 Ga0070663_100004258 Ga0070663_1000042587 158
154 3300005455 Ga0070663_100165928 Ga0070663_1001659282 158
155 3300005455 Ga0070663_100486520 Ga0070663_1004865201 158
156 3300005455 Ga0070663_100909677 Ga0070663_1009096772 158
157 3300005455 Ga0070663_101250232 Ga0070663_1012502321 158
158 3300005456 Ga0070678_100222512 Ga0070678_1002225122 158
159 3300005457 Ga0070662_100102169 Ga0070662_1001021692 158
160 3300005457 Ga0070662_101404043 Ga0070662_1014040431 158
161 3300005459 Ga0068867_100133578 Ga0068867_1001335782 158
162 3300005459 Ga0068867_100781647 Ga0068867_1007816472 158
163 3300005467 Ga0070706_100686668 Ga0070706_1006866682 158
164 3300005518 Ga0070699_100499672 Ga0070699_1004996721 158
165 3300005539 Ga0068853_100714351 Ga0068853_1007143512 158
166 3300005543 Ga0070672_100234660 Ga0070672_1002346602 158
167 3300005544 Ga0070686_100030509 Ga0070686_1000305092 158
168 3300005544 Ga0070686_100282868 Ga0070686_1002828682 158
169 3300005544 Ga0070686_100824072 Ga0070686_1008240722 158
170 3300005544 Ga0070686_100948640 Ga0070686_1009486401 158
171 3300005546 Ga0070696_100225976 Ga0070696_1002259762 158
172 3300005546 Ga0070696_100550148 Ga0070696_1005501481 158
173 3300005547 Ga0070693_100042981 Ga0070693_1000429813 158
174 3300005547 Ga0070693_100220775 Ga0070693_1002207752 158
175 3300005548 Ga0070665_100057106 Ga0070665_1000571062 158
176 3300005548 Ga0070665_100069254 Ga0070665_1000692542 158
177 3300005548 Ga0070665_100171529 Ga0070665_1001715293 158
178 3300005548 Ga0070665_100636708 Ga0070665_1006367082 158
179 3300005548 Ga0070665_101002409 Ga0070665_1010024092 158
180 3300005563 Ga0068855_100000994 Ga0068855_10000099415 158
181 3300005563 Ga0068855_100023587 Ga0068855_1000235872 158
182 3300005563 Ga0068855_100286670 Ga0068855_1002866702 158
183 3300005563 Ga0068855_102075284 Ga0068855_1020752842 158
184 3300005564 Ga0070664_100346944 Ga0070664_1003469442 158
185 3300005578 Ga0068854_100565285 Ga0068854_1005652852 158
186 3300005578 Ga0068854_100985186 Ga0068854_1009851862 158
187 3300005614 Ga0068856_100627006 Ga0068856_1006270062 158
188 3300005614 Ga0068856_101718419 Ga0068856_1017184191 158
189 3300005615 Ga0070702_100298427 Ga0070702_1002984272 158
190 3300005615 Ga0070702_100350477 Ga0070702_1003504771 158
191 3300005616 Ga0068852_100067025 Ga0068852_1000670252 158
192 3300005616 Ga0068852_100242251 Ga0068852_1002422512 158
193 3300005616 Ga0068852_101016554 Ga0068852_1010165542 158
194 3300005616 Ga0068852_101209859 Ga0068852_1012098592 158
195 3300005617 Ga0068859_100007456 Ga0068859_10000745610 158
196 3300005617 Ga0068859_100063326 Ga0068859_1000633262 158
197 3300005617 Ga0068859_101696236 Ga0068859_1016962362 158
198 3300005618 Ga0068864_100029724 Ga0068864_1000297243 158
199 3300005618 Ga0068864_100144519 Ga0068864_1001445192 158
200 3300005718 Ga0068866_10420738 Ga0068866_104207382 158
201 3300005719 Ga0068861_100436972 Ga0068861_1004369722 158
202 3300005719 Ga0068861_101451533 Ga0068861_1014515332 158
203 3300005841 Ga0068863_100023157 Ga0068863_1000231575 158
204 3300005841 Ga0068863_100231953 Ga0068863_1002319532 158
205 3300005841 Ga0068863_100744649 Ga0068863_1007446492 158
206 3300005841 Ga0068863_101228515 Ga0068863_1012285152 158
207 3300005842 Ga0068858_100019652 Ga0068858_1000196523 158
208 3300005842 Ga0068858_100354095 Ga0068858_1003540952 158
209 3300005842 Ga0068858_101101733 Ga0068858_1011017332 158
210 3300005843 Ga0068860_100021301 Ga0068860_1000213016 158
211 3300005843 Ga0068860_100285965 Ga0068860_1002859652 158
212 3300005843 Ga0068860_100920649 Ga0068860_1009206492 158
213 3300005844 Ga0068862_100102556 Ga0068862_1001025562 158
214 3300005844 Ga0068862_100152077 Ga0068862_1001520772 158
215 3300005844 Ga0068862_100297237 Ga0068862_1002972372 158
216 3300005844 Ga0068862_100640216 Ga0068862_1006402162 158
217 3300005844 Ga0068862_100694043 Ga0068862_1006940432 158
218 3300005937 Ga0081455_10036376 Ga0081455_100363764 158
219 3300005937 Ga0081455_10095062 Ga0081455_100950624 158
220 3300005983 Ga0081540_1001273 Ga0081540_100127325 158
221 3300005983 Ga0081540_1004433 Ga0081540_10044339 158
222 3300005983 Ga0081540_1007588 Ga0081540_100758810 158
223 3300005983 Ga0081540_1029423 Ga0081540_10294232 158
224 3300005985 Ga0081539_10119548 Ga0081539_101195482 158
225 3300006038 Ga0075365_10004788 Ga0075365_100047882 158
226 3300006038 Ga0075365_10122121 Ga0075365_101221212 158
227 3300006042 Ga0075368_10317224 Ga0075368_103172242 158
228 3300006048 Ga0075363_100005068 Ga0075363_1000050683 158
229 3300006051 Ga0075364_10243222 Ga0075364_102432222 158
230 3300006051 Ga0075364_10348156 Ga0075364_103481562 158
231 3300006058 Ga0075432_10101437 Ga0075432_101014372 158
232 3300006163 Ga0070715_10232644 Ga0070715_102326442 158
233 3300006175 Ga0070712_100525035 Ga0070712_1005250352 158
234 3300006177 Ga0075362_10477687 Ga0075362_104776871 158
235 3300006178 Ga0075367_10006819 Ga0075367_100068194 158
236 3300006178 Ga0075367_10136490 Ga0075367_101364902 158
237 3300006178 Ga0075367_10404420 Ga0075367_104044201 158
238 3300006178 Ga0075367_10435364 Ga0075367_104353641 158
239 3300006195 Ga0075366_10645420 Ga0075366_106454201 158
240 3300006195 Ga0075366_10660925 Ga0075366_106609252 158
241 3300006237 Ga0097621_100499621 Ga0097621_1004996212 158
242 3300006353 Ga0075370_10028134 Ga0075370_100281342 158
243 3300006353 Ga0075370_10155586 Ga0075370_101555862 158
244 3300006353 Ga0075370_10464034 Ga0075370_104640342 158
245 3300006358 Ga0068871_100275487 Ga0068871_1002754872 158
246 3300006844 Ga0075428_100726299 Ga0075428_1007262992 158
247 3300006881 Ga0068865_100067502 Ga0068865_1000675022 158
248 3300006881 Ga0068865_100441924 Ga0068865_1004419242 158
249 3300006881 Ga0068865_100628287 Ga0068865_1006282872 158
250 3300006931 Ga0097620_100007456 Ga0097620_1000074562 158
251 3300006931 Ga0097620_100063328 Ga0097620_1000633282 158
252 3300006931 Ga0097620_101696533 Ga0097620_1016965332 158
253 3300007076 Ga0075435_100147933 Ga0075435_1001479332 158
254 3300009036 Ga0105244_10268305 Ga0105244_102683052 158
255 3300009092 Ga0105250_10260498 Ga0105250_102604982 158
256 3300009093 Ga0105240_10446739 Ga0105240_104467392 158
257 3300009094 Ga0111539_10463556 Ga0111539_104635562 158
258 3300009094 Ga0111539_10554387 Ga0111539_105543872 158
259 3300009098 Ga0105245_10139110 Ga0105245_101391102 158
260 3300009098 Ga0105245_11235466 Ga0105245_112354662 158
261 3300009098 Ga0105245_12614679 Ga0105245_126146791 158
262 3300009101 Ga0105247_10113322 Ga0105247_101133222 158
263 3300009101 Ga0105247_10219304 Ga0105247_102193042 158
264 3300009101 Ga0105247_10507400 Ga0105247_105074002 158
265 3300009101 Ga0105247_10578478 Ga0105247_105784782 158
266 3300009147 Ga0114129_10827321 Ga0114129_108273212 158
267 3300009148 Ga0105243_10407528 Ga0105243_104075282 158
268 3300009148 Ga0105243_10708577 Ga0105243_107085772 158
269 3300009174 Ga0105241_10035235 Ga0105241_100352352 158
270 3300009174 Ga0105241_10535063 Ga0105241_105350632 158
271 3300009174 Ga0105241_10620129 Ga0105241_106201292 158
272 3300009176 Ga0105242_10398312 Ga0105242_103983122 158
273 3300009176 Ga0105242_11491921 Ga0105242_114919212 158
274 3300009176 Ga0105242_11496406 Ga0105242_114964062 158
275 3300009177 Ga0105248_10047570 Ga0105248_100475703 158
276 3300009177 Ga0105248_10114790 Ga0105248_101147902 158
277 3300009177 Ga0105248_10378607 Ga0105248_103786072 158
278 3300009177 Ga0105248_10640216 Ga0105248_106402162 158
279 3300009177 Ga0105248_10858805 Ga0105248_108588052 158
280 3300009177 Ga0105248_10895067 Ga0105248_108950672 158
281 3300009545 Ga0105237_10100303 Ga0105237_101003032 158
282 3300009545 Ga0105237_10104870 Ga0105237_101048702 158
283 3300009551 Ga0105238_10419151 Ga0105238_104191512 158
284 3300009551 Ga0105238_10579086 Ga0105238_105790862 158
285 3300009551 Ga0105238_10779032 Ga0105238_107790322 158
286 3300009553 Ga0105249_10131543 Ga0105249_101315432 158
287 3300009553 Ga0105249_10386945 Ga0105249_103869452 158
288 3300009553 Ga0105249_10416484 Ga0105249_104164842 158
289 3300009553 Ga0105249_10521675 Ga0105249_105216752 158
290 3300009553 Ga0105249_10531777 Ga0105249_105317772 158
291 3300009553 Ga0105249_11462716 Ga0105249_114627162 158
292 3300010375 Ga0105239_10094432 Ga0105239_100944323 158
293 3300010375 Ga0105239_10188851 Ga0105239_101888512 158
294 3300010375 Ga0105239_11018154 Ga0105239_110181542 158
295 3300010375 Ga0105239_11278588 Ga0105239_112785881 158
296 3300010375 Ga0105239_11521608 Ga0105239_115216081 158
297 3300011119 Ga0105246_10044167 Ga0105246_100441672 158
298 3300011119 Ga0105246_10418940 Ga0105246_104189402 158
299 3300011119 Ga0105246_10620219 Ga0105246_106202192 158
300 3300011119 Ga0105246_10669029 Ga0105246_106690292 158
301 3300013102 Ga0157371_10652389 Ga0157371_106523892 158
302 3300013296 Ga0157374_10042146 Ga0157374_100421465 158
303 3300013296 Ga0157374_10370458 Ga0157374_103704582 158
304 3300013296 Ga0157374_12274556 Ga0157374_122745561 158
305 3300013297 Ga0157378_10124203 Ga0157378_101242032 158
306 3300013297 Ga0157378_11059528 Ga0157378_110595282 158
307 3300013306 Ga0163162_10070625 Ga0163162_100706254 158
308 3300013306 Ga0163162_10746522 Ga0163162_107465222 158
309 3300013306 Ga0163162_10806919 Ga0163162_108069191 158
310 3300013306 Ga0163162_11718944 Ga0163162_117189442 158
311 3300013308 Ga0157375_10667029 Ga0157375_106670292 158
312 3300013308 Ga0157375_10668897 Ga0157375_106688972 158
313 3300014325 Ga0163163_10396842 Ga0163163_103968422 158
314 3300014325 Ga0163163_10520501 Ga0163163_105205012 158
315 3300014326 Ga0157380_10060148 Ga0157380_100601482 158
316 3300014326 Ga0157380_10186435 Ga0157380_101864352 158
317 3300014326 Ga0157380_10234153 Ga0157380_102341532 158
318 3300014326 Ga0157380_10949387 Ga0157380_109493872 158
319 3300014326 Ga0157380_11031643 Ga0157380_110316432 158
320 3300014968 Ga0157379_10157257 Ga0157379_101572572 158
321 3300014968 Ga0157379_10279604 Ga0157379_102796042 158
322 3300014968 Ga0157379_11242506 Ga0157379_112425062 158
323 3300014968 Ga0157379_11719451 Ga0157379_117194511 158
324 3300014969 Ga0157376_10533785 Ga0157376_105337852 158
325 3300020082 Ga0206353_11984242 Ga0206353_119842422 158
326 3300025315 Ga0207697_10058295 Ga0207697_100582952 158
327 3300025315 Ga0207697_10120431 Ga0207697_101204312 158
328 3300025315 Ga0207697_10279151 Ga0207697_102791511 158
329 3300025711 Ga0207696_1084892 Ga0207696_10848922 158
330 3300025899 Ga0207642_10020577 Ga0207642_100205772 158
331 3300025899 Ga0207642_10478528 Ga0207642_104785282 158
332 3300025900 Ga0207710_10071617 Ga0207710_100716172 158
333 3300025900 Ga0207710_10182256 Ga0207710_101822562 158
334 3300025900 Ga0207710_10399755 Ga0207710_103997552 158
335 3300025901 Ga0207688_10028174 Ga0207688_100281743 158
336 3300025901 Ga0207688_10333094 Ga0207688_103330942 158
337 3300025903 Ga0207680_10139088 Ga0207680_101390882 158
338 3300025903 Ga0207680_10342479 Ga0207680_103424792 158
339 3300025907 Ga0207645_10717171 Ga0207645_107171712 158
340 3300025908 Ga0207643_10463358 Ga0207643_104633582 158
341 3300025909 Ga0207705_10141395 Ga0207705_101413952 158
342 3300025909 Ga0207705_10154531 Ga0207705_101545312 158
343 3300025909 Ga0207705_10358941 Ga0207705_103589412 158
344 3300025911 Ga0207654_10055630 Ga0207654_100556302 158
345 3300025911 Ga0207654_10246746 Ga0207654_102467462 158
346 3300025911 Ga0207654_10774201 Ga0207654_107742012 158
347 3300025914 Ga0207671_10337122 Ga0207671_103371222 158
348 3300025914 Ga0207671_10924872 Ga0207671_109248722 158
349 3300025915 Ga0207693_10180540 Ga0207693_101805402 158
350 3300025915 Ga0207693_10489288 Ga0207693_104892882 158
351 3300025919 Ga0207657_10215974 Ga0207657_102159742 158
352 3300025920 Ga0207649_10076679 Ga0207649_100766792 158
353 3300025923 Ga0207681_10000248 Ga0207681_1000024823 158
354 3300025924 Ga0207694_10658396 Ga0207694_106583961 158
355 3300025925 Ga0207650_11137700 Ga0207650_111377002 158
356 3300025927 Ga0207687_10111760 Ga0207687_101117602 158
357 3300025927 Ga0207687_10147633 Ga0207687_101476332 158
358 3300025927 Ga0207687_10491869 Ga0207687_104918692 158
359 3300025928 Ga0207700_11344719 Ga0207700_113447192 158
360 3300025931 Ga0207644_10000004 Ga0207644_1000000434 158
361 3300025931 Ga0207644_10005101 Ga0207644_100051017 158
362 3300025932 Ga0207690_11276313 Ga0207690_112763132 158
363 3300025933 Ga0207706_10063847 Ga0207706_100638473 158
364 3300025933 Ga0207706_10232732 Ga0207706_102327322 158
365 3300025933 Ga0207706_11090466 Ga0207706_110904662 158
366 3300025934 Ga0207686_10411884 Ga0207686_104118842 158
367 3300025934 Ga0207686_10519596 Ga0207686_105195962 158
368 3300025935 Ga0207709_10108126 Ga0207709_101081262 158
369 3300025935 Ga0207709_10392342 Ga0207709_103923422 158
370 3300025936 Ga0207670_10061119 Ga0207670_100611193 158
371 3300025937 Ga0207669_10119491 Ga0207669_101194912 158
372 3300025937 Ga0207669_10226526 Ga0207669_102265262 158
373 3300025937 Ga0207669_11080566 Ga0207669_110805661 158
374 3300025938 Ga0207704_10079310 Ga0207704_100793102 158
375 3300025938 Ga0207704_10701116 Ga0207704_107011161 158
376 3300025938 Ga0207704_10973690 Ga0207704_109736901 158
377 3300025940 Ga0207691_10177730 Ga0207691_101777303 158
378 3300025940 Ga0207691_11337186 Ga0207691_113371861 158
379 3300025941 Ga0207711_10028582 Ga0207711_100285822 158
380 3300025941 Ga0207711_10484600 Ga0207711_104846002 158
381 3300025941 Ga0207711_10491080 Ga0207711_104910802 158
382 3300025941 Ga0207711_10541428 Ga0207711_105414282 158
383 3300025942 Ga0207689_10061700 Ga0207689_100617003 158
384 3300025942 Ga0207689_10710456 Ga0207689_107104562 158
385 3300025949 Ga0207667_10002818 Ga0207667_100028187 158
386 3300025949 Ga0207667_10018462 Ga0207667_100184627 158
387 3300025949 Ga0207667_10050257 Ga0207667_100502572 158
388 3300025961 Ga0207712_10113006 Ga0207712_101130062 158
389 3300025961 Ga0207712_10303325 Ga0207712_103033252 158
390 3300025961 Ga0207712_10351548 Ga0207712_103515482 158
391 3300025961 Ga0207712_10805158 Ga0207712_108051582 158
392 3300025961 Ga0207712_11246689 Ga0207712_112466892 158
393 3300025972 Ga0207668_10028354 Ga0207668_100283543 158
394 3300025972 Ga0207668_10042250 Ga0207668_100422502 158
395 3300025972 Ga0207668_10056374 Ga0207668_100563743 158
396 3300025972 Ga0207668_10191358 Ga0207668_101913582 158
397 3300025972 Ga0207668_10215697 Ga0207668_102156972 158
398 3300025972 Ga0207668_10390743 Ga0207668_103907432 158
399 3300025972 Ga0207668_10458159 Ga0207668_104581592 158
400 3300025972 Ga0207668_10923667 Ga0207668_109236672 158
401 3300025981 Ga0207640_10169884 Ga0207640_101698841 158
402 3300025986 Ga0207658_10027233 Ga0207658_100272335 158
403 3300025986 Ga0207658_12115809 Ga0207658_121158091 158
404 3300026023 Ga0207677_10116864 Ga0207677_101168643 158
405 3300026023 Ga0207677_10185918 Ga0207677_101859181 158
406 3300026023 Ga0207677_10267149 Ga0207677_102671492 158
407 3300026035 Ga0207703_10011714 Ga0207703_100117142 158
408 3300026035 Ga0207703_10020479 Ga0207703_100204792 158
409 3300026035 Ga0207703_10177458 Ga0207703_101774583 158
410 3300026035 Ga0207703_10256204 Ga0207703_102562042 158
411 3300026041 Ga0207639_10132349 Ga0207639_101323492 158
412 3300026041 Ga0207639_10220992 Ga0207639_102209922 158
413 3300026067 Ga0207678_10014567 Ga0207678_100145672 158
414 3300026067 Ga0207678_10055860 Ga0207678_100558603 158
415 3300026067 Ga0207678_10490963 Ga0207678_104909632 158
416 3300026067 Ga0207678_11556491 Ga0207678_115564911 158
417 3300026075 Ga0207708_10808472 Ga0207708_108084722 158
418 3300026075 Ga0207708_10851534 Ga0207708_108515342 158
419 3300026078 Ga0207702_10195760 Ga0207702_101957602 158
420 3300026078 Ga0207702_10460574 Ga0207702_104605742 158
421 3300026088 Ga0207641_10432417 Ga0207641_104324172 158
422 3300026088 Ga0207641_10862902 Ga0207641_108629021 158
423 3300026089 Ga0207648_10112313 Ga0207648_101123132 158
424 3300026089 Ga0207648_10335180 Ga0207648_103351802 158
425 3300026089 Ga0207648_10415874 Ga0207648_104158743 158
426 3300026095 Ga0207676_10046581 Ga0207676_100465812 158
427 3300026095 Ga0207676_10054381 Ga0207676_100543814 158
428 3300026095 Ga0207676_10152956 Ga0207676_101529562 158
429 3300026116 Ga0207674_11420874 Ga0207674_114208741 158
430 3300026118 Ga0207675_100141319 Ga0207675_1001413191 158
431 3300026118 Ga0207675_100448463 Ga0207675_1004484632 158
432 3300026118 Ga0207675_100455596 Ga0207675_1004555962 158
433 3300026118 Ga0207675_100676936 Ga0207675_1006769361 158
434 3300026121 Ga0207683_10166017 Ga0207683_101660172 158
435 3300026121 Ga0207683_10289502 Ga0207683_102895022 158
436 3300026121 Ga0207683_10446288 Ga0207683_104462881 158
437 3300026142 Ga0207698_10189323 Ga0207698_101893232 158
438 3300026142 Ga0207698_10667585 Ga0207698_106675852 158
439 3300028379 Ga0268266_10000446 Ga0268266_1000044629 158
440 3300028379 Ga0268266_10000670 Ga0268266_1000067016 158
441 3300028379 Ga0268266_10039605 Ga0268266_100396052 158
442 3300028379 Ga0268266_10440412 Ga0268266_104404122 158
443 3300028379 Ga0268266_10571470 Ga0268266_105714702 158
444 3300028379 Ga0268266_11520113 Ga0268266_115201132 158
445 3300028380 Ga0268265_10046888 Ga0268265_100468883 158
446 3300028380 Ga0268265_10078046 Ga0268265_100780462 158
447 3300028380 Ga0268265_10332438 Ga0268265_103324382 158
448 3300028380 Ga0268265_10409715 Ga0268265_104097152 158
449 3300028380 Ga0268265_10635320 Ga0268265_106353201 158
450 3300028381 Ga0268264_10086929 Ga0268264_100869291 158
451 3300028381 Ga0268264_12189523 Ga0268264_121895231 158
452 3300028786 Ga0307517_10085793 Ga0307517_100857932 158
453 3300028794 Ga0307515_10426051 Ga0307515_104260512 158
454 3300031548 Ga0307408_100536531 Ga0307408_1005365312 158
455 3300031548 Ga0307408_100694832 Ga0307408_1006948322 158
456 3300031616 Ga0307508_10009664 Ga0307508_100096647 158
457 3300031616 Ga0307508_10359193 Ga0307508_103591931 158
458 3300031730 Ga0307516_10089872 Ga0307516_100898723 158
459 3300031824 Ga0307413_10041245 Ga0307413_100412452 158
460 3300031903 Ga0307407_10350353 Ga0307407_103503532 158
461 3300031911 Ga0307412_10135144 Ga0307412_101351442 158
462 3300031995 Ga0307409_101208873 Ga0307409_1012088732 158
463 3300032002 Ga0307416_100793386 Ga0307416_1007933862 158
464 3300032005 Ga0307411_10076751 Ga0307411_100767513 158
465 3300032005 Ga0307411_10113101 Ga0307411_101131012 158
466 3300032126 Ga0307415_100075103 Ga0307415_1000751032 158
467 3300032126 Ga0307415_100560061 Ga0307415_1005600612 158
468 3300032126 Ga0307415_101548922 Ga0307415_1015489221 158
469 3300033180 Ga0307510_10019030 Ga0307510_100190303 158
470 3300033180 Ga0307510_10256328 Ga0307510_102563282 158
471 3300034816 Ga0373930_0007018 Ga0373930_0007018_723_1199 158
472 3300034957 Ga0373938_0067420 Ga0373938_0067420_236_712 158
473 3300035092 Ga0373952_0171208 Ga0373952_0171208_13_489 158
474 3300035112 Ga0373932_0019441 Ga0373932_0019441_190_666 158
475 3300035119 Ga0373956_0024429 Ga0373956_0024429_37_519 158
476 3300035121 Ga0373960_0096433 Ga0373960_0096433_156_632 158
477 3300035207 Ga0373942_0262401 Ga0373942_0262401_60_536 158
478 3300035242 Ga0373962_0057167 Ga0373962_0057167_329_805 158
479 3300035691 Ga0373931_0025121 Ga0373931_0025121_2112_2588 158
480 3300035691 Ga0373931_0892161 Ga0373931_0892161_88_564 158
481 3300035692 Ga0373935_0111842 Ga0373935_0111842_438_914 158
482 3300035725 Ga0373947_0207262 Ga0373947_0207262_532_1008 158
483 3300035725 Ga0373947_0568811 Ga0373947_0568811_117_593 158
484 3300041413 Ga0439465_0060773 Ga0439465_0060773_386_862 158
485 3300041443 Ga0451789_1131362 Ga0451789_1131362_74_550 158
486 3300041452 Ga0451793_1643059 Ga0451793_1643059_131_613 158
487 3300041459 Ga0451800_1272588 Ga0451800_1272588_31_507 158
488 3300041463 Ga0451804_0577402 Ga0451804_0577402_52_549 158
489 3300041509 Ga0451843_1327502 Ga0451843_1327502_117_593 158
490 3300041997 Ga0439431_0235909 Ga0439431_0235909_52_528 158
491 3300042005 Ga0439448_0140871 Ga0439448_0140871_173_649 158
492 3300042016 Ga0439463_156452 Ga0439463_156452_43_519 158
493 3300044712 Ga0453684_0057660 Ga0453684_0057660_4091_4573 158
494 3300046452 Ga0495617_037019 Ga0495617_037019_38_514 158
495 3300046455 Ga0495603_0036252 Ga0495603_0036252_1913_2389 158
496 3300046457 Ga0495590_0080715 Ga0495590_0080715_638_1114 158
497 3300046459 Ga0495629_0152799 Ga0495629_0152799_165_641 158
498 3300046460 Ga0495638_0015230 Ga0495638_0015230_3970_4446 158
499 3300046461 Ga0495641_0062919 Ga0495641_0062919_811_1287 158
500 3300046471 Ga0495650_0132169 Ga0495650_0132169_391_867 158
501 3300046472 Ga0495580_0794910 Ga0495580_0794910_117_593 158
502 3300046473 Ga0495582_0423108 Ga0495582_0423108_234_710 158
503 3300046474 Ga0495605_0185320 Ga0495605_0185320_364_840 158
504 3300046475 Ga0495639_0182924 Ga0495639_0182924_139_615 158
505 3300046491 Ga0495584_0100895 Ga0495584_0100895_397_873 158
506 3300046491 Ga0495584_0467286 Ga0495584_0467286_154_630 158
507 3300046491 Ga0495584_0590203 Ga0495584_0590203_55_531 158
508 3300046492 Ga0495585_0064003 Ga0495585_0064003_1008_1499 158
509 3300046492 Ga0495585_0066562 Ga0495585_0066562_160_636 158
510 3300046500 Ga0495596_0066003 Ga0495596_0066003_18_494 158
511 3300046500 Ga0495596_0228539 Ga0495596_0228539_91_567 158
512 3300046501 Ga0495607_0182075 Ga0495607_0182075_565_1041 158
513 3300046506 Ga0495583_0177577 Ga0495583_0177577_226_702 158
514 3300046507 Ga0495606_0133935 Ga0495606_0133935_124_600 158
515 3300046507 Ga0495606_0221452 Ga0495606_0221452_394_870 158
516 3300046515 Ga0495620_0113333 Ga0495620_0113333_161_637 158
517 3300046517 Ga0495630_0851161 Ga0495630_0851161_101_577 158
518 3300046518 Ga0495631_0056972 Ga0495631_0056972_728_1204 158
519 3300046518 Ga0495631_0385414 Ga0495631_0385414_76_552 158
520 3300046520 Ga0495637_0217915 Ga0495637_0217915_164_640 158
521 3300046522 Ga0495643_0229534 Ga0495643_0229534_256_732 158
522 3300046523 Ga0495644_0027751 Ga0495644_0027751_1520_2011 158
523 3300046524 Ga0495648_0315100 Ga0495648_0315100_134_610 158
524 3300046528 Ga0495642_0076392 Ga0495642_0076392_404_895 158
525 3300046529 Ga0495652_1109266 Ga0495652_1109266_12_488 158
526 3300046537 Ga0495598_0060743 Ga0495598_0060743_201_677 158
527 3300046538 Ga0495609_0100951 Ga0495609_0100951_207_683 158
528 3300046538 Ga0495609_0222961 Ga0495609_0222961_140_631 158
529 3300046542 Ga0495597_0174386 Ga0495597_0174386_237_713 158
530 3300046557 Ga0495622_0040003 Ga0495622_0040003_791_1267 158
531 3300046615 Ga0495656_0019569 Ga0495656_0019569_1797_2273 158
532 3300046615 Ga0495656_0037417 Ga0495656_0037417_1300_1791 158
533 3300046616 Ga0495668_0302103 Ga0495668_0302103_391_867 158
534 3300046648 Ga0495611_0027449 Ga0495611_0027449_1806_2282 158
535 3300046648 Ga0495611_0061366 Ga0495611_0061366_613_1089 158
536 3300046648 Ga0495611_0178178 Ga0495611_0178178_112_588 158
537 3300046660 Ga0495625_0353919 Ga0495625_0353919_106_582 158
538 3300046660 Ga0495625_0415652 Ga0495625_0415652_56_532 158
539 3300046663 Ga0495635_0240697 Ga0495635_0240697_552_1028 158
540 3300046664 Ga0495659_0012710 Ga0495659_0012710_1807_2298 158
541 3300046664 Ga0495659_0239144 Ga0495659_0239144_42_518 158
542 3300046665 Ga0495661_0314960 Ga0495661_0314960_91_567 158
543 3300046683 Ga0495658_0256238 Ga0495658_0256238_254_730 158
544 3300046684 Ga0495669_0022881 Ga0495669_0022881_661_1137 158
545 3300046684 Ga0495669_0037766 Ga0495669_0037766_1133_1609 158
546 3300046684 Ga0495669_0256870 Ga0495669_0256870_13_489 158
547 3300046692 Ga0495671_0432509 Ga0495671_0432509_47_523 158
548 3300046794 Ga0495589_0120484 Ga0495589_0120484_353_829 158
549 3300047315 Ga0495581_0027928 Ga0495581_0027928_2669_3145 158
550 3300047317 Ga0495604_0193262 Ga0495604_0193262_548_1024 158
551 3300047319 Ga0495674_0235436 Ga0495674_0235436_741_1217 158
552 3300047320 Ga0495672_0034475 Ga0495672_0034475_2081_2557 158
553 3300047322 Ga0495680_0482529 Ga0495680_0482529_232_708 158
554 3300047323 Ga0495683_0305327 Ga0495683_0305327_128_604 158
555 3300047446 Ga0495679_042227 Ga0495679_042227_148_624 158
556 3300047447 Ga0495685_138946 Ga0495685_138946_226_717 158
557 3300047472 Ga0495686_0357552 Ga0495686_0357552_218_694 158
558 3300047472 Ga0495686_0485115 Ga0495686_0485115_107_583 158
559 3300048903 Ga0496100_0136693 Ga0496100_0136693_503_979 158
560 3300048903 Ga0496100_0150574 Ga0496100_0150574_1107_1583 158
561 3300048904 Ga0496101_0005995 Ga0496101_0005995_6310_6798 158
562 3300048904 Ga0496101_0082969 Ga0496101_0082969_1284_1760 158
563 3300048904 Ga0496101_0434221 Ga0496101_0434221_109_585 158
564 3300048904 Ga0496101_0565000 Ga0496101_0565000_349_825 158
565 3300048905 Ga0496102_0068054 Ga0496102_0068054_1067_1543 158
566 3300048905 Ga0496102_0084900 Ga0496102_0084900_275_751 158
567 3300048905 Ga0496102_0138305 Ga0496102_0138305_459_947 158
568 3300048905 Ga0496102_0152079 Ga0496102_0152079_531_1007 158
569 3300048905 Ga0496102_0727129 Ga0496102_0727129_373_849 158
570 3300048905 Ga0496102_0967551 Ga0496102_0967551_139_615 158
571 3300048906 Ga0496103_0015686 Ga0496103_0015686_4014_4490 158
572 3300048906 Ga0496103_0129438 Ga0496103_0129438_224_712 158
573 3300048906 Ga0496103_0553048 Ga0496103_0553048_125_601 158
574 3300048907 Ga0496104_0309445 Ga0496104_0309445_264_752 158
575 3300048907 Ga0496104_0356795 Ga0496104_0356795_84_560 158
576 3300048907 Ga0496104_0385952 Ga0496104_0385952_122_598 158
577 3300048907 Ga0496104_1559642 Ga0496104_1559642_57_533 158
578 3300048908 Ga0496105_0080378 Ga0496105_0080378_1434_1910 158
579 3300048908 Ga0496105_0138424 Ga0496105_0138424_933_1421 158
580 3300048908 Ga0496105_0985179 Ga0496105_0985179_59_535 158
581 3300048909 Ga0496106_0064146 Ga0496106_0064146_118_594 158
582 3300048909 Ga0496106_0137608 Ga0496106_0137608_1295_1771 158
583 3300048909 Ga0496106_0358600 Ga0496106_0358600_531_1007 158
584 3300048909 Ga0496106_0602940 Ga0496106_0602940_217_693 158
585 3300048909 Ga0496106_1119527 Ga0496106_1119527_113_589 158
586 3300048910 Ga0496107_0015115 Ga0496107_0015115_222_710 158
587 3300048910 Ga0496107_0141467 Ga0496107_0141467_1167_1643 158
588 3300048910 Ga0496107_0484829 Ga0496107_0484829_25_501 158
589 3300048911 Ga0496108_0146822 Ga0496108_0146822_248_736 158
590 3300048911 Ga0496108_0154186 Ga0496108_0154186_369_845 158
591 3300048911 Ga0496108_0469433 Ga0496108_0469433_140_616 158
592 3300048911 Ga0496108_0557672 Ga0496108_0557672_258_746 158
593 3300048912 Ga0496109_0028952 Ga0496109_0028952_1652_2128 158
594 3300048912 Ga0496109_0146281 Ga0496109_0146281_954_1430 158
595 3300048912 Ga0496109_0799271 Ga0496109_0799271_292_768 158
596 3300048913 Ga0496110_0027369 Ga0496110_0027369_1562_2050 158
597 3300048913 Ga0496110_0046887 Ga0496110_0046887_1164_1640 158
598 3300048913 Ga0496110_0615742 Ga0496110_0615742_164_640 158
599 3300048914 Ga0496111_0041641 Ga0496111_0041641_745_1221 158
600 3300048914 Ga0496111_0104351 Ga0496111_0104351_1153_1641 158
601 3300048915 Ga0496112_0033990 Ga0496112_0033990_615_1091 158
602 3300048915 Ga0496112_0055956 Ga0496112_0055956_2321_2797 158
603 3300048915 Ga0496112_0290937 Ga0496112_0290937_231_719 158
604 3300048916 Ga0496113_0000807 Ga0496113_0000807_2703_3191 158
605 3300048916 Ga0496113_0018950 Ga0496113_0018950_4251_4727 158
606 3300048916 Ga0496113_0469984 Ga0496113_0469984_183_659 158
607 3300048916 Ga0496113_0683672 Ga0496113_0683672_226_714 158
608 3300048916 Ga0496113_0773826 Ga0496113_0773826_60_536 158
609 3300048916 Ga0496113_0909668 Ga0496113_0909668_90_566 158
610 3300048917 Ga0496114_0050365 Ga0496114_0050365_2248_2736 158
611 3300048917 Ga0496114_0124263 Ga0496114_0124263_598_1074 158
612 3300048917 Ga0496114_1158739 Ga0496114_1158739_26_502 158
613 3300048918 Ga0496115_0009296 Ga0496115_0009296_1272_1748 158
614 3300048918 Ga0496115_0191841 Ga0496115_0191841_968_1456 158
615 3300048918 Ga0496115_0262435 Ga0496115_0262435_595_1071 158
616 3300048918 Ga0496115_0464273 Ga0496115_0464273_153_629 158
617 3300048920 Ga0496117_0102516 Ga0496117_0102516_1084_1560 158
618 3300048924 Ga0496121_0091621 Ga0496121_0091621_1072_1548 158
619 3300048924 Ga0496121_0125113 Ga0496121_0125113_1258_1734 158
620 3300048924 Ga0496121_0389533 Ga0496121_0389533_246_722 158
621 3300048924 Ga0496121_0424582 Ga0496121_0424582_205_693 158
622 3300048924 Ga0496121_0652824 Ga0496121_0652824_141_617 158
623 3300048928 Ga0496125_0315756 Ga0496125_0315756_386_874 158
624 3300048929 Ga0496126_0000483 Ga0496126_0000483_43277_43765 158
625 3300048929 Ga0496126_0009701 Ga0496126_0009701_6484_6960 158
626 3300049583 Ga0501067_0643987 Ga0501067_0643987_101_577 158
627 3300049585 Ga0501069_0199298 Ga0501069_0199298_59_535 158
628 3300050489 nmdc:mga03683_85452_c1 nmdc:mga03683_85452_c1_132_608 158
629 3300050490 nmdc:mga03n38_216364_c1 nmdc:mga03n38_216364_c1_357_833 158
630 3300050490 nmdc:mga03n38_46_c2 nmdc:mga03n38_46_c2_12164_12640 158
631 3300050490 nmdc:mga03n38_982484_c1 nmdc:mga03n38_982484_c1_14_490 158
632 3300050492 nmdc:mga0yw44_17722_c1 nmdc:mga0yw44_17722_c1_238_714 158
633 3300050492 nmdc:mga0yw44_319403_c1 nmdc:mga0yw44_319403_c1_78_554 158
634 3300050492 nmdc:mga0yw44_367800_c1 nmdc:mga0yw44_367800_c1_262_738 158
635 3300050492 nmdc:mga0yw44_521170_c1 nmdc:mga0yw44_521170_c1_51_527 158
636 3300050493 nmdc:mga0k408_390542_c1 nmdc:mga0k408_390542_c1_156_632 158
637 3300050493 nmdc:mga0k408_408114_c1 nmdc:mga0k408_408114_c1_206_682 158
638 3300050493 nmdc:mga0k408_685693_c1 nmdc:mga0k408_685693_c1_24_500 158
639 3300050494 nmdc:mga06z11_264442_c1 nmdc:mga06z11_264442_c1_156_632 158
640 3300050494 nmdc:mga06z11_39880_c1 nmdc:mga06z11_39880_c1_557_1033 158
641 3300050495 nmdc:mga04h51_217474_c1 nmdc:mga04h51_217474_c1_121_597 158
642 3300050496 nmdc:mga07m45_319458_c1 nmdc:mga07m45_319458_c1_243_719 158
643 3300050496 nmdc:mga07m45_49471_c1 nmdc:mga07m45_49471_c1_55_531 158
644 3300050496 nmdc:mga07m45_7364_c1 nmdc:mga07m45_7364_c1_1570_2046 158
645 3300050507 nmdc:mga05p37_950515_c1 nmdc:mga05p37_950515_c1_184_660 158
646 3300050511 nmdc:mga08y16_490127_c1 nmdc:mga08y16_490127_c1_245_721 158
647 3300050515 nmdc:mga0a205_657650_c1 nmdc:mga0a205_657650_c1_384_860 158
648 3300053086 Ga0500578_0465841 Ga0500578_0465841_161_637 158
649 3300053087 Ga0500643_057151 Ga0500643_057151_549_1025 158
650 3300053090 Ga0500646_0244868 Ga0500646_0244868_90_566 158
651 3300053092 Ga0500583_0045097 Ga0500583_0045097_769_1245 158
652 3300053094 Ga0500566_0205436 Ga0500566_0205436_23_499 158
653 3300053096 Ga0500641_0047587 Ga0500641_0047587_1115_1591 158
654 3300053096 Ga0500641_0061416 Ga0500641_0061416_1047_1523 158
655 3300053108 Ga0500562_141756 Ga0500562_141756_106_582 158
656 3300053118 Ga0500594_0094413 Ga0500594_0094413_214_690 158
657 3300053119 Ga0500595_018947 Ga0500595_018947_997_1473 158
658 3300053119 Ga0500595_152212 Ga0500595_152212_21_497 158
659 3300053133 Ga0500655_007445 Ga0500655_007445_880_1356 158
660 3300053139 Ga0500568_0081886 Ga0500568_0081886_166_642 158
661 3300053147 Ga0500589_066930 Ga0500589_066930_1093_1569 158
662 3300053147 Ga0500589_096267 Ga0500589_096267_56_532 158
663 3300053158 Ga0500627_0116618 Ga0500627_0116618_587_1063 158
664 3300053160 Ga0500633_0133672 Ga0500633_0133672_77_553 158
665 3300053161 Ga0500634_0112173 Ga0500634_0112173_400_876 158
666 3300053731 Ga0500609_013392 Ga0500609_013392_428_904 158
667 3300053739 Ga0500587_024005 Ga0500587_024005_127_603 158
668 3300061734 Ga0530510_0776700 Ga0530510_0776700_54_530 158
669 3300003203 JGI25406J46586_10000009 JGI25406J46586_1000000947 159
670 3300003659 JGI25404J52841_10020452 JGI25404J52841_100204522 159
671 3300003659 JGI25404J52841_10091040 JGI25404J52841_100910401 159
672 3300005327 Ga0070658_10007845 Ga0070658_100078455 159
673 3300005327 Ga0070658_10068198 Ga0070658_100681981 159
674 3300005329 Ga0070683_100021476 Ga0070683_1000214762 159
675 3300005329 Ga0070683_100119491 Ga0070683_1001194913 159
676 3300005329 Ga0070683_100282679 Ga0070683_1002826792 159
677 3300005336 Ga0070680_100001803 Ga0070680_1000018033 159
678 3300005336 Ga0070680_100011799 Ga0070680_1000117993 159
679 3300005336 Ga0070680_100433827 Ga0070680_1004338272 159
680 3300005336 Ga0070680_100493238 Ga0070680_1004932382 159
681 3300005337 Ga0070682_100104401 Ga0070682_1001044012 159
682 3300005338 Ga0068868_100041686 Ga0068868_1000416863 159
683 3300005339 Ga0070660_100011735 Ga0070660_1000117354 159
684 3300005341 Ga0070691_10001192 Ga0070691_100011922 159
685 3300005341 Ga0070691_10089264 Ga0070691_100892642 159
686 3300005355 Ga0070671_101090832 Ga0070671_1010908321 159
687 3300005356 Ga0070674_100114276 Ga0070674_1001142763 159
688 3300005364 Ga0070673_100635591 Ga0070673_1006355912 159
689 3300005434 Ga0070709_10003808 Ga0070709_100038081 159
690 3300005434 Ga0070709_10007552 Ga0070709_100075525 159
691 3300005434 Ga0070709_10057714 Ga0070709_100577142 159
692 3300005434 Ga0070709_11067153 Ga0070709_110671531 159
693 3300005435 Ga0070714_100028634 Ga0070714_1000286342 159
694 3300005435 Ga0070714_100093490 Ga0070714_1000934903 159
695 3300005435 Ga0070714_100160852 Ga0070714_1001608522 159
696 3300005435 Ga0070714_100249116 Ga0070714_1002491162 159
697 3300005435 Ga0070714_100882843 Ga0070714_1008828431 159
698 3300005436 Ga0070713_100002435 Ga0070713_1000024352 159
699 3300005436 Ga0070713_100073158 Ga0070713_1000731582 159
700 3300005436 Ga0070713_100131735 Ga0070713_1001317352 159
701 3300005436 Ga0070713_100258840 Ga0070713_1002588402 159
702 3300005436 Ga0070713_100286853 Ga0070713_1002868532 159
703 3300005437 Ga0070710_10002245 Ga0070710_1000224511 159
704 3300005437 Ga0070710_10006209 Ga0070710_100062092 159
705 3300005437 Ga0070710_10260683 Ga0070710_102606832 159
706 3300005437 Ga0070710_10456928 Ga0070710_104569282 159
707 3300005439 Ga0070711_100002514 Ga0070711_10000251411 159
708 3300005439 Ga0070711_100024311 Ga0070711_1000243112 159
709 3300005439 Ga0070711_100039210 Ga0070711_1000392104 159
710 3300005439 Ga0070711_100342004 Ga0070711_1003420042 159
711 3300005445 Ga0070708_100735694 Ga0070708_1007356942 159
712 3300005455 Ga0070663_100164013 Ga0070663_1001640132 159
713 3300005456 Ga0070678_100029826 Ga0070678_1000298264 159
714 3300005456 Ga0070678_100062529 Ga0070678_1000625293 159
715 3300005458 Ga0070681_10009096 Ga0070681_100090968 159
716 3300005458 Ga0070681_10147974 Ga0070681_101479742 159
717 3300005458 Ga0070681_10155196 Ga0070681_101551962 159
718 3300005458 Ga0070681_10225037 Ga0070681_102250372 159
719 3300005458 Ga0070681_10715255 Ga0070681_107152552 159
720 3300005468 Ga0070707_100131402 Ga0070707_1001314023 159
721 3300005471 Ga0070698_100293524 Ga0070698_1002935242 159
722 3300005518 Ga0070699_101436602 Ga0070699_1014366021 159
723 3300005530 Ga0070679_100005316 Ga0070679_10000531611 159
724 3300005535 Ga0070684_100018865 Ga0070684_1000188652 159
725 3300005535 Ga0070684_100040283 Ga0070684_1000402833 159
726 3300005535 Ga0070684_100191844 Ga0070684_1001918441 159
727 3300005539 Ga0068853_100021395 Ga0068853_1000213953 159
728 3300005539 Ga0068853_100141746 Ga0068853_1001417462 159
729 3300005539 Ga0068853_100248758 Ga0068853_1002487583 159
730 3300005543 Ga0070672_100257256 Ga0070672_1002572562 159
731 3300005543 Ga0070672_101140541 Ga0070672_1011405411 159
732 3300005548 Ga0070665_100044811 Ga0070665_1000448111 159
733 3300005548 Ga0070665_100549915 Ga0070665_1005499152 159
734 3300005548 Ga0070665_100784671 Ga0070665_1007846712 159
735 3300005548 Ga0070665_101924692 Ga0070665_1019246921 159
736 3300005563 Ga0068855_100032725 Ga0068855_1000327252 159
737 3300005563 Ga0068855_100056856 Ga0068855_1000568564 159
738 3300005563 Ga0068855_100065587 Ga0068855_1000655875 159
739 3300005563 Ga0068855_100170343 Ga0068855_1001703432 159
740 3300005563 Ga0068855_100186786 Ga0068855_1001867862 159
741 3300005563 Ga0068855_100691188 Ga0068855_1006911882 159
742 3300005564 Ga0070664_100245982 Ga0070664_1002459822 159
743 3300005564 Ga0070664_100797496 Ga0070664_1007974962 159
744 3300005564 Ga0070664_101482409 Ga0070664_1014824091 159
745 3300005577 Ga0068857_100013137 Ga0068857_1000131373 159
746 3300005577 Ga0068857_100051455 Ga0068857_1000514552 159
747 3300005614 Ga0068856_100006491 Ga0068856_10000649111 159
748 3300005614 Ga0068856_100147819 Ga0068856_1001478192 159
749 3300005614 Ga0068856_100245946 Ga0068856_1002459462 159
750 3300005614 Ga0068856_100266581 Ga0068856_1002665812 159
751 3300005614 Ga0068856_100702331 Ga0068856_1007023312 159
752 3300005614 Ga0068856_101172716 Ga0068856_1011727162 159
753 3300005616 Ga0068852_100575395 Ga0068852_1005753952 159
754 3300005617 Ga0068859_100214710 Ga0068859_1002147103 159
755 3300005718 Ga0068866_10164293 Ga0068866_101642932 159
756 3300005719 Ga0068861_101164855 Ga0068861_1011648552 159
757 3300005834 Ga0068851_10034114 Ga0068851_100341143 159
758 3300005840 Ga0068870_10300733 Ga0068870_103007332 159
759 3300005842 Ga0068858_101009146 Ga0068858_1010091462 159
760 3300005843 Ga0068860_100320673 Ga0068860_1003206732 159
761 3300005937 Ga0081455_10000633 Ga0081455_1000063336 159
762 3300005937 Ga0081455_10007244 Ga0081455_100072447 159
763 3300005937 Ga0081455_10144769 Ga0081455_101447692 159
764 3300005983 Ga0081540_1004295 Ga0081540_10042957 159
765 3300005983 Ga0081540_1015480 Ga0081540_10154805 159
766 3300005983 Ga0081540_1020000 Ga0081540_10200002 159
767 3300005983 Ga0081540_1114366 Ga0081540_11143662 159
768 3300005983 Ga0081540_1147325 Ga0081540_11473252 159
769 3300005985 Ga0081539_10000048 Ga0081539_10000048100 159
770 3300005985 Ga0081539_10000203 Ga0081539_10000203135 159
771 3300006028 Ga0070717_10001217 Ga0070717_1000121711 159
772 3300006028 Ga0070717_10033689 Ga0070717_100336892 159
773 3300006028 Ga0070717_10711403 Ga0070717_107114032 159
774 3300006028 Ga0070717_10793140 Ga0070717_107931402 159
775 3300006028 Ga0070717_10901607 Ga0070717_109016072 159
776 3300006038 Ga0075365_10057450 Ga0075365_100574502 159
777 3300006048 Ga0075363_100094048 Ga0075363_1000940482 159
778 3300006051 Ga0075364_10669074 Ga0075364_106690742 159
779 3300006163 Ga0070715_10241348 Ga0070715_102413482 159
780 3300006163 Ga0070715_10398088 Ga0070715_103980881 159
781 3300006173 Ga0070716_100017080 Ga0070716_1000170802 159
782 3300006173 Ga0070716_100044733 Ga0070716_1000447334 159
783 3300006173 Ga0070716_100351381 Ga0070716_1003513812 159
784 3300006173 Ga0070716_100445426 Ga0070716_1004454262 159
785 3300006175 Ga0070712_100010424 Ga0070712_1000104242 159
786 3300006175 Ga0070712_100027750 Ga0070712_1000277501 159
787 3300006175 Ga0070712_100117209 Ga0070712_1001172092 159
788 3300006175 Ga0070712_100473801 Ga0070712_1004738012 159
789 3300006175 Ga0070712_100566390 Ga0070712_1005663902 159
790 3300006178 Ga0075367_10152067 Ga0075367_101520672 159
791 3300006178 Ga0075367_10231237 Ga0075367_102312371 159
792 3300006178 Ga0075367_10418586 Ga0075367_104185862 159
793 3300006358 Ga0068871_100315755 Ga0068871_1003157552 159
794 3300006358 Ga0068871_100540174 Ga0068871_1005401742 159
795 3300006871 Ga0075434_100028126 Ga0075434_1000281264 159
796 3300006931 Ga0097620_100214708 Ga0097620_1002147083 159
797 3300006941 Ga0099825_1036353 Ga0099825_10363532 159
798 3300006942 Ga0099824_1012432 Ga0099824_10124327 159
799 3300006943 Ga0099822_1000676 Ga0099822_10006768 159
800 3300007076 Ga0075435_100033061 Ga0075435_1000330612 159
801 3300007076 Ga0075435_100570463 Ga0075435_1005704632 159
802 3300007788 Ga0099795_10018379 Ga0099795_100183792 159
803 3300007788 Ga0099795_10150933 Ga0099795_101509332 159
804 3300009093 Ga0105240_10010432 Ga0105240_100104328 159
805 3300009093 Ga0105240_10022388 Ga0105240_100223887 159
806 3300009093 Ga0105240_10052813 Ga0105240_100528135 159
807 3300009093 Ga0105240_10488562 Ga0105240_104885622 159
808 3300009093 Ga0105240_10961608 Ga0105240_109616082 159
809 3300009093 Ga0105240_11643168 Ga0105240_116431682 159
810 3300009098 Ga0105245_11955993 Ga0105245_119559932 159
811 3300009174 Ga0105241_10822697 Ga0105241_108226972 159
812 3300009176 Ga0105242_11506969 Ga0105242_115069691 159
813 3300009177 Ga0105248_11436330 Ga0105248_114363302 159
814 3300009545 Ga0105237_10127776 Ga0105237_101277762 159
815 3300009545 Ga0105237_10227928 Ga0105237_102279283 159
816 3300009551 Ga0105238_10054676 Ga0105238_100546762 159
817 3300009551 Ga0105238_10220793 Ga0105238_102207932 159
818 3300009551 Ga0105238_10657626 Ga0105238_106576262 159
819 3300010159 Ga0099796_10058628 Ga0099796_100586282 159
820 3300010159 Ga0099796_10309674 Ga0099796_103096741 159
821 3300010375 Ga0105239_10057882 Ga0105239_100578823 159
822 3300010375 Ga0105239_10158415 Ga0105239_101584153 159
823 3300010375 Ga0105239_10547140 Ga0105239_105471402 159
824 3300010375 Ga0105239_11595024 Ga0105239_115950242 159
825 3300010375 Ga0105239_13011793 Ga0105239_130117931 159
826 3300011119 Ga0105246_10031311 Ga0105246_100313114 159
827 3300013100 Ga0157373_10258670 Ga0157373_102586701 159
828 3300013104 Ga0157370_10136478 Ga0157370_101364782 159
829 3300013104 Ga0157370_10237235 Ga0157370_102372351 159
830 3300013104 Ga0157370_10314118 Ga0157370_103141182 159
831 3300013104 Ga0157370_10946928 Ga0157370_109469281 159
832 3300013105 Ga0157369_10121716 Ga0157369_101217162 159
833 3300013105 Ga0157369_10246166 Ga0157369_102461662 159
834 3300013105 Ga0157369_10335635 Ga0157369_103356352 159
835 3300013296 Ga0157374_10071292 Ga0157374_100712921 159
836 3300013296 Ga0157374_10085422 Ga0157374_100854222 159
837 3300013296 Ga0157374_11006947 Ga0157374_110069472 159
838 3300013297 Ga0157378_10059778 Ga0157378_100597783 159
839 3300013297 Ga0157378_10557641 Ga0157378_105576412 159
840 3300013306 Ga0163162_10162094 Ga0163162_101620942 159
841 3300013306 Ga0163162_10798576 Ga0163162_107985762 159
842 3300013308 Ga0157375_10165114 Ga0157375_101651142 159
843 3300014325 Ga0163163_10048338 Ga0163163_100483382 159
844 3300014969 Ga0157376_10037168 Ga0157376_100371684 159
845 3300014969 Ga0157376_11981849 Ga0157376_119818491 159
846 3300017792 Ga0163161_10480318 Ga0163161_104803182 159
847 3300020069 Ga0197907_10033556 Ga0197907_100335562 159
848 3300020078 Ga0206352_10877984 Ga0206352_108779842 159
849 3300020082 Ga0206353_10274628 Ga0206353_102746282 159
850 3300021377 Ga0213874_10064230 Ga0213874_100642302 159
851 3300021384 Ga0213876_10085041 Ga0213876_100850412 159
852 3300021388 Ga0213875_10022449 Ga0213875_100224492 159
853 3300025321 Ga0207656_10037335 Ga0207656_100373352 159
854 3300025898 Ga0207692_10051478 Ga0207692_100514782 159
855 3300025898 Ga0207692_10052673 Ga0207692_100526733 159
856 3300025898 Ga0207692_10381735 Ga0207692_103817352 159
857 3300025898 Ga0207692_10542414 Ga0207692_105424142 159
858 3300025905 Ga0207685_10045309 Ga0207685_100453092 159
859 3300025905 Ga0207685_10068327 Ga0207685_100683272 159
860 3300025906 Ga0207699_10007093 Ga0207699_100070935 159
861 3300025906 Ga0207699_10014450 Ga0207699_100144502 159
862 3300025906 Ga0207699_10066405 Ga0207699_100664053 159
863 3300025909 Ga0207705_10034900 Ga0207705_100349003 159
864 3300025909 Ga0207705_10063236 Ga0207705_100632362 159
865 3300025910 Ga0207684_10558205 Ga0207684_105582052 159
866 3300025910 Ga0207684_10926391 Ga0207684_109263912 159
867 3300025912 Ga0207707_10008752 Ga0207707_100087526 159
868 3300025912 Ga0207707_10013145 Ga0207707_100131456 159
869 3300025912 Ga0207707_10219273 Ga0207707_102192732 159
870 3300025912 Ga0207707_10367627 Ga0207707_103676272 159
871 3300025912 Ga0207707_10551254 Ga0207707_105512541 159
872 3300025913 Ga0207695_10078385 Ga0207695_100783853 159
873 3300025913 Ga0207695_10241413 Ga0207695_102414132 159
874 3300025913 Ga0207695_10273131 Ga0207695_102731312 159
875 3300025913 Ga0207695_10446680 Ga0207695_104466802 159
876 3300025914 Ga0207671_10117481 Ga0207671_101174812 159
877 3300025914 Ga0207671_10357077 Ga0207671_103570772 159
878 3300025914 Ga0207671_10590255 Ga0207671_105902552 159
879 3300025915 Ga0207693_10007651 Ga0207693_100076512 159
880 3300025915 Ga0207693_10011694 Ga0207693_100116948 159
881 3300025915 Ga0207693_10027350 Ga0207693_100273502 159
882 3300025915 Ga0207693_10126980 Ga0207693_101269803 159
883 3300025915 Ga0207693_10272266 Ga0207693_102722661 159
884 3300025916 Ga0207663_10007481 Ga0207663_100074812 159
885 3300025916 Ga0207663_10032758 Ga0207663_100327582 159
886 3300025916 Ga0207663_10032999 Ga0207663_100329993 159
887 3300025916 Ga0207663_10918655 Ga0207663_109186552 159
888 3300025917 Ga0207660_10032733 Ga0207660_100327333 159
889 3300025917 Ga0207660_10074168 Ga0207660_100741682 159
890 3300025919 Ga0207657_10002580 Ga0207657_1000258016 159
891 3300025920 Ga0207649_10114372 Ga0207649_101143722 159
892 3300025921 Ga0207652_10007221 Ga0207652_100072213 159
893 3300025921 Ga0207652_10014787 Ga0207652_100147875 159
894 3300025921 Ga0207652_10230571 Ga0207652_102305712 159
895 3300025921 Ga0207652_10343884 Ga0207652_103438842 159
896 3300025922 Ga0207646_10239429 Ga0207646_102394292 159
897 3300025924 Ga0207694_10033330 Ga0207694_100333302 159
898 3300025924 Ga0207694_10078105 Ga0207694_100781052 159
899 3300025924 Ga0207694_10146877 Ga0207694_101468772 159
900 3300025924 Ga0207694_10538059 Ga0207694_105380592 159
901 3300025924 Ga0207694_10654411 Ga0207694_106544112 159
902 3300025924 Ga0207694_10721508 Ga0207694_107215082 159
903 3300025926 Ga0207659_10057464 Ga0207659_100574643 159
904 3300025927 Ga0207687_10496593 Ga0207687_104965932 159
905 3300025928 Ga0207700_10003283 Ga0207700_100032835 159
906 3300025928 Ga0207700_10041218 Ga0207700_100412183 159
907 3300025928 Ga0207700_10068583 Ga0207700_100685832 159
908 3300025928 Ga0207700_10096383 Ga0207700_100963832 159
909 3300025928 Ga0207700_10219871 Ga0207700_102198712 159
910 3300025928 Ga0207700_10237564 Ga0207700_102375642 159
911 3300025929 Ga0207664_10022106 Ga0207664_100221062 159
912 3300025929 Ga0207664_10055824 Ga0207664_100558243 159
913 3300025929 Ga0207664_10066442 Ga0207664_100664422 159
914 3300025929 Ga0207664_10230436 Ga0207664_102304362 159
915 3300025929 Ga0207664_10295012 Ga0207664_102950122 159
916 3300025935 Ga0207709_10186625 Ga0207709_101866252 159
917 3300025939 Ga0207665_10007232 Ga0207665_100072322 159
918 3300025939 Ga0207665_10029943 Ga0207665_100299433 159
919 3300025939 Ga0207665_10258544 Ga0207665_102585442 159
920 3300025939 Ga0207665_10445960 Ga0207665_104459602 159
921 3300025939 Ga0207665_10627619 Ga0207665_106276192 159
922 3300025939 Ga0207665_11122585 Ga0207665_111225851 159
923 3300025940 Ga0207691_10111293 Ga0207691_101112932 159
924 3300025941 Ga0207711_10956781 Ga0207711_109567812 159
925 3300025944 Ga0207661_10000889 Ga0207661_100008898 159
926 3300025944 Ga0207661_10073195 Ga0207661_100731952 159
927 3300025944 Ga0207661_10739204 Ga0207661_107392042 159
928 3300025945 Ga0207679_10256917 Ga0207679_102569172 159
929 3300025949 Ga0207667_10011892 Ga0207667_100118925 159
930 3300025949 Ga0207667_10054977 Ga0207667_100549773 159
931 3300025949 Ga0207667_10167961 Ga0207667_101679612 159
932 3300025960 Ga0207651_10103843 Ga0207651_101038433 159
933 3300026023 Ga0207677_10010857 Ga0207677_100108574 159
934 3300026041 Ga0207639_10096777 Ga0207639_100967772 159
935 3300026041 Ga0207639_10280171 Ga0207639_102801712 159
936 3300026041 Ga0207639_10341575 Ga0207639_103415752 159
937 3300026041 Ga0207639_10525913 Ga0207639_105259132 159
938 3300026041 Ga0207639_10591691 Ga0207639_105916912 159
939 3300026078 Ga0207702_10000433 Ga0207702_1000043348 159
940 3300026078 Ga0207702_10156956 Ga0207702_101569562 159
941 3300026078 Ga0207702_10336092 Ga0207702_103360922 159
942 3300026078 Ga0207702_11344313 Ga0207702_113443132 159
943 3300026116 Ga0207674_10020134 Ga0207674_100201343 159
944 3300026116 Ga0207674_10047317 Ga0207674_100473174 159
945 3300026118 Ga0207675_100218915 Ga0207675_1002189151 159
946 3300026121 Ga0207683_10022491 Ga0207683_100224912 159
947 3300026121 Ga0207683_10027057 Ga0207683_100270571 159
948 3300026121 Ga0207683_10550524 Ga0207683_105505242 159
949 3300026121 Ga0207683_10652695 Ga0207683_106526952 159
950 3300026121 Ga0207683_10986456 Ga0207683_109864561 159
951 3300026142 Ga0207698_10168949 Ga0207698_101689492 159
952 3300026142 Ga0207698_10195622 Ga0207698_101956222 159
953 3300026142 Ga0207698_11186307 Ga0207698_111863072 159
954 3300026142 Ga0207698_11492278 Ga0207698_114922782 159
955 3300027357 Ga0209589_1000009 Ga0209589_1000009197 159
956 3300027361 Ga0209489_100010 Ga0209489_10001073 159
957 3300027363 Ga0209700_100017 Ga0209700_10001773 159
958 3300027866 Ga0209813_10231557 Ga0209813_102315571 159
959 3300028379 Ga0268266_10330383 Ga0268266_103303832 159
960 3300028379 Ga0268266_10818337 Ga0268266_108183371 159
961 3300028379 Ga0268266_11631259 Ga0268266_116312591 159
962 3300028381 Ga0268264_10582119 Ga0268264_105821192 159
963 3300028573 Ga0265334_10009203 Ga0265334_100092032 159
964 3300028786 Ga0307517_10000512 Ga0307517_1000051244 159
965 3300028794 Ga0307515_10007488 Ga0307515_1000748815 159
966 3300028800 Ga0265338_10369397 Ga0265338_103693971 159
967 3300031235 Ga0265330_10042318 Ga0265330_100423182 159
968 3300031238 Ga0265332_10017124 Ga0265332_100171242 159
969 3300031456 Ga0307513_10066917 Ga0307513_100669172 159
970 3300031507 Ga0307509_10362884 Ga0307509_103628842 159
971 3300031507 Ga0307509_10555128 Ga0307509_105551281 159
972 3300031548 Ga0307408_100274895 Ga0307408_1002748952 159
973 3300031616 Ga0307508_10000514 Ga0307508_1000051436 159
974 3300031711 Ga0265314_10011527 Ga0265314_100115275 159
975 3300031730 Ga0307516_10011779 Ga0307516_100117797 159
976 3300031730 Ga0307516_10268754 Ga0307516_102687542 159
977 3300031901 Ga0307406_10151527 Ga0307406_101515272 159
978 3300031903 Ga0307407_10540635 Ga0307407_105406352 159
979 3300031911 Ga0307412_10070318 Ga0307412_100703182 159
980 3300032002 Ga0307416_100091588 Ga0307416_1000915882 159
981 3300032005 Ga0307411_10609426 Ga0307411_106094261 159
982 3300032126 Ga0307415_100635159 Ga0307415_1006351592 159
983 3300033180 Ga0307510_10023408 Ga0307510_100234082 159
984 3300033544 Ga0316215_1004581 Ga0316215_10045812 159
985 3300035088 Ga0373940_0208698 Ga0373940_0208698_132_629 159
986 3300035089 Ga0373944_0045956 Ga0373944_0045956_308_790 159
987 3300035091 Ga0373951_0069421 Ga0373951_0069421_83_565 159
988 3300035092 Ga0373952_0105437 Ga0373952_0105437_254_736 159
989 3300035113 Ga0373936_0002974 Ga0373936_0002974_2736_3218 159
990 3300035116 Ga0373945_0009494 Ga0373945_0009494_456_938 159
991 3300035117 Ga0373953_0003113 Ga0373953_0003113_4527_5009 159
992 3300035120 Ga0373957_0004852 Ga0373957_0004852_306_788 159
993 3300035170 Ga0373943_0023841 Ga0373943_0023841_1688_2170 159
994 3300035171 Ga0373946_0012423 Ga0373946_0012423_2523_3005 159
995 3300035171 Ga0373946_0106178 Ga0373946_0106178_730_1212 159
996 3300035692 Ga0373935_0001637 Ga0373935_0001637_2421_2903 159
997 3300035692 Ga0373935_0666612 Ga0373935_0666612_219_701 159
998 3300035695 Ga0373927_0000331 Ga0373927_0000331_31858_32340 159
999 3300035695 Ga0373927_0005361 Ga0373927_0005361_5359_5841 159
1000 3300035695 Ga0373927_0018601 Ga0373927_0018601_2145_2627 159
1001 3300035695 Ga0373927_0075809 Ga0373927_0075809_50_532 159
1002 3300035695 Ga0373927_0829994 Ga0373927_0829994_52_531 159
1003 3300035724 Ga0373933_0000377 Ga0373933_0000377_3854_4336 159
1004 3300035724 Ga0373933_0024966 Ga0373933_0024966_2509_2991 159
1005 3300035724 Ga0373933_0709833 Ga0373933_0709833_120_602 159
1006 3300035725 Ga0373947_0005852 Ga0373947_0005852_3794_4276 159
1007 3300035725 Ga0373947_0015963 Ga0373947_0015963_3227_3709 159
1008 3300035725 Ga0373947_0032326 Ga0373947_0032326_2308_2790 159
1009 3300035725 Ga0373947_0037473 Ga0373947_0037473_1183_1665 159
1010 3300036401 Ga0373937_0015924 Ga0373937_0015924_3394_3876 159
1011 3300037068 Ga0373925_0029052 Ga0373925_0029052_299_781 159
1012 3300037068 Ga0373925_0374049 Ga0373925_0374049_151_633 159
1013 3300037068 Ga0373925_0666181 Ga0373925_0666181_73_564 159
1014 3300037312 Ga0395899_0009172 Ga0395899_0009172_6161_6643 159
1015 3300037312 Ga0395899_0138097 Ga0395899_0138097_497_979 159
1016 3300037418 Ga0395900_0398370 Ga0395900_0398370_198_680 159
1017 3300037466 Ga0395898_0554086 Ga0395898_0554086_12_494 159
1018 3300037471 Ga0395905_0647711 Ga0395905_0647711_279_761 159
1019 3300037471 Ga0395905_0961284 Ga0395905_0961284_47_541 159
1020 3300037853 Ga0436364_0001304 Ga0436364_0001304_1832_2314 159
1021 3300037853 Ga0436364_0072718 Ga0436364_0072718_365_853 159
1022 3300037853 Ga0436364_0942302 Ga0436364_0942302_578_1060 159
1023 3300037853 Ga0436364_1436174 Ga0436364_1436174_515_997 159
1024 3300038443 Ga0395901_0054356 Ga0395901_0054356_1281_1763 159
1025 3300038443 Ga0395901_0084781 Ga0395901_0084781_359_841 159
1026 3300038443 Ga0395901_0436586 Ga0395901_0436586_372_854 159
1027 3300039437 Ga0436365_0979043 Ga0436365_0979043_3995_4477 159
1028 3300039437 Ga0436365_1662883 Ga0436365_1662883_1188_1670 159
1029 3300039437 Ga0436365_1666053 Ga0436365_1666053_1988_2470 159
1030 3300039438 Ga0436360_0321210 Ga0436360_0321210_149_631 159
1031 3300039438 Ga0436360_0805252 Ga0436360_0805252_245_727 159
1032 3300039447 Ga0436361_0106883 Ga0436361_0106883_20_502 159
1033 3300039447 Ga0436361_0621214 Ga0436361_0621214_1319_1801 159
1034 3300039450 Ga0436363_0475902 Ga0436363_0475902_6735_7262 159
1035 3300039450 Ga0436363_0726196 Ga0436363_0726196_1846_2328 159
1036 3300039450 Ga0436363_1489761 Ga0436363_1489761_53_535 159
1037 3300041503 Ga0451847_0078248 Ga0451847_0078248_311_793 159
1038 3300041512 Ga0451853_3406428 Ga0451853_3406428_89_568 159
1039 3300044694 Ga0466963_0427356 Ga0466963_0427356_35_517 159
1040 3300044706 Ga0466964_0088277 Ga0466964_0088277_678_1160 159
1041 3300044765 Ga0466970_0107661 Ga0466970_0107661_1007_1489 159
1042 3300044842 Ga0466957_0062703 Ga0466957_0062703_147_629 159
1043 3300045049 Ga0466959_0149442 Ga0466959_0149442_231_713 159
1044 3300045976 Ga0466967_0838165 Ga0466967_0838165_29_511 159
1045 3300045976 Ga0466967_1260624 Ga0466967_1260624_123_605 159
1046 3300046454 Ga0495592_0033915 Ga0495592_0033915_2113_2595 159
1047 3300046454 Ga0495592_0127916 Ga0495592_0127916_1082_1564 159
1048 3300046455 Ga0495603_0015303 Ga0495603_0015303_4022_4504 159
1049 3300046455 Ga0495603_0039904 Ga0495603_0039904_294_776 159
1050 3300046455 Ga0495603_0053664 Ga0495603_0053664_707_1189 159
1051 3300046455 Ga0495603_0127432 Ga0495603_0127432_104_586 159
1052 3300046459 Ga0495629_0001243 Ga0495629_0001243_9477_9959 159
1053 3300046461 Ga0495641_0004926 Ga0495641_0004926_6024_6506 159
1054 3300046461 Ga0495641_0153169 Ga0495641_0153169_175_657 159
1055 3300046462 Ga0495651_0086681 Ga0495651_0086681_1719_2201 159
1056 3300046462 Ga0495651_0641549 Ga0495651_0641549_121_603 159
1057 3300046462 Ga0495651_0690597 Ga0495651_0690597_115_597 159
1058 3300046463 Ga0495653_0011097 Ga0495653_0011097_4796_5278 159
1059 3300046472 Ga0495580_0001284 Ga0495580_0001284_9262_9744 159
1060 3300046472 Ga0495580_0085993 Ga0495580_0085993_1161_1643 159
1061 3300046472 Ga0495580_0282542 Ga0495580_0282542_357_839 159
1062 3300046472 Ga0495580_0355421 Ga0495580_0355421_376_858 159
1063 3300046473 Ga0495582_0000166 Ga0495582_0000166_9338_9820 159
1064 3300046475 Ga0495639_0001186 Ga0495639_0001186_9337_9819 159
1065 3300046476 Ga0495662_0000887 Ga0495662_0000887_8142_8624 159
1066 3300046477 Ga0495664_0071918 Ga0495664_0071918_1152_1634 159
1067 3300046477 Ga0495664_0081855 Ga0495664_0081855_1187_1669 159
1068 3300046499 Ga0495594_0000692 Ga0495594_0000692_9306_9788 159
1069 3300046499 Ga0495594_0266004 Ga0495594_0266004_244_726 159
1070 3300046507 Ga0495606_0000939 Ga0495606_0000939_13651_14133 159
1071 3300046511 Ga0495608_0140480 Ga0495608_0140480_625_1107 159
1072 3300046514 Ga0495618_0063817 Ga0495618_0063817_1545_2027 159
1073 3300046516 Ga0495628_0074488 Ga0495628_0074488_1343_1825 159
1074 3300046517 Ga0495630_0007555 Ga0495630_0007555_829_1311 159
1075 3300046526 Ga0495666_0027403 Ga0495666_0027403_1735_2217 159
1076 3300046529 Ga0495652_0204026 Ga0495652_0204026_162_644 159
1077 3300046531 Ga0495665_0000104 Ga0495665_0000104_33886_34368 159
1078 3300046531 Ga0495665_0620360 Ga0495665_0620360_27_509 159
1079 3300046533 Ga0495640_0008638 Ga0495640_0008638_4416_4898 159
1080 3300046543 Ga0495645_0034120 Ga0495645_0034120_852_1334 159
1081 3300046557 Ga0495622_0064799 Ga0495622_0064799_1105_1587 159
1082 3300046615 Ga0495656_0105143 Ga0495656_0105143_580_1062 159
1083 3300046616 Ga0495668_0339777 Ga0495668_0339777_252_734 159
1084 3300046642 Ga0495634_0004417 Ga0495634_0004417_5417_5899 159
1085 3300046642 Ga0495634_0018689 Ga0495634_0018689_40_522 159
1086 3300046660 Ga0495625_0275271 Ga0495625_0275271_475_954 159
1087 3300046663 Ga0495635_0001205 Ga0495635_0001205_12576_13058 159
1088 3300046663 Ga0495635_0008253 Ga0495635_0008253_4811_5293 159
1089 3300046674 Ga0495588_0038217 Ga0495588_0038217_1635_2117 159
1090 3300046678 Ga0495599_0762684 Ga0495599_0762684_17_499 159
1091 3300046679 Ga0495623_0296622 Ga0495623_0296622_121_603 159
1092 3300046680 Ga0495646_0002999 Ga0495646_0002999_9652_10134 159
1093 3300046680 Ga0495646_0003385 Ga0495646_0003385_7622_8104 159
1094 3300046681 Ga0495647_0005695 Ga0495647_0005695_466_948 159
1095 3300046683 Ga0495658_0002138 Ga0495658_0002138_2999_3481 159
1096 3300046684 Ga0495669_0412982 Ga0495669_0412982_72_566 159
1097 3300046689 Ga0495613_0025996 Ga0495613_0025996_3625_4107 159
1098 3300046689 Ga0495613_0051891 Ga0495613_0051891_1965_2447 159
1099 3300046690 Ga0495624_0002866 Ga0495624_0002866_8225_8707 159
1100 3300046690 Ga0495624_0400748 Ga0495624_0400748_178_660 159
1101 3300046690 Ga0495624_0403886 Ga0495624_0403886_292_774 159
1102 3300046690 Ga0495624_0461862 Ga0495624_0461862_210_692 159
1103 3300046794 Ga0495589_0083491 Ga0495589_0083491_1022_1516 159
1104 3300046809 Ga0495600_0121962 Ga0495600_0121962_689_1171 159
1105 3300046809 Ga0495600_0454079 Ga0495600_0454079_230_712 159
1106 3300046809 Ga0495600_0631648 Ga0495600_0631648_21_503 159
1107 3300047315 Ga0495581_0000391 Ga0495581_0000391_9337_9819 159
1108 3300047315 Ga0495581_0123057 Ga0495581_0123057_426_923 159
1109 3300047318 Ga0495636_0264687 Ga0495636_0264687_129_611 159
1110 3300047319 Ga0495674_0002721 Ga0495674_0002721_8475_8957 159
1111 3300047319 Ga0495674_0017714 Ga0495674_0017714_4333_4815 159
1112 3300047320 Ga0495672_0025901 Ga0495672_0025901_3095_3577 159
1113 3300047321 Ga0495676_0411718 Ga0495676_0411718_41_523 159
1114 3300047469 Ga0495673_0019681 Ga0495673_0019681_1064_1546 159
1115 3300047471 Ga0495684_0001891 Ga0495684_0001891_13849_14331 159
1116 3300047471 Ga0495684_0298594 Ga0495684_0298594_369_851 159
1117 3300047673 Ga0495593_0000180 Ga0495593_0000180_9333_9815 159
1118 3300047673 Ga0495593_0010159 Ga0495593_0010159_337_819 159
1119 3300047673 Ga0495593_0609991 Ga0495593_0609991_48_530 159
1120 3300048088 Ga0495602_0538584 Ga0495602_0538584_207_689 159
1121 3300048088 Ga0495602_0742213 Ga0495602_0742213_98_580 159
1122 3300048903 Ga0496100_0012270 Ga0496100_0012270_1388_1870 159
1123 3300048903 Ga0496100_0742383 Ga0496100_0742383_186_668 159
1124 3300048903 Ga0496100_0971189 Ga0496100_0971189_17_499 159
1125 3300048904 Ga0496101_0032497 Ga0496101_0032497_1347_1829 159
1126 3300048904 Ga0496101_0745524 Ga0496101_0745524_121_615 159
1127 3300048905 Ga0496102_0001773 Ga0496102_0001773_12751_13233 159
1128 3300048905 Ga0496102_0183964 Ga0496102_0183964_27_509 159
1129 3300048907 Ga0496104_0023762 Ga0496104_0023762_3612_4094 159
1130 3300048907 Ga0496104_0209282 Ga0496104_0209282_1025_1507 159
1131 3300048907 Ga0496104_0442951 Ga0496104_0442951_624_1118 159
1132 3300048908 Ga0496105_0032232 Ga0496105_0032232_2129_2611 159
1133 3300048908 Ga0496105_0176526 Ga0496105_0176526_324_806 159
1134 3300048909 Ga0496106_0006597 Ga0496106_0006597_909_1391 159
1135 3300048909 Ga0496106_0035076 Ga0496106_0035076_3197_3679 159
1136 3300048909 Ga0496106_0334597 Ga0496106_0334597_298_780 159
1137 3300048910 Ga0496107_0008230 Ga0496107_0008230_6312_6794 159
1138 3300048910 Ga0496107_0318792 Ga0496107_0318792_652_1146 159
1139 3300048910 Ga0496107_0705796 Ga0496107_0705796_106_588 159
1140 3300048911 Ga0496108_0196399 Ga0496108_0196399_344_826 159
1141 3300048911 Ga0496108_0579652 Ga0496108_0579652_41_523 159
1142 3300048911 Ga0496108_0725204 Ga0496108_0725204_344_838 159
1143 3300048912 Ga0496109_0051059 Ga0496109_0051059_1719_2201 159
1144 3300048912 Ga0496109_0679986 Ga0496109_0679986_375_857 159
1145 3300048912 Ga0496109_0790578 Ga0496109_0790578_88_582 159
1146 3300048913 Ga0496110_0164782 Ga0496110_0164782_331_813 159
1147 3300048913 Ga0496110_0334107 Ga0496110_0334107_414_896 159
1148 3300048914 Ga0496111_0039133 Ga0496111_0039133_314_796 159
1149 3300048914 Ga0496111_0047722 Ga0496111_0047722_560_1042 159
1150 3300048914 Ga0496111_0063998 Ga0496111_0063998_1903_2385 159
1151 3300048915 Ga0496112_0000019 Ga0496112_0000019_176481_176963 159
1152 3300048915 Ga0496112_0120658 Ga0496112_0120658_1158_1640 159
1153 3300048915 Ga0496112_0353035 Ga0496112_0353035_507_1001 159
1154 3300048915 Ga0496112_0357056 Ga0496112_0357056_349_831 159
1155 3300048916 Ga0496113_0072749 Ga0496113_0072749_422_904 159
1156 3300048916 Ga0496113_0429768 Ga0496113_0429768_177_659 159
1157 3300048917 Ga0496114_0073391 Ga0496114_0073391_279_761 159
1158 3300048918 Ga0496115_0001360 Ga0496115_0001360_6612_7094 159
1159 3300048918 Ga0496115_0033069 Ga0496115_0033069_384_866 159
1160 3300048918 Ga0496115_0133276 Ga0496115_0133276_437_919 159
1161 3300048918 Ga0496115_0203602 Ga0496115_0203602_897_1379 159
1162 3300048920 Ga0496117_0038054 Ga0496117_0038054_3038_3559 159
1163 3300048921 Ga0496118_0054264 Ga0496118_0054264_807_1289 159
1164 3300048922 Ga0496119_0219518 Ga0496119_0219518_59_580 159
1165 3300048924 Ga0496121_0000365 Ga0496121_0000365_83006_83488 159
1166 3300048924 Ga0496121_0018687 Ga0496121_0018687_109_591 159
1167 3300048924 Ga0496121_0031262 Ga0496121_0031262_3999_4481 159
1168 3300048924 Ga0496121_0057162 Ga0496121_0057162_872_1354 159
1169 3300048924 Ga0496121_0145875 Ga0496121_0145875_817_1299 159
1170 3300048924 Ga0496121_0362348 Ga0496121_0362348_153_650 159
1171 3300048927 Ga0496124_0008072 Ga0496124_0008072_3896_4378 159
1172 3300048929 Ga0496126_0002146 Ga0496126_0002146_2620_3117 159
1173 3300048929 Ga0496126_0027923 Ga0496126_0027923_4190_4672 159
1174 3300048929 Ga0496126_0036970 Ga0496126_0036970_430_912 159
1175 3300048929 Ga0496126_0104306 Ga0496126_0104306_546_1028 159
1176 3300048929 Ga0496126_0221971 Ga0496126_0221971_961_1443 159
1177 3300048929 Ga0496126_0222017 Ga0496126_0222017_579_1061 159
1178 3300048929 Ga0496126_0910664 Ga0496126_0910664_47_529 159
1179 3300049580 Ga0501046_0074602 Ga0501046_0074602_2114_2596 159
1180 3300049581 Ga0501047_0124858 Ga0501047_0124858_1896_2378 159
1181 3300049581 Ga0501047_0256777 Ga0501047_0256777_614_1096 159
1182 3300049586 Ga0501070_0040505 Ga0501070_0040505_53_535 159
1183 3300049589 Ga0501073_0072930 Ga0501073_0072930_73_555 159
1184 3300049590 Ga0501074_0031172 Ga0501074_0031172_60_542 159
1185 3300049742 Ga0501080_0002786 Ga0501080_0002786_14791_15273 159
1186 3300049823 Ga0501044_0143390 Ga0501044_0143390_67_549 159
1187 3300050489 nmdc:mga03683_281711_c1 nmdc:mga03683_281711_c1_190_672 159
1188 3300050489 nmdc:mga03683_368666_c1 nmdc:mga03683_368666_c1_145_627 159
1189 3300050490 nmdc:mga03n38_86131_c1 nmdc:mga03n38_86131_c1_928_1410 159
1190 3300050491 nmdc:mga00v17_528839_c1 nmdc:mga00v17_528839_c1_114_596 159
1191 3300050492 nmdc:mga0yw44_17809_c1 nmdc:mga0yw44_17809_c1_544_1026 159
1192 3300050493 nmdc:mga0k408_699396_c1 nmdc:mga0k408_699396_c1_47_541 159
1193 3300050494 nmdc:mga06z11_258422_c1 nmdc:mga06z11_258422_c1_232_714 159
1194 3300050494 nmdc:mga06z11_367178_c1 nmdc:mga06z11_367178_c1_47_568 159
1195 3300050495 nmdc:mga04h51_165031_c1 nmdc:mga04h51_165031_c1_26_508 159
1196 3300050496 nmdc:mga07m45_473359_c1 nmdc:mga07m45_473359_c1_54_533 159
1197 3300050512 nmdc:mga0n895_3688_c1 nmdc:mga0n895_3688_c1_9599_10090 159
1198 3300050513 nmdc:mga0rr50_164437_c1 nmdc:mga0rr50_164437_c1_992_1486 159
1199 3300050513 nmdc:mga0rr50_573382_c1 nmdc:mga0rr50_573382_c1_469_951 159
1200 3300050514 nmdc:mga08x19_427671_c1 nmdc:mga08x19_427671_c1_124_606 159
1201 3300053077 Ga0495601_0391578 Ga0495601_0391578_285_767 159
1202 3300053077 Ga0495601_0685458 Ga0495601_0685458_12_494 159
1203 3300053078 Ga0495612_0142454 Ga0495612_0142454_348_830 159
1204 3300053079 Ga0500610_0196747 Ga0500610_0196747_358_837 159
1205 3300053080 Ga0500635_0085889 Ga0500635_0085889_498_980 159
1206 3300053083 Ga0495655_0135701 Ga0495655_0135701_104_586 159
1207 3300053084 Ga0495595_0004220 Ga0495595_0004220_4704_5186 159
1208 3300053084 Ga0495595_0005357 Ga0495595_0005357_4047_4529 159
1209 3300053085 Ga0495619_0185770 Ga0495619_0185770_249_731 159
1210 3300053091 Ga0500647_0183288 Ga0500647_0183288_317_799 159
1211 3300053091 Ga0500647_0221418 Ga0500647_0221418_221_703 159
1212 3300053094 Ga0500566_0000122 Ga0500566_0000122_19149_19631 159
1213 3300053094 Ga0500566_0024142 Ga0500566_0024142_145_627 159
1214 3300053095 Ga0500640_008021 Ga0500640_008021_2590_3072 159
1215 3300053097 Ga0500648_158071 Ga0500648_158071_136_618 159
1216 3300053102 Ga0500554_000582 Ga0500554_000582_4286_4768 159
1217 3300053102 Ga0500554_004983 Ga0500554_004983_221_703 159
1218 3300053111 Ga0500572_000053 Ga0500572_000053_27793_28275 159
1219 3300053113 Ga0500580_148560 Ga0500580_148560_87_569 159
1220 3300053119 Ga0500595_002485 Ga0500595_002485_6471_6953 159
1221 3300053119 Ga0500595_019042 Ga0500595_019042_310_792 159
1222 3300053122 Ga0500608_024872 Ga0500608_024872_705_1187 159
1223 3300053136 Ga0500559_0001445 Ga0500559_0001445_12110_12592 159
1224 3300053136 Ga0500559_0065370 Ga0500559_0065370_435_917 159
1225 3300053139 Ga0500568_0011478 Ga0500568_0011478_381_863 159
1226 3300053140 Ga0500573_0039597 Ga0500573_0039597_1591_2073 159
1227 3300053144 Ga0500585_168518 Ga0500585_168518_219_701 159
1228 3300053148 Ga0500590_079068 Ga0500590_079068_813_1295 159
1229 3300053148 Ga0500590_192021 Ga0500590_192021_382_864 159
1230 3300053150 Ga0500603_000341 Ga0500603_000341_9102_9584 159
1231 3300053150 Ga0500603_001366 Ga0500603_001366_3664_4146 159
1232 3300053150 Ga0500603_246965 Ga0500603_246965_75_557 159
1233 3300053159 Ga0500630_003299 Ga0500630_003299_3756_4238 159
1234 3300053162 Ga0500638_001838 Ga0500638_001838_3634_4116 159
1235 3300053162 Ga0500638_006669 Ga0500638_006669_223_705 159
1236 3300053162 Ga0500638_164379 Ga0500638_164379_312_794 159
1237 3300053163 Ga0500639_000008 Ga0500639_000008_47808_48290 159
1238 3300053163 Ga0500639_054379 Ga0500639_054379_1438_1920 159
1239 3300053177 Ga0500636_0027580 Ga0500636_0027580_132_614 159
1240 3300053178 Ga0500637_0000070 Ga0500637_0000070_6234_6716 159
1241 3300053178 Ga0500637_0001409 Ga0500637_0001409_9299_9781 159
1242 3300053178 Ga0500637_0049099 Ga0500637_0049099_429_911 159
1243 3300053728 Ga0500657_162072 Ga0500657_162072_170_652 159
1244 3300053735 Ga0500596_002311 Ga0500596_002311_2273_2755 159
1245 3300053735 Ga0500596_002931 Ga0500596_002931_1181_1663 159
1246 3300055283 Ga0500661_000295 Ga0500661_000295_5438_5920 159
1247 3300061719 Ga0466962_0401363 Ga0466962_0401363_173_655 159
1248 3300061734 Ga0530510_1220340 Ga0530510_1220340_80_559 159
1249 3300002067 JGI24735J21928_10174835 JGI24735J21928_101748351 160
1250 3300005337 Ga0070682_100334348 Ga0070682_1003343482 160
1251 3300005458 Ga0070681_10760630 Ga0070681_107606301 160
1252 3300005530 Ga0070679_100119450 Ga0070679_1001194502 160
1253 3300005530 Ga0070679_100288199 Ga0070679_1002881992 160
1254 3300005718 Ga0068866_10932502 Ga0068866_109325021 160
1255 3300005841 Ga0068863_100386800 Ga0068863_1003868001 160
1256 3300005843 Ga0068860_100012742 Ga0068860_1000127425 160
1257 3300006237 Ga0097621_100664082 Ga0097621_1006640822 160
1258 3300006358 Ga0068871_100340216 Ga0068871_1003402162 160
1259 3300007265 Ga0099794_10090494 Ga0099794_100904942 160
1260 3300009101 Ga0105247_10059204 Ga0105247_100592042 160
1261 3300009545 Ga0105237_10097302 Ga0105237_100973022 160
1262 3300009988 Ga0105035_116225 Ga0105035_1162252 160
1263 3300010159 Ga0099796_10061146 Ga0099796_100611462 160
1264 3300013105 Ga0157369_12170976 Ga0157369_121709761 160
1265 3300013297 Ga0157378_10269721 Ga0157378_102697212 160
1266 3300021361 Ga0213872_10162189 Ga0213872_101621892 160
1267 3300025261 Ga0209233_1003513 Ga0209233_10035134 160
1268 3300025900 Ga0207710_10025072 Ga0207710_100250722 160
1269 3300025912 Ga0207707_10000852 Ga0207707_1000085214 160
1270 3300025914 Ga0207671_10193003 Ga0207671_101930032 160
1271 3300025917 Ga0207660_10230213 Ga0207660_102302132 160
1272 3300025921 Ga0207652_10024999 Ga0207652_100249992 160
1273 3300025921 Ga0207652_10062755 Ga0207652_100627552 160
1274 3300026088 Ga0207641_10732202 Ga0207641_107322022 160
1275 3300027671 Ga0209588_1062957 Ga0209588_10629572 160
1276 3300028381 Ga0268264_10000038 Ga0268264_1000003865 160
1277 3300031730 Ga0307516_10018988 Ga0307516_100189886 160
1278 3300031730 Ga0307516_10146281 Ga0307516_101462812 160
1279 3300033179 Ga0307507_10010286 Ga0307507_100102868 160
1280 3300033442 Ga0315911_1000009 Ga0315911_1000009318 160
1281 3300035083 Ga0373926_0228054 Ga0373926_0228054_77_574 160
1282 3300035086 Ga0373934_0002376 Ga0373934_0002376_4702_5199 160
1283 3300035086 Ga0373934_0011722 Ga0373934_0011722_2322_2819 160
1284 3300035111 Ga0373923_0001881 Ga0373923_0001881_108_605 160
1285 3300035111 Ga0373923_0234047 Ga0373923_0234047_147_644 160
1286 3300035113 Ga0373936_0102137 Ga0373936_0102137_566_1063 160
1287 3300035116 Ga0373945_0007983 Ga0373945_0007983_1108_1605 160
1288 3300035117 Ga0373953_0020937 Ga0373953_0020937_1805_2302 160
1289 3300035118 Ga0373954_0013120 Ga0373954_0013120_1074_1571 160
1290 3300035118 Ga0373954_0147565 Ga0373954_0147565_562_1059 160
1291 3300035119 Ga0373956_0005493 Ga0373956_0005493_94_591 160
1292 3300035119 Ga0373956_0030747 Ga0373956_0030747_756_1253 160
1293 3300035120 Ga0373957_0031440 Ga0373957_0031440_179_676 160
1294 3300035170 Ga0373943_0071292 Ga0373943_0071292_50_547 160
1295 3300035172 Ga0373955_0022371 Ga0373955_0022371_66_563 160
1296 3300035410 Ga0373924_0003075 Ga0373924_0003075_4850_5347 160
1297 3300035692 Ga0373935_0523525 Ga0373935_0523525_50_547 160
1298 3300035695 Ga0373927_0023227 Ga0373927_0023227_677_1174 160
1299 3300035695 Ga0373927_0203910 Ga0373927_0203910_782_1279 160
1300 3300035724 Ga0373933_0042940 Ga0373933_0042940_773_1270 160
1301 3300035725 Ga0373947_0522125 Ga0373947_0522125_59_556 160
1302 3300036401 Ga0373937_0027279 Ga0373937_0027279_4314_4811 160
1303 3300036401 Ga0373937_0085815 Ga0373937_0085815_106_603 160
1304 3300037068 Ga0373925_0008062 Ga0373925_0008062_1445_1942 160
1305 3300037068 Ga0373925_0106942 Ga0373925_0106942_465_962 160
1306 3300039447 Ga0436361_0453764 Ga0436361_0453764_313_795 160
1307 3300046459 Ga0495629_0012109 Ga0495629_0012109_4560_5057 160
1308 3300046459 Ga0495629_0044686 Ga0495629_0044686_1257_1754 160
1309 3300046459 Ga0495629_0261096 Ga0495629_0261096_464_961 160
1310 3300046461 Ga0495641_0242368 Ga0495641_0242368_186_683 160
1311 3300046462 Ga0495651_0007131 Ga0495651_0007131_6725_7222 160
1312 3300046472 Ga0495580_0149952 Ga0495580_0149952_782_1279 160
1313 3300046473 Ga0495582_0031855 Ga0495582_0031855_189_686 160
1314 3300046475 Ga0495639_0021762 Ga0495639_0021762_187_684 160
1315 3300046475 Ga0495639_0124318 Ga0495639_0124318_460_957 160
1316 3300046476 Ga0495662_0027805 Ga0495662_0027805_920_1417 160
1317 3300046477 Ga0495664_0003804 Ga0495664_0003804_5792_6289 160
1318 3300046511 Ga0495608_0565267 Ga0495608_0565267_66_563 160
1319 3300046514 Ga0495618_0011851 Ga0495618_0011851_2429_2926 160
1320 3300046516 Ga0495628_0405478 Ga0495628_0405478_340_837 160
1321 3300046517 Ga0495630_0021452 Ga0495630_0021452_798_1295 160
1322 3300046517 Ga0495630_0256802 Ga0495630_0256802_481_978 160
1323 3300046526 Ga0495666_0009552 Ga0495666_0009552_4297_4794 160
1324 3300046529 Ga0495652_0070679 Ga0495652_0070679_1858_2355 160
1325 3300046529 Ga0495652_0299249 Ga0495652_0299249_483_980 160
1326 3300046531 Ga0495665_0438462 Ga0495665_0438462_21_518 160
1327 3300046533 Ga0495640_0006908 Ga0495640_0006908_121_618 160
1328 3300046535 Ga0495586_0160223 Ga0495586_0160223_59_556 160
1329 3300046536 Ga0495587_0003522 Ga0495587_0003522_8607_9104 160
1330 3300046543 Ga0495645_0452616 Ga0495645_0452616_237_734 160
1331 3300046557 Ga0495622_0072642 Ga0495622_0072642_141_638 160
1332 3300046557 Ga0495622_0091511 Ga0495622_0091511_227_724 160
1333 3300046642 Ga0495634_0045434 Ga0495634_0045434_53_550 160
1334 3300046663 Ga0495635_0199189 Ga0495635_0199189_714_1211 160
1335 3300046674 Ga0495588_0590551 Ga0495588_0590551_74_571 160
1336 3300046675 Ga0495657_0009562 Ga0495657_0009562_6726_7223 160
1337 3300046678 Ga0495599_0000673 Ga0495599_0000673_588_1085 160
1338 3300046678 Ga0495599_0299464 Ga0495599_0299464_392_889 160
1339 3300046679 Ga0495623_0101404 Ga0495623_0101404_66_563 160
1340 3300046680 Ga0495646_0112349 Ga0495646_0112349_102_599 160
1341 3300046683 Ga0495658_0006603 Ga0495658_0006603_1182_1679 160
1342 3300046689 Ga0495613_0018203 Ga0495613_0018203_4441_4938 160
1343 3300046689 Ga0495613_0090693 Ga0495613_0090693_1199_1696 160
1344 3300046690 Ga0495624_0194679 Ga0495624_0194679_340_837 160
1345 3300046809 Ga0495600_0007219 Ga0495600_0007219_4826_5323 160
1346 3300047315 Ga0495581_0283999 Ga0495581_0283999_156_653 160
1347 3300047317 Ga0495604_0139733 Ga0495604_0139733_66_563 160
1348 3300047317 Ga0495604_0307764 Ga0495604_0307764_368_865 160
1349 3300047319 Ga0495674_0017899 Ga0495674_0017899_2576_3073 160
1350 3300047321 Ga0495676_0007448 Ga0495676_0007448_222_719 160
1351 3300047322 Ga0495680_0008673 Ga0495680_0008673_8607_9104 160
1352 3300047471 Ga0495684_0019909 Ga0495684_0019909_2931_3428 160
1353 3300047673 Ga0495593_0065947 Ga0495593_0065947_171_668 160
1354 3300047673 Ga0495593_0549964 Ga0495593_0549964_21_557 160
1355 3300048088 Ga0495602_0473934 Ga0495602_0473934_66_563 160
1356 3300048923 Ga0496120_0305628 Ga0496120_0305628_40_531 160
1357 3300053077 Ga0495601_0063657 Ga0495601_0063657_1590_2087 160
1358 3300053078 Ga0495612_0264823 Ga0495612_0264823_35_532 160
1359 3300053085 Ga0495619_0006724 Ga0495619_0006724_1156_1653 160
1360 3300053085 Ga0495619_0800022 Ga0495619_0800022_106_603 160
1361 3300053094 Ga0500566_0165900 Ga0500566_0165900_570_1067 160
1362 3300053728 Ga0500657_175293 Ga0500657_175293_246_743 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

89

162

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

21

88

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9771 2 156
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9738 1 156
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.972 3 155
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9707 3 156
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9698 5 157
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9876 2 76 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9791 81 155 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9776 81 155 1.10.150.120
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9767 3 78 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9675 2 78 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A160TUD5-F1-model_v4 Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4) 0.9955 1 156 GO:0004854
GO:0046872
GO:0051537
AF-A0A382B5I4-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9952 4 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A177QCX2-F1-model_v4 Ferredoxin 0.9948 1 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A519QHK6-F1-model_v4 (2Fe-2S)-binding protein 0.9941 1 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A3D5FJQ6-F1-model_v4 Ferredoxin 0.9934 1 143 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.67 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map