F493271

General Info

Members Datasets Scaffolds Average Seq Length
1354 386 1354 113

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10574484|Ga0307513_105744842
Length 133
Sequence MLIAIFVVSVLFIHEAKQRYCMSTSELSFSAVTGDGLILKIDLHNLKKAALVLRAVNHKLRQQILKLIDEHGRVTVTELYVKMRLEQSVASQHLAILRKAGFVKTLRDGKFIYYSVNIIRMDEVNQFLADLLD

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
219 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
220 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
223 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
232 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
233 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
236 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
237 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
238 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
239 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
240 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
281 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
282 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
283 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
284 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
285 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
286 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
287 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
314 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
315 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
316 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
317 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
318 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
319 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
320 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
321 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
322 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
323 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
324 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
325 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
326 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
327 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
328 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
329 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
330 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
331 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
332 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
333 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
334 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
335 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
336 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
337 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
338 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
339 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
340 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
341 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
342 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
343 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
344 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
345 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
346 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
349 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
350 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
351 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
352 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
353 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
354 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
355 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
356 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
357 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
358 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
359 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
360 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
361 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
362 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
373 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
374 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
380 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 4.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 1.85
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10120710 3300002067 Bacteria 754
2 JGI24744J21845_10004710 3300002077 Bacteria 2817
3 JGI24744J21845_10009003 3300002077 Bacteria 2051
4 JGI24751J29686_10019570 3300002459 Bacteria 1402
5 Ga0006778J45830_1013083 3300003162 Bacteria 587
6 Ga0006778J45830_1091642 3300003162 Bacteria 543
7 Ga0006777J48905_1002824 3300003308 Bacteria 725
8 Ga0006777J48905_1016926 3300003308 Bacteria 1263
9 rootH1_10183607 3300003323 Bacteria 2112
10 Ga0007417J51691_1011400 3300003544 Bacteria 610
11 Ga0007416J51690_1008420 3300003577 Bacteria 941
12 Ga0007416J51690_1081396 3300003577 Unclassified 625
13 Ga0007429J51699_1010111 3300003579 Bacteria 763
14 Ga0007429J51699_1095847 3300003579 Unclassified 931
15 Ga0032354_1046868 3300003693 Unclassified 659
16 Ga0032354_1049471 3300003693 Unclassified 551
17 Ga0032354_1057186 3300003693 Bacteria 1094
18 Ga0058859_11674870 3300004798 Bacteria 557
19 Ga0058863_11581661 3300004799 Bacteria 652
20 Ga0058863_11776965 3300004799 Unclassified 530
21 Ga0058860_10045833 3300004801 Unclassified 658
22 Ga0058860_12154840 3300004801 Bacteria 639
23 Ga0058862_12659472 3300004803 Bacteria 625
24 Ga0065712_10026861 3300005290 Bacteria 1709
25 Ga0065712_10087786 3300005290 Bacteria 2555
26 Ga0065712_10148035 3300005290 Bacteria 1392
27 Ga0065712_10361631 3300005290 Bacteria 774
28 Ga0065715_10230257 3300005293 Bacteria 1232
29 Ga0065715_10704909 3300005293 Unclassified 651
30 Ga0065707_10721520 3300005295 Unclassified 598
31 Ga0065707_10987347 3300005295 Bacteria 517
32 Ga0070658_10012624 3300005327 Bacteria 6776
33 Ga0070658_10029509 3300005327 Bacteria 4407
34 Ga0070658_10062639 3300005327 Bacteria 3031
35 Ga0070658_10126103 3300005327 Bacteria 2131
36 Ga0070658_10229184 3300005327 Bacteria 1573
37 Ga0070658_10280764 3300005327 Bacteria 1417
38 Ga0070658_10459066 3300005327 Bacteria 1098
39 Ga0070658_10516094 3300005327 Bacteria 1033
40 Ga0070658_10550401 3300005327 Bacteria 998
41 Ga0070658_10915549 3300005327 Bacteria 762
42 Ga0070676_10000340 3300005328 Bacteria 21336
43 Ga0070676_10017698 3300005328 Bacteria 3943
44 Ga0070676_10085446 3300005328 Bacteria 1923
45 Ga0070676_10200590 3300005328 Bacteria 1308
46 Ga0070676_10890368 3300005328 Bacteria 662
47 Ga0070676_11246259 3300005328 Bacteria 566
48 Ga0070683_100001004 3300005329 Bacteria 21143
49 Ga0070683_100003956 3300005329 Bacteria 12127
50 Ga0070683_100035848 3300005329 Bacteria 4536
51 Ga0070683_100187047 3300005329 Bacteria 1966
52 Ga0070683_100199184 3300005329 Bacteria 1902
53 Ga0070683_101209375 3300005329 Unclassified 726
54 Ga0070683_101643660 3300005329 Bacteria 618
55 Ga0070683_101765980 3300005329 Unclassified 595
56 Ga0070690_100003006 3300005330 Bacteria 9138
57 Ga0070690_100141322 3300005330 Bacteria 1634
58 Ga0070690_100866033 3300005330 Unclassified 705
59 Ga0070690_101499843 3300005330 Bacteria 545
60 Ga0070690_101512723 3300005330 Unclassified 542
61 Ga0070670_100029206 3300005331 Bacteria 4745
62 Ga0070670_100040999 3300005331 Bacteria 3979
63 Ga0070670_100057109 3300005331 Bacteria 3351
64 Ga0070670_100286752 3300005331 Bacteria 1438
65 Ga0070670_100399657 3300005331 Bacteria 1213
66 Ga0070670_100426281 3300005331 Unclassified 1173
67 Ga0070670_101006189 3300005331 Bacteria 758
68 Ga0070670_101101227 3300005331 Bacteria 724
69 Ga0070677_10022958 3300005333 Bacteria 2304
70 Ga0070677_10707447 3300005333 Bacteria 568
71 Ga0068869_100000814 3300005334 Bacteria 17836
72 Ga0068869_100006000 3300005334 Bacteria 7683
73 Ga0068869_100009437 3300005334 Bacteria 6331
74 Ga0068869_100011329 3300005334 Bacteria 5843
75 Ga0068869_100034895 3300005334 Bacteria 3562
76 Ga0068869_100053625 3300005334 Bacteria 2932
77 Ga0068869_100078925 3300005334 Bacteria 2453
78 Ga0068869_100117581 3300005334 Bacteria 2029
79 Ga0068869_100810229 3300005334 Bacteria 805
80 Ga0068869_101832079 3300005334 Bacteria 543
81 Ga0070666_10018034 3300005335 Bacteria 4531
82 Ga0070666_10047710 3300005335 Bacteria 2876
83 Ga0070666_10392737 3300005335 Unclassified 997
84 Ga0070666_10847220 3300005335 Unclassified 674
85 Ga0070680_100020264 3300005336 Bacteria 5277
86 Ga0070680_100075158 3300005336 Bacteria 2781
87 Ga0070680_100784742 3300005336 Bacteria 821
88 Ga0070680_100958779 3300005336 Unclassified 738
89 Ga0070680_101406973 3300005336 Unclassified 604
90 Ga0070680_101656178 3300005336 Bacteria 554
91 Ga0070682_100012263 3300005337 Bacteria 4909
92 Ga0070682_100015226 3300005337 Bacteria 4453
93 Ga0070682_100126080 3300005337 Bacteria 1726
94 Ga0070682_100485120 3300005337 Bacteria 954
95 Ga0070682_100847295 3300005337 Unclassified 747
96 Ga0070682_101046657 3300005337 Bacteria 680
97 Ga0068868_100001169 3300005338 Bacteria 17976
98 Ga0068868_100005060 3300005338 Bacteria 9257
99 Ga0068868_100025302 3300005338 Bacteria 4513
100 Ga0068868_100159717 3300005338 Bacteria 1861
101 Ga0068868_100189892 3300005338 Bacteria 1708
102 Ga0070660_100055941 3300005339 Bacteria 3051
103 Ga0070660_100106511 3300005339 Bacteria 2227
104 Ga0070660_100142017 3300005339 Unclassified 1927
105 Ga0070660_100164804 3300005339 Bacteria 1787
106 Ga0070660_100167402 3300005339 Bacteria 1774
107 Ga0070660_100341239 3300005339 Bacteria 1233
108 Ga0070660_100739479 3300005339 Unclassified 826
109 Ga0070660_101716378 3300005339 Bacteria 535
110 Ga0070689_100026770 3300005340 Bacteria 4343
111 Ga0070689_100562504 3300005340 Bacteria 984
112 Ga0070689_100573594 3300005340 Bacteria 974
113 Ga0070689_101278567 3300005340 Bacteria 660
114 Ga0070689_101527653 3300005340 Unclassified 605
115 Ga0070687_100088757 3300005343 Bacteria 1705
116 Ga0070687_100421644 3300005343 Bacteria 880
117 Ga0070687_100563885 3300005343 Unclassified 777
118 Ga0070687_100651995 3300005343 Bacteria 730
119 Ga0070687_100972578 3300005343 Unclassified 613
120 Ga0070661_100000922 3300005344 Bacteria 21063
121 Ga0070661_100033516 3300005344 Bacteria 3720
122 Ga0070661_100183306 3300005344 Bacteria 1594
123 Ga0070661_100215522 3300005344 Bacteria 1471
124 Ga0070661_100578471 3300005344 Bacteria 906
125 Ga0070661_101010148 3300005344 Bacteria 690
126 Ga0070661_101285064 3300005344 Bacteria 614
127 Ga0070661_101338823 3300005344 Unclassified 601
128 Ga0070692_10070014 3300005345 Unclassified 1867
129 Ga0070692_11428399 3300005345 Unclassified 500
130 Ga0070668_100017076 3300005347 Bacteria 5430
131 Ga0070668_100082150 3300005347 Bacteria 2527
132 Ga0070668_100258355 3300005347 Bacteria 1448
133 Ga0070668_100347465 3300005347 Bacteria 1254
134 Ga0070668_100437687 3300005347 Bacteria 1122
135 Ga0070668_100844109 3300005347 Bacteria 816
136 Ga0070668_102272089 3300005347 Bacteria 501
137 Ga0070669_100015753 3300005353 Bacteria 5390
138 Ga0070669_100037656 3300005353 Bacteria 3509
139 Ga0070669_100043024 3300005353 Bacteria 3288
140 Ga0070669_100964811 3300005353 Bacteria 730
141 Ga0070675_100031074 3300005354 Bacteria 4316
142 Ga0070675_100046713 3300005354 Unclassified 3547
143 Ga0070675_100075723 3300005354 Bacteria 2797
144 Ga0070675_100348931 3300005354 Bacteria 1312
145 Ga0070675_100610286 3300005354 Unclassified 990
146 Ga0070671_100058203 3300005355 Bacteria 3217
147 Ga0070671_100135511 3300005355 Bacteria 2076
148 Ga0070671_100317391 3300005355 Bacteria 1327
149 Ga0070671_100346544 3300005355 Bacteria 1268
150 Ga0070671_100467074 3300005355 Bacteria 1083
151 Ga0070671_100522016 3300005355 Bacteria 1023
152 Ga0070671_101287338 3300005355 Bacteria 644
153 Ga0070671_101554485 3300005355 Unclassified 586
154 Ga0070674_100008110 3300005356 Bacteria 6232
155 Ga0070674_100021467 3300005356 Bacteria 4146
156 Ga0070674_100147980 3300005356 Bacteria 1769
157 Ga0070674_100188454 3300005356 Bacteria 1585
158 Ga0070673_100017493 3300005364 Bacteria 5100
159 Ga0070673_100020326 3300005364 Bacteria 4788
160 Ga0070673_100022986 3300005364 Bacteria 4548
161 Ga0070673_100023551 3300005364 Bacteria 4500
162 Ga0070673_101553553 3300005364 Bacteria 625
163 Ga0070688_100015010 3300005365 Bacteria 4397
164 Ga0070688_100098477 3300005365 Bacteria 1924
165 Ga0070688_100464982 3300005365 Bacteria 948
166 Ga0070659_100007055 3300005366 Bacteria 8139
167 Ga0070659_100029021 3300005366 Unclassified 4275
168 Ga0070659_100064481 3300005366 Bacteria 2899
169 Ga0070659_100070336 3300005366 Unclassified 2780
170 Ga0070659_100151246 3300005366 Bacteria 1893
171 Ga0070659_100151481 3300005366 Bacteria 1892
172 Ga0070659_100824509 3300005366 Unclassified 808
173 Ga0070659_100855305 3300005366 Bacteria 793
174 Ga0070659_101137156 3300005366 Bacteria 689
175 Ga0070667_100035482 3300005367 Bacteria 4178
176 Ga0070667_100046741 3300005367 Bacteria 3642
177 Ga0070667_100074526 3300005367 Bacteria 2896
178 Ga0070667_100128173 3300005367 Bacteria 2213
179 Ga0070667_100130441 3300005367 Bacteria 2193
180 Ga0070667_100339234 3300005367 Bacteria 1359
181 Ga0070667_100357374 3300005367 Bacteria 1323
182 Ga0070667_100553316 3300005367 Bacteria 1058
183 Ga0070667_101167865 3300005367 Bacteria 720
184 Ga0070667_101361336 3300005367 Unclassified 665
185 Ga0070667_102248834 3300005367 Unclassified 514
186 Ga0070701_10196341 3300005438 Bacteria 1190
187 Ga0070700_100447705 3300005441 Unclassified 982
188 Ga0070663_100012531 3300005455 Bacteria 5368
189 Ga0070663_100290961 3300005455 Unclassified 1305
190 Ga0070663_100417760 3300005455 Bacteria 1100
191 Ga0070663_100761800 3300005455 Bacteria 827
192 Ga0070663_100814180 3300005455 Bacteria 802
193 Ga0070663_101010045 3300005455 Unclassified 724
194 Ga0070663_101461080 3300005455 Unclassified 607
195 Ga0070678_100008073 3300005456 Bacteria 6280
196 Ga0070678_100016088 3300005456 Bacteria 4773
197 Ga0070678_100716497 3300005456 Unclassified 903
198 Ga0070662_100004730 3300005457 Bacteria 8629
199 Ga0070662_100018859 3300005457 Bacteria 4674
200 Ga0070662_100081231 3300005457 Bacteria 2415
201 Ga0070662_100207859 3300005457 Bacteria 1556
202 Ga0070662_100873016 3300005457 Unclassified 767
203 Ga0070681_10051236 3300005458 Bacteria 4117
204 Ga0070681_10061709 3300005458 Bacteria 3722
205 Ga0070681_10116108 3300005458 Bacteria 2614
206 Ga0070681_10211758 3300005458 Bacteria 1854
207 Ga0070681_10332775 3300005458 Bacteria 1428
208 Ga0070681_10865798 3300005458 Bacteria 821
209 Ga0070681_11116016 3300005458 Unclassified 710
210 Ga0068867_100005364 3300005459 Bacteria 9062
211 Ga0068867_100006725 3300005459 Bacteria 8128
212 Ga0068867_100026845 3300005459 Bacteria 4137
213 Ga0068867_100089568 3300005459 Bacteria 2333
214 Ga0068867_100133475 3300005459 Bacteria 1932
215 Ga0068867_101233311 3300005459 Bacteria 688
216 Ga0068867_101983939 3300005459 Unclassified 550
217 Ga0070685_10123019 3300005466 Bacteria 1613
218 Ga0070685_10129128 3300005466 Bacteria 1578
219 Ga0070685_10175524 3300005466 Bacteria 1376
220 Ga0070685_10211790 3300005466 Unclassified 1265
221 Ga0070679_100005664 3300005530 Bacteria 11578
222 Ga0070679_100010208 3300005530 Bacteria 8901
223 Ga0070679_100011076 3300005530 Bacteria 8579
224 Ga0070679_100349398 3300005530 Bacteria 1426
225 Ga0070679_102080695 3300005530 Unclassified 517
226 Ga0070684_100000042 3300005535 Bacteria 89896
227 Ga0070684_100001194 3300005535 Bacteria 18651
228 Ga0070684_100005415 3300005535 Bacteria 9778
229 Ga0070684_100126335 3300005535 Bacteria 2304
230 Ga0070684_100390623 3300005535 Bacteria 1282
231 Ga0070684_100472027 3300005535 Bacteria 1161
232 Ga0070684_100547671 3300005535 Bacteria 1074
233 Ga0070684_100767332 3300005535 Bacteria 901
234 Ga0070684_101349609 3300005535 Bacteria 671
235 Ga0070684_101548916 3300005535 Unclassified 625
236 Ga0068853_100003672 3300005539 Bacteria 11770
237 Ga0068853_100010717 3300005539 Bacteria 7424
238 Ga0068853_100016724 3300005539 Bacteria 6041
239 Ga0068853_100062299 3300005539 Bacteria 3227
240 Ga0068853_100066698 3300005539 Bacteria 3126
241 Ga0068853_100447405 3300005539 Bacteria 1215
242 Ga0068853_100457503 3300005539 Bacteria 1201
243 Ga0068853_100462983 3300005539 Bacteria 1193
244 Ga0068853_100549427 3300005539 Bacteria 1094
245 Ga0068853_100578372 3300005539 Bacteria 1066
246 Ga0068853_100733003 3300005539 Bacteria 944
247 Ga0068853_101491640 3300005539 Bacteria 655
248 Ga0068853_102026212 3300005539 Unclassified 558
249 Ga0068853_102215898 3300005539 Bacteria 533
250 Ga0070672_100133825 3300005543 Bacteria 2040
251 Ga0070672_100139675 3300005543 Bacteria 1997
252 Ga0070672_100309927 3300005543 Bacteria 1340
253 Ga0070672_100347138 3300005543 Bacteria 1265
254 Ga0070672_100506644 3300005543 Unclassified 1045
255 Ga0070672_100546229 3300005543 Bacteria 1006
256 Ga0070672_100699958 3300005543 Unclassified 887
257 Ga0070672_101194824 3300005543 Bacteria 677
258 Ga0070686_100484062 3300005544 Bacteria 957
259 Ga0070686_100900636 3300005544 Unclassified 720
260 Ga0070665_100025483 3300005548 Bacteria 5957
261 Ga0070665_100030076 3300005548 Bacteria 5465
262 Ga0070665_100599352 3300005548 Bacteria 1115
263 Ga0068855_100008676 3300005563 Bacteria 12284
264 Ga0068855_100013610 3300005563 Bacteria 9809
265 Ga0068855_100033717 3300005563 Bacteria 6108
266 Ga0068855_100433331 3300005563 Bacteria 1437
267 Ga0068855_100613771 3300005563 Bacteria 1172
268 Ga0068855_100895013 3300005563 Bacteria 938
269 Ga0068855_101002585 3300005563 Bacteria 877
270 Ga0068855_101014320 3300005563 Bacteria 871
271 Ga0068855_102346774 3300005563 Bacteria 533
272 Ga0070664_100000266 3300005564 Bacteria 37671
273 Ga0070664_100087741 3300005564 Bacteria 2690
274 Ga0070664_100115621 3300005564 Unclassified 2345
275 Ga0070664_100263733 3300005564 Bacteria 1550
276 Ga0070664_100880505 3300005564 Bacteria 839
277 Ga0070664_100887865 3300005564 Bacteria 835
278 Ga0070664_100907853 3300005564 Bacteria 826
279 Ga0070664_101246263 3300005564 Bacteria 702
280 Ga0068857_100006612 3300005577 Bacteria 9955
281 Ga0068857_100180869 3300005577 Bacteria 1919
282 Ga0068857_100257661 3300005577 Bacteria 1600
283 Ga0068857_100328705 3300005577 Bacteria 1413
284 Ga0068857_100400512 3300005577 Bacteria 1277
285 Ga0068857_100702373 3300005577 Bacteria 961
286 Ga0068857_101368862 3300005577 Unclassified 688
287 Ga0068854_100021292 3300005578 Bacteria 4399
288 Ga0068854_100100913 3300005578 Bacteria 2164
289 Ga0068854_100139820 3300005578 Bacteria 1857
290 Ga0068854_100245718 3300005578 Unclassified 1427
291 Ga0068854_100314063 3300005578 Bacteria 1272
292 Ga0068854_101101763 3300005578 Bacteria 707
293 Ga0068854_101476586 3300005578 Bacteria 617
294 Ga0068854_101557294 3300005578 Bacteria 601
295 Ga0068854_102136890 3300005578 Bacteria 517
296 Ga0068854_102263412 3300005578 Unclassified 503
297 Ga0068856_100254908 3300005614 Bacteria 1769
298 Ga0068856_100446120 3300005614 Bacteria 1314
299 Ga0068856_101871833 3300005614 Bacteria 611
300 Ga0068856_102570338 3300005614 Bacteria 515
301 Ga0070702_100195072 3300005615 Bacteria 1336
302 Ga0070702_100234415 3300005615 Bacteria 1235
303 Ga0070702_100463752 3300005615 Unclassified 922
304 Ga0070702_100775468 3300005615 Bacteria 739
305 Ga0070702_101641100 3300005615 Bacteria 533
306 Ga0068852_100000454 3300005616 Bacteria 27039
307 Ga0068852_100028526 3300005616 Bacteria 4570
308 Ga0068852_100029241 3300005616 Bacteria 4524
309 Ga0068852_100045606 3300005616 Bacteria 3730
310 Ga0068852_100045652 3300005616 Bacteria 3728
311 Ga0068852_100151694 3300005616 Unclassified 2156
312 Ga0068852_100176471 3300005616 Bacteria 2006
313 Ga0068852_100186123 3300005616 Unclassified 1956
314 Ga0068852_100447777 3300005616 Bacteria 1278
315 Ga0068852_100888601 3300005616 Bacteria 908
316 Ga0068852_101703159 3300005616 Bacteria 653
317 Ga0068852_101742132 3300005616 Unclassified 645
318 Ga0068852_101898050 3300005616 Unclassified 618
319 Ga0068852_101908904 3300005616 Unclassified 616
320 Ga0068859_100012944 3300005617 Bacteria 8382
321 Ga0068859_100016137 3300005617 Bacteria 7501
322 Ga0068859_100016352 3300005617 Bacteria 7453
323 Ga0068859_100039683 3300005617 Bacteria 4724
324 Ga0068859_100064024 3300005617 Bacteria 3709
325 Ga0068859_100082452 3300005617 Bacteria 3259
326 Ga0068859_100806587 3300005617 Bacteria 1026
327 Ga0068859_100934465 3300005617 Bacteria 951
328 Ga0068864_100038571 3300005618 Bacteria 4081
329 Ga0068864_100048935 3300005618 Bacteria 3635
330 Ga0068864_100082813 3300005618 Bacteria 2816
331 Ga0068864_100260246 3300005618 Bacteria 1614
332 Ga0068864_100733675 3300005618 Bacteria 967
333 Ga0068864_101199275 3300005618 Bacteria 757
334 Ga0068864_101635732 3300005618 Unclassified 648
335 Ga0068866_10010298 3300005718 Bacteria 4004
336 Ga0068866_10021202 3300005718 Bacteria 2991
337 Ga0068866_10023585 3300005718 Bacteria 2865
338 Ga0068866_10079389 3300005718 Bacteria 1758
339 Ga0068866_10335842 3300005718 Bacteria 955
340 Ga0068861_100051333 3300005719 Bacteria 3130
341 Ga0068861_100073767 3300005719 Bacteria 2652
342 Ga0068861_100120249 3300005719 Bacteria 2118
343 Ga0068861_100161242 3300005719 Bacteria 1850
344 Ga0068861_100279444 3300005719 Bacteria 1437
345 Ga0068861_100413833 3300005719 Unclassified 1200
346 Ga0068861_100818533 3300005719 Bacteria 875
347 Ga0068861_100841951 3300005719 Bacteria 864
348 Ga0068861_100938749 3300005719 Bacteria 822
349 Ga0068851_10014708 3300005834 Bacteria 3719
350 Ga0068851_10050055 3300005834 Bacteria 2121
351 Ga0068851_10772991 3300005834 Bacteria 595
352 Ga0068851_10777152 3300005834 Unclassified 594
353 Ga0068870_10016162 3300005840 Bacteria 3559
354 Ga0068870_10041994 3300005840 Bacteria 2379
355 Ga0068870_10159345 3300005840 Bacteria 1337
356 Ga0068870_10280578 3300005840 Bacteria 1044
357 Ga0068870_10943574 3300005840 Bacteria 612
358 Ga0068863_100029026 3300005841 Bacteria 5284
359 Ga0068863_100090425 3300005841 Bacteria 2902
360 Ga0068863_100448448 3300005841 Bacteria 1266
361 Ga0068863_100630713 3300005841 Bacteria 1062
362 Ga0068863_100694585 3300005841 Bacteria 1011
363 Ga0068858_100012456 3300005842 Bacteria 8019
364 Ga0068858_100187834 3300005842 Bacteria 1952
365 Ga0068858_100532078 3300005842 Bacteria 1137
366 Ga0068858_101198172 3300005842 Bacteria 746
367 Ga0068858_101373923 3300005842 Bacteria 696
368 Ga0068858_101602774 3300005842 Bacteria 642
369 Ga0068860_100023035 3300005843 Bacteria 6023
370 Ga0068860_100062721 3300005843 Bacteria 3532
371 Ga0068860_100097098 3300005843 Bacteria 2809
372 Ga0068860_100189317 3300005843 Bacteria 1991
373 Ga0068860_100307542 3300005843 Bacteria 1554
374 Ga0068860_100532188 3300005843 Unclassified 1176
375 Ga0068860_100953218 3300005843 Bacteria 875
376 Ga0068860_101590741 3300005843 Bacteria 675
377 Ga0068860_102002419 3300005843 Bacteria 601
378 Ga0068862_100011150 3300005844 Bacteria 7421
379 Ga0068862_100059921 3300005844 Bacteria 3270
380 Ga0068862_100098588 3300005844 Unclassified 2553
381 Ga0068862_100799465 3300005844 Bacteria 921
382 Ga0068862_100919936 3300005844 Bacteria 861
383 Ga0068862_101029043 3300005844 Bacteria 816
384 Ga0070717_11521271 3300006028 Bacteria 607
385 Ga0070715_10078967 3300006163 Bacteria 1489
386 Ga0070715_10647350 3300006163 Bacteria 625
387 Ga0075366_10040177 3300006195 Bacteria 2767
388 Ga0075366_10049611 3300006195 Bacteria 2491
389 Ga0097621_100007404 3300006237 Bacteria 7850
390 Ga0097621_100120076 3300006237 Bacteria 2228
391 Ga0097621_100538930 3300006237 Unclassified 1061
392 Ga0097621_100890285 3300006237 Bacteria 829
393 Ga0068871_100054184 3300006358 Bacteria 3253
394 Ga0068871_100487356 3300006358 Bacteria 1110
395 Ga0068871_100537308 3300006358 Bacteria 1057
396 Ga0068871_100704530 3300006358 Bacteria 925
397 Ga0068871_101187381 3300006358 Unclassified 715
398 Ga0068871_102118768 3300006358 Bacteria 536
399 Ga0075428_100638233 3300006844 Bacteria 1136
400 Ga0075434_100162609 3300006871 Bacteria 2252
401 Ga0075434_101171273 3300006871 Unclassified 781
402 Ga0075434_101974918 3300006871 Unclassified 589
403 Ga0068865_100019851 3300006881 Bacteria 4352
404 Ga0068865_100274456 3300006881 Bacteria 1340
405 Ga0068865_100305863 3300006881 Bacteria 1274
406 Ga0068865_100357204 3300006881 Bacteria 1185
407 Ga0068865_100379802 3300006881 Bacteria 1152
408 Ga0097620_100012943 3300006931 Bacteria 8382
409 Ga0097620_100016137 3300006931 Bacteria 7501
410 Ga0097620_100016353 3300006931 Bacteria 7453
411 Ga0097620_100039681 3300006931 Bacteria 4724
412 Ga0097620_100064027 3300006931 Bacteria 3709
413 Ga0097620_100082448 3300006931 Bacteria 3259
414 Ga0097620_100806637 3300006931 Bacteria 1026
415 Ga0097620_100934328 3300006931 Bacteria 951
416 Ga0105251_10045746 3300009011 Unclassified 2109
417 Ga0105240_10152474 3300009093 Bacteria 2751
418 Ga0105240_10850041 3300009093 Bacteria 985
419 Ga0111539_10052316 3300009094 Unclassified 4861
420 Ga0105245_11105189 3300009098 Bacteria 839
421 Ga0105247_10002375 3300009101 Bacteria 12826
422 Ga0105247_10935152 3300009101 Unclassified 672
423 Ga0114129_10239923 3300009147 Bacteria 2437
424 Ga0105243_10758784 3300009148 Bacteria 952
425 Ga0105241_10004448 3300009174 Bacteria 10363
426 Ga0105241_10064271 3300009174 Bacteria 2833
427 Ga0105241_10160475 3300009174 Bacteria 1848
428 Ga0105241_10826120 3300009174 Unclassified 855
429 Ga0105241_10896292 3300009174 Unclassified 823
430 Ga0105241_11318747 3300009174 Unclassified 688
431 Ga0105241_11387541 3300009174 Bacteria 672
432 Ga0105241_11454418 3300009174 Bacteria 658
433 Ga0105242_10012464 3300009176 Bacteria 6546
434 Ga0105242_10023748 3300009176 Bacteria 4835
435 Ga0105242_10152188 3300009176 Unclassified 2018
436 Ga0105242_10338183 3300009176 Bacteria 1386
437 Ga0105242_10350791 3300009176 Bacteria 1363
438 Ga0105242_10972450 3300009176 Bacteria 855
439 Ga0105242_12246589 3300009176 Bacteria 591
440 Ga0105248_10751547 3300009177 Bacteria 1100
441 Ga0105248_11834692 3300009177 Bacteria 688
442 Ga0105248_11895292 3300009177 Bacteria 676
443 Ga0105237_10016034 3300009545 Bacteria 7791
444 Ga0105237_10235089 3300009545 Bacteria 1834
445 Ga0105237_10465390 3300009545 Bacteria 1270
446 Ga0105238_11202961 3300009551 Unclassified 782
447 Ga0105238_11638829 3300009551 Unclassified 674
448 Ga0105249_10015985 3300009553 Bacteria 6652
449 Ga0105249_10061023 3300009553 Bacteria 3460
450 Ga0105249_10070285 3300009553 Bacteria 3231
451 Ga0105249_10077543 3300009553 Bacteria 3082
452 Ga0105249_10204206 3300009553 Bacteria 1935
453 Ga0105249_10406175 3300009553 Bacteria 1393
454 Ga0105249_10460531 3300009553 Bacteria 1312
455 Ga0105249_10620684 3300009553 Bacteria 1137
456 Ga0105249_10935094 3300009553 Bacteria 934
457 Ga0105249_10997775 3300009553 Bacteria 906
458 Ga0105249_11483727 3300009553 Bacteria 750
459 Ga0105249_11925922 3300009553 Unclassified 664
460 Ga0105239_10073188 3300010375 Bacteria 3767
461 Ga0105239_10631921 3300010375 Bacteria 1222
462 Ga0105239_10691313 3300010375 Bacteria 1166
463 Ga0105239_10878834 3300010375 Unclassified 1028
464 Ga0105239_12981080 3300010375 Bacteria 552
465 Ga0105246_10173321 3300011119 Bacteria 1654
466 Ga0105246_10209132 3300011119 Bacteria 1522
467 Ga0105246_12116545 3300011119 Bacteria 546
468 Ga0157373_10000592 3300013100 Bacteria 28163
469 Ga0157373_10021014 3300013100 Bacteria 4738
470 Ga0157373_10025954 3300013100 Bacteria 4234
471 Ga0157373_10028988 3300013100 Bacteria 3991
472 Ga0157373_10038167 3300013100 Bacteria 3443
473 Ga0157373_10062105 3300013100 Bacteria 2646
474 Ga0157373_10249750 3300013100 Unclassified 1255
475 Ga0157373_10249987 3300013100 Unclassified 1254
476 Ga0157373_10516337 3300013100 Bacteria 864
477 Ga0157373_10985261 3300013100 Bacteria 628
478 Ga0157373_10988032 3300013100 Bacteria 628
479 Ga0157373_11157404 3300013100 Unclassified 582
480 Ga0157373_11353516 3300013100 Bacteria 540
481 Ga0157371_10003403 3300013102 Bacteria 14452
482 Ga0157371_10004188 3300013102 Bacteria 12709
483 Ga0157371_10011420 3300013102 Bacteria 6843
484 Ga0157371_10014159 3300013102 Bacteria 6030
485 Ga0157371_10015346 3300013102 Bacteria 5749
486 Ga0157371_10050178 3300013102 Bacteria 2964
487 Ga0157371_10064214 3300013102 Bacteria 2601
488 Ga0157371_10077105 3300013102 Bacteria 2360
489 Ga0157371_10127238 3300013102 Bacteria 1812
490 Ga0157371_10181644 3300013102 Bacteria 1504
491 Ga0157371_10184865 3300013102 Unclassified 1491
492 Ga0157371_10190841 3300013102 Bacteria 1467
493 Ga0157371_10274888 3300013102 Bacteria 1216
494 Ga0157371_10283163 3300013102 Bacteria 1198
495 Ga0157371_10512720 3300013102 Bacteria 886
496 Ga0157371_10586172 3300013102 Bacteria 829
497 Ga0157371_10588824 3300013102 Bacteria 827
498 Ga0157371_11042238 3300013102 Bacteria 625
499 Ga0157370_10002668 3300013104 Bacteria 21394
500 Ga0157370_10006362 3300013104 Bacteria 13037
501 Ga0157370_10008665 3300013104 Bacteria 10947
502 Ga0157370_10008795 3300013104 Bacteria 10848
503 Ga0157370_10186464 3300013104 Bacteria 1926
504 Ga0157370_11114771 3300013104 Bacteria 713
505 Ga0157370_11339363 3300013104 Unclassified 645
506 Ga0157370_11736182 3300013104 Bacteria 560
507 Ga0157370_11747254 3300013104 Bacteria 558
508 Ga0157370_11847793 3300013104 Bacteria 542
509 Ga0157369_10004162 3300013105 Bacteria 17136
510 Ga0157369_10009198 3300013105 Bacteria 11303
511 Ga0157369_10019866 3300013105 Bacteria 7515
512 Ga0157369_10064958 3300013105 Bacteria 3930
513 Ga0157369_10223125 3300013105 Unclassified 1972
514 Ga0157369_10398377 3300013105 Bacteria 1428
515 Ga0157369_10529562 3300013105 Bacteria 1219
516 Ga0157369_10757503 3300013105 Bacteria 999
517 Ga0157369_10894349 3300013105 Bacteria 911
518 Ga0157369_11093559 3300013105 Bacteria 815
519 Ga0157369_11831780 3300013105 Unclassified 616
520 Ga0157374_10003156 3300013296 Bacteria 13854
521 Ga0157374_10014456 3300013296 Bacteria 6907
522 Ga0157374_10061563 3300013296 Bacteria 3516
523 Ga0157374_10062669 3300013296 Unclassified 3486
524 Ga0157374_10259932 3300013296 Bacteria 1710
525 Ga0157374_10415942 3300013296 Bacteria 1343
526 Ga0157374_10567574 3300013296 Bacteria 1143
527 Ga0157374_11647093 3300013296 Bacteria 666
528 Ga0157374_11678788 3300013296 Bacteria 660
529 Ga0157374_12494395 3300013296 Bacteria 544
530 Ga0157378_10072175 3300013297 Bacteria 3102
531 Ga0157378_10104662 3300013297 Bacteria 2587
532 Ga0157378_10119493 3300013297 Bacteria 2427
533 Ga0157378_10151173 3300013297 Bacteria 2163
534 Ga0157378_10237073 3300013297 Bacteria 1741
535 Ga0157378_10539166 3300013297 Bacteria 1171
536 Ga0157378_10553446 3300013297 Bacteria 1156
537 Ga0157378_10756599 3300013297 Bacteria 995
538 Ga0157378_10759312 3300013297 Unclassified 993
539 Ga0157378_11252948 3300013297 Bacteria 782
540 Ga0157378_11468733 3300013297 Bacteria 726
541 Ga0163162_10012546 3300013306 Bacteria 8276
542 Ga0163162_10014394 3300013306 Bacteria 7730
543 Ga0163162_10022713 3300013306 Bacteria 6185
544 Ga0163162_10024304 3300013306 Bacteria 5980
545 Ga0163162_10238238 3300013306 Bacteria 1950
546 Ga0163162_10474200 3300013306 Bacteria 1383
547 Ga0163162_10556412 3300013306 Unclassified 1275
548 Ga0163162_11303811 3300013306 Bacteria 825
549 Ga0163162_11992315 3300013306 Bacteria 665
550 Ga0163162_12936613 3300013306 Unclassified 548
551 Ga0157372_10009464 3300013307 Bacteria 10362
552 Ga0157372_10023397 3300013307 Bacteria 6696
553 Ga0157372_10025178 3300013307 Bacteria 6467
554 Ga0157372_10032959 3300013307 Bacteria 5686
555 Ga0157372_10049169 3300013307 Bacteria 4688
556 Ga0157372_10108205 3300013307 Bacteria 3181
557 Ga0157372_10124997 3300013307 Bacteria 2957
558 Ga0157372_10172006 3300013307 Bacteria 2506
559 Ga0157372_10202576 3300013307 Unclassified 2299
560 Ga0157372_10285220 3300013307 Bacteria 1920
561 Ga0157372_10372015 3300013307 Bacteria 1665
562 Ga0157372_10394828 3300013307 Unclassified 1612
563 Ga0157372_10428568 3300013307 Bacteria 1542
564 Ga0157372_10520690 3300013307 Bacteria 1386
565 Ga0157372_10530484 3300013307 Bacteria 1372
566 Ga0157372_10601330 3300013307 Bacteria 1282
567 Ga0157372_10653775 3300013307 Bacteria 1224
568 Ga0157372_10711445 3300013307 Bacteria 1169
569 Ga0157372_10720938 3300013307 Bacteria 1160
570 Ga0157372_10784638 3300013307 Bacteria 1107
571 Ga0157372_10797009 3300013307 Bacteria 1098
572 Ga0157372_10998344 3300013307 Unclassified 969
573 Ga0157372_11106433 3300013307 Bacteria 916
574 Ga0157372_11114117 3300013307 Bacteria 913
575 Ga0157372_11174214 3300013307 Bacteria 887
576 Ga0157372_11296358 3300013307 Unclassified 841
577 Ga0157372_11486242 3300013307 Bacteria 781
578 Ga0157372_11895544 3300013307 Bacteria 685
579 Ga0157372_12513893 3300013307 Bacteria 591
580 Ga0157375_10010150 3300013308 Bacteria 8284
581 Ga0157375_10091006 3300013308 Unclassified 3111
582 Ga0157375_10174426 3300013308 Bacteria 2299
583 Ga0157375_10234365 3300013308 Bacteria 1995
584 Ga0157375_10332365 3300013308 Bacteria 1685
585 Ga0157375_11340750 3300013308 Bacteria 842
586 Ga0157375_11374148 3300013308 Unclassified 832
587 Ga0157375_11401390 3300013308 Bacteria 823
588 Ga0157375_11551831 3300013308 Bacteria 782
589 Ga0163163_10001563 3300014325 Bacteria 19320
590 Ga0163163_10004743 3300014325 Bacteria 11653
591 Ga0163163_10309897 3300014325 Bacteria 1631
592 Ga0163163_10385178 3300014325 Bacteria 1460
593 Ga0163163_10650339 3300014325 Bacteria 1118
594 Ga0163163_10731420 3300014325 Bacteria 1053
595 Ga0163163_11037756 3300014325 Bacteria 883
596 Ga0163163_11482249 3300014325 Bacteria 740
597 Ga0157380_10024118 3300014326 Bacteria 4599
598 Ga0157380_10492957 3300014326 Bacteria 1188
599 Ga0157380_10744334 3300014326 Bacteria 991
600 Ga0157380_11603831 3300014326 Bacteria 706
601 Ga0157380_12055440 3300014326 Unclassified 634
602 Ga0157380_12181888 3300014326 Bacteria 617
603 Ga0157377_10017170 3300014745 Bacteria 3739
604 Ga0157377_10018690 3300014745 Bacteria 3606
605 Ga0157377_10094906 3300014745 Bacteria 1767
606 Ga0157377_10864936 3300014745 Bacteria 673
607 Ga0157379_10047219 3300014968 Bacteria 3841
608 Ga0157379_10055113 3300014968 Bacteria 3553
609 Ga0157379_10114814 3300014968 Bacteria 2420
610 Ga0157379_10295217 3300014968 Bacteria 1476
611 Ga0157376_10022781 3300014969 Bacteria 4890
612 Ga0157376_10198238 3300014969 Unclassified 1845
613 Ga0157376_10217360 3300014969 Bacteria 1768
614 Ga0157376_10631607 3300014969 Bacteria 1069
615 Ga0157376_10632617 3300014969 Bacteria 1068
616 Ga0157376_11151127 3300014969 Bacteria 803
617 Ga0157376_12362432 3300014969 Unclassified 571
618 Ga0157376_12655559 3300014969 Bacteria 541
619 Ga0182005_1073270 3300015265 Bacteria 941
620 Ga0163161_10224584 3300017792 Bacteria 1455
621 Ga0163161_10823061 3300017792 Unclassified 782
622 Ga0163161_11476468 3300017792 Bacteria 596
623 Ga0206356_10994341 3300020070 Bacteria 509
624 Ga0206356_11687923 3300020070 Bacteria 563
625 Ga0206349_1377899 3300020075 Bacteria 501
626 Ga0206351_10974334 3300020077 Unclassified 521
627 Ga0206352_10819092 3300020078 Bacteria 942
628 Ga0206350_10633921 3300020080 Bacteria 505
629 Ga0206350_11141334 3300020080 Unclassified 662
630 Ga0206350_11435478 3300020080 Unclassified 538
631 Ga0206350_11624967 3300020080 Bacteria 557
632 Ga0206350_11654957 3300020080 Bacteria 567
633 Ga0206354_10173907 3300020081 Bacteria 543
634 Ga0206354_10273940 3300020081 Bacteria 797
635 Ga0206353_11167834 3300020082 Bacteria 581
636 Ga0206353_11715051 3300020082 Unclassified 506
637 Ga0224712_10545855 3300022467 Bacteria 563
638 Ga0207666_1015809 3300025271 Unclassified 1078
639 Ga0207673_1025405 3300025290 Unclassified 810
640 Ga0207697_10021574 3300025315 Bacteria 2636
641 Ga0207697_10033727 3300025315 Bacteria 2095
642 Ga0207697_10311372 3300025315 Unclassified 699
643 Ga0207656_10056099 3300025321 Bacteria 1716
644 Ga0207656_10237043 3300025321 Unclassified 891
645 Ga0207656_10241468 3300025321 Unclassified 883
646 Ga0207682_10029024 3300025893 Bacteria 2211
647 Ga0207682_10102376 3300025893 Bacteria 1253
648 Ga0207682_10367146 3300025893 Bacteria 679
649 Ga0207682_10568521 3300025893 Unclassified 535
650 Ga0207642_10004344 3300025899 Unclassified 4569
651 Ga0207642_10004642 3300025899 Bacteria 4438
652 Ga0207642_10061353 3300025899 Bacteria 1748
653 Ga0207642_10103122 3300025899 Bacteria 1436
654 Ga0207642_11144001 3300025899 Unclassified 504
655 Ga0207710_10006643 3300025900 Bacteria 4930
656 Ga0207688_10058350 3300025901 Bacteria 2172
657 Ga0207688_10468924 3300025901 Bacteria 786
658 Ga0207680_10032788 3300025903 Bacteria 2956
659 Ga0207680_10267887 3300025903 Bacteria 1184
660 Ga0207647_10013718 3300025904 Bacteria 5611
661 Ga0207647_10056774 3300025904 Bacteria 2401
662 Ga0207647_10104095 3300025904 Bacteria 1682
663 Ga0207685_10498195 3300025905 Unclassified 641
664 Ga0207645_10001491 3300025907 Bacteria 19131
665 Ga0207645_10004909 3300025907 Bacteria 9808
666 Ga0207645_10023123 3300025907 Bacteria 4040
667 Ga0207645_10154585 3300025907 Bacteria 1498
668 Ga0207645_10400899 3300025907 Bacteria 922
669 Ga0207645_11000735 3300025907 Bacteria 566
670 Ga0207643_10009019 3300025908 Bacteria 5355
671 Ga0207643_10054565 3300025908 Bacteria 2272
672 Ga0207643_10164151 3300025908 Bacteria 1337
673 Ga0207643_10248003 3300025908 Bacteria 1096
674 Ga0207643_10307580 3300025908 Bacteria 987
675 Ga0207705_10009398 3300025909 Bacteria 7110
676 Ga0207705_10026600 3300025909 Bacteria 4124
677 Ga0207705_10048712 3300025909 Bacteria 3049
678 Ga0207705_10208676 3300025909 Bacteria 1481
679 Ga0207705_10209406 3300025909 Bacteria 1479
680 Ga0207705_10216366 3300025909 Bacteria 1454
681 Ga0207705_10283595 3300025909 Bacteria 1268
682 Ga0207705_10295685 3300025909 Bacteria 1241
683 Ga0207705_10619018 3300025909 Bacteria 842
684 Ga0207654_10272411 3300025911 Bacteria 1142
685 Ga0207654_10373832 3300025911 Bacteria 986
686 Ga0207654_10419197 3300025911 Bacteria 934
687 Ga0207654_10697594 3300025911 Unclassified 729
688 Ga0207654_10806615 3300025911 Bacteria 678
689 Ga0207707_10124335 3300025912 Bacteria 2256
690 Ga0207707_10188789 3300025912 Bacteria 1798
691 Ga0207707_10324338 3300025912 Bacteria 1329
692 Ga0207707_10535864 3300025912 Bacteria 996
693 Ga0207695_10082168 3300025913 Bacteria 3259
694 Ga0207695_10311100 3300025913 Bacteria 1465
695 Ga0207671_11330761 3300025914 Bacteria 559
696 Ga0207660_10007763 3300025917 Bacteria 6946
697 Ga0207660_10029630 3300025917 Bacteria 3757
698 Ga0207660_10098800 3300025917 Bacteria 2178
699 Ga0207660_11344277 3300025917 Unclassified 580
700 Ga0207657_10005870 3300025919 Bacteria 12791
701 Ga0207657_10017331 3300025919 Bacteria 6911
702 Ga0207657_10057007 3300025919 Bacteria 3369
703 Ga0207657_10081676 3300025919 Bacteria 2714
704 Ga0207657_10089484 3300025919 Bacteria 2571
705 Ga0207657_10185647 3300025919 Unclassified 1679
706 Ga0207657_10215296 3300025919 Bacteria 1540
707 Ga0207649_10000644 3300025920 Bacteria 23288
708 Ga0207649_10385775 3300025920 Bacteria 1045
709 Ga0207649_10461186 3300025920 Bacteria 961
710 Ga0207649_10601197 3300025920 Bacteria 846
711 Ga0207652_10000010 3300025921 Bacteria 247079
712 Ga0207652_10000844 3300025921 Bacteria 29188
713 Ga0207652_10007238 3300025921 Bacteria 8939
714 Ga0207652_10021217 3300025921 Bacteria 5360
715 Ga0207652_10032135 3300025921 Bacteria 4408
716 Ga0207652_10059056 3300025921 Bacteria 3306
717 Ga0207652_11649498 3300025921 Unclassified 546
718 Ga0207681_10003840 3300025923 Bacteria 9323
719 Ga0207681_10065387 3300025923 Bacteria 2514
720 Ga0207681_10080903 3300025923 Bacteria 2292
721 Ga0207681_10425614 3300025923 Bacteria 1076
722 Ga0207681_10958497 3300025923 Unclassified 717
723 Ga0207681_11020514 3300025923 Bacteria 694
724 Ga0207650_10002472 3300025925 Bacteria 12853
725 Ga0207650_10013869 3300025925 Bacteria 5590
726 Ga0207650_10062858 3300025925 Unclassified 2774
727 Ga0207650_10108938 3300025925 Bacteria 2142
728 Ga0207650_10167710 3300025925 Bacteria 1743
729 Ga0207650_10459239 3300025925 Bacteria 1061
730 Ga0207650_10762865 3300025925 Bacteria 819
731 Ga0207650_11031792 3300025925 Bacteria 700
732 Ga0207650_11298831 3300025925 Bacteria 619
733 Ga0207650_11694504 3300025925 Unclassified 536
734 Ga0207650_11716284 3300025925 Unclassified 532
735 Ga0207659_10072911 3300025926 Bacteria 2512
736 Ga0207659_10139502 3300025926 Bacteria 1881
737 Ga0207659_10228918 3300025926 Unclassified 1498
738 Ga0207659_10307732 3300025926 Bacteria 1304
739 Ga0207644_10085680 3300025931 Bacteria 2338
740 Ga0207644_10114518 3300025931 Bacteria 2043
741 Ga0207644_10126372 3300025931 Bacteria 1952
742 Ga0207644_10178954 3300025931 Bacteria 1661
743 Ga0207644_10635799 3300025931 Unclassified 887
744 Ga0207690_10006232 3300025932 Bacteria 7060
745 Ga0207690_10023922 3300025932 Bacteria 3820
746 Ga0207690_10050038 3300025932 Unclassified 2788
747 Ga0207690_10072678 3300025932 Bacteria 2376
748 Ga0207690_11599811 3300025932 Bacteria 544
749 Ga0207706_10023357 3300025933 Bacteria 5553
750 Ga0207706_10027153 3300025933 Bacteria 5120
751 Ga0207706_10032203 3300025933 Bacteria 4669
752 Ga0207706_10043173 3300025933 Bacteria 3996
753 Ga0207706_10079253 3300025933 Bacteria 2888
754 Ga0207706_10124679 3300025933 Bacteria 2266
755 Ga0207706_10488731 3300025933 Bacteria 1063
756 Ga0207686_10091395 3300025934 Bacteria 2010
757 Ga0207686_10144137 3300025934 Bacteria 1650
758 Ga0207686_10415035 3300025934 Bacteria 1028
759 Ga0207686_10617505 3300025934 Bacteria 855
760 Ga0207686_10722194 3300025934 Bacteria 793
761 Ga0207686_10889760 3300025934 Bacteria 718
762 Ga0207709_10780416 3300025935 Unclassified 770
763 Ga0207670_10214606 3300025936 Unclassified 1469
764 Ga0207670_11002599 3300025936 Unclassified 703
765 Ga0207670_11356876 3300025936 Unclassified 603
766 Ga0207670_11588139 3300025936 Unclassified 556
767 Ga0207669_10060773 3300025937 Bacteria 2318
768 Ga0207669_10083926 3300025937 Bacteria 2050
769 Ga0207669_10092169 3300025937 Bacteria 1976
770 Ga0207669_10170167 3300025937 Bacteria 1550
771 Ga0207704_10098240 3300025938 Bacteria 1944
772 Ga0207704_10164213 3300025938 Bacteria 1584
773 Ga0207704_10181946 3300025938 Bacteria 1520
774 Ga0207704_10246611 3300025938 Bacteria 1338
775 Ga0207704_11624245 3300025938 Bacteria 555
776 Ga0207704_11682442 3300025938 Bacteria 545
777 Ga0207691_10009018 3300025940 Bacteria 9565
778 Ga0207691_10159330 3300025940 Bacteria 1981
779 Ga0207691_10174361 3300025940 Bacteria 1882
780 Ga0207691_10191807 3300025940 Bacteria 1782
781 Ga0207691_10286766 3300025940 Bacteria 1416
782 Ga0207691_10392947 3300025940 Bacteria 1183
783 Ga0207691_10499520 3300025940 Bacteria 1033
784 Ga0207711_10267123 3300025941 Bacteria 1573
785 Ga0207689_10001227 3300025942 Bacteria 24647
786 Ga0207689_10001306 3300025942 Bacteria 24017
787 Ga0207689_10005140 3300025942 Bacteria 11766
788 Ga0207689_10008581 3300025942 Bacteria 8905
789 Ga0207689_10015923 3300025942 Bacteria 6366
790 Ga0207689_10032199 3300025942 Bacteria 4361
791 Ga0207689_10059258 3300025942 Bacteria 3149
792 Ga0207689_10067810 3300025942 Bacteria 2932
793 Ga0207689_10121552 3300025942 Unclassified 2148
794 Ga0207689_10854575 3300025942 Bacteria 768
795 Ga0207661_10000781 3300025944 Bacteria 20721
796 Ga0207661_10008250 3300025944 Bacteria 7439
797 Ga0207661_10161528 3300025944 Bacteria 1944
798 Ga0207661_10325833 3300025944 Bacteria 1382
799 Ga0207661_10568366 3300025944 Bacteria 1040
800 Ga0207661_11630255 3300025944 Unclassified 590
801 Ga0207679_10000733 3300025945 Bacteria 21828
802 Ga0207679_10053505 3300025945 Bacteria 2967
803 Ga0207679_10072529 3300025945 Unclassified 2601
804 Ga0207679_10141082 3300025945 Bacteria 1948
805 Ga0207679_10156009 3300025945 Bacteria 1864
806 Ga0207679_10249089 3300025945 Bacteria 1509
807 Ga0207679_10435024 3300025945 Bacteria 1160
808 Ga0207679_10615805 3300025945 Unclassified 979
809 Ga0207679_11269232 3300025945 Bacteria 676
810 Ga0207667_10084321 3300025949 Bacteria 3289
811 Ga0207667_10084964 3300025949 Bacteria 3276
812 Ga0207667_10530279 3300025949 Bacteria 1192
813 Ga0207667_10680425 3300025949 Bacteria 1032
814 Ga0207667_10841888 3300025949 Bacteria 912
815 Ga0207667_11603226 3300025949 Unclassified 619
816 Ga0207667_11694124 3300025949 Unclassified 599
817 Ga0207667_11931420 3300025949 Bacteria 552
818 Ga0207651_10072501 3300025960 Bacteria 2445
819 Ga0207651_10216789 3300025960 Unclassified 1544
820 Ga0207651_10225893 3300025960 Bacteria 1517
821 Ga0207651_10264575 3300025960 Bacteria 1413
822 Ga0207651_11556114 3300025960 Bacteria 596
823 Ga0207712_10013550 3300025961 Bacteria 5228
824 Ga0207712_10047438 3300025961 Bacteria 2982
825 Ga0207712_10056675 3300025961 Bacteria 2761
826 Ga0207712_10113360 3300025961 Bacteria 2038
827 Ga0207712_10115165 3300025961 Bacteria 2023
828 Ga0207712_10463209 3300025961 Bacteria 1077
829 Ga0207712_10904136 3300025961 Bacteria 780
830 Ga0207712_11121198 3300025961 Bacteria 701
831 Ga0207712_11673634 3300025961 Bacteria 570
832 Ga0207668_10106752 3300025972 Bacteria 2092
833 Ga0207668_10374600 3300025972 Bacteria 1196
834 Ga0207668_10790971 3300025972 Bacteria 839
835 Ga0207668_11311581 3300025972 Bacteria 652
836 Ga0207668_11525417 3300025972 Bacteria 603
837 Ga0207668_11884211 3300025972 Bacteria 539
838 Ga0207668_12001922 3300025972 Bacteria 522
839 Ga0207640_10045009 3300025981 Bacteria 2832
840 Ga0207640_10111724 3300025981 Bacteria 1938
841 Ga0207640_10192788 3300025981 Bacteria 1537
842 Ga0207640_10210025 3300025981 Bacteria 1482
843 Ga0207640_10452051 3300025981 Unclassified 1059
844 Ga0207640_10936226 3300025981 Bacteria 759
845 Ga0207640_10971783 3300025981 Bacteria 745
846 Ga0207640_11023323 3300025981 Bacteria 728
847 Ga0207640_11795081 3300025981 Bacteria 554
848 Ga0207658_10060668 3300025986 Bacteria 2823
849 Ga0207658_10089383 3300025986 Bacteria 2384
850 Ga0207658_10094559 3300025986 Bacteria 2326
851 Ga0207658_10155481 3300025986 Bacteria 1868
852 Ga0207658_10195342 3300025986 Bacteria 1685
853 Ga0207658_10199918 3300025986 Bacteria 1668
854 Ga0207658_10256647 3300025986 Bacteria 1488
855 Ga0207658_10381397 3300025986 Bacteria 1235
856 Ga0207658_11172073 3300025986 Unclassified 702
857 Ga0207658_11220733 3300025986 Bacteria 687
858 Ga0207677_10026950 3300026023 Bacteria 3612
859 Ga0207677_10098217 3300026023 Bacteria 2148
860 Ga0207677_10267386 3300026023 Bacteria 1397
861 Ga0207677_10357321 3300026023 Bacteria 1226
862 Ga0207677_10477083 3300026023 Bacteria 1074
863 Ga0207677_10526548 3300026023 Bacteria 1026
864 Ga0207677_11092251 3300026023 Bacteria 727
865 Ga0207677_11427023 3300026023 Bacteria 638
866 Ga0207677_11558332 3300026023 Bacteria 611
867 Ga0207703_10864410 3300026035 Bacteria 865
868 Ga0207703_10958773 3300026035 Bacteria 820
869 Ga0207703_11001954 3300026035 Unclassified 801
870 Ga0207703_11836455 3300026035 Bacteria 582
871 Ga0207703_12388597 3300026035 Unclassified 504
872 Ga0207639_10005779 3300026041 Bacteria 8376
873 Ga0207639_10007423 3300026041 Bacteria 7476
874 Ga0207639_10041435 3300026041 Bacteria 3445
875 Ga0207639_10058957 3300026041 Bacteria 2955
876 Ga0207639_10143068 3300026041 Bacteria 1995
877 Ga0207639_10336625 3300026041 Bacteria 1344
878 Ga0207639_10479747 3300026041 Bacteria 1133
879 Ga0207639_10794847 3300026041 Bacteria 881
880 Ga0207639_10985363 3300026041 Bacteria 789
881 Ga0207639_11890669 3300026041 Unclassified 558
882 Ga0207678_10009599 3300026067 Bacteria 8510
883 Ga0207678_10616279 3300026067 Bacteria 952
884 Ga0207678_10677097 3300026067 Unclassified 907
885 Ga0207678_11340383 3300026067 Unclassified 633
886 Ga0207708_10044948 3300026075 Unclassified 3365
887 Ga0207708_10747342 3300026075 Unclassified 839
888 Ga0207708_11263794 3300026075 Bacteria 646
889 Ga0207702_10347041 3300026078 Bacteria 1419
890 Ga0207702_10596127 3300026078 Unclassified 1084
891 Ga0207702_10713515 3300026078 Bacteria 988
892 Ga0207702_11978408 3300026078 Bacteria 573
893 Ga0207641_10020546 3300026088 Bacteria 5424
894 Ga0207641_10097845 3300026088 Bacteria 2580
895 Ga0207641_10337636 3300026088 Bacteria 1433
896 Ga0207641_10696774 3300026088 Bacteria 1000
897 Ga0207641_11243593 3300026088 Unclassified 745
898 Ga0207641_12323467 3300026088 Bacteria 536
899 Ga0207648_10000906 3300026089 Bacteria 33383
900 Ga0207648_10005239 3300026089 Bacteria 13107
901 Ga0207648_10016291 3300026089 Bacteria 6797
902 Ga0207648_10018178 3300026089 Bacteria 6367
903 Ga0207648_10033647 3300026089 Unclassified 4520
904 Ga0207648_10055713 3300026089 Bacteria 3451
905 Ga0207648_10060090 3300026089 Archaea 3315
906 Ga0207648_10066109 3300026089 Bacteria 3153
907 Ga0207648_10179839 3300026089 Bacteria 1872
908 Ga0207648_10221880 3300026089 Bacteria 1680
909 Ga0207648_10587571 3300026089 Bacteria 1026
910 Ga0207676_10014205 3300026095 Bacteria 5721
911 Ga0207676_10025141 3300026095 Bacteria 4417
912 Ga0207676_10036338 3300026095 Bacteria 3746
913 Ga0207676_10211820 3300026095 Bacteria 1720
914 Ga0207676_10299654 3300026095 Bacteria 1467
915 Ga0207676_10855359 3300026095 Bacteria 890
916 Ga0207676_11570661 3300026095 Unclassified 655
917 Ga0207676_11820684 3300026095 Unclassified 607
918 Ga0207674_10003645 3300026116 Bacteria 18783
919 Ga0207674_10014347 3300026116 Bacteria 8754
920 Ga0207674_10023297 3300026116 Bacteria 6634
921 Ga0207674_10106006 3300026116 Bacteria 2788
922 Ga0207674_10237708 3300026116 Bacteria 1769
923 Ga0207674_10245214 3300026116 Bacteria 1739
924 Ga0207674_10308238 3300026116 Bacteria 1532
925 Ga0207674_10371054 3300026116 Bacteria 1383
926 Ga0207674_10729040 3300026116 Bacteria 957
927 Ga0207674_11329563 3300026116 Bacteria 688
928 Ga0207674_11826505 3300026116 Bacteria 575
929 Ga0207675_100000496 3300026118 Bacteria 38204
930 Ga0207675_100003900 3300026118 Bacteria 14503
931 Ga0207675_100094858 3300026118 Unclassified 2807
932 Ga0207675_100130700 3300026118 Bacteria 2381
933 Ga0207675_100189525 3300026118 Bacteria 1972
934 Ga0207675_100235580 3300026118 Bacteria 1767
935 Ga0207675_100361752 3300026118 Bacteria 1424
936 Ga0207675_101227108 3300026118 Bacteria 770
937 Ga0207675_101407816 3300026118 Unclassified 718
938 Ga0207675_101781796 3300026118 Bacteria 635
939 Ga0207675_102278564 3300026118 Bacteria 556
940 Ga0207683_10004237 3300026121 Bacteria 12380
941 Ga0207683_10007976 3300026121 Bacteria 9060
942 Ga0207683_11516036 3300026121 Bacteria 619
943 Ga0207683_11878587 3300026121 Bacteria 548
944 Ga0207683_11943180 3300026121 Unclassified 537
945 Ga0207698_10003198 3300026142 Bacteria 9833
946 Ga0207698_10012551 3300026142 Bacteria 5551
947 Ga0207698_10014378 3300026142 Bacteria 5259
948 Ga0207698_10029763 3300026142 Bacteria 3916
949 Ga0207698_10113516 3300026142 Unclassified 2276
950 Ga0207698_10270413 3300026142 Bacteria 1566
951 Ga0207698_10421632 3300026142 Bacteria 1281
952 Ga0207698_10687150 3300026142 Bacteria 1017
953 Ga0207698_11069317 3300026142 Unclassified 819
954 Ga0207698_11613111 3300026142 Bacteria 664
955 Ga0207698_11708834 3300026142 Bacteria 645
956 Ga0207698_11827991 3300026142 Bacteria 623
957 Ga0209995_1037020 3300027471 Bacteria 821
958 Ga0207428_10372498 3300027907 Bacteria 1048
959 Ga0268266_10480327 3300028379 Bacteria 1184
960 Ga0268266_11333412 3300028379 Bacteria 693
961 Ga0268266_11864541 3300028379 Unclassified 575
962 Ga0268265_10008576 3300028380 Bacteria 6906
963 Ga0268265_10061107 3300028380 Bacteria 2890
964 Ga0268265_10106353 3300028380 Bacteria 2279
965 Ga0268265_10222975 3300028380 Bacteria 1651
966 Ga0268265_10854671 3300028380 Bacteria 890
967 Ga0268265_11158175 3300028380 Bacteria 769
968 Ga0268264_10001295 3300028381 Bacteria 23620
969 Ga0268264_10024319 3300028381 Bacteria 4946
970 Ga0268264_10038507 3300028381 Unclassified 3947
971 Ga0268264_10055818 3300028381 Bacteria 3301
972 Ga0268264_10453748 3300028381 Bacteria 1242
973 Ga0268264_10622929 3300028381 Bacteria 1065
974 Ga0268264_10798299 3300028381 Bacteria 943
975 Ga0268264_12172110 3300028381 Unclassified 563
976 Ga0268264_12580824 3300028381 Bacteria 513
977 Ga0268264_12644500 3300028381 Unclassified 506
978 Ga0265327_10015792 3300031251 Bacteria 4846
979 Ga0265327_10043185 3300031251 Bacteria 2415
980 Ga0265316_10046775 3300031344 Bacteria 3426
981 Ga0307513_10574484 3300031456 Bacteria 838
982 Ga0307509_10491177 3300031507 Bacteria 914
983 Ga0307509_10640912 3300031507 Bacteria 732
984 Ga0307408_100507118 3300031548 Bacteria 1057
985 Ga0307408_101094699 3300031548 Bacteria 739
986 Ga0307405_10111142 3300031731 Bacteria 1857
987 Ga0307405_10479317 3300031731 Bacteria 993
988 Ga0307405_11259116 3300031731 Bacteria 642
989 Ga0307405_11490336 3300031731 Bacteria 594
990 Ga0307413_10115271 3300031824 Bacteria 1808
991 Ga0307413_11644679 3300031824 Bacteria 571
992 Ga0307410_10153075 3300031852 Bacteria 1719
993 Ga0307410_11164357 3300031852 Unclassified 670
994 Ga0307410_11413355 3300031852 Unclassified 611
995 Ga0307410_11831560 3300031852 Unclassified 539
996 Ga0307406_10318421 3300031901 Unclassified 1202
997 Ga0307406_10969437 3300031901 Bacteria 728
998 Ga0307407_10346477 3300031903 Bacteria 1051
999 Ga0307407_10740564 3300031903 Bacteria 743
1000 Ga0307412_10081682 3300031911 Bacteria 2236
1001 Ga0307412_11437011 3300031911 Bacteria 625
1002 Ga0307412_11718953 3300031911 Bacteria 575
1003 Ga0307409_100575929 3300031995 Bacteria 1109
1004 Ga0307409_100838540 3300031995 Bacteria 929
1005 Ga0307409_100979952 3300031995 Bacteria 863
1006 Ga0307409_101186670 3300031995 Bacteria 786
1007 Ga0307416_100218735 3300032002 Bacteria 1825
1008 Ga0307416_100307269 3300032002 Bacteria 1580
1009 Ga0307416_100604728 3300032002 Bacteria 1176
1010 Ga0307416_100662298 3300032002 Bacteria 1130
1011 Ga0307416_101696177 3300032002 Bacteria 736
1012 Ga0307416_102048396 3300032002 Bacteria 675
1013 Ga0307414_10322595 3300032004 Bacteria 1315
1014 Ga0307414_10333185 3300032004 Bacteria 1296
1015 Ga0307414_10364209 3300032004 Bacteria 1245
1016 Ga0307414_10698407 3300032004 Bacteria 918
1017 Ga0307414_10710030 3300032004 Bacteria 911
1018 Ga0307414_11101502 3300032004 Bacteria 733
1019 Ga0307411_10320100 3300032005 Bacteria 1252
1020 Ga0307411_10380459 3300032005 Bacteria 1161
1021 Ga0307411_10784192 3300032005 Bacteria 838
1022 Ga0307411_11137867 3300032005 Bacteria 705
1023 Ga0307411_11891096 3300032005 Unclassified 555
1024 Ga0307415_100171612 3300032126 Bacteria 1692
1025 Ga0307415_100518824 3300032126 Bacteria 1045
1026 Ga0373934_0024614 3300035086 Bacteria 2328
1027 Ga0373957_0129104 3300035120 Unclassified 1028
1028 Ga0373955_0342799 3300035172 Unclassified 904
1029 Ga0373924_0035738 3300035410 Bacteria 2016
1030 Ga0373935_0395323 3300035692 Bacteria 992
1031 Ga0373933_1154390 3300035724 Bacteria 510
1032 Ga0373947_0057918 3300035725 Bacteria 2346
1033 Ga0373947_1084024 3300035725 Bacteria 546
1034 Ga0373937_0156276 3300036401 Bacteria 2137
1035 Ga0373925_0409562 3300037068 Bacteria 1107
1036 Ga0395899_0000248 3300037312 Bacteria 72047
1037 Ga0395899_0014814 3300037312 Bacteria 5950
1038 Ga0395899_0043261 3300037312 Bacteria 3360
1039 Ga0395899_0118039 3300037312 Bacteria 1902
1040 Ga0395899_0189212 3300037312 Unclassified 1441
1041 Ga0395899_0206187 3300037312 Bacteria 1368
1042 Ga0395899_0245842 3300037312 Bacteria 1229
1043 Ga0395899_0302035 3300037312 Bacteria 1083
1044 Ga0395900_0005223 3300037418 Bacteria 13624
1045 Ga0395900_0015001 3300037418 Bacteria 7897
1046 Ga0395900_0018816 3300037418 Bacteria 7045
1047 Ga0395900_0041998 3300037418 Bacteria 4711
1048 Ga0395900_0138186 3300037418 Bacteria 2496
1049 Ga0395900_0159137 3300037418 Bacteria 2304
1050 Ga0395900_0232969 3300037418 Unclassified 1851
1051 Ga0395900_0434999 3300037418 Bacteria 1270
1052 Ga0395900_0978770 3300037418 Bacteria 766
1053 Ga0395898_0003603 3300037466 Bacteria 17248
1054 Ga0395898_0043780 3300037466 Bacteria 4410
1055 Ga0395898_0179806 3300037466 Bacteria 2022
1056 Ga0395898_0416002 3300037466 Bacteria 1281
1057 Ga0395898_0519908 3300037466 Bacteria 1131
1058 Ga0395898_0550665 3300037466 Bacteria 1096
1059 Ga0395898_0555286 3300037466 Bacteria 1090
1060 Ga0395905_0002268 3300037471 Bacteria 21601
1061 Ga0395905_0615760 3300037471 Unclassified 988
1062 Ga0395905_0645488 3300037471 Bacteria 960
1063 Ga0395905_1029246 3300037471 Bacteria 727
1064 Ga0395905_1230702 3300037471 Unclassified 652
1065 Ga0395905_1594571 3300037471 Unclassified 557
1066 Ga0395901_0002328 3300038443 Bacteria 19351
1067 Ga0395901_0007090 3300038443 Bacteria 11330
1068 Ga0395901_0039606 3300038443 Bacteria 4878
1069 Ga0395901_0064162 3300038443 Bacteria 3823
1070 Ga0395901_0089136 3300038443 Unclassified 3227
1071 Ga0395901_0324917 3300038443 Bacteria 1591
1072 Ga0395901_0730800 3300038443 Bacteria 984
1073 Ga0436365_1917912 3300039437 Bacteria 29135
1074 Ga0436363_0188068 3300039450 Bacteria 604
1075 Ga0436363_1545009 3300039450 Bacteria 835
1076 Ga0439447_055322 3300041407 Bacteria 941
1077 Ga0439465_0018267 3300041413 Bacteria 2192
1078 Ga0439465_0018786 3300041413 Bacteria 2160
1079 Ga0451787_175855 3300041441 Bacteria 889
1080 Ga0451789_0302099 3300041443 Bacteria 544
1081 Ga0451790_10861 3300041444 Bacteria 557
1082 Ga0451791_0474555 3300041451 Bacteria 622
1083 Ga0451800_0208990 3300041459 Bacteria 544
1084 Ga0451802_0225735 3300041460 Bacteria 1186
1085 Ga0451807_0456267 3300041486 Bacteria 596
1086 Ga0451807_0825022 3300041486 Bacteria 825
1087 Ga0451807_1125245 3300041486 Bacteria 941
1088 Ga0451807_1196384 3300041486 Bacteria 656
1089 Ga0451807_1384814 3300041486 Bacteria 786
1090 Ga0451807_1403346 3300041486 Unclassified 580
1091 Ga0451843_0946552 3300041509 Bacteria 748
1092 Ga0451855_1068511 3300041511 Unclassified 550
1093 Ga0439431_0024267 3300041997 Bacteria 1474
1094 Ga0439442_006943 3300042002 Unclassified 2274
1095 Ga0439445_0046399 3300042004 Bacteria 1165
1096 Ga0439445_0107356 3300042004 Bacteria 795
1097 Ga0439449_0176728 3300042007 Bacteria 798
1098 Ga0439452_031447 3300042010 Bacteria 1302
1099 Ga0439457_010179 3300042014 Bacteria 2169
1100 Ga0450922_008749 3300042124 Bacteria 958
1101 Ga0450922_032820 3300042124 Unclassified 570
1102 Ga0450923_035171 3300042125 Bacteria 1036
1103 Ga0450923_074150 3300042125 Bacteria 758
1104 Ga0450897_000424 3300042128 Bacteria 2302
1105 Ga0450894_017598 3300042131 Unclassified 952
1106 Ga0450898_007895 3300042134 Bacteria 1666
1107 Ga0450899_017547 3300042135 Unclassified 824
1108 Ga0439446_0145801 3300042156 Bacteria 776
1109 Ga0450909_075809 3300042185 Unclassified 541
1110 Ga0439434_0021642 3300042435 Bacteria 1932
1111 Ga0466972_0397662 3300044658 Bacteria 646
1112 Ga0453683_0965757 3300044673 Unclassified 565
1113 Ga0466965_0263098 3300044683 Bacteria 928
1114 Ga0466966_0533852 3300044684 Bacteria 706
1115 Ga0466966_0869026 3300044684 Bacteria 544
1116 Ga0453684_0090631 3300044712 Bacteria 3777
1117 Ga0466957_0391781 3300044842 Unclassified 949
1118 Ga0466957_0423314 3300044842 Bacteria 914
1119 Ga0466959_0087819 3300045049 Bacteria 2236
1120 Ga0495592_0216098 3300046454 Bacteria 1285
1121 Ga0495629_0257410 3300046459 Unclassified 1200
1122 Ga0495653_0308387 3300046463 Unclassified 1030
1123 Ga0495608_0235595 3300046511 Unclassified 1145
1124 Ga0495618_0310230 3300046514 Unclassified 979
1125 Ga0495628_0300099 3300046516 Unclassified 1189
1126 Ga0495630_0397373 3300046517 Unclassified 1056
1127 Ga0495645_0822106 3300046543 Unclassified 556
1128 Ga0495667_0073158 3300046559 Bacteria 2233
1129 Ga0495668_0000114 3300046616 Bacteria 127503
1130 Ga0495625_0711521 3300046660 Unclassified 592
1131 Ga0495657_0337428 3300046675 Bacteria 894
1132 Ga0495600_0236075 3300046809 Unclassified 1166
1133 Ga0495674_0558200 3300047319 Unclassified 911
1134 Ga0495672_0062722 3300047320 Bacteria 2136
1135 Ga0495676_0398433 3300047321 Bacteria 914
1136 Ga0495676_0626630 3300047321 Bacteria 699
1137 Ga0495684_0625569 3300047471 Unclassified 723
1138 Ga0496101_0548459 3300048904 Bacteria 914
1139 Ga0496104_1137122 3300048907 Unclassified 684
1140 Ga0496105_0817204 3300048908 Unclassified 708
1141 Ga0496105_1210400 3300048908 Unclassified 556
1142 Ga0496108_0404646 3300048911 Bacteria 1192
1143 Ga0496108_1051099 3300048911 Bacteria 694
1144 Ga0496109_0820303 3300048912 Unclassified 868
1145 Ga0496110_0155711 3300048913 Unclassified 2070
1146 Ga0496110_1141114 3300048913 Bacteria 688
1147 Ga0496111_0152411 3300048914 Bacteria 1715
1148 Ga0496111_0704150 3300048914 Bacteria 734
1149 Ga0496112_0971154 3300048915 Bacteria 770
1150 Ga0496112_1559510 3300048915 Unclassified 574
1151 Ga0501306_071612 3300049127 Bacteria 586
1152 Ga0501306_109724 3300049127 Bacteria 500
1153 Ga0501308_060379 3300049128 Bacteria 571
1154 Ga0501309_029104 3300049129 Bacteria 808
1155 Ga0501343_020000 3300049132 Unclassified 588
1156 Ga0501343_027694 3300049132 Bacteria 517
1157 Ga0501305_058570 3300049161 Bacteria 659
1158 Ga0501307_078896 3300049162 Unclassified 535
1159 Ga0501290_011714 3300049513 Bacteria 1132
1160 Ga0501291_044826 3300049514 Bacteria 789
1161 Ga0501292_031629 3300049515 Bacteria 891
1162 Ga0501292_054778 3300049515 Bacteria 713
1163 Ga0501292_083530 3300049515 Bacteria 611
1164 Ga0501294_007346 3300049517 Bacteria 1063
1165 Ga0501296_067272 3300049519 Bacteria 550
1166 Ga0501298_007240 3300049521 Bacteria 1837
1167 Ga0501298_038717 3300049521 Bacteria 961
1168 Ga0501300_017076 3300049523 Bacteria 1059
1169 Ga0501300_060283 3300049523 Unclassified 599
1170 Ga0501311_072243 3300049527 Bacteria 574
1171 Ga0501312_055850 3300049528 Bacteria 675
1172 Ga0501315_016985 3300049531 Bacteria 947
1173 Ga0501316_044824 3300049532 Bacteria 625
1174 Ga0501316_056787 3300049532 Bacteria 573
1175 Ga0501318_075573 3300049534 Bacteria 538
1176 Ga0501323_073987 3300049539 Unclassified 549
1177 Ga0501325_041696 3300049541 Bacteria 561
1178 Ga0501330_005645 3300049546 Bacteria 803
1179 Ga0501335_022393 3300049551 Bacteria 681
1180 Ga0501335_049356 3300049551 Bacteria 510
1181 Ga0501336_011409 3300049552 Bacteria 724
1182 Ga0501336_017612 3300049552 Bacteria 628
1183 Ga0501336_019397 3300049552 Bacteria 609
1184 Ga0501031_0026007 3300049568 Bacteria 3818
1185 Ga0501031_0225837 3300049568 Bacteria 1219
1186 Ga0501031_1119795 3300049568 Unclassified 502
1187 Ga0501032_0010076 3300049569 Bacteria 6823
1188 Ga0501032_0043622 3300049569 Bacteria 3036
1189 Ga0501032_0269697 3300049569 Bacteria 1103
1190 Ga0501033_0018072 3300049570 Bacteria 5327
1191 Ga0501033_0111743 3300049570 Bacteria 1988
1192 Ga0501033_0506976 3300049570 Bacteria 834
1193 Ga0501034_0000007 3300049571 Bacteria 357805
1194 Ga0501034_0005034 3300049571 Bacteria 14519
1195 Ga0501034_0023352 3300049571 Bacteria 6302
1196 Ga0501034_0040596 3300049571 Bacteria 4710
1197 Ga0501034_0057802 3300049571 Bacteria 3899
1198 Ga0501034_0180504 3300049571 Bacteria 2075
1199 Ga0501034_0966504 3300049571 Bacteria 737
1200 Ga0501036_0043431 3300049572 Bacteria 3807
1201 Ga0501036_0079155 3300049572 Bacteria 2780
1202 Ga0501037_0021694 3300049573 Bacteria 4750
1203 Ga0501038_0021012 3300049574 Bacteria 5865
1204 Ga0501038_0131224 3300049574 Bacteria 2057
1205 Ga0501038_0783293 3300049574 Bacteria 710
1206 Ga0501039_0337383 3300049575 Bacteria 1184
1207 Ga0501043_0050958 3300049579 Bacteria 3254
1208 Ga0501043_0091378 3300049579 Bacteria 2393
1209 Ga0501043_0237703 3300049579 Bacteria 1406
1210 Ga0501046_0006756 3300049580 Bacteria 10131
1211 Ga0501046_0272495 3300049580 Unclassified 1241
1212 Ga0501047_0178701 3300049581 Unclassified 1989
1213 Ga0501047_0245711 3300049581 Bacteria 1639
1214 Ga0501048_0597865 3300049582 Unclassified 792
1215 Ga0501070_0080956 3300049586 Bacteria 2687
1216 Ga0501072_1430110 3300049588 Unclassified 534
1217 Ga0501073_0428554 3300049589 Bacteria 914
1218 Ga0501074_1076566 3300049590 Unclassified 565
1219 Ga0501198_001580 3300049649 Bacteria 3000
1220 Ga0501201_001270 3300049651 Bacteria 2371
1221 Ga0501201_014368 3300049651 Bacteria 799
1222 Ga0501201_047672 3300049651 Bacteria 528
1223 Ga0501202_000790 3300049652 Bacteria 4748
1224 Ga0501202_001791 3300049652 Bacteria 3513
1225 Ga0501202_060439 3300049652 Bacteria 856
1226 Ga0501202_069430 3300049652 Bacteria 809
1227 Ga0501202_219117 3300049652 Bacteria 526
1228 Ga0501202_236393 3300049652 Bacteria 510
1229 Ga0501206_003625 3300049653 Bacteria 1963
1230 Ga0501207_016617 3300049654 Bacteria 1142
1231 Ga0501208_035825 3300049655 Bacteria 898
1232 Ga0501209_078617 3300049656 Bacteria 948
1233 Ga0501209_095888 3300049656 Bacteria 866
1234 Ga0501216_034590 3300049660 Bacteria 947
1235 Ga0501217_002203 3300049661 Bacteria 3793
1236 Ga0501217_076286 3300049661 Bacteria 921
1237 Ga0501217_159378 3300049661 Bacteria 680
1238 Ga0501217_317435 3300049661 Bacteria 518
1239 Ga0501222_010583 3300049662 Bacteria 1218
1240 Ga0501223_009991 3300049663 Bacteria 1914
1241 Ga0501223_038304 3300049663 Unclassified 931
1242 Ga0501224_002212 3300049664 Bacteria 2639
1243 Ga0501224_011100 3300049664 Bacteria 1324
1244 Ga0501224_043505 3300049664 Bacteria 681
1245 Ga0501228_008389 3300049666 Bacteria 987
1246 Ga0501233_006024 3300049668 Bacteria 2266
1247 Ga0501233_028403 3300049668 Bacteria 1249
1248 Ga0501233_057526 3300049668 Bacteria 957
1249 Ga0501235_001211 3300049669 Bacteria 5430
1250 Ga0501235_018918 3300049669 Bacteria 1528
1251 Ga0501235_024447 3300049669 Bacteria 1349
1252 Ga0501235_072232 3300049669 Bacteria 817
1253 Ga0501242_000073 3300049674 Bacteria 6442
1254 Ga0501242_000250 3300049674 Bacteria 4284
1255 Ga0501242_029783 3300049674 Bacteria 734
1256 Ga0501243_014076 3300049675 Bacteria 1276
1257 Ga0501243_048493 3300049675 Bacteria 761
1258 Ga0501246_032311 3300049676 Bacteria 594
1259 Ga0501246_034226 3300049676 Bacteria 584
1260 Ga0501246_042643 3300049676 Unclassified 547
1261 Ga0501247_070938 3300049677 Bacteria 550
1262 Ga0501249_050515 3300049679 Bacteria 954
1263 Ga0501249_058812 3300049679 Bacteria 889
1264 Ga0501249_108585 3300049679 Bacteria 669
1265 Ga0501250_048450 3300049680 Bacteria 645
1266 Ga0501251_004398 3300049681 Bacteria 1455
1267 Ga0501251_007862 3300049681 Bacteria 1195
1268 Ga0501252_000172 3300049682 Bacteria 4110
1269 Ga0501252_019383 3300049682 Bacteria 878
1270 Ga0501253_003050 3300049683 Bacteria 1965
1271 Ga0501256_020221 3300049685 Bacteria 694
1272 Ga0501257_001060 3300049686 Bacteria 5563
1273 Ga0501257_030087 3300049686 Bacteria 1306
1274 Ga0501257_173910 3300049686 Bacteria 606
1275 Ga0501257_276937 3300049686 Bacteria 504
1276 Ga0501259_002647 3300049688 Bacteria 2881
1277 Ga0501259_026209 3300049688 Bacteria 1072
1278 Ga0501259_043126 3300049688 Bacteria 893
1279 Ga0501261_010240 3300049690 Bacteria 1232
1280 Ga0501261_029325 3300049690 Bacteria 826
1281 Ga0501261_054018 3300049690 Bacteria 666
1282 Ga0501219_000098 3300049703 Bacteria 15144
1283 Ga0501219_013282 3300049703 Bacteria 647
1284 Ga0501219_025542 3300049703 Unclassified 534
1285 Ga0501221_006060 3300049704 Bacteria 2034
1286 Ga0501221_006642 3300049704 Bacteria 1961
1287 Ga0501221_007562 3300049704 Bacteria 1868
1288 Ga0501225_0010047 3300049705 Bacteria 2687
1289 Ga0501225_0091965 3300049705 Bacteria 879
1290 Ga0501225_0106549 3300049705 Bacteria 823
1291 Ga0501229_019627 3300049706 Bacteria 891
1292 Ga0501234_008763 3300049707 Bacteria 1576
1293 Ga0501234_045729 3300049707 Bacteria 722
1294 Ga0501234_092997 3300049707 Unclassified 542
1295 Ga0501245_003293 3300049708 Bacteria 2189
1296 Ga0501245_020847 3300049708 Bacteria 1025
1297 Ga0501080_0301267 3300049742 Bacteria 1454
1298 Ga0501080_0491848 3300049742 Unclassified 1097
1299 Ga0501232_080362 3300049757 Bacteria 551
1300 Ga0501241_008833 3300049758 Bacteria 1837
1301 Ga0501241_123474 3300049758 Bacteria 577
1302 Ga0501241_151258 3300049758 Bacteria 535
1303 Ga0501263_005319 3300049760 Bacteria 1450
1304 Ga0501264_009859 3300049761 Bacteria 915
1305 Ga0501265_078489 3300049762 Bacteria 570
1306 Ga0501266_034487 3300049763 Bacteria 733
1307 Ga0501267_056423 3300049764 Bacteria 522
1308 Ga0501268_108753 3300049765 Bacteria 602
1309 Ga0501270_020550 3300049767 Bacteria 1001
1310 Ga0501270_030346 3300049767 Bacteria 888
1311 Ga0501270_039931 3300049767 Bacteria 813
1312 Ga0501270_085763 3300049767 Bacteria 634
1313 Ga0501273_041528 3300049770 Unclassified 682
1314 Ga0501274_022279 3300049771 Bacteria 666
1315 Ga0501275_011233 3300049772 Bacteria 969
1316 Ga0501276_002039 3300049773 Bacteria 1408
1317 Ga0501276_045818 3300049773 Bacteria 500
1318 Ga0501279_032072 3300049775 Bacteria 782
1319 Ga0501281_04140 3300049777 Bacteria 1023
1320 Ga0501035_0004551 3300049822 Bacteria 13161
1321 Ga0501035_0012875 3300049822 Bacteria 7724
1322 Ga0501035_0028671 3300049822 Bacteria 5080
1323 Ga0501035_1155202 3300049822 Bacteria 602
1324 Ga0501044_0021980 3300049823 Bacteria 6802
1325 Ga0501044_0052997 3300049823 Bacteria 4176
1326 Ga0501044_0602278 3300049823 Bacteria 992
1327 Ga0501045_0680010 3300049824 Bacteria 760
1328 Ga0501045_0751636 3300049824 Unclassified 719
1329 Ga0501284_00036 3300050005 Bacteria 57905
1330 nmdc:mga0k408_3233_c1 3300050493 Bacteria 8623
1331 nmdc:mga0k408_355923_c1 3300050493 Bacteria 873
1332 nmdc:mga0k408_76325_c1 3300050493 Bacteria 1958
1333 nmdc:mga09592_19360_c1 3300050508 Bacteria 5589
1334 nmdc:mga08y16_304943_c1 3300050511 Unclassified 1641
1335 nmdc:mga0n895_125677_c1 3300050512 Bacteria 2588
1336 nmdc:mga0n895_1599605_c1 3300050512 Unclassified 616
1337 nmdc:mga0n895_911130_c1 3300050512 Bacteria 864
1338 Ga0495619_0145973 3300053085 Bacteria 1631
1339 Ga0500650_0466189 3300053098 Unclassified 540
1340 Ga0500628_066294 3300053129 Bacteria 894
1341 Ga0500568_0000459 3300053139 Bacteria 30347
1342 Ga0500616_0120548 3300053153 Bacteria 1254
1343 Ga0500616_0400153 3300053153 Unclassified 549
1344 Ga0500622_0001989 3300053156 Bacteria 15325
1345 Ga0500611_000008 3300053727 Bacteria 198346
1346 Ga0500645_009288 3300053730 Bacteria 3308
1347 Ga0500661_001406 3300055283 Bacteria 4500
1348 Ga0587066_192175 3300059490 Bacteria 532
1349 Ga0587080_162991 3300059503 Bacteria 524
1350 Ga0587091_112400 3300059511 Unclassified 652
1351 Ga0587115_097623 3300059626 Unclassified 541
1352 Ga0587067_185738 3300059640 Bacteria 544
1353 Ga0587069_091107 3300059642 Unclassified 609
1354 Ga0587079_097162 3300059647 Bacteria 698

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_11925922 Ga0105249_119259221 102
2 3300031548 Ga0307408_100507118 Ga0307408_1005071181 102
3 3300031731 Ga0307405_10111142 Ga0307405_101111423 102
4 3300031824 Ga0307413_10115271 Ga0307413_101152711 102
5 3300031852 Ga0307410_11831560 Ga0307410_118315601 102
6 3300031903 Ga0307407_10740564 Ga0307407_107405641 102
7 3300031911 Ga0307412_10081682 Ga0307412_100816822 102
8 3300031995 Ga0307409_100838540 Ga0307409_1008385401 102
9 3300032002 Ga0307416_101696177 Ga0307416_1016961771 102
10 3300032004 Ga0307414_10710030 Ga0307414_107100301 102
11 3300032005 Ga0307411_10320100 Ga0307411_103201001 102
12 3300032126 Ga0307415_100171612 Ga0307415_1001716122 102
13 3300049652 Ga0501202_069430 Ga0501202_069430_149_490 102
14 3300049656 Ga0501209_078617 Ga0501209_078617_267_608 102
15 3300049660 Ga0501216_034590 Ga0501216_034590_458_799 102
16 3300049664 Ga0501224_011100 Ga0501224_011100_332_673 102
17 3300049705 Ga0501225_0091965 Ga0501225_0091965_99_440 102
18 3300049773 Ga0501276_045818 Ga0501276_045818_16_357 102
19 3300031901 Ga0307406_10318421 Ga0307406_103184211 103
20 3300049552 Ga0501336_011409 Ga0501336_011409_328_687 103
21 3300005336 Ga0070680_101656178 Ga0070680_1016561781 104
22 3300005458 Ga0070681_10332775 Ga0070681_103327751 104
23 3300005577 Ga0068857_100180869 Ga0068857_1001808692 104
24 3300009545 Ga0105237_10016034 Ga0105237_100160346 104
25 3300013100 Ga0157373_10025954 Ga0157373_100259545 104
26 3300013307 Ga0157372_10428568 Ga0157372_104285682 104
27 3300013307 Ga0157372_11296358 Ga0157372_112963582 104
28 3300031251 Ga0265327_10043185 Ga0265327_100431853 104
29 3300031344 Ga0265316_10046775 Ga0265316_100467752 104
30 3300031852 Ga0307410_11413355 Ga0307410_114133551 104
31 3300044712 Ga0453684_0090631 Ga0453684_0090631_679_1008 104
32 3300049579 Ga0501043_0237703 Ga0501043_0237703_1057_1386 104
33 3300049664 Ga0501224_043505 Ga0501224_043505_93_422 104
34 3300002459 JGI24751J29686_10019570 JGI24751J29686_100195702 105
35 3300005290 Ga0065712_10026861 Ga0065712_100268611 105
36 3300005290 Ga0065712_10148035 Ga0065712_101480351 105
37 3300005290 Ga0065712_10361631 Ga0065712_103616312 105
38 3300005293 Ga0065715_10230257 Ga0065715_102302571 105
39 3300005293 Ga0065715_10704909 Ga0065715_107049091 105
40 3300005327 Ga0070658_10062639 Ga0070658_100626395 105
41 3300005327 Ga0070658_10280764 Ga0070658_102807642 105
42 3300005329 Ga0070683_100035848 Ga0070683_1000358484 105
43 3300005330 Ga0070690_101512723 Ga0070690_1015127231 105
44 3300005331 Ga0070670_100029206 Ga0070670_1000292063 105
45 3300005331 Ga0070670_100399657 Ga0070670_1003996572 105
46 3300005335 Ga0070666_10847220 Ga0070666_108472201 105
47 3300005337 Ga0070682_101046657 Ga0070682_1010466572 105
48 3300005338 Ga0068868_100189892 Ga0068868_1001898922 105
49 3300005340 Ga0070689_101527653 Ga0070689_1015276531 105
50 3300005343 Ga0070687_100088757 Ga0070687_1000887573 105
51 3300005343 Ga0070687_100421644 Ga0070687_1004216442 105
52 3300005343 Ga0070687_100651995 Ga0070687_1006519952 105
53 3300005344 Ga0070661_100215522 Ga0070661_1002155222 105
54 3300005344 Ga0070661_100578471 Ga0070661_1005784712 105
55 3300005344 Ga0070661_101010148 Ga0070661_1010101482 105
56 3300005347 Ga0070668_100844109 Ga0070668_1008441092 105
57 3300005353 Ga0070669_100964811 Ga0070669_1009648112 105
58 3300005354 Ga0070675_100031074 Ga0070675_1000310743 105
59 3300005354 Ga0070675_100348931 Ga0070675_1003489312 105
60 3300005355 Ga0070671_100317391 Ga0070671_1003173912 105
61 3300005355 Ga0070671_100346544 Ga0070671_1003465442 105
62 3300005355 Ga0070671_101287338 Ga0070671_1012873381 105
63 3300005356 Ga0070674_100147980 Ga0070674_1001479802 105
64 3300005365 Ga0070688_100464982 Ga0070688_1004649821 105
65 3300005366 Ga0070659_100151481 Ga0070659_1001514812 105
66 3300005366 Ga0070659_100855305 Ga0070659_1008553051 105
67 3300005367 Ga0070667_101361336 Ga0070667_1013613361 105
68 3300005466 Ga0070685_10211790 Ga0070685_102117902 105
69 3300005535 Ga0070684_100001194 Ga0070684_10000119411 105
70 3300005535 Ga0070684_100547671 Ga0070684_1005476712 105
71 3300005539 Ga0068853_100733003 Ga0068853_1007330031 105
72 3300005543 Ga0070672_100309927 Ga0070672_1003099272 105
73 3300005543 Ga0070672_101194824 Ga0070672_1011948242 105
74 3300005564 Ga0070664_100887865 Ga0070664_1008878652 105
75 3300005614 Ga0068856_102570338 Ga0068856_1025703382 105
76 3300005616 Ga0068852_100029241 Ga0068852_1000292414 105
77 3300005616 Ga0068852_100176471 Ga0068852_1001764712 105
78 3300005616 Ga0068852_100186123 Ga0068852_1001861233 105
79 3300005616 Ga0068852_100888601 Ga0068852_1008886012 105
80 3300005618 Ga0068864_101199275 Ga0068864_1011992751 105
81 3300005834 Ga0068851_10014708 Ga0068851_100147082 105
82 3300005840 Ga0068870_10280578 Ga0068870_102805781 105
83 3300005840 Ga0068870_10943574 Ga0068870_109435741 105
84 3300006028 Ga0070717_11521271 Ga0070717_115212712 105
85 3300009174 Ga0105241_10896292 Ga0105241_108962921 105
86 3300009551 Ga0105238_11638829 Ga0105238_116388291 105
87 3300013100 Ga0157373_10062105 Ga0157373_100621053 105
88 3300013100 Ga0157373_10516337 Ga0157373_105163372 105
89 3300013100 Ga0157373_11353516 Ga0157373_113535162 105
90 3300013102 Ga0157371_10011420 Ga0157371_100114205 105
91 3300013102 Ga0157371_10077105 Ga0157371_100771052 105
92 3300013102 Ga0157371_10184865 Ga0157371_101848652 105
93 3300013102 Ga0157371_10512720 Ga0157371_105127201 105
94 3300013102 Ga0157371_10586172 Ga0157371_105861722 105
95 3300013104 Ga0157370_11339363 Ga0157370_113393631 105
96 3300013105 Ga0157369_10223125 Ga0157369_102231252 105
97 3300013105 Ga0157369_10757503 Ga0157369_107575032 105
98 3300013105 Ga0157369_10894349 Ga0157369_108943492 105
99 3300013105 Ga0157369_11093559 Ga0157369_110935592 105
100 3300013105 Ga0157369_11831780 Ga0157369_118317802 105
101 3300013296 Ga0157374_10415942 Ga0157374_104159422 105
102 3300013306 Ga0163162_12936613 Ga0163162_129366131 105
103 3300013307 Ga0157372_10108205 Ga0157372_101082053 105
104 3300013307 Ga0157372_10202576 Ga0157372_102025762 105
105 3300013307 Ga0157372_10285220 Ga0157372_102852204 105
106 3300013307 Ga0157372_10372015 Ga0157372_103720152 105
107 3300013307 Ga0157372_10394828 Ga0157372_103948281 105
108 3300013307 Ga0157372_10520690 Ga0157372_105206902 105
109 3300013307 Ga0157372_10653775 Ga0157372_106537752 105
110 3300013307 Ga0157372_10711445 Ga0157372_107114452 105
111 3300013307 Ga0157372_10720938 Ga0157372_107209382 105
112 3300013307 Ga0157372_10797009 Ga0157372_107970092 105
113 3300013307 Ga0157372_11106433 Ga0157372_111064331 105
114 3300013307 Ga0157372_11114117 Ga0157372_111141172 105
115 3300013308 Ga0157375_11374148 Ga0157375_113741482 105
116 3300013308 Ga0157375_11401390 Ga0157375_114013902 105
117 3300014325 Ga0163163_10004743 Ga0163163_1000474316 105
118 3300014325 Ga0163163_10650339 Ga0163163_106503392 105
119 3300014326 Ga0157380_10024118 Ga0157380_100241182 105
120 3300014745 Ga0157377_10018690 Ga0157377_100186906 105
121 3300014969 Ga0157376_10632617 Ga0157376_106326172 105
122 3300015265 Ga0182005_1073270 Ga0182005_10732702 105
123 3300025321 Ga0207656_10237043 Ga0207656_102370432 105
124 3300025893 Ga0207682_10568521 Ga0207682_105685211 105
125 3300025908 Ga0207643_10307580 Ga0207643_103075802 105
126 3300025909 Ga0207705_10216366 Ga0207705_102163662 105
127 3300025909 Ga0207705_10619018 Ga0207705_106190181 105
128 3300025911 Ga0207654_10806615 Ga0207654_108066151 105
129 3300025920 Ga0207649_10461186 Ga0207649_104611862 105
130 3300025920 Ga0207649_10601197 Ga0207649_106011972 105
131 3300025923 Ga0207681_11020514 Ga0207681_110205142 105
132 3300025925 Ga0207650_10002472 Ga0207650_1000247211 105
133 3300025925 Ga0207650_11694504 Ga0207650_116945041 105
134 3300025926 Ga0207659_10139502 Ga0207659_101395021 105
135 3300025926 Ga0207659_10307732 Ga0207659_103077322 105
136 3300025931 Ga0207644_10126372 Ga0207644_101263722 105
137 3300025931 Ga0207644_10635799 Ga0207644_106357992 105
138 3300025932 Ga0207690_11599811 Ga0207690_115998111 105
139 3300025933 Ga0207706_10488731 Ga0207706_104887311 105
140 3300025936 Ga0207670_11356876 Ga0207670_113568761 105
141 3300025936 Ga0207670_11588139 Ga0207670_115881392 105
142 3300025937 Ga0207669_10092169 Ga0207669_100921692 105
143 3300025940 Ga0207691_10392947 Ga0207691_103929472 105
144 3300025944 Ga0207661_10008250 Ga0207661_100082505 105
145 3300025944 Ga0207661_11630255 Ga0207661_116302552 105
146 3300025945 Ga0207679_10053505 Ga0207679_100535052 105
147 3300025960 Ga0207651_10225893 Ga0207651_102258932 105
148 3300025972 Ga0207668_11311581 Ga0207668_113115811 105
149 3300025986 Ga0207658_11172073 Ga0207658_111720732 105
150 3300026023 Ga0207677_10477083 Ga0207677_104770831 105
151 3300026041 Ga0207639_10058957 Ga0207639_100589575 105
152 3300026078 Ga0207702_10596127 Ga0207702_105961272 105
153 3300026095 Ga0207676_11570661 Ga0207676_115706612 105
154 3300026116 Ga0207674_10308238 Ga0207674_103082382 105
155 3300026142 Ga0207698_10014378 Ga0207698_100143782 105
156 3300026142 Ga0207698_10029763 Ga0207698_100297633 105
157 3300026142 Ga0207698_11613111 Ga0207698_116131112 105
158 3300031731 Ga0307405_10479317 Ga0307405_104793172 105
159 3300031731 Ga0307405_11490336 Ga0307405_114903361 105
160 3300031901 Ga0307406_10969437 Ga0307406_109694372 105
161 3300031911 Ga0307412_11437011 Ga0307412_114370111 105
162 3300031911 Ga0307412_11718953 Ga0307412_117189532 105
163 3300031995 Ga0307409_100979952 Ga0307409_1009799522 105
164 3300031995 Ga0307409_101186670 Ga0307409_1011866701 105
165 3300032002 Ga0307416_100604728 Ga0307416_1006047282 105
166 3300032002 Ga0307416_102048396 Ga0307416_1020483962 105
167 3300032004 Ga0307414_10322595 Ga0307414_103225953 105
168 3300032004 Ga0307414_10333185 Ga0307414_103331852 105
169 3300032004 Ga0307414_10364209 Ga0307414_103642092 105
170 3300032004 Ga0307414_10698407 Ga0307414_106984072 105
171 3300032004 Ga0307414_11101502 Ga0307414_111015022 105
172 3300032005 Ga0307411_11137867 Ga0307411_111378672 105
173 3300032005 Ga0307411_11891096 Ga0307411_118910961 105
174 3300037312 Ga0395899_0302035 Ga0395899_0302035_403_735 105
175 3300037418 Ga0395900_0018816 Ga0395900_0018816_67_399 105
176 3300037466 Ga0395898_0550665 Ga0395898_0550665_91_423 105
177 3300037471 Ga0395905_0002268 Ga0395905_0002268_10168_10500 105
178 3300037471 Ga0395905_0645488 Ga0395905_0645488_12_344 105
179 3300037471 Ga0395905_1029246 Ga0395905_1029246_312_644 105
180 3300039450 Ga0436363_1545009 Ga0436363_1545009_41_364 105
181 3300041486 Ga0451807_1384814 Ga0451807_1384814_242_565 105
182 3300042004 Ga0439445_0107356 Ga0439445_0107356_422_754 105
183 3300044684 Ga0466966_0533852 Ga0466966_0533852_345_674 105
184 3300044842 Ga0466957_0423314 Ga0466957_0423314_376_705 105
185 3300045049 Ga0466959_0087819 Ga0466959_0087819_263_595 105
186 3300048911 Ga0496108_1051099 Ga0496108_1051099_102_434 105
187 3300049127 Ga0501306_071612 Ga0501306_071612_153_482 105
188 3300049127 Ga0501306_109724 Ga0501306_109724_79_411 105
189 3300049128 Ga0501308_060379 Ga0501308_060379_94_423 105
190 3300049129 Ga0501309_029104 Ga0501309_029104_149_478 105
191 3300049132 Ga0501343_027694 Ga0501343_027694_105_473 105
192 3300049161 Ga0501305_058570 Ga0501305_058570_10_339 105
193 3300049513 Ga0501290_011714 Ga0501290_011714_47_379 105
194 3300049515 Ga0501292_031629 Ga0501292_031629_345_677 105
195 3300049515 Ga0501292_054778 Ga0501292_054778_232_600 105
196 3300049515 Ga0501292_083530 Ga0501292_083530_159_491 105
197 3300049517 Ga0501294_007346 Ga0501294_007346_600_932 105
198 3300049519 Ga0501296_067272 Ga0501296_067272_16_348 105
199 3300049521 Ga0501298_007240 Ga0501298_007240_1261_1593 105
200 3300049523 Ga0501300_017076 Ga0501300_017076_482_814 105
201 3300049523 Ga0501300_060283 Ga0501300_060283_145_477 105
202 3300049527 Ga0501311_072243 Ga0501311_072243_94_423 105
203 3300049528 Ga0501312_055850 Ga0501312_055850_33_365 105
204 3300049531 Ga0501315_016985 Ga0501315_016985_460_789 105
205 3300049532 Ga0501316_056787 Ga0501316_056787_149_481 105
206 3300049534 Ga0501318_075573 Ga0501318_075573_117_446 105
207 3300049541 Ga0501325_041696 Ga0501325_041696_79_411 105
208 3300049546 Ga0501330_005645 Ga0501330_005645_332_664 105
209 3300049551 Ga0501335_022393 Ga0501335_022393_10_333 105
210 3300049551 Ga0501335_049356 Ga0501335_049356_63_392 105
211 3300049552 Ga0501336_017612 Ga0501336_017612_150_482 105
212 3300049552 Ga0501336_019397 Ga0501336_019397_25_357 105
213 3300049649 Ga0501198_001580 Ga0501198_001580_1493_1825 105
214 3300049651 Ga0501201_001270 Ga0501201_001270_375_707 105
215 3300049651 Ga0501201_014368 Ga0501201_014368_158_490 105
216 3300049651 Ga0501201_047672 Ga0501201_047672_163_495 105
217 3300049652 Ga0501202_000790 Ga0501202_000790_1010_1342 105
218 3300049652 Ga0501202_001791 Ga0501202_001791_2745_3077 105
219 3300049652 Ga0501202_060439 Ga0501202_060439_248_580 105
220 3300049652 Ga0501202_219117 Ga0501202_219117_74_406 105
221 3300049653 Ga0501206_003625 Ga0501206_003625_567_899 105
222 3300049654 Ga0501207_016617 Ga0501207_016617_740_1072 105
223 3300049655 Ga0501208_035825 Ga0501208_035825_206_538 105
224 3300049656 Ga0501209_095888 Ga0501209_095888_173_505 105
225 3300049661 Ga0501217_002203 Ga0501217_002203_787_1119 105
226 3300049661 Ga0501217_076286 Ga0501217_076286_319_687 105
227 3300049661 Ga0501217_159378 Ga0501217_159378_165_488 105
228 3300049661 Ga0501217_317435 Ga0501217_317435_15_347 105
229 3300049662 Ga0501222_010583 Ga0501222_010583_575_907 105
230 3300049663 Ga0501223_009991 Ga0501223_009991_571_903 105
231 3300049663 Ga0501223_038304 Ga0501223_038304_316_684 105
232 3300049664 Ga0501224_002212 Ga0501224_002212_952_1284 105
233 3300049666 Ga0501228_008389 Ga0501228_008389_306_638 105
234 3300049668 Ga0501233_006024 Ga0501233_006024_1383_1715 105
235 3300049668 Ga0501233_028403 Ga0501233_028403_140_508 105
236 3300049668 Ga0501233_057526 Ga0501233_057526_189_521 105
237 3300049669 Ga0501235_001211 Ga0501235_001211_963_1295 105
238 3300049669 Ga0501235_018918 Ga0501235_018918_482_814 105
239 3300049669 Ga0501235_024447 Ga0501235_024447_578_946 105
240 3300049669 Ga0501235_072232 Ga0501235_072232_196_528 105
241 3300049674 Ga0501242_000073 Ga0501242_000073_844_1176 105
242 3300049674 Ga0501242_000250 Ga0501242_000250_1050_1382 105
243 3300049674 Ga0501242_029783 Ga0501242_029783_79_411 105
244 3300049675 Ga0501243_014076 Ga0501243_014076_869_1201 105
245 3300049675 Ga0501243_048493 Ga0501243_048493_268_600 105
246 3300049676 Ga0501246_032311 Ga0501246_032311_114_482 105
247 3300049676 Ga0501246_042643 Ga0501246_042643_95_427 105
248 3300049677 Ga0501247_070938 Ga0501247_070938_109_477 105
249 3300049679 Ga0501249_050515 Ga0501249_050515_478_810 105
250 3300049679 Ga0501249_108585 Ga0501249_108585_145_513 105
251 3300049680 Ga0501250_048450 Ga0501250_048450_117_449 105
252 3300049681 Ga0501251_004398 Ga0501251_004398_907_1239 105
253 3300049681 Ga0501251_007862 Ga0501251_007862_206_538 105
254 3300049682 Ga0501252_000172 Ga0501252_000172_11_343 105
255 3300049682 Ga0501252_019383 Ga0501252_019383_293_625 105
256 3300049683 Ga0501253_003050 Ga0501253_003050_1145_1477 105
257 3300049685 Ga0501256_020221 Ga0501256_020221_221_553 105
258 3300049686 Ga0501257_001060 Ga0501257_001060_1075_1407 105
259 3300049686 Ga0501257_030087 Ga0501257_030087_864_1196 105
260 3300049686 Ga0501257_173910 Ga0501257_173910_145_513 105
261 3300049686 Ga0501257_276937 Ga0501257_276937_75_398 105
262 3300049688 Ga0501259_002647 Ga0501259_002647_2079_2411 105
263 3300049688 Ga0501259_026209 Ga0501259_026209_274_606 105
264 3300049688 Ga0501259_043126 Ga0501259_043126_415_783 105
265 3300049690 Ga0501261_010240 Ga0501261_010240_756_1088 105
266 3300049690 Ga0501261_029325 Ga0501261_029325_311_643 105
267 3300049690 Ga0501261_054018 Ga0501261_054018_105_437 105
268 3300049703 Ga0501219_013282 Ga0501219_013282_200_532 105
269 3300049703 Ga0501219_025542 Ga0501219_025542_132_464 105
270 3300049704 Ga0501221_006060 Ga0501221_006060_767_1099 105
271 3300049704 Ga0501221_006642 Ga0501221_006642_37_369 105
272 3300049704 Ga0501221_007562 Ga0501221_007562_1457_1825 105
273 3300049705 Ga0501225_0010047 Ga0501225_0010047_1524_1856 105
274 3300049705 Ga0501225_0106549 Ga0501225_0106549_230_598 105
275 3300049706 Ga0501229_019627 Ga0501229_019627_73_405 105
276 3300049707 Ga0501234_008763 Ga0501234_008763_249_581 105
277 3300049707 Ga0501234_045729 Ga0501234_045729_176_544 105
278 3300049707 Ga0501234_092997 Ga0501234_092997_197_529 105
279 3300049708 Ga0501245_003293 Ga0501245_003293_656_988 105
280 3300049708 Ga0501245_020847 Ga0501245_020847_310_678 105
281 3300049757 Ga0501232_080362 Ga0501232_080362_133_501 105
282 3300049758 Ga0501241_123474 Ga0501241_123474_158_481 105
283 3300049758 Ga0501241_151258 Ga0501241_151258_120_452 105
284 3300049760 Ga0501263_005319 Ga0501263_005319_516_848 105
285 3300049761 Ga0501264_009859 Ga0501264_009859_114_437 105
286 3300049762 Ga0501265_078489 Ga0501265_078489_71_403 105
287 3300049763 Ga0501266_034487 Ga0501266_034487_223_555 105
288 3300049764 Ga0501267_056423 Ga0501267_056423_150_482 105
289 3300049765 Ga0501268_108753 Ga0501268_108753_62_430 105
290 3300049767 Ga0501270_020550 Ga0501270_020550_383_715 105
291 3300049767 Ga0501270_030346 Ga0501270_030346_158_490 105
292 3300049767 Ga0501270_039931 Ga0501270_039931_406_738 105
293 3300049767 Ga0501270_085763 Ga0501270_085763_33_356 105
294 3300049770 Ga0501273_041528 Ga0501273_041528_324_656 105
295 3300049771 Ga0501274_022279 Ga0501274_022279_186_509 105
296 3300049772 Ga0501275_011233 Ga0501275_011233_127_459 105
297 3300049773 Ga0501276_002039 Ga0501276_002039_1034_1366 105
298 3300049775 Ga0501279_032072 Ga0501279_032072_273_641 105
299 3300049777 Ga0501281_04140 Ga0501281_04140_43_375 105
300 3300005345 Ga0070692_11428399 Ga0070692_114283991 106
301 3300005347 Ga0070668_102272089 Ga0070668_1022720891 106
302 3300005355 Ga0070671_100058203 Ga0070671_1000582032 106
303 3300005364 Ga0070673_101553553 Ga0070673_1015535531 106
304 3300005367 Ga0070667_100553316 Ga0070667_1005533162 106
305 3300005455 Ga0070663_100814180 Ga0070663_1008141801 106
306 3300005539 Ga0068853_102026212 Ga0068853_1020262121 106
307 3300005543 Ga0070672_100347138 Ga0070672_1003471382 106
308 3300005543 Ga0070672_100546229 Ga0070672_1005462291 106
309 3300005834 Ga0068851_10050055 Ga0068851_100500552 106
310 3300013296 Ga0157374_12494395 Ga0157374_124943951 106
311 3300013306 Ga0163162_11992315 Ga0163162_119923152 106
312 3300013308 Ga0157375_10234365 Ga0157375_102343652 106
313 3300014325 Ga0163163_11482249 Ga0163163_114822492 106
314 3300014326 Ga0157380_11603831 Ga0157380_116038311 106
315 3300014326 Ga0157380_12055440 Ga0157380_120554402 106
316 3300017792 Ga0163161_10224584 Ga0163161_102245842 106
317 3300017792 Ga0163161_11476468 Ga0163161_114764682 106
318 3300025321 Ga0207656_10056099 Ga0207656_100560991 106
319 3300025893 Ga0207682_10102376 Ga0207682_101023762 106
320 3300025925 Ga0207650_10108938 Ga0207650_101089382 106
321 3300025940 Ga0207691_10286766 Ga0207691_102867662 106
322 3300025940 Ga0207691_10499520 Ga0207691_104995202 106
323 3300025960 Ga0207651_11556114 Ga0207651_115561141 106
324 3300025986 Ga0207658_10381397 Ga0207658_103813972 106
325 3300026041 Ga0207639_11890669 Ga0207639_118906691 106
326 3300026067 Ga0207678_10616279 Ga0207678_106162792 106
327 3300026088 Ga0207641_12323467 Ga0207641_123234672 106
328 3300026142 Ga0207698_11708834 Ga0207698_117088341 106
329 3300031731 Ga0307405_11259116 Ga0307405_112591162 106
330 3300031824 Ga0307413_11644679 Ga0307413_116446791 106
331 3300031852 Ga0307410_10153075 Ga0307410_101530752 106
332 3300031903 Ga0307407_10346477 Ga0307407_103464772 106
333 3300032002 Ga0307416_100307269 Ga0307416_1003072692 106
334 3300032005 Ga0307411_10380459 Ga0307411_103804592 106
335 3300032126 Ga0307415_100518824 Ga0307415_1005188242 106
336 3300039450 Ga0436363_0188068 Ga0436363_0188068_50_385 106
337 3300041486 Ga0451807_0456267 Ga0451807_0456267_46_381 106
338 3300042124 Ga0450922_008749 Ga0450922_008749_511_834 106
339 3300042125 Ga0450923_035171 Ga0450923_035171_309_632 106
340 3300044684 Ga0466966_0869026 Ga0466966_0869026_57_392 106
341 3300049132 Ga0501343_020000 Ga0501343_020000_205_540 106
342 3300049162 Ga0501307_078896 Ga0501307_078896_38_373 106
343 3300049532 Ga0501316_044824 Ga0501316_044824_30_365 106
344 3300049539 Ga0501323_073987 Ga0501323_073987_110_445 106
345 3300049589 Ga0501073_0428554 Ga0501073_0428554_272_607 106
346 3300002077 JGI24744J21845_10009003 JGI24744J21845_100090032 107
347 3300003162 Ga0006778J45830_1013083 Ga0006778J45830_10130831 107
348 3300003162 Ga0006778J45830_1091642 Ga0006778J45830_10916421 107
349 3300003308 Ga0006777J48905_1002824 Ga0006777J48905_10028241 107
350 3300003308 Ga0006777J48905_1016926 Ga0006777J48905_10169262 107
351 3300003323 rootH1_10183607 rootH1_101836073 107
352 3300003544 Ga0007417J51691_1011400 Ga0007417J51691_10114001 107
353 3300003577 Ga0007416J51690_1008420 Ga0007416J51690_10084201 107
354 3300003577 Ga0007416J51690_1081396 Ga0007416J51690_10813961 107
355 3300003579 Ga0007429J51699_1010111 Ga0007429J51699_10101111 107
356 3300003579 Ga0007429J51699_1095847 Ga0007429J51699_10958471 107
357 3300003693 Ga0032354_1046868 Ga0032354_10468681 107
358 3300003693 Ga0032354_1049471 Ga0032354_10494711 107
359 3300003693 Ga0032354_1057186 Ga0032354_10571861 107
360 3300004798 Ga0058859_11674870 Ga0058859_116748701 107
361 3300004799 Ga0058863_11776965 Ga0058863_117769651 107
362 3300004801 Ga0058860_10045833 Ga0058860_100458331 107
363 3300004801 Ga0058860_12154840 Ga0058860_121548401 107
364 3300005290 Ga0065712_10087786 Ga0065712_100877863 107
365 3300005295 Ga0065707_10721520 Ga0065707_107215201 107
366 3300005295 Ga0065707_10987347 Ga0065707_109873472 107
367 3300005327 Ga0070658_10516094 Ga0070658_105160942 107
368 3300005328 Ga0070676_10000340 Ga0070676_1000034014 107
369 3300005328 Ga0070676_10017698 Ga0070676_100176985 107
370 3300005328 Ga0070676_10085446 Ga0070676_100854462 107
371 3300005328 Ga0070676_10200590 Ga0070676_102005902 107
372 3300005328 Ga0070676_10890368 Ga0070676_108903681 107
373 3300005329 Ga0070683_100001004 Ga0070683_10000100410 107
374 3300005329 Ga0070683_100003956 Ga0070683_1000039564 107
375 3300005329 Ga0070683_100187047 Ga0070683_1001870472 107
376 3300005329 Ga0070683_100199184 Ga0070683_1001991842 107
377 3300005329 Ga0070683_101765980 Ga0070683_1017659802 107
378 3300005330 Ga0070690_100003006 Ga0070690_1000030066 107
379 3300005330 Ga0070690_100141322 Ga0070690_1001413222 107
380 3300005330 Ga0070690_100866033 Ga0070690_1008660332 107
381 3300005330 Ga0070690_101499843 Ga0070690_1014998431 107
382 3300005331 Ga0070670_100057109 Ga0070670_1000571092 107
383 3300005331 Ga0070670_100286752 Ga0070670_1002867522 107
384 3300005331 Ga0070670_100426281 Ga0070670_1004262811 107
385 3300005331 Ga0070670_101006189 Ga0070670_1010061892 107
386 3300005333 Ga0070677_10022958 Ga0070677_100229582 107
387 3300005333 Ga0070677_10707447 Ga0070677_107074471 107
388 3300005334 Ga0068869_100000814 Ga0068869_10000081412 107
389 3300005334 Ga0068869_100006000 Ga0068869_1000060004 107
390 3300005334 Ga0068869_100009437 Ga0068869_1000094373 107
391 3300005334 Ga0068869_100034895 Ga0068869_1000348954 107
392 3300005334 Ga0068869_100053625 Ga0068869_1000536254 107
393 3300005334 Ga0068869_100078925 Ga0068869_1000789253 107
394 3300005334 Ga0068869_100117581 Ga0068869_1001175812 107
395 3300005334 Ga0068869_101832079 Ga0068869_1018320791 107
396 3300005335 Ga0070666_10018034 Ga0070666_100180344 107
397 3300005335 Ga0070666_10047710 Ga0070666_100477102 107
398 3300005335 Ga0070666_10392737 Ga0070666_103927372 107
399 3300005336 Ga0070680_101406973 Ga0070680_1014069732 107
400 3300005337 Ga0070682_100015226 Ga0070682_1000152262 107
401 3300005337 Ga0070682_100126080 Ga0070682_1001260803 107
402 3300005337 Ga0070682_100847295 Ga0070682_1008472951 107
403 3300005338 Ga0068868_100001169 Ga0068868_1000011699 107
404 3300005338 Ga0068868_100005060 Ga0068868_1000050606 107
405 3300005338 Ga0068868_100025302 Ga0068868_1000253024 107
406 3300005338 Ga0068868_100159717 Ga0068868_1001597171 107
407 3300005339 Ga0070660_100142017 Ga0070660_1001420172 107
408 3300005339 Ga0070660_100739479 Ga0070660_1007394792 107
409 3300005340 Ga0070689_100026770 Ga0070689_1000267703 107
410 3300005340 Ga0070689_100562504 Ga0070689_1005625042 107
411 3300005340 Ga0070689_100573594 Ga0070689_1005735941 107
412 3300005343 Ga0070687_100563885 Ga0070687_1005638852 107
413 3300005343 Ga0070687_100972578 Ga0070687_1009725782 107
414 3300005344 Ga0070661_100000922 Ga0070661_10000092212 107
415 3300005344 Ga0070661_100033516 Ga0070661_1000335164 107
416 3300005344 Ga0070661_100183306 Ga0070661_1001833063 107
417 3300005344 Ga0070661_101285064 Ga0070661_1012850641 107
418 3300005347 Ga0070668_100017076 Ga0070668_1000170766 107
419 3300005347 Ga0070668_100082150 Ga0070668_1000821502 107
420 3300005347 Ga0070668_100258355 Ga0070668_1002583552 107
421 3300005347 Ga0070668_100347465 Ga0070668_1003474652 107
422 3300005347 Ga0070668_100437687 Ga0070668_1004376872 107
423 3300005353 Ga0070669_100015753 Ga0070669_1000157532 107
424 3300005353 Ga0070669_100037656 Ga0070669_1000376562 107
425 3300005353 Ga0070669_100043024 Ga0070669_1000430242 107
426 3300005354 Ga0070675_100046713 Ga0070675_1000467134 107
427 3300005354 Ga0070675_100075723 Ga0070675_1000757232 107
428 3300005354 Ga0070675_100610286 Ga0070675_1006102861 107
429 3300005355 Ga0070671_100135511 Ga0070671_1001355112 107
430 3300005355 Ga0070671_100467074 Ga0070671_1004670742 107
431 3300005355 Ga0070671_100522016 Ga0070671_1005220162 107
432 3300005356 Ga0070674_100008110 Ga0070674_1000081106 107
433 3300005356 Ga0070674_100021467 Ga0070674_1000214674 107
434 3300005356 Ga0070674_100188454 Ga0070674_1001884541 107
435 3300005364 Ga0070673_100017493 Ga0070673_1000174936 107
436 3300005364 Ga0070673_100020326 Ga0070673_1000203262 107
437 3300005364 Ga0070673_100022986 Ga0070673_1000229863 107
438 3300005364 Ga0070673_100023551 Ga0070673_1000235515 107
439 3300005365 Ga0070688_100015010 Ga0070688_1000150101 107
440 3300005365 Ga0070688_100098477 Ga0070688_1000984772 107
441 3300005366 Ga0070659_100070336 Ga0070659_1000703362 107
442 3300005366 Ga0070659_100151246 Ga0070659_1001512462 107
443 3300005366 Ga0070659_100824509 Ga0070659_1008245091 107
444 3300005367 Ga0070667_100046741 Ga0070667_1000467414 107
445 3300005367 Ga0070667_100074526 Ga0070667_1000745264 107
446 3300005367 Ga0070667_100128173 Ga0070667_1001281732 107
447 3300005367 Ga0070667_100130441 Ga0070667_1001304412 107
448 3300005367 Ga0070667_100339234 Ga0070667_1003392342 107
449 3300005367 Ga0070667_100357374 Ga0070667_1003573742 107
450 3300005367 Ga0070667_101167865 Ga0070667_1011678652 107
451 3300005367 Ga0070667_102248834 Ga0070667_1022488341 107
452 3300005438 Ga0070701_10196341 Ga0070701_101963412 107
453 3300005441 Ga0070700_100447705 Ga0070700_1004477052 107
454 3300005455 Ga0070663_100290961 Ga0070663_1002909611 107
455 3300005455 Ga0070663_100417760 Ga0070663_1004177601 107
456 3300005455 Ga0070663_100761800 Ga0070663_1007618001 107
457 3300005455 Ga0070663_101010045 Ga0070663_1010100452 107
458 3300005455 Ga0070663_101461080 Ga0070663_1014610801 107
459 3300005456 Ga0070678_100008073 Ga0070678_1000080731 107
460 3300005456 Ga0070678_100016088 Ga0070678_1000160884 107
461 3300005456 Ga0070678_100716497 Ga0070678_1007164972 107
462 3300005457 Ga0070662_100004730 Ga0070662_1000047306 107
463 3300005457 Ga0070662_100018859 Ga0070662_1000188595 107
464 3300005457 Ga0070662_100081231 Ga0070662_1000812312 107
465 3300005457 Ga0070662_100207859 Ga0070662_1002078592 107
466 3300005457 Ga0070662_100873016 Ga0070662_1008730162 107
467 3300005458 Ga0070681_11116016 Ga0070681_111160162 107
468 3300005459 Ga0068867_100005364 Ga0068867_1000053645 107
469 3300005459 Ga0068867_100006725 Ga0068867_1000067258 107
470 3300005459 Ga0068867_100026845 Ga0068867_1000268452 107
471 3300005459 Ga0068867_100089568 Ga0068867_1000895682 107
472 3300005459 Ga0068867_101233311 Ga0068867_1012333112 107
473 3300005466 Ga0070685_10123019 Ga0070685_101230192 107
474 3300005466 Ga0070685_10129128 Ga0070685_101291282 107
475 3300005466 Ga0070685_10175524 Ga0070685_101755242 107
476 3300005535 Ga0070684_100000042 Ga0070684_10000004213 107
477 3300005535 Ga0070684_100005415 Ga0070684_1000054156 107
478 3300005535 Ga0070684_100126335 Ga0070684_1001263352 107
479 3300005535 Ga0070684_101548916 Ga0070684_1015489162 107
480 3300005539 Ga0068853_100003672 Ga0068853_1000036729 107
481 3300005539 Ga0068853_100066698 Ga0068853_1000666982 107
482 3300005539 Ga0068853_100457503 Ga0068853_1004575031 107
483 3300005539 Ga0068853_100549427 Ga0068853_1005494272 107
484 3300005539 Ga0068853_100578372 Ga0068853_1005783722 107
485 3300005539 Ga0068853_102215898 Ga0068853_1022158981 107
486 3300005543 Ga0070672_100133825 Ga0070672_1001338252 107
487 3300005543 Ga0070672_100139675 Ga0070672_1001396752 107
488 3300005543 Ga0070672_100506644 Ga0070672_1005066442 107
489 3300005543 Ga0070672_100699958 Ga0070672_1006999582 107
490 3300005544 Ga0070686_100484062 Ga0070686_1004840621 107
491 3300005544 Ga0070686_100900636 Ga0070686_1009006361 107
492 3300005548 Ga0070665_100025483 Ga0070665_1000254832 107
493 3300005548 Ga0070665_100030076 Ga0070665_1000300762 107
494 3300005548 Ga0070665_100599352 Ga0070665_1005993521 107
495 3300005563 Ga0068855_100613771 Ga0068855_1006137712 107
496 3300005564 Ga0070664_100000266 Ga0070664_10000026631 107
497 3300005564 Ga0070664_100087741 Ga0070664_1000877412 107
498 3300005564 Ga0070664_100115621 Ga0070664_1001156212 107
499 3300005564 Ga0070664_100263733 Ga0070664_1002637333 107
500 3300005564 Ga0070664_100880505 Ga0070664_1008805051 107
501 3300005564 Ga0070664_101246263 Ga0070664_1012462632 107
502 3300005577 Ga0068857_100006612 Ga0068857_10000661210 107
503 3300005577 Ga0068857_100257661 Ga0068857_1002576612 107
504 3300005577 Ga0068857_100702373 Ga0068857_1007023732 107
505 3300005577 Ga0068857_101368862 Ga0068857_1013688622 107
506 3300005578 Ga0068854_100021292 Ga0068854_1000212922 107
507 3300005578 Ga0068854_100100913 Ga0068854_1001009131 107
508 3300005578 Ga0068854_100245718 Ga0068854_1002457182 107
509 3300005578 Ga0068854_100314063 Ga0068854_1003140632 107
510 3300005578 Ga0068854_101476586 Ga0068854_1014765861 107
511 3300005615 Ga0070702_100195072 Ga0070702_1001950722 107
512 3300005615 Ga0070702_100463752 Ga0070702_1004637521 107
513 3300005615 Ga0070702_100775468 Ga0070702_1007754682 107
514 3300005615 Ga0070702_101641100 Ga0070702_1016411001 107
515 3300005616 Ga0068852_100045606 Ga0068852_1000456062 107
516 3300005616 Ga0068852_100151694 Ga0068852_1001516943 107
517 3300005616 Ga0068852_101742132 Ga0068852_1017421322 107
518 3300005616 Ga0068852_101908904 Ga0068852_1019089041 107
519 3300005617 Ga0068859_100012944 Ga0068859_1000129449 107
520 3300005617 Ga0068859_100016137 Ga0068859_1000161372 107
521 3300005617 Ga0068859_100016352 Ga0068859_1000163527 107
522 3300005617 Ga0068859_100064024 Ga0068859_1000640243 107
523 3300005617 Ga0068859_100082452 Ga0068859_1000824524 107
524 3300005617 Ga0068859_100806587 Ga0068859_1008065871 107
525 3300005617 Ga0068859_100934465 Ga0068859_1009344652 107
526 3300005618 Ga0068864_100038571 Ga0068864_1000385712 107
527 3300005618 Ga0068864_100048935 Ga0068864_1000489353 107
528 3300005618 Ga0068864_100260246 Ga0068864_1002602461 107
529 3300005618 Ga0068864_100733675 Ga0068864_1007336752 107
530 3300005618 Ga0068864_101635732 Ga0068864_1016357321 107
531 3300005718 Ga0068866_10010298 Ga0068866_100102983 107
532 3300005718 Ga0068866_10021202 Ga0068866_100212023 107
533 3300005718 Ga0068866_10023585 Ga0068866_100235853 107
534 3300005718 Ga0068866_10335842 Ga0068866_103358421 107
535 3300005719 Ga0068861_100051333 Ga0068861_1000513335 107
536 3300005719 Ga0068861_100073767 Ga0068861_1000737673 107
537 3300005719 Ga0068861_100120249 Ga0068861_1001202492 107
538 3300005719 Ga0068861_100279444 Ga0068861_1002794442 107
539 3300005719 Ga0068861_100413833 Ga0068861_1004138331 107
540 3300005719 Ga0068861_100818533 Ga0068861_1008185332 107
541 3300005719 Ga0068861_100938749 Ga0068861_1009387492 107
542 3300005834 Ga0068851_10777152 Ga0068851_107771522 107
543 3300005840 Ga0068870_10016162 Ga0068870_100161623 107
544 3300005840 Ga0068870_10041994 Ga0068870_100419943 107
545 3300005841 Ga0068863_100029026 Ga0068863_1000290262 107
546 3300005841 Ga0068863_100090425 Ga0068863_1000904251 107
547 3300005841 Ga0068863_100448448 Ga0068863_1004484482 107
548 3300005841 Ga0068863_100694585 Ga0068863_1006945852 107
549 3300005842 Ga0068858_100012456 Ga0068858_1000124563 107
550 3300005842 Ga0068858_100187834 Ga0068858_1001878342 107
551 3300005842 Ga0068858_100532078 Ga0068858_1005320782 107
552 3300005842 Ga0068858_101198172 Ga0068858_1011981722 107
553 3300005842 Ga0068858_101373923 Ga0068858_1013739231 107
554 3300005843 Ga0068860_100023035 Ga0068860_1000230356 107
555 3300005843 Ga0068860_100062721 Ga0068860_1000627213 107
556 3300005843 Ga0068860_100307542 Ga0068860_1003075422 107
557 3300005843 Ga0068860_100532188 Ga0068860_1005321882 107
558 3300005843 Ga0068860_100953218 Ga0068860_1009532182 107
559 3300005843 Ga0068860_102002419 Ga0068860_1020024191 107
560 3300005844 Ga0068862_100059921 Ga0068862_1000599213 107
561 3300005844 Ga0068862_100098588 Ga0068862_1000985883 107
562 3300005844 Ga0068862_100799465 Ga0068862_1007994652 107
563 3300005844 Ga0068862_100919936 Ga0068862_1009199362 107
564 3300005844 Ga0068862_101029043 Ga0068862_1010290432 107
565 3300006163 Ga0070715_10078967 Ga0070715_100789672 107
566 3300006163 Ga0070715_10647350 Ga0070715_106473502 107
567 3300006195 Ga0075366_10040177 Ga0075366_100401773 107
568 3300006195 Ga0075366_10049611 Ga0075366_100496112 107
569 3300006237 Ga0097621_100007404 Ga0097621_1000074047 107
570 3300006237 Ga0097621_100120076 Ga0097621_1001200763 107
571 3300006237 Ga0097621_100890285 Ga0097621_1008902851 107
572 3300006358 Ga0068871_100054184 Ga0068871_1000541842 107
573 3300006358 Ga0068871_100487356 Ga0068871_1004873562 107
574 3300006358 Ga0068871_100537308 Ga0068871_1005373081 107
575 3300006358 Ga0068871_100704530 Ga0068871_1007045302 107
576 3300006358 Ga0068871_102118768 Ga0068871_1021187681 107
577 3300006844 Ga0075428_100638233 Ga0075428_1006382332 107
578 3300006871 Ga0075434_100162609 Ga0075434_1001626092 107
579 3300006871 Ga0075434_101974918 Ga0075434_1019749181 107
580 3300006881 Ga0068865_100019851 Ga0068865_1000198513 107
581 3300006881 Ga0068865_100274456 Ga0068865_1002744562 107
582 3300006881 Ga0068865_100357204 Ga0068865_1003572042 107
583 3300006881 Ga0068865_100379802 Ga0068865_1003798022 107
584 3300006931 Ga0097620_100012943 Ga0097620_1000129439 107
585 3300006931 Ga0097620_100016137 Ga0097620_1000161372 107
586 3300006931 Ga0097620_100016353 Ga0097620_1000163537 107
587 3300006931 Ga0097620_100064027 Ga0097620_1000640273 107
588 3300006931 Ga0097620_100082448 Ga0097620_1000824484 107
589 3300006931 Ga0097620_100806637 Ga0097620_1008066372 107
590 3300006931 Ga0097620_100934328 Ga0097620_1009343282 107
591 3300009011 Ga0105251_10045746 Ga0105251_100457462 107
592 3300009094 Ga0111539_10052316 Ga0111539_100523165 107
593 3300009101 Ga0105247_10002375 Ga0105247_100023754 107
594 3300009101 Ga0105247_10935152 Ga0105247_109351521 107
595 3300009147 Ga0114129_10239923 Ga0114129_102399234 107
596 3300009148 Ga0105243_10758784 Ga0105243_107587842 107
597 3300009174 Ga0105241_10064271 Ga0105241_100642713 107
598 3300009174 Ga0105241_10160475 Ga0105241_101604753 107
599 3300009174 Ga0105241_10826120 Ga0105241_108261201 107
600 3300009174 Ga0105241_11318747 Ga0105241_113187472 107
601 3300009176 Ga0105242_10012464 Ga0105242_100124644 107
602 3300009176 Ga0105242_10023748 Ga0105242_100237482 107
603 3300009176 Ga0105242_10152188 Ga0105242_101521881 107
604 3300009176 Ga0105242_10338183 Ga0105242_103381832 107
605 3300009176 Ga0105242_10350791 Ga0105242_103507912 107
606 3300009176 Ga0105242_10972450 Ga0105242_109724501 107
607 3300009177 Ga0105248_10751547 Ga0105248_107515472 107
608 3300009177 Ga0105248_11834692 Ga0105248_118346921 107
609 3300009177 Ga0105248_11895292 Ga0105248_118952921 107
610 3300009545 Ga0105237_10235089 Ga0105237_102350892 107
611 3300009551 Ga0105238_11202961 Ga0105238_112029611 107
612 3300009553 Ga0105249_10015985 Ga0105249_100159854 107
613 3300009553 Ga0105249_10061023 Ga0105249_100610232 107
614 3300009553 Ga0105249_10070285 Ga0105249_100702853 107
615 3300009553 Ga0105249_10077543 Ga0105249_100775431 107
616 3300009553 Ga0105249_10204206 Ga0105249_102042062 107
617 3300009553 Ga0105249_10460531 Ga0105249_104605312 107
618 3300009553 Ga0105249_11483727 Ga0105249_114837271 107
619 3300010375 Ga0105239_10631921 Ga0105239_106319212 107
620 3300010375 Ga0105239_10691313 Ga0105239_106913131 107
621 3300010375 Ga0105239_10878834 Ga0105239_108788342 107
622 3300011119 Ga0105246_10173321 Ga0105246_101733213 107
623 3300011119 Ga0105246_12116545 Ga0105246_121165451 107
624 3300013100 Ga0157373_10249750 Ga0157373_102497502 107
625 3300013100 Ga0157373_10249987 Ga0157373_102499871 107
626 3300013100 Ga0157373_10988032 Ga0157373_109880321 107
627 3300013100 Ga0157373_11157404 Ga0157373_111574041 107
628 3300013102 Ga0157371_10190841 Ga0157371_101908412 107
629 3300013102 Ga0157371_10588824 Ga0157371_105888241 107
630 3300013102 Ga0157371_11042238 Ga0157371_110422382 107
631 3300013296 Ga0157374_10003156 Ga0157374_1000315610 107
632 3300013296 Ga0157374_10014456 Ga0157374_100144569 107
633 3300013296 Ga0157374_10061563 Ga0157374_100615632 107
634 3300013296 Ga0157374_10062669 Ga0157374_100626692 107
635 3300013296 Ga0157374_11678788 Ga0157374_116787882 107
636 3300013297 Ga0157378_10072175 Ga0157378_100721753 107
637 3300013297 Ga0157378_10104662 Ga0157378_101046623 107
638 3300013297 Ga0157378_10119493 Ga0157378_101194933 107
639 3300013297 Ga0157378_10539166 Ga0157378_105391662 107
640 3300013297 Ga0157378_10759312 Ga0157378_107593122 107
641 3300013306 Ga0163162_10014394 Ga0163162_100143944 107
642 3300013306 Ga0163162_10022713 Ga0163162_100227136 107
643 3300013306 Ga0163162_10024304 Ga0163162_100243042 107
644 3300013306 Ga0163162_10238238 Ga0163162_102382382 107
645 3300013306 Ga0163162_10556412 Ga0163162_105564122 107
646 3300013306 Ga0163162_11303811 Ga0163162_113038111 107
647 3300013307 Ga0157372_10998344 Ga0157372_109983441 107
648 3300013307 Ga0157372_11486242 Ga0157372_114862421 107
649 3300013308 Ga0157375_10010150 Ga0157375_100101509 107
650 3300013308 Ga0157375_10091006 Ga0157375_100910063 107
651 3300013308 Ga0157375_10174426 Ga0157375_101744262 107
652 3300013308 Ga0157375_10332365 Ga0157375_103323652 107
653 3300013308 Ga0157375_11340750 Ga0157375_113407502 107
654 3300013308 Ga0157375_11551831 Ga0157375_115518312 107
655 3300014325 Ga0163163_10001563 Ga0163163_1000156311 107
656 3300014325 Ga0163163_10309897 Ga0163163_103098972 107
657 3300014325 Ga0163163_10385178 Ga0163163_103851781 107
658 3300014325 Ga0163163_10731420 Ga0163163_107314202 107
659 3300014325 Ga0163163_11037756 Ga0163163_110377561 107
660 3300014326 Ga0157380_10492957 Ga0157380_104929571 107
661 3300014326 Ga0157380_10744334 Ga0157380_107443341 107
662 3300014745 Ga0157377_10017170 Ga0157377_100171704 107
663 3300014745 Ga0157377_10094906 Ga0157377_100949062 107
664 3300014968 Ga0157379_10047219 Ga0157379_100472194 107
665 3300014968 Ga0157379_10055113 Ga0157379_100551132 107
666 3300014968 Ga0157379_10114814 Ga0157379_101148144 107
667 3300014968 Ga0157379_10295217 Ga0157379_102952173 107
668 3300014969 Ga0157376_10022781 Ga0157376_100227813 107
669 3300014969 Ga0157376_10198238 Ga0157376_101982382 107
670 3300014969 Ga0157376_10217360 Ga0157376_102173602 107
671 3300014969 Ga0157376_10631607 Ga0157376_106316072 107
672 3300014969 Ga0157376_12362432 Ga0157376_123624321 107
673 3300017792 Ga0163161_10823061 Ga0163161_108230611 107
674 3300020080 Ga0206350_11435478 Ga0206350_114354782 107
675 3300020081 Ga0206354_10273940 Ga0206354_102739401 107
676 3300025271 Ga0207666_1015809 Ga0207666_10158092 107
677 3300025290 Ga0207673_1025405 Ga0207673_10254052 107
678 3300025315 Ga0207697_10021574 Ga0207697_100215743 107
679 3300025315 Ga0207697_10033727 Ga0207697_100337273 107
680 3300025315 Ga0207697_10311372 Ga0207697_103113722 107
681 3300025321 Ga0207656_10241468 Ga0207656_102414682 107
682 3300025893 Ga0207682_10029024 Ga0207682_100290242 107
683 3300025893 Ga0207682_10367146 Ga0207682_103671461 107
684 3300025899 Ga0207642_10004642 Ga0207642_100046424 107
685 3300025899 Ga0207642_10061353 Ga0207642_100613532 107
686 3300025899 Ga0207642_10103122 Ga0207642_101031221 107
687 3300025899 Ga0207642_11144001 Ga0207642_111440011 107
688 3300025900 Ga0207710_10006643 Ga0207710_100066435 107
689 3300025901 Ga0207688_10058350 Ga0207688_100583502 107
690 3300025901 Ga0207688_10468924 Ga0207688_104689241 107
691 3300025903 Ga0207680_10032788 Ga0207680_100327882 107
692 3300025903 Ga0207680_10267887 Ga0207680_102678872 107
693 3300025904 Ga0207647_10013718 Ga0207647_100137183 107
694 3300025904 Ga0207647_10104095 Ga0207647_101040952 107
695 3300025905 Ga0207685_10498195 Ga0207685_104981951 107
696 3300025907 Ga0207645_10001491 Ga0207645_100014917 107
697 3300025907 Ga0207645_10004909 Ga0207645_1000490911 107
698 3300025907 Ga0207645_10023123 Ga0207645_100231232 107
699 3300025907 Ga0207645_10154585 Ga0207645_101545853 107
700 3300025907 Ga0207645_10400899 Ga0207645_104008992 107
701 3300025908 Ga0207643_10009019 Ga0207643_100090194 107
702 3300025908 Ga0207643_10054565 Ga0207643_100545652 107
703 3300025908 Ga0207643_10248003 Ga0207643_102480031 107
704 3300025911 Ga0207654_10272411 Ga0207654_102724112 107
705 3300025911 Ga0207654_10419197 Ga0207654_104191972 107
706 3300025911 Ga0207654_10697594 Ga0207654_106975942 107
707 3300025919 Ga0207657_10185647 Ga0207657_101856472 107
708 3300025920 Ga0207649_10000644 Ga0207649_1000064410 107
709 3300025920 Ga0207649_10385775 Ga0207649_103857752 107
710 3300025923 Ga0207681_10003840 Ga0207681_100038406 107
711 3300025923 Ga0207681_10065387 Ga0207681_100653872 107
712 3300025923 Ga0207681_10080903 Ga0207681_100809032 107
713 3300025923 Ga0207681_10425614 Ga0207681_104256142 107
714 3300025923 Ga0207681_10958497 Ga0207681_109584971 107
715 3300025925 Ga0207650_10013869 Ga0207650_100138697 107
716 3300025925 Ga0207650_10062858 Ga0207650_100628582 107
717 3300025925 Ga0207650_10167710 Ga0207650_101677102 107
718 3300025925 Ga0207650_11031792 Ga0207650_110317921 107
719 3300025925 Ga0207650_11298831 Ga0207650_112988311 107
720 3300025925 Ga0207650_11716284 Ga0207650_117162841 107
721 3300025926 Ga0207659_10072911 Ga0207659_100729112 107
722 3300025926 Ga0207659_10228918 Ga0207659_102289181 107
723 3300025931 Ga0207644_10085680 Ga0207644_100856802 107
724 3300025931 Ga0207644_10114518 Ga0207644_101145181 107
725 3300025931 Ga0207644_10178954 Ga0207644_101789542 107
726 3300025932 Ga0207690_10050038 Ga0207690_100500382 107
727 3300025933 Ga0207706_10023357 Ga0207706_100233573 107
728 3300025933 Ga0207706_10027153 Ga0207706_100271535 107
729 3300025933 Ga0207706_10032203 Ga0207706_100322035 107
730 3300025933 Ga0207706_10043173 Ga0207706_100431735 107
731 3300025933 Ga0207706_10079253 Ga0207706_100792533 107
732 3300025933 Ga0207706_10124679 Ga0207706_101246793 107
733 3300025934 Ga0207686_10091395 Ga0207686_100913952 107
734 3300025934 Ga0207686_10144137 Ga0207686_101441372 107
735 3300025934 Ga0207686_10415035 Ga0207686_104150352 107
736 3300025934 Ga0207686_10617505 Ga0207686_106175051 107
737 3300025934 Ga0207686_10722194 Ga0207686_107221941 107
738 3300025934 Ga0207686_10889760 Ga0207686_108897601 107
739 3300025935 Ga0207709_10780416 Ga0207709_107804161 107
740 3300025936 Ga0207670_10214606 Ga0207670_102146063 107
741 3300025936 Ga0207670_11002599 Ga0207670_110025991 107
742 3300025937 Ga0207669_10060773 Ga0207669_100607733 107
743 3300025937 Ga0207669_10083926 Ga0207669_100839263 107
744 3300025937 Ga0207669_10170167 Ga0207669_101701672 107
745 3300025938 Ga0207704_10098240 Ga0207704_100982403 107
746 3300025938 Ga0207704_10164213 Ga0207704_101642132 107
747 3300025938 Ga0207704_10181946 Ga0207704_101819461 107
748 3300025938 Ga0207704_11624245 Ga0207704_116242451 107
749 3300025940 Ga0207691_10009018 Ga0207691_100090189 107
750 3300025940 Ga0207691_10159330 Ga0207691_101593302 107
751 3300025940 Ga0207691_10174361 Ga0207691_101743612 107
752 3300025940 Ga0207691_10191807 Ga0207691_101918073 107
753 3300025941 Ga0207711_10267123 Ga0207711_102671232 107
754 3300025942 Ga0207689_10001227 Ga0207689_1000122722 107
755 3300025942 Ga0207689_10001306 Ga0207689_1000130619 107
756 3300025942 Ga0207689_10005140 Ga0207689_100051403 107
757 3300025942 Ga0207689_10008581 Ga0207689_100085815 107
758 3300025942 Ga0207689_10032199 Ga0207689_100321996 107
759 3300025942 Ga0207689_10059258 Ga0207689_100592582 107
760 3300025942 Ga0207689_10067810 Ga0207689_100678102 107
761 3300025942 Ga0207689_10121552 Ga0207689_101215523 107
762 3300025942 Ga0207689_10854575 Ga0207689_108545751 107
763 3300025944 Ga0207661_10000781 Ga0207661_100007819 107
764 3300025944 Ga0207661_10161528 Ga0207661_101615282 107
765 3300025944 Ga0207661_10325833 Ga0207661_103258332 107
766 3300025945 Ga0207679_10000733 Ga0207679_1000073313 107
767 3300025945 Ga0207679_10072529 Ga0207679_100725294 107
768 3300025945 Ga0207679_10141082 Ga0207679_101410821 107
769 3300025945 Ga0207679_10156009 Ga0207679_101560092 107
770 3300025945 Ga0207679_10249089 Ga0207679_102490892 107
771 3300025945 Ga0207679_10435024 Ga0207679_104350242 107
772 3300025945 Ga0207679_10615805 Ga0207679_106158052 107
773 3300025949 Ga0207667_11603226 Ga0207667_116032261 107
774 3300025960 Ga0207651_10072501 Ga0207651_100725011 107
775 3300025960 Ga0207651_10216789 Ga0207651_102167892 107
776 3300025960 Ga0207651_10264575 Ga0207651_102645752 107
777 3300025961 Ga0207712_10013550 Ga0207712_100135506 107
778 3300025961 Ga0207712_10047438 Ga0207712_100474382 107
779 3300025961 Ga0207712_10056675 Ga0207712_100566752 107
780 3300025961 Ga0207712_10113360 Ga0207712_101133602 107
781 3300025961 Ga0207712_10115165 Ga0207712_101151652 107
782 3300025961 Ga0207712_10904136 Ga0207712_109041362 107
783 3300025961 Ga0207712_11121198 Ga0207712_111211981 107
784 3300025961 Ga0207712_11673634 Ga0207712_116736341 107
785 3300025972 Ga0207668_10106752 Ga0207668_101067523 107
786 3300025972 Ga0207668_10374600 Ga0207668_103746002 107
787 3300025972 Ga0207668_11525417 Ga0207668_115254171 107
788 3300025972 Ga0207668_11884211 Ga0207668_118842111 107
789 3300025972 Ga0207668_12001922 Ga0207668_120019221 107
790 3300025981 Ga0207640_10045009 Ga0207640_100450093 107
791 3300025981 Ga0207640_10111724 Ga0207640_101117242 107
792 3300025981 Ga0207640_10210025 Ga0207640_102100252 107
793 3300025981 Ga0207640_10452051 Ga0207640_104520512 107
794 3300025981 Ga0207640_10936226 Ga0207640_109362262 107
795 3300025986 Ga0207658_10060668 Ga0207658_100606683 107
796 3300025986 Ga0207658_10089383 Ga0207658_100893833 107
797 3300025986 Ga0207658_10155481 Ga0207658_101554812 107
798 3300025986 Ga0207658_10195342 Ga0207658_101953422 107
799 3300025986 Ga0207658_10199918 Ga0207658_101999182 107
800 3300025986 Ga0207658_10256647 Ga0207658_102566472 107
801 3300025986 Ga0207658_11220733 Ga0207658_112207332 107
802 3300026023 Ga0207677_10026950 Ga0207677_100269505 107
803 3300026023 Ga0207677_10098217 Ga0207677_100982172 107
804 3300026023 Ga0207677_10357321 Ga0207677_103573212 107
805 3300026023 Ga0207677_10526548 Ga0207677_105265482 107
806 3300026035 Ga0207703_10864410 Ga0207703_108644102 107
807 3300026035 Ga0207703_10958773 Ga0207703_109587732 107
808 3300026035 Ga0207703_11001954 Ga0207703_110019541 107
809 3300026035 Ga0207703_11836455 Ga0207703_118364551 107
810 3300026035 Ga0207703_12388597 Ga0207703_123885972 107
811 3300026041 Ga0207639_10005779 Ga0207639_100057797 107
812 3300026041 Ga0207639_10041435 Ga0207639_100414354 107
813 3300026041 Ga0207639_10479747 Ga0207639_104797472 107
814 3300026041 Ga0207639_10794847 Ga0207639_107948471 107
815 3300026067 Ga0207678_10677097 Ga0207678_106770971 107
816 3300026075 Ga0207708_10044948 Ga0207708_100449484 107
817 3300026075 Ga0207708_10747342 Ga0207708_107473421 107
818 3300026075 Ga0207708_11263794 Ga0207708_112637942 107
819 3300026078 Ga0207702_10713515 Ga0207702_107135152 107
820 3300026088 Ga0207641_10020546 Ga0207641_100205462 107
821 3300026088 Ga0207641_10097845 Ga0207641_100978454 107
822 3300026088 Ga0207641_10337636 Ga0207641_103376362 107
823 3300026088 Ga0207641_11243593 Ga0207641_112435932 107
824 3300026089 Ga0207648_10000906 Ga0207648_1000090610 107
825 3300026089 Ga0207648_10005239 Ga0207648_100052395 107
826 3300026089 Ga0207648_10016291 Ga0207648_100162913 107
827 3300026089 Ga0207648_10018178 Ga0207648_100181782 107
828 3300026089 Ga0207648_10033647 Ga0207648_100336476 107
829 3300026089 Ga0207648_10055713 Ga0207648_100557131 107
830 3300026089 Ga0207648_10179839 Ga0207648_101798392 107
831 3300026089 Ga0207648_10587571 Ga0207648_105875712 107
832 3300026095 Ga0207676_10014205 Ga0207676_100142051 107
833 3300026095 Ga0207676_10025141 Ga0207676_100251415 107
834 3300026095 Ga0207676_10036338 Ga0207676_100363382 107
835 3300026095 Ga0207676_10211820 Ga0207676_102118203 107
836 3300026095 Ga0207676_10855359 Ga0207676_108553592 107
837 3300026095 Ga0207676_11820684 Ga0207676_118206841 107
838 3300026116 Ga0207674_10003645 Ga0207674_1000364510 107
839 3300026116 Ga0207674_10014347 Ga0207674_100143472 107
840 3300026116 Ga0207674_10023297 Ga0207674_100232977 107
841 3300026116 Ga0207674_10371054 Ga0207674_103710542 107
842 3300026116 Ga0207674_10729040 Ga0207674_107290402 107
843 3300026118 Ga0207675_100000496 Ga0207675_10000049618 107
844 3300026118 Ga0207675_100003900 Ga0207675_10000390011 107
845 3300026118 Ga0207675_100094858 Ga0207675_1000948582 107
846 3300026118 Ga0207675_100130700 Ga0207675_1001307005 107
847 3300026118 Ga0207675_100189525 Ga0207675_1001895252 107
848 3300026118 Ga0207675_100361752 Ga0207675_1003617522 107
849 3300026118 Ga0207675_101227108 Ga0207675_1012271081 107
850 3300026118 Ga0207675_101407816 Ga0207675_1014078161 107
851 3300026121 Ga0207683_10004237 Ga0207683_100042377 107
852 3300026121 Ga0207683_10007976 Ga0207683_100079764 107
853 3300026121 Ga0207683_11516036 Ga0207683_115160361 107
854 3300026121 Ga0207683_11943180 Ga0207683_119431801 107
855 3300026142 Ga0207698_10113516 Ga0207698_101135162 107
856 3300026142 Ga0207698_10270413 Ga0207698_102704133 107
857 3300026142 Ga0207698_11069317 Ga0207698_110693172 107
858 3300027471 Ga0209995_1037020 Ga0209995_10370202 107
859 3300027907 Ga0207428_10372498 Ga0207428_103724982 107
860 3300028379 Ga0268266_10480327 Ga0268266_104803272 107
861 3300028379 Ga0268266_11333412 Ga0268266_113334121 107
862 3300028379 Ga0268266_11864541 Ga0268266_118645411 107
863 3300028380 Ga0268265_10008576 Ga0268265_100085763 107
864 3300028380 Ga0268265_10106353 Ga0268265_101063532 107
865 3300028380 Ga0268265_10222975 Ga0268265_102229752 107
866 3300028380 Ga0268265_10854671 Ga0268265_108546712 107
867 3300028380 Ga0268265_11158175 Ga0268265_111581751 107
868 3300028381 Ga0268264_10024319 Ga0268264_100243192 107
869 3300028381 Ga0268264_10055818 Ga0268264_100558183 107
870 3300028381 Ga0268264_10453748 Ga0268264_104537482 107
871 3300028381 Ga0268264_10622929 Ga0268264_106229291 107
872 3300028381 Ga0268264_12172110 Ga0268264_121721101 107
873 3300028381 Ga0268264_12580824 Ga0268264_125808241 107
874 3300028381 Ga0268264_12644500 Ga0268264_126445001 107
875 3300031456 Ga0307513_10574484 Ga0307513_105744842 107
876 3300031507 Ga0307509_10491177 Ga0307509_104911771 107
877 3300031507 Ga0307509_10640912 Ga0307509_106409121 107
878 3300031548 Ga0307408_101094699 Ga0307408_1010946991 107
879 3300031852 Ga0307410_11164357 Ga0307410_111643571 107
880 3300031995 Ga0307409_100575929 Ga0307409_1005759292 107
881 3300032002 Ga0307416_100218735 Ga0307416_1002187352 107
882 3300032002 Ga0307416_100662298 Ga0307416_1006622981 107
883 3300032005 Ga0307411_10784192 Ga0307411_107841922 107
884 3300035086 Ga0373934_0024614 Ga0373934_0024614_1134_1472 107
885 3300035120 Ga0373957_0129104 Ga0373957_0129104_166_504 107
886 3300035172 Ga0373955_0342799 Ga0373955_0342799_412_750 107
887 3300035410 Ga0373924_0035738 Ga0373924_0035738_881_1219 107
888 3300035692 Ga0373935_0395323 Ga0373935_0395323_143_481 107
889 3300035724 Ga0373933_1154390 Ga0373933_1154390_37_375 107
890 3300035725 Ga0373947_0057918 Ga0373947_0057918_1177_1515 107
891 3300035725 Ga0373947_1084024 Ga0373947_1084024_112_450 107
892 3300036401 Ga0373937_0156276 Ga0373937_0156276_1331_1669 107
893 3300037068 Ga0373925_0409562 Ga0373925_0409562_188_526 107
894 3300041407 Ga0439447_055322 Ga0439447_055322_349_687 107
895 3300041413 Ga0439465_0018267 Ga0439465_0018267_1458_1796 107
896 3300041413 Ga0439465_0018786 Ga0439465_0018786_851_1189 107
897 3300041441 Ga0451787_175855 Ga0451787_175855_483_869 107
898 3300041443 Ga0451789_0302099 Ga0451789_0302099_25_363 107
899 3300041451 Ga0451791_0474555 Ga0451791_0474555_246_584 107
900 3300041459 Ga0451800_0208990 Ga0451800_0208990_16_354 107
901 3300041486 Ga0451807_0825022 Ga0451807_0825022_395_733 107
902 3300041486 Ga0451807_1196384 Ga0451807_1196384_295_633 107
903 3300041486 Ga0451807_1403346 Ga0451807_1403346_61_399 107
904 3300041511 Ga0451855_1068511 Ga0451855_1068511_51_437 107
905 3300041997 Ga0439431_0024267 Ga0439431_0024267_579_917 107
906 3300042002 Ga0439442_006943 Ga0439442_006943_1730_2068 107
907 3300042004 Ga0439445_0046399 Ga0439445_0046399_598_936 107
908 3300042007 Ga0439449_0176728 Ga0439449_0176728_127_465 107
909 3300042010 Ga0439452_031447 Ga0439452_031447_589_927 107
910 3300042014 Ga0439457_010179 Ga0439457_010179_1421_1759 107
911 3300042124 Ga0450922_032820 Ga0450922_032820_97_435 107
912 3300042125 Ga0450923_074150 Ga0450923_074150_96_434 107
913 3300042128 Ga0450897_000424 Ga0450897_000424_1608_1946 107
914 3300042131 Ga0450894_017598 Ga0450894_017598_398_736 107
915 3300042134 Ga0450898_007895 Ga0450898_007895_1294_1632 107
916 3300042135 Ga0450899_017547 Ga0450899_017547_271_609 107
917 3300042156 Ga0439446_0145801 Ga0439446_0145801_172_510 107
918 3300042185 Ga0450909_075809 Ga0450909_075809_25_363 107
919 3300042435 Ga0439434_0021642 Ga0439434_0021642_589_927 107
920 3300044658 Ga0466972_0397662 Ga0466972_0397662_153_491 107
921 3300044673 Ga0453683_0965757 Ga0453683_0965757_134_472 107
922 3300044683 Ga0466965_0263098 Ga0466965_0263098_379_702 107
923 3300046454 Ga0495592_0216098 Ga0495592_0216098_824_1162 107
924 3300046459 Ga0495629_0257410 Ga0495629_0257410_142_480 107
925 3300046463 Ga0495653_0308387 Ga0495653_0308387_581_919 107
926 3300046511 Ga0495608_0235595 Ga0495608_0235595_542_880 107
927 3300046514 Ga0495618_0310230 Ga0495618_0310230_401_739 107
928 3300046516 Ga0495628_0300099 Ga0495628_0300099_526_864 107
929 3300046517 Ga0495630_0397373 Ga0495630_0397373_699_1037 107
930 3300046543 Ga0495645_0822106 Ga0495645_0822106_25_363 107
931 3300046559 Ga0495667_0073158 Ga0495667_0073158_1650_1988 107
932 3300046660 Ga0495625_0711521 Ga0495625_0711521_109_447 107
933 3300046675 Ga0495657_0337428 Ga0495657_0337428_264_602 107
934 3300046809 Ga0495600_0236075 Ga0495600_0236075_548_886 107
935 3300047319 Ga0495674_0558200 Ga0495674_0558200_345_683 107
936 3300047320 Ga0495672_0062722 Ga0495672_0062722_741_1067 107
937 3300047321 Ga0495676_0398433 Ga0495676_0398433_281_619 107
938 3300047321 Ga0495676_0626630 Ga0495676_0626630_214_552 107
939 3300047471 Ga0495684_0625569 Ga0495684_0625569_277_615 107
940 3300048904 Ga0496101_0548459 Ga0496101_0548459_294_632 107
941 3300048907 Ga0496104_1137122 Ga0496104_1137122_34_372 107
942 3300048908 Ga0496105_0817204 Ga0496105_0817204_251_589 107
943 3300048908 Ga0496105_1210400 Ga0496105_1210400_202_540 107
944 3300048911 Ga0496108_0404646 Ga0496108_0404646_605_943 107
945 3300048912 Ga0496109_0820303 Ga0496109_0820303_267_605 107
946 3300048913 Ga0496110_0155711 Ga0496110_0155711_1224_1562 107
947 3300048913 Ga0496110_1141114 Ga0496110_1141114_37_375 107
948 3300048914 Ga0496111_0152411 Ga0496111_0152411_1010_1348 107
949 3300048914 Ga0496111_0704150 Ga0496111_0704150_293_631 107
950 3300048915 Ga0496112_0971154 Ga0496112_0971154_266_604 107
951 3300048915 Ga0496112_1559510 Ga0496112_1559510_181_519 107
952 3300049521 Ga0501298_038717 Ga0501298_038717_243_566 107
953 3300049568 Ga0501031_0026007 Ga0501031_0026007_693_1031 107
954 3300049569 Ga0501032_0010076 Ga0501032_0010076_4558_4881 107
955 3300049569 Ga0501032_0043622 Ga0501032_0043622_1674_2012 107
956 3300049570 Ga0501033_0111743 Ga0501033_0111743_432_755 107
957 3300049571 Ga0501034_0023352 Ga0501034_0023352_5381_5704 107
958 3300049571 Ga0501034_0180504 Ga0501034_0180504_1044_1382 107
959 3300049571 Ga0501034_0966504 Ga0501034_0966504_63_386 107
960 3300049572 Ga0501036_0043431 Ga0501036_0043431_3048_3371 107
961 3300049572 Ga0501036_0079155 Ga0501036_0079155_1171_1509 107
962 3300049573 Ga0501037_0021694 Ga0501037_0021694_1081_1419 107
963 3300049574 Ga0501038_0021012 Ga0501038_0021012_439_777 107
964 3300049574 Ga0501038_0131224 Ga0501038_0131224_921_1244 107
965 3300049575 Ga0501039_0337383 Ga0501039_0337383_680_1018 107
966 3300049579 Ga0501043_0050958 Ga0501043_0050958_311_634 107
967 3300049579 Ga0501043_0091378 Ga0501043_0091378_166_504 107
968 3300049580 Ga0501046_0006756 Ga0501046_0006756_8708_9046 107
969 3300049580 Ga0501046_0272495 Ga0501046_0272495_409_732 107
970 3300049581 Ga0501047_0178701 Ga0501047_0178701_1390_1713 107
971 3300049581 Ga0501047_0245711 Ga0501047_0245711_133_471 107
972 3300049582 Ga0501048_0597865 Ga0501048_0597865_457_780 107
973 3300049588 Ga0501072_1430110 Ga0501072_1430110_146_484 107
974 3300049652 Ga0501202_236393 Ga0501202_236393_109_432 107
975 3300049676 Ga0501246_034226 Ga0501246_034226_118_441 107
976 3300049679 Ga0501249_058812 Ga0501249_058812_146_469 107
977 3300049703 Ga0501219_000098 Ga0501219_000098_4588_4911 107
978 3300049758 Ga0501241_008833 Ga0501241_008833_112_435 107
979 3300049822 Ga0501035_0004551 Ga0501035_0004551_529_867 107
980 3300049822 Ga0501035_0028671 Ga0501035_0028671_1406_1729 107
981 3300049823 Ga0501044_0021980 Ga0501044_0021980_2244_2582 107
982 3300049823 Ga0501044_0052997 Ga0501044_0052997_1727_2050 107
983 3300049824 Ga0501045_0680010 Ga0501045_0680010_224_562 107
984 3300049824 Ga0501045_0751636 Ga0501045_0751636_101_424 107
985 3300050005 Ga0501284_00036 Ga0501284_00036_8213_8536 107
986 3300050493 nmdc:mga0k408_3233_c1 nmdc:mga0k408_3233_c1_5131_5457 107
987 3300050493 nmdc:mga0k408_355923_c1 nmdc:mga0k408_355923_c1_212_550 107
988 3300050493 nmdc:mga0k408_76325_c1 nmdc:mga0k408_76325_c1_1017_1355 107
989 3300050508 nmdc:mga09592_19360_c1 nmdc:mga09592_19360_c1_3236_3559 107
990 3300050511 nmdc:mga08y16_304943_c1 nmdc:mga08y16_304943_c1_838_1176 107
991 3300050512 nmdc:mga0n895_125677_c1 nmdc:mga0n895_125677_c1_1065_1403 107
992 3300050512 nmdc:mga0n895_1599605_c1 nmdc:mga0n895_1599605_c1_203_541 107
993 3300053085 Ga0495619_0145973 Ga0495619_0145973_982_1320 107
994 3300053129 Ga0500628_066294 Ga0500628_066294_522_860 107
995 3300053139 Ga0500568_0000459 Ga0500568_0000459_25372_25710 107
996 3300053153 Ga0500616_0400153 Ga0500616_0400153_151_489 107
997 3300053727 Ga0500611_000008 Ga0500611_000008_62993_63331 107
998 3300059511 Ga0587091_112400 Ga0587091_112400_85_423 107
999 3300005578 Ga0068854_101557294 Ga0068854_1015572942 108
1000 3300005578 Ga0068854_102263412 Ga0068854_1022634121 108
1001 3300006237 Ga0097621_100538930 Ga0097621_1005389302 108
1002 3300006358 Ga0068871_101187381 Ga0068871_1011873811 108
1003 3300006871 Ga0075434_101171273 Ga0075434_1011712731 108
1004 3300009176 Ga0105242_12246589 Ga0105242_122465891 108
1005 3300009553 Ga0105249_10997775 Ga0105249_109977752 108
1006 3300013297 Ga0157378_10151173 Ga0157378_101511731 108
1007 3300025981 Ga0207640_11795081 Ga0207640_117950811 108
1008 3300026116 Ga0207674_10237708 Ga0207674_102377082 108
1009 3300050512 nmdc:mga0n895_911130_c1 nmdc:mga0n895_911130_c1_65_412 108
1010 3300005331 Ga0070670_101101227 Ga0070670_1011012271 109
1011 3300005336 Ga0070680_100958779 Ga0070680_1009587792 109
1012 3300005340 Ga0070689_101278567 Ga0070689_1012785671 109
1013 3300005539 Ga0068853_100010717 Ga0068853_1000107172 109
1014 3300009553 Ga0105249_10620684 Ga0105249_106206842 109
1015 3300026041 Ga0207639_10007423 Ga0207639_100074232 109
1016 3300049514 Ga0501291_044826 Ga0501291_044826_27_359 109
1017 3300005616 Ga0068852_101703159 Ga0068852_1017031591 110
1018 3300053156 Ga0500622_0001989 Ga0500622_0001989_11695_12027 110
1019 3300053730 Ga0500645_009288 Ga0500645_009288_2668_3000 110
1020 3300055283 Ga0500661_001406 Ga0500661_001406_1321_1653 110
1021 3300005616 Ga0068852_101898050 Ga0068852_1018980501 111
1022 3300009098 Ga0105245_11105189 Ga0105245_111051892 111
1023 3300013296 Ga0157374_10567574 Ga0157374_105675742 111
1024 3300031251 Ga0265327_10015792 Ga0265327_100157923 111
1025 3300039437 Ga0436365_1917912 Ga0436365_1917912_3425_3760 111
1026 3300041486 Ga0451807_1125245 Ga0451807_1125245_548_883 111
1027 3300049570 Ga0501033_0018072 Ga0501033_0018072_4405_4740 111
1028 3300049571 Ga0501034_0005034 Ga0501034_0005034_13424_13759 111
1029 3300049590 Ga0501074_1076566 Ga0501074_1076566_33_368 111
1030 3300049742 Ga0501080_0301267 Ga0501080_0301267_765_1100 111
1031 3300049742 Ga0501080_0491848 Ga0501080_0491848_612_947 111
1032 3300053098 Ga0500650_0466189 Ga0500650_0466189_64_399 111
1033 3300005327 Ga0070658_10459066 Ga0070658_104590661 112
1034 3300005366 Ga0070659_101137156 Ga0070659_1011371562 112
1035 3300013104 Ga0157370_11847793 Ga0157370_118477931 112
1036 3300020078 Ga0206352_10819092 Ga0206352_108190922 112
1037 3300026121 Ga0207683_11878587 Ga0207683_118785871 112
1038 3300037312 Ga0395899_0189212 Ga0395899_0189212_576_923 112
1039 3300037418 Ga0395900_0232969 Ga0395900_0232969_278_625 112
1040 3300044842 Ga0466957_0391781 Ga0466957_0391781_228_575 112
1041 3300005834 Ga0068851_10772991 Ga0068851_107729911 114
1042 3300005843 Ga0068860_101590741 Ga0068860_1015907411 114
1043 3300014969 Ga0157376_11151127 Ga0157376_111511271 114
1044 3300028381 Ga0268264_10798299 Ga0268264_107982992 114
1045 3300002077 JGI24744J21845_10004710 JGI24744J21845_100047103 115
1046 3300005459 Ga0068867_100133475 Ga0068867_1001334753 115
1047 3300013104 Ga0157370_10008665 Ga0157370_100086654 115
1048 3300013306 Ga0163162_10012546 Ga0163162_100125461 115
1049 3300026089 Ga0207648_10066109 Ga0207648_100661092 115
1050 3300041460 Ga0451802_0225735 Ga0451802_0225735_19_369 115
1051 3300049571 Ga0501034_0000007 Ga0501034_0000007_36782_37132 115
1052 3300046616 Ga0495668_0000114 Ga0495668_0000114_35836_36186 116
1053 3300002067 JGI24735J21928_10120710 JGI24735J21928_101207101 117
1054 3300004799 Ga0058863_11581661 Ga0058863_115816611 117
1055 3300004803 Ga0058862_12659472 Ga0058862_126594722 117
1056 3300005327 Ga0070658_10012624 Ga0070658_100126244 117
1057 3300005327 Ga0070658_10029509 Ga0070658_100295095 117
1058 3300005327 Ga0070658_10126103 Ga0070658_101261032 117
1059 3300005327 Ga0070658_10229184 Ga0070658_102291841 117
1060 3300005327 Ga0070658_10550401 Ga0070658_105504012 117
1061 3300005327 Ga0070658_10915549 Ga0070658_109155492 117
1062 3300005328 Ga0070676_11246259 Ga0070676_112462591 117
1063 3300005329 Ga0070683_101209375 Ga0070683_1012093751 117
1064 3300005329 Ga0070683_101643660 Ga0070683_1016436601 117
1065 3300005331 Ga0070670_100040999 Ga0070670_1000409993 117
1066 3300005334 Ga0068869_100011329 Ga0068869_10001132910 117
1067 3300005334 Ga0068869_100810229 Ga0068869_1008102291 117
1068 3300005336 Ga0070680_100020264 Ga0070680_1000202644 117
1069 3300005336 Ga0070680_100075158 Ga0070680_1000751582 117
1070 3300005336 Ga0070680_100784742 Ga0070680_1007847422 117
1071 3300005337 Ga0070682_100012263 Ga0070682_1000122632 117
1072 3300005337 Ga0070682_100485120 Ga0070682_1004851201 117
1073 3300005339 Ga0070660_100055941 Ga0070660_1000559415 117
1074 3300005339 Ga0070660_100106511 Ga0070660_1001065112 117
1075 3300005339 Ga0070660_100164804 Ga0070660_1001648042 117
1076 3300005339 Ga0070660_100167402 Ga0070660_1001674022 117
1077 3300005339 Ga0070660_100341239 Ga0070660_1003412391 117
1078 3300005339 Ga0070660_101716378 Ga0070660_1017163781 117
1079 3300005344 Ga0070661_101338823 Ga0070661_1013388231 117
1080 3300005345 Ga0070692_10070014 Ga0070692_100700141 117
1081 3300005355 Ga0070671_101554485 Ga0070671_1015544851 117
1082 3300005366 Ga0070659_100007055 Ga0070659_1000070555 117
1083 3300005366 Ga0070659_100029021 Ga0070659_1000290213 117
1084 3300005366 Ga0070659_100064481 Ga0070659_1000644815 117
1085 3300005367 Ga0070667_100035482 Ga0070667_1000354823 117
1086 3300005455 Ga0070663_100012531 Ga0070663_1000125316 117
1087 3300005458 Ga0070681_10051236 Ga0070681_100512361 117
1088 3300005458 Ga0070681_10061709 Ga0070681_100617096 117
1089 3300005458 Ga0070681_10116108 Ga0070681_101161082 117
1090 3300005458 Ga0070681_10211758 Ga0070681_102117582 117
1091 3300005458 Ga0070681_10865798 Ga0070681_108657982 117
1092 3300005459 Ga0068867_101983939 Ga0068867_1019839391 117
1093 3300005530 Ga0070679_100005664 Ga0070679_1000056642 117
1094 3300005530 Ga0070679_100010208 Ga0070679_1000102088 117
1095 3300005530 Ga0070679_100011076 Ga0070679_1000110762 117
1096 3300005530 Ga0070679_100349398 Ga0070679_1003493982 117
1097 3300005530 Ga0070679_102080695 Ga0070679_1020806951 117
1098 3300005535 Ga0070684_100390623 Ga0070684_1003906232 117
1099 3300005535 Ga0070684_100472027 Ga0070684_1004720272 117
1100 3300005535 Ga0070684_100767332 Ga0070684_1007673322 117
1101 3300005535 Ga0070684_101349609 Ga0070684_1013496091 117
1102 3300005539 Ga0068853_100016724 Ga0068853_1000167244 117
1103 3300005539 Ga0068853_100062299 Ga0068853_1000622993 117
1104 3300005539 Ga0068853_100447405 Ga0068853_1004474051 117
1105 3300005539 Ga0068853_100462983 Ga0068853_1004629831 117
1106 3300005539 Ga0068853_101491640 Ga0068853_1014916401 117
1107 3300005563 Ga0068855_100008676 Ga0068855_10000867611 117
1108 3300005563 Ga0068855_100013610 Ga0068855_10001361016 117
1109 3300005563 Ga0068855_100033717 Ga0068855_1000337174 117
1110 3300005563 Ga0068855_100433331 Ga0068855_1004333311 117
1111 3300005563 Ga0068855_100895013 Ga0068855_1008950132 117
1112 3300005563 Ga0068855_101002585 Ga0068855_1010025852 117
1113 3300005563 Ga0068855_101014320 Ga0068855_1010143202 117
1114 3300005563 Ga0068855_102346774 Ga0068855_1023467742 117
1115 3300005564 Ga0070664_100907853 Ga0070664_1009078531 117
1116 3300005577 Ga0068857_100328705 Ga0068857_1003287051 117
1117 3300005577 Ga0068857_100400512 Ga0068857_1004005122 117
1118 3300005578 Ga0068854_100139820 Ga0068854_1001398203 117
1119 3300005578 Ga0068854_101101763 Ga0068854_1011017632 117
1120 3300005578 Ga0068854_102136890 Ga0068854_1021368901 117
1121 3300005614 Ga0068856_100254908 Ga0068856_1002549083 117
1122 3300005614 Ga0068856_100446120 Ga0068856_1004461202 117
1123 3300005614 Ga0068856_101871833 Ga0068856_1018718332 117
1124 3300005615 Ga0070702_100234415 Ga0070702_1002344151 117
1125 3300005616 Ga0068852_100000454 Ga0068852_10000045413 117
1126 3300005616 Ga0068852_100028526 Ga0068852_1000285265 117
1127 3300005616 Ga0068852_100045652 Ga0068852_1000456523 117
1128 3300005616 Ga0068852_100447777 Ga0068852_1004477772 117
1129 3300005617 Ga0068859_100039683 Ga0068859_1000396833 117
1130 3300005618 Ga0068864_100082813 Ga0068864_1000828133 117
1131 3300005718 Ga0068866_10079389 Ga0068866_100793892 117
1132 3300005719 Ga0068861_100161242 Ga0068861_1001612422 117
1133 3300005719 Ga0068861_100841951 Ga0068861_1008419511 117
1134 3300005840 Ga0068870_10159345 Ga0068870_101593452 117
1135 3300005841 Ga0068863_100630713 Ga0068863_1006307133 117
1136 3300005842 Ga0068858_101602774 Ga0068858_1016027741 117
1137 3300005843 Ga0068860_100097098 Ga0068860_1000970984 117
1138 3300005843 Ga0068860_100189317 Ga0068860_1001893172 117
1139 3300005844 Ga0068862_100011150 Ga0068862_1000111507 117
1140 3300006881 Ga0068865_100305863 Ga0068865_1003058632 117
1141 3300006931 Ga0097620_100039681 Ga0097620_1000396813 117
1142 3300009093 Ga0105240_10152474 Ga0105240_101524742 117
1143 3300009093 Ga0105240_10850041 Ga0105240_108500411 117
1144 3300009174 Ga0105241_10004448 Ga0105241_100044485 117
1145 3300009174 Ga0105241_11387541 Ga0105241_113875412 117
1146 3300009174 Ga0105241_11454418 Ga0105241_114544181 117
1147 3300009545 Ga0105237_10465390 Ga0105237_104653901 117
1148 3300009553 Ga0105249_10406175 Ga0105249_104061752 117
1149 3300009553 Ga0105249_10935094 Ga0105249_109350941 117
1150 3300010375 Ga0105239_10073188 Ga0105239_100731882 117
1151 3300010375 Ga0105239_12981080 Ga0105239_129810801 117
1152 3300011119 Ga0105246_10209132 Ga0105246_102091322 117
1153 3300013100 Ga0157373_10000592 Ga0157373_1000059219 117
1154 3300013100 Ga0157373_10021014 Ga0157373_100210143 117
1155 3300013100 Ga0157373_10028988 Ga0157373_100289883 117
1156 3300013100 Ga0157373_10038167 Ga0157373_100381674 117
1157 3300013100 Ga0157373_10985261 Ga0157373_109852611 117
1158 3300013102 Ga0157371_10003403 Ga0157371_100034032 117
1159 3300013102 Ga0157371_10004188 Ga0157371_100041888 117
1160 3300013102 Ga0157371_10014159 Ga0157371_100141592 117
1161 3300013102 Ga0157371_10015346 Ga0157371_100153464 117
1162 3300013102 Ga0157371_10050178 Ga0157371_100501782 117
1163 3300013102 Ga0157371_10064214 Ga0157371_100642142 117
1164 3300013102 Ga0157371_10127238 Ga0157371_101272381 117
1165 3300013102 Ga0157371_10181644 Ga0157371_101816442 117
1166 3300013102 Ga0157371_10274888 Ga0157371_102748882 117
1167 3300013102 Ga0157371_10283163 Ga0157371_102831631 117
1168 3300013104 Ga0157370_10002668 Ga0157370_100026687 117
1169 3300013104 Ga0157370_10006362 Ga0157370_100063628 117
1170 3300013104 Ga0157370_10008795 Ga0157370_100087955 117
1171 3300013104 Ga0157370_10186464 Ga0157370_101864642 117
1172 3300013104 Ga0157370_11114771 Ga0157370_111147712 117
1173 3300013104 Ga0157370_11736182 Ga0157370_117361821 117
1174 3300013104 Ga0157370_11747254 Ga0157370_117472541 117
1175 3300013105 Ga0157369_10004162 Ga0157369_100041622 117
1176 3300013105 Ga0157369_10009198 Ga0157369_1000919812 117
1177 3300013105 Ga0157369_10019866 Ga0157369_100198662 117
1178 3300013105 Ga0157369_10064958 Ga0157369_100649583 117
1179 3300013105 Ga0157369_10398377 Ga0157369_103983773 117
1180 3300013105 Ga0157369_10529562 Ga0157369_105295622 117
1181 3300013296 Ga0157374_10259932 Ga0157374_102599322 117
1182 3300013296 Ga0157374_11647093 Ga0157374_116470932 117
1183 3300013297 Ga0157378_10237073 Ga0157378_102370732 117
1184 3300013297 Ga0157378_10553446 Ga0157378_105534462 117
1185 3300013297 Ga0157378_10756599 Ga0157378_107565992 117
1186 3300013297 Ga0157378_11252948 Ga0157378_112529481 117
1187 3300013297 Ga0157378_11468733 Ga0157378_114687332 117
1188 3300013306 Ga0163162_10474200 Ga0163162_104742002 117
1189 3300013307 Ga0157372_10009464 Ga0157372_1000946411 117
1190 3300013307 Ga0157372_10023397 Ga0157372_100233975 117
1191 3300013307 Ga0157372_10025178 Ga0157372_100251788 117
1192 3300013307 Ga0157372_10032959 Ga0157372_100329598 117
1193 3300013307 Ga0157372_10049169 Ga0157372_100491694 117
1194 3300013307 Ga0157372_10124997 Ga0157372_101249974 117
1195 3300013307 Ga0157372_10172006 Ga0157372_101720062 117
1196 3300013307 Ga0157372_10530484 Ga0157372_105304842 117
1197 3300013307 Ga0157372_10601330 Ga0157372_106013303 117
1198 3300013307 Ga0157372_10784638 Ga0157372_107846381 117
1199 3300013307 Ga0157372_11174214 Ga0157372_111742142 117
1200 3300013307 Ga0157372_11895544 Ga0157372_118955441 117
1201 3300013307 Ga0157372_12513893 Ga0157372_125138931 117
1202 3300014326 Ga0157380_12181888 Ga0157380_121818881 117
1203 3300014745 Ga0157377_10864936 Ga0157377_108649361 117
1204 3300014969 Ga0157376_12655559 Ga0157376_126555591 117
1205 3300020070 Ga0206356_10994341 Ga0206356_109943411 117
1206 3300020070 Ga0206356_11687923 Ga0206356_116879231 117
1207 3300020075 Ga0206349_1377899 Ga0206349_13778991 117
1208 3300020077 Ga0206351_10974334 Ga0206351_109743341 117
1209 3300020080 Ga0206350_10633921 Ga0206350_106339211 117
1210 3300020080 Ga0206350_11141334 Ga0206350_111413342 117
1211 3300020080 Ga0206350_11624967 Ga0206350_116249671 117
1212 3300020080 Ga0206350_11654957 Ga0206350_116549571 117
1213 3300020081 Ga0206354_10173907 Ga0206354_101739071 117
1214 3300020082 Ga0206353_11167834 Ga0206353_111678342 117
1215 3300020082 Ga0206353_11715051 Ga0206353_117150511 117
1216 3300022467 Ga0224712_10545855 Ga0224712_105458551 117
1217 3300025899 Ga0207642_10004344 Ga0207642_100043442 117
1218 3300025904 Ga0207647_10056774 Ga0207647_100567742 117
1219 3300025907 Ga0207645_11000735 Ga0207645_110007351 117
1220 3300025908 Ga0207643_10164151 Ga0207643_101641512 117
1221 3300025909 Ga0207705_10009398 Ga0207705_100093987 117
1222 3300025909 Ga0207705_10026600 Ga0207705_100266004 117
1223 3300025909 Ga0207705_10048712 Ga0207705_100487125 117
1224 3300025909 Ga0207705_10208676 Ga0207705_102086762 117
1225 3300025909 Ga0207705_10209406 Ga0207705_102094062 117
1226 3300025909 Ga0207705_10283595 Ga0207705_102835952 117
1227 3300025909 Ga0207705_10295685 Ga0207705_102956852 117
1228 3300025911 Ga0207654_10373832 Ga0207654_103738322 117
1229 3300025912 Ga0207707_10124335 Ga0207707_101243352 117
1230 3300025912 Ga0207707_10188789 Ga0207707_101887893 117
1231 3300025912 Ga0207707_10324338 Ga0207707_103243382 117
1232 3300025912 Ga0207707_10535864 Ga0207707_105358642 117
1233 3300025913 Ga0207695_10082168 Ga0207695_100821685 117
1234 3300025913 Ga0207695_10311100 Ga0207695_103111002 117
1235 3300025914 Ga0207671_11330761 Ga0207671_113307611 117
1236 3300025917 Ga0207660_10007763 Ga0207660_100077635 117
1237 3300025917 Ga0207660_10029630 Ga0207660_100296305 117
1238 3300025917 Ga0207660_10098800 Ga0207660_100988002 117
1239 3300025917 Ga0207660_11344277 Ga0207660_113442771 117
1240 3300025919 Ga0207657_10005870 Ga0207657_100058705 117
1241 3300025919 Ga0207657_10017331 Ga0207657_100173319 117
1242 3300025919 Ga0207657_10057007 Ga0207657_100570073 117
1243 3300025919 Ga0207657_10081676 Ga0207657_100816763 117
1244 3300025919 Ga0207657_10089484 Ga0207657_100894843 117
1245 3300025919 Ga0207657_10215296 Ga0207657_102152962 117
1246 3300025921 Ga0207652_10000010 Ga0207652_1000001030 117
1247 3300025921 Ga0207652_10000844 Ga0207652_100008444 117
1248 3300025921 Ga0207652_10007238 Ga0207652_100072389 117
1249 3300025921 Ga0207652_10021217 Ga0207652_100212175 117
1250 3300025921 Ga0207652_10032135 Ga0207652_100321356 117
1251 3300025921 Ga0207652_10059056 Ga0207652_100590562 117
1252 3300025921 Ga0207652_11649498 Ga0207652_116494981 117
1253 3300025925 Ga0207650_10459239 Ga0207650_104592392 117
1254 3300025925 Ga0207650_10762865 Ga0207650_107628651 117
1255 3300025932 Ga0207690_10006232 Ga0207690_100062324 117
1256 3300025932 Ga0207690_10023922 Ga0207690_100239222 117
1257 3300025932 Ga0207690_10072678 Ga0207690_100726782 117
1258 3300025938 Ga0207704_10246611 Ga0207704_102466112 117
1259 3300025938 Ga0207704_11682442 Ga0207704_116824422 117
1260 3300025942 Ga0207689_10015923 Ga0207689_100159239 117
1261 3300025944 Ga0207661_10568366 Ga0207661_105683662 117
1262 3300025945 Ga0207679_11269232 Ga0207679_112692321 117
1263 3300025949 Ga0207667_10084321 Ga0207667_100843212 117
1264 3300025949 Ga0207667_10084964 Ga0207667_100849642 117
1265 3300025949 Ga0207667_10530279 Ga0207667_105302792 117
1266 3300025949 Ga0207667_10680425 Ga0207667_106804252 117
1267 3300025949 Ga0207667_10841888 Ga0207667_108418882 117
1268 3300025949 Ga0207667_11694124 Ga0207667_116941241 117
1269 3300025949 Ga0207667_11931420 Ga0207667_119314202 117
1270 3300025961 Ga0207712_10463209 Ga0207712_104632092 117
1271 3300025972 Ga0207668_10790971 Ga0207668_107909711 117
1272 3300025981 Ga0207640_10192788 Ga0207640_101927883 117
1273 3300025981 Ga0207640_10971783 Ga0207640_109717831 117
1274 3300025981 Ga0207640_11023323 Ga0207640_110233231 117
1275 3300025986 Ga0207658_10094559 Ga0207658_100945592 117
1276 3300026023 Ga0207677_10267386 Ga0207677_102673861 117
1277 3300026023 Ga0207677_11092251 Ga0207677_110922511 117
1278 3300026023 Ga0207677_11427023 Ga0207677_114270231 117
1279 3300026023 Ga0207677_11558332 Ga0207677_115583321 117
1280 3300026041 Ga0207639_10143068 Ga0207639_101430683 117
1281 3300026041 Ga0207639_10336625 Ga0207639_103366251 117
1282 3300026041 Ga0207639_10985363 Ga0207639_109853631 117
1283 3300026067 Ga0207678_10009599 Ga0207678_100095997 117
1284 3300026067 Ga0207678_11340383 Ga0207678_113403831 117
1285 3300026078 Ga0207702_10347041 Ga0207702_103470412 117
1286 3300026078 Ga0207702_11978408 Ga0207702_119784081 117
1287 3300026088 Ga0207641_10696774 Ga0207641_106967742 117
1288 3300026089 Ga0207648_10060090 Ga0207648_100600904 117
1289 3300026089 Ga0207648_10221880 Ga0207648_102218801 117
1290 3300026095 Ga0207676_10299654 Ga0207676_102996542 117
1291 3300026116 Ga0207674_10106006 Ga0207674_101060064 117
1292 3300026116 Ga0207674_10245214 Ga0207674_102452143 117
1293 3300026116 Ga0207674_11329563 Ga0207674_113295631 117
1294 3300026116 Ga0207674_11826505 Ga0207674_118265051 117
1295 3300026118 Ga0207675_100235580 Ga0207675_1002355803 117
1296 3300026118 Ga0207675_101781796 Ga0207675_1017817961 117
1297 3300026118 Ga0207675_102278564 Ga0207675_1022785641 117
1298 3300026142 Ga0207698_10003198 Ga0207698_100031988 117
1299 3300026142 Ga0207698_10012551 Ga0207698_100125516 117
1300 3300026142 Ga0207698_10421632 Ga0207698_104216321 117
1301 3300026142 Ga0207698_10687150 Ga0207698_106871502 117
1302 3300026142 Ga0207698_11827991 Ga0207698_118279911 117
1303 3300028380 Ga0268265_10061107 Ga0268265_100611073 117
1304 3300028381 Ga0268264_10001295 Ga0268264_100012953 117
1305 3300028381 Ga0268264_10038507 Ga0268264_100385075 117
1306 3300037312 Ga0395899_0000248 Ga0395899_0000248_20186_20539 117
1307 3300037312 Ga0395899_0014814 Ga0395899_0014814_3765_4118 117
1308 3300037312 Ga0395899_0043261 Ga0395899_0043261_2996_3349 117
1309 3300037312 Ga0395899_0118039 Ga0395899_0118039_53_406 117
1310 3300037312 Ga0395899_0206187 Ga0395899_0206187_382_735 117
1311 3300037312 Ga0395899_0245842 Ga0395899_0245842_605_958 117
1312 3300037418 Ga0395900_0005223 Ga0395900_0005223_9267_9620 117
1313 3300037418 Ga0395900_0015001 Ga0395900_0015001_4108_4461 117
1314 3300037418 Ga0395900_0041998 Ga0395900_0041998_2701_3054 117
1315 3300037418 Ga0395900_0138186 Ga0395900_0138186_607_960 117
1316 3300037418 Ga0395900_0159137 Ga0395900_0159137_438_791 117
1317 3300037418 Ga0395900_0434999 Ga0395900_0434999_699_1052 117
1318 3300037418 Ga0395900_0978770 Ga0395900_0978770_147_500 117
1319 3300037466 Ga0395898_0003603 Ga0395898_0003603_8405_8758 117
1320 3300037466 Ga0395898_0043780 Ga0395898_0043780_2377_2730 117
1321 3300037466 Ga0395898_0179806 Ga0395898_0179806_152_505 117
1322 3300037466 Ga0395898_0416002 Ga0395898_0416002_23_376 117
1323 3300037466 Ga0395898_0519908 Ga0395898_0519908_574_927 117
1324 3300037466 Ga0395898_0555286 Ga0395898_0555286_537_890 117
1325 3300037471 Ga0395905_0615760 Ga0395905_0615760_577_930 117
1326 3300037471 Ga0395905_1230702 Ga0395905_1230702_100_453 117
1327 3300037471 Ga0395905_1594571 Ga0395905_1594571_59_412 117
1328 3300038443 Ga0395901_0002328 Ga0395901_0002328_18959_19312 117
1329 3300038443 Ga0395901_0007090 Ga0395901_0007090_8766_9119 117
1330 3300038443 Ga0395901_0039606 Ga0395901_0039606_4254_4607 117
1331 3300038443 Ga0395901_0064162 Ga0395901_0064162_548_901 117
1332 3300038443 Ga0395901_0089136 Ga0395901_0089136_2089_2442 117
1333 3300038443 Ga0395901_0324917 Ga0395901_0324917_887_1240 117
1334 3300038443 Ga0395901_0730800 Ga0395901_0730800_513_866 117
1335 3300041444 Ga0451790_10861 Ga0451790_10861_10_369 117
1336 3300041509 Ga0451843_0946552 Ga0451843_0946552_353_706 117
1337 3300049568 Ga0501031_0225837 Ga0501031_0225837_236_589 117
1338 3300049568 Ga0501031_1119795 Ga0501031_1119795_57_410 117
1339 3300049569 Ga0501032_0269697 Ga0501032_0269697_720_1073 117
1340 3300049570 Ga0501033_0506976 Ga0501033_0506976_383_736 117
1341 3300049571 Ga0501034_0040596 Ga0501034_0040596_3554_3907 117
1342 3300049571 Ga0501034_0057802 Ga0501034_0057802_2156_2509 117
1343 3300049574 Ga0501038_0783293 Ga0501038_0783293_236_589 117
1344 3300049586 Ga0501070_0080956 Ga0501070_0080956_122_475 117
1345 3300049822 Ga0501035_0012875 Ga0501035_0012875_591_944 117
1346 3300049822 Ga0501035_1155202 Ga0501035_1155202_102_455 117
1347 3300049823 Ga0501044_0602278 Ga0501044_0602278_224_577 117
1348 3300053153 Ga0500616_0120548 Ga0500616_0120548_710_1063 117
1349 3300059490 Ga0587066_192175 Ga0587066_192175_18_371 117
1350 3300059503 Ga0587080_162991 Ga0587080_162991_155_508 117
1351 3300059626 Ga0587115_097623 Ga0587115_097623_143_496 117
1352 3300059640 Ga0587067_185738 Ga0587067_185738_51_404 117
1353 3300059642 Ga0587069_091107 Ga0587069_091107_39_392 117
1354 3300059647 Ga0587079_097162 Ga0587079_097162_143_496 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

58

105

0.95

PF01047

MarR

MarR family

61

109

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9742 45 100
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9464 43 100
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9348 44 102
7rhe-assembly1.cif.gz_A-2 crystal structure of rok family protein from burkholderia vietnamiensis g4 0.9326 45 104
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.926 29 109
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9788 42 99 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9742 45 100 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.947 42 100 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9464 43 100 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9402 26 111 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I5Z3L0-F1-model_v4 Transcriptional regulator, ArsR family 1.002 25 117 GO:0003700
GO:0005737
AF-A0A5B8V8R0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9975 25 117 GO:0003700
GO:0005737
AF-A0A1V5GE74-F1-model_v4 Transcriptional repressor SdpR 0.9968 25 117 GO:0003700
GO:0005737
AF-A0A832BRN3-F1-model_v4 Transcriptional regulator 0.9967 25 117 GO:0003700
GO:0005737
AF-A0A4U3L8U0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9956 25 117 GO:0003700
GO:0005737

Feature Viewer

pLDDT pTM Quality
88.58 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map