F493271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1354 | 386 | 1354 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10574484|Ga0307513_105744842 |
| Length | 133 |
| Sequence | MLIAIFVVSVLFIHEAKQRYCMSTSELSFSAVTGDGLILKIDLHNLKKAALVLRAVNHKLRQQILKLIDEHGRVTVTELYVKMRLEQSVASQHLAILRKAGFVKTLRDGKFIYYSVNIIRMDEVNQFLADLLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 221 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 226 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 229 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 232 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 233 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 234 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 235 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 236 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 237 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 238 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 239 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 240 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 281 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 282 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 283 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 284 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 285 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 286 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 287 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 314 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 315 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 316 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 317 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 318 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 320 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 321 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 322 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 323 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 326 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 330 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 331 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 332 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 337 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 339 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 342 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 343 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 345 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 349 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 351 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 352 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 353 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 354 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 355 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 356 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 358 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 359 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 360 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 361 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 362 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 373 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 374 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 380 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.35 |
| Metatranscriptomes | 4.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 96.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10120710 | 3300002067 | Bacteria | 754 |
| 2 | JGI24744J21845_10004710 | 3300002077 | Bacteria | 2817 |
| 3 | JGI24744J21845_10009003 | 3300002077 | Bacteria | 2051 |
| 4 | JGI24751J29686_10019570 | 3300002459 | Bacteria | 1402 |
| 5 | Ga0006778J45830_1013083 | 3300003162 | Bacteria | 587 |
| 6 | Ga0006778J45830_1091642 | 3300003162 | Bacteria | 543 |
| 7 | Ga0006777J48905_1002824 | 3300003308 | Bacteria | 725 |
| 8 | Ga0006777J48905_1016926 | 3300003308 | Bacteria | 1263 |
| 9 | rootH1_10183607 | 3300003323 | Bacteria | 2112 |
| 10 | Ga0007417J51691_1011400 | 3300003544 | Bacteria | 610 |
| 11 | Ga0007416J51690_1008420 | 3300003577 | Bacteria | 941 |
| 12 | Ga0007416J51690_1081396 | 3300003577 | Unclassified | 625 |
| 13 | Ga0007429J51699_1010111 | 3300003579 | Bacteria | 763 |
| 14 | Ga0007429J51699_1095847 | 3300003579 | Unclassified | 931 |
| 15 | Ga0032354_1046868 | 3300003693 | Unclassified | 659 |
| 16 | Ga0032354_1049471 | 3300003693 | Unclassified | 551 |
| 17 | Ga0032354_1057186 | 3300003693 | Bacteria | 1094 |
| 18 | Ga0058859_11674870 | 3300004798 | Bacteria | 557 |
| 19 | Ga0058863_11581661 | 3300004799 | Bacteria | 652 |
| 20 | Ga0058863_11776965 | 3300004799 | Unclassified | 530 |
| 21 | Ga0058860_10045833 | 3300004801 | Unclassified | 658 |
| 22 | Ga0058860_12154840 | 3300004801 | Bacteria | 639 |
| 23 | Ga0058862_12659472 | 3300004803 | Bacteria | 625 |
| 24 | Ga0065712_10026861 | 3300005290 | Bacteria | 1709 |
| 25 | Ga0065712_10087786 | 3300005290 | Bacteria | 2555 |
| 26 | Ga0065712_10148035 | 3300005290 | Bacteria | 1392 |
| 27 | Ga0065712_10361631 | 3300005290 | Bacteria | 774 |
| 28 | Ga0065715_10230257 | 3300005293 | Bacteria | 1232 |
| 29 | Ga0065715_10704909 | 3300005293 | Unclassified | 651 |
| 30 | Ga0065707_10721520 | 3300005295 | Unclassified | 598 |
| 31 | Ga0065707_10987347 | 3300005295 | Bacteria | 517 |
| 32 | Ga0070658_10012624 | 3300005327 | Bacteria | 6776 |
| 33 | Ga0070658_10029509 | 3300005327 | Bacteria | 4407 |
| 34 | Ga0070658_10062639 | 3300005327 | Bacteria | 3031 |
| 35 | Ga0070658_10126103 | 3300005327 | Bacteria | 2131 |
| 36 | Ga0070658_10229184 | 3300005327 | Bacteria | 1573 |
| 37 | Ga0070658_10280764 | 3300005327 | Bacteria | 1417 |
| 38 | Ga0070658_10459066 | 3300005327 | Bacteria | 1098 |
| 39 | Ga0070658_10516094 | 3300005327 | Bacteria | 1033 |
| 40 | Ga0070658_10550401 | 3300005327 | Bacteria | 998 |
| 41 | Ga0070658_10915549 | 3300005327 | Bacteria | 762 |
| 42 | Ga0070676_10000340 | 3300005328 | Bacteria | 21336 |
| 43 | Ga0070676_10017698 | 3300005328 | Bacteria | 3943 |
| 44 | Ga0070676_10085446 | 3300005328 | Bacteria | 1923 |
| 45 | Ga0070676_10200590 | 3300005328 | Bacteria | 1308 |
| 46 | Ga0070676_10890368 | 3300005328 | Bacteria | 662 |
| 47 | Ga0070676_11246259 | 3300005328 | Bacteria | 566 |
| 48 | Ga0070683_100001004 | 3300005329 | Bacteria | 21143 |
| 49 | Ga0070683_100003956 | 3300005329 | Bacteria | 12127 |
| 50 | Ga0070683_100035848 | 3300005329 | Bacteria | 4536 |
| 51 | Ga0070683_100187047 | 3300005329 | Bacteria | 1966 |
| 52 | Ga0070683_100199184 | 3300005329 | Bacteria | 1902 |
| 53 | Ga0070683_101209375 | 3300005329 | Unclassified | 726 |
| 54 | Ga0070683_101643660 | 3300005329 | Bacteria | 618 |
| 55 | Ga0070683_101765980 | 3300005329 | Unclassified | 595 |
| 56 | Ga0070690_100003006 | 3300005330 | Bacteria | 9138 |
| 57 | Ga0070690_100141322 | 3300005330 | Bacteria | 1634 |
| 58 | Ga0070690_100866033 | 3300005330 | Unclassified | 705 |
| 59 | Ga0070690_101499843 | 3300005330 | Bacteria | 545 |
| 60 | Ga0070690_101512723 | 3300005330 | Unclassified | 542 |
| 61 | Ga0070670_100029206 | 3300005331 | Bacteria | 4745 |
| 62 | Ga0070670_100040999 | 3300005331 | Bacteria | 3979 |
| 63 | Ga0070670_100057109 | 3300005331 | Bacteria | 3351 |
| 64 | Ga0070670_100286752 | 3300005331 | Bacteria | 1438 |
| 65 | Ga0070670_100399657 | 3300005331 | Bacteria | 1213 |
| 66 | Ga0070670_100426281 | 3300005331 | Unclassified | 1173 |
| 67 | Ga0070670_101006189 | 3300005331 | Bacteria | 758 |
| 68 | Ga0070670_101101227 | 3300005331 | Bacteria | 724 |
| 69 | Ga0070677_10022958 | 3300005333 | Bacteria | 2304 |
| 70 | Ga0070677_10707447 | 3300005333 | Bacteria | 568 |
| 71 | Ga0068869_100000814 | 3300005334 | Bacteria | 17836 |
| 72 | Ga0068869_100006000 | 3300005334 | Bacteria | 7683 |
| 73 | Ga0068869_100009437 | 3300005334 | Bacteria | 6331 |
| 74 | Ga0068869_100011329 | 3300005334 | Bacteria | 5843 |
| 75 | Ga0068869_100034895 | 3300005334 | Bacteria | 3562 |
| 76 | Ga0068869_100053625 | 3300005334 | Bacteria | 2932 |
| 77 | Ga0068869_100078925 | 3300005334 | Bacteria | 2453 |
| 78 | Ga0068869_100117581 | 3300005334 | Bacteria | 2029 |
| 79 | Ga0068869_100810229 | 3300005334 | Bacteria | 805 |
| 80 | Ga0068869_101832079 | 3300005334 | Bacteria | 543 |
| 81 | Ga0070666_10018034 | 3300005335 | Bacteria | 4531 |
| 82 | Ga0070666_10047710 | 3300005335 | Bacteria | 2876 |
| 83 | Ga0070666_10392737 | 3300005335 | Unclassified | 997 |
| 84 | Ga0070666_10847220 | 3300005335 | Unclassified | 674 |
| 85 | Ga0070680_100020264 | 3300005336 | Bacteria | 5277 |
| 86 | Ga0070680_100075158 | 3300005336 | Bacteria | 2781 |
| 87 | Ga0070680_100784742 | 3300005336 | Bacteria | 821 |
| 88 | Ga0070680_100958779 | 3300005336 | Unclassified | 738 |
| 89 | Ga0070680_101406973 | 3300005336 | Unclassified | 604 |
| 90 | Ga0070680_101656178 | 3300005336 | Bacteria | 554 |
| 91 | Ga0070682_100012263 | 3300005337 | Bacteria | 4909 |
| 92 | Ga0070682_100015226 | 3300005337 | Bacteria | 4453 |
| 93 | Ga0070682_100126080 | 3300005337 | Bacteria | 1726 |
| 94 | Ga0070682_100485120 | 3300005337 | Bacteria | 954 |
| 95 | Ga0070682_100847295 | 3300005337 | Unclassified | 747 |
| 96 | Ga0070682_101046657 | 3300005337 | Bacteria | 680 |
| 97 | Ga0068868_100001169 | 3300005338 | Bacteria | 17976 |
| 98 | Ga0068868_100005060 | 3300005338 | Bacteria | 9257 |
| 99 | Ga0068868_100025302 | 3300005338 | Bacteria | 4513 |
| 100 | Ga0068868_100159717 | 3300005338 | Bacteria | 1861 |
| 101 | Ga0068868_100189892 | 3300005338 | Bacteria | 1708 |
| 102 | Ga0070660_100055941 | 3300005339 | Bacteria | 3051 |
| 103 | Ga0070660_100106511 | 3300005339 | Bacteria | 2227 |
| 104 | Ga0070660_100142017 | 3300005339 | Unclassified | 1927 |
| 105 | Ga0070660_100164804 | 3300005339 | Bacteria | 1787 |
| 106 | Ga0070660_100167402 | 3300005339 | Bacteria | 1774 |
| 107 | Ga0070660_100341239 | 3300005339 | Bacteria | 1233 |
| 108 | Ga0070660_100739479 | 3300005339 | Unclassified | 826 |
| 109 | Ga0070660_101716378 | 3300005339 | Bacteria | 535 |
| 110 | Ga0070689_100026770 | 3300005340 | Bacteria | 4343 |
| 111 | Ga0070689_100562504 | 3300005340 | Bacteria | 984 |
| 112 | Ga0070689_100573594 | 3300005340 | Bacteria | 974 |
| 113 | Ga0070689_101278567 | 3300005340 | Bacteria | 660 |
| 114 | Ga0070689_101527653 | 3300005340 | Unclassified | 605 |
| 115 | Ga0070687_100088757 | 3300005343 | Bacteria | 1705 |
| 116 | Ga0070687_100421644 | 3300005343 | Bacteria | 880 |
| 117 | Ga0070687_100563885 | 3300005343 | Unclassified | 777 |
| 118 | Ga0070687_100651995 | 3300005343 | Bacteria | 730 |
| 119 | Ga0070687_100972578 | 3300005343 | Unclassified | 613 |
| 120 | Ga0070661_100000922 | 3300005344 | Bacteria | 21063 |
| 121 | Ga0070661_100033516 | 3300005344 | Bacteria | 3720 |
| 122 | Ga0070661_100183306 | 3300005344 | Bacteria | 1594 |
| 123 | Ga0070661_100215522 | 3300005344 | Bacteria | 1471 |
| 124 | Ga0070661_100578471 | 3300005344 | Bacteria | 906 |
| 125 | Ga0070661_101010148 | 3300005344 | Bacteria | 690 |
| 126 | Ga0070661_101285064 | 3300005344 | Bacteria | 614 |
| 127 | Ga0070661_101338823 | 3300005344 | Unclassified | 601 |
| 128 | Ga0070692_10070014 | 3300005345 | Unclassified | 1867 |
| 129 | Ga0070692_11428399 | 3300005345 | Unclassified | 500 |
| 130 | Ga0070668_100017076 | 3300005347 | Bacteria | 5430 |
| 131 | Ga0070668_100082150 | 3300005347 | Bacteria | 2527 |
| 132 | Ga0070668_100258355 | 3300005347 | Bacteria | 1448 |
| 133 | Ga0070668_100347465 | 3300005347 | Bacteria | 1254 |
| 134 | Ga0070668_100437687 | 3300005347 | Bacteria | 1122 |
| 135 | Ga0070668_100844109 | 3300005347 | Bacteria | 816 |
| 136 | Ga0070668_102272089 | 3300005347 | Bacteria | 501 |
| 137 | Ga0070669_100015753 | 3300005353 | Bacteria | 5390 |
| 138 | Ga0070669_100037656 | 3300005353 | Bacteria | 3509 |
| 139 | Ga0070669_100043024 | 3300005353 | Bacteria | 3288 |
| 140 | Ga0070669_100964811 | 3300005353 | Bacteria | 730 |
| 141 | Ga0070675_100031074 | 3300005354 | Bacteria | 4316 |
| 142 | Ga0070675_100046713 | 3300005354 | Unclassified | 3547 |
| 143 | Ga0070675_100075723 | 3300005354 | Bacteria | 2797 |
| 144 | Ga0070675_100348931 | 3300005354 | Bacteria | 1312 |
| 145 | Ga0070675_100610286 | 3300005354 | Unclassified | 990 |
| 146 | Ga0070671_100058203 | 3300005355 | Bacteria | 3217 |
| 147 | Ga0070671_100135511 | 3300005355 | Bacteria | 2076 |
| 148 | Ga0070671_100317391 | 3300005355 | Bacteria | 1327 |
| 149 | Ga0070671_100346544 | 3300005355 | Bacteria | 1268 |
| 150 | Ga0070671_100467074 | 3300005355 | Bacteria | 1083 |
| 151 | Ga0070671_100522016 | 3300005355 | Bacteria | 1023 |
| 152 | Ga0070671_101287338 | 3300005355 | Bacteria | 644 |
| 153 | Ga0070671_101554485 | 3300005355 | Unclassified | 586 |
| 154 | Ga0070674_100008110 | 3300005356 | Bacteria | 6232 |
| 155 | Ga0070674_100021467 | 3300005356 | Bacteria | 4146 |
| 156 | Ga0070674_100147980 | 3300005356 | Bacteria | 1769 |
| 157 | Ga0070674_100188454 | 3300005356 | Bacteria | 1585 |
| 158 | Ga0070673_100017493 | 3300005364 | Bacteria | 5100 |
| 159 | Ga0070673_100020326 | 3300005364 | Bacteria | 4788 |
| 160 | Ga0070673_100022986 | 3300005364 | Bacteria | 4548 |
| 161 | Ga0070673_100023551 | 3300005364 | Bacteria | 4500 |
| 162 | Ga0070673_101553553 | 3300005364 | Bacteria | 625 |
| 163 | Ga0070688_100015010 | 3300005365 | Bacteria | 4397 |
| 164 | Ga0070688_100098477 | 3300005365 | Bacteria | 1924 |
| 165 | Ga0070688_100464982 | 3300005365 | Bacteria | 948 |
| 166 | Ga0070659_100007055 | 3300005366 | Bacteria | 8139 |
| 167 | Ga0070659_100029021 | 3300005366 | Unclassified | 4275 |
| 168 | Ga0070659_100064481 | 3300005366 | Bacteria | 2899 |
| 169 | Ga0070659_100070336 | 3300005366 | Unclassified | 2780 |
| 170 | Ga0070659_100151246 | 3300005366 | Bacteria | 1893 |
| 171 | Ga0070659_100151481 | 3300005366 | Bacteria | 1892 |
| 172 | Ga0070659_100824509 | 3300005366 | Unclassified | 808 |
| 173 | Ga0070659_100855305 | 3300005366 | Bacteria | 793 |
| 174 | Ga0070659_101137156 | 3300005366 | Bacteria | 689 |
| 175 | Ga0070667_100035482 | 3300005367 | Bacteria | 4178 |
| 176 | Ga0070667_100046741 | 3300005367 | Bacteria | 3642 |
| 177 | Ga0070667_100074526 | 3300005367 | Bacteria | 2896 |
| 178 | Ga0070667_100128173 | 3300005367 | Bacteria | 2213 |
| 179 | Ga0070667_100130441 | 3300005367 | Bacteria | 2193 |
| 180 | Ga0070667_100339234 | 3300005367 | Bacteria | 1359 |
| 181 | Ga0070667_100357374 | 3300005367 | Bacteria | 1323 |
| 182 | Ga0070667_100553316 | 3300005367 | Bacteria | 1058 |
| 183 | Ga0070667_101167865 | 3300005367 | Bacteria | 720 |
| 184 | Ga0070667_101361336 | 3300005367 | Unclassified | 665 |
| 185 | Ga0070667_102248834 | 3300005367 | Unclassified | 514 |
| 186 | Ga0070701_10196341 | 3300005438 | Bacteria | 1190 |
| 187 | Ga0070700_100447705 | 3300005441 | Unclassified | 982 |
| 188 | Ga0070663_100012531 | 3300005455 | Bacteria | 5368 |
| 189 | Ga0070663_100290961 | 3300005455 | Unclassified | 1305 |
| 190 | Ga0070663_100417760 | 3300005455 | Bacteria | 1100 |
| 191 | Ga0070663_100761800 | 3300005455 | Bacteria | 827 |
| 192 | Ga0070663_100814180 | 3300005455 | Bacteria | 802 |
| 193 | Ga0070663_101010045 | 3300005455 | Unclassified | 724 |
| 194 | Ga0070663_101461080 | 3300005455 | Unclassified | 607 |
| 195 | Ga0070678_100008073 | 3300005456 | Bacteria | 6280 |
| 196 | Ga0070678_100016088 | 3300005456 | Bacteria | 4773 |
| 197 | Ga0070678_100716497 | 3300005456 | Unclassified | 903 |
| 198 | Ga0070662_100004730 | 3300005457 | Bacteria | 8629 |
| 199 | Ga0070662_100018859 | 3300005457 | Bacteria | 4674 |
| 200 | Ga0070662_100081231 | 3300005457 | Bacteria | 2415 |
| 201 | Ga0070662_100207859 | 3300005457 | Bacteria | 1556 |
| 202 | Ga0070662_100873016 | 3300005457 | Unclassified | 767 |
| 203 | Ga0070681_10051236 | 3300005458 | Bacteria | 4117 |
| 204 | Ga0070681_10061709 | 3300005458 | Bacteria | 3722 |
| 205 | Ga0070681_10116108 | 3300005458 | Bacteria | 2614 |
| 206 | Ga0070681_10211758 | 3300005458 | Bacteria | 1854 |
| 207 | Ga0070681_10332775 | 3300005458 | Bacteria | 1428 |
| 208 | Ga0070681_10865798 | 3300005458 | Bacteria | 821 |
| 209 | Ga0070681_11116016 | 3300005458 | Unclassified | 710 |
| 210 | Ga0068867_100005364 | 3300005459 | Bacteria | 9062 |
| 211 | Ga0068867_100006725 | 3300005459 | Bacteria | 8128 |
| 212 | Ga0068867_100026845 | 3300005459 | Bacteria | 4137 |
| 213 | Ga0068867_100089568 | 3300005459 | Bacteria | 2333 |
| 214 | Ga0068867_100133475 | 3300005459 | Bacteria | 1932 |
| 215 | Ga0068867_101233311 | 3300005459 | Bacteria | 688 |
| 216 | Ga0068867_101983939 | 3300005459 | Unclassified | 550 |
| 217 | Ga0070685_10123019 | 3300005466 | Bacteria | 1613 |
| 218 | Ga0070685_10129128 | 3300005466 | Bacteria | 1578 |
| 219 | Ga0070685_10175524 | 3300005466 | Bacteria | 1376 |
| 220 | Ga0070685_10211790 | 3300005466 | Unclassified | 1265 |
| 221 | Ga0070679_100005664 | 3300005530 | Bacteria | 11578 |
| 222 | Ga0070679_100010208 | 3300005530 | Bacteria | 8901 |
| 223 | Ga0070679_100011076 | 3300005530 | Bacteria | 8579 |
| 224 | Ga0070679_100349398 | 3300005530 | Bacteria | 1426 |
| 225 | Ga0070679_102080695 | 3300005530 | Unclassified | 517 |
| 226 | Ga0070684_100000042 | 3300005535 | Bacteria | 89896 |
| 227 | Ga0070684_100001194 | 3300005535 | Bacteria | 18651 |
| 228 | Ga0070684_100005415 | 3300005535 | Bacteria | 9778 |
| 229 | Ga0070684_100126335 | 3300005535 | Bacteria | 2304 |
| 230 | Ga0070684_100390623 | 3300005535 | Bacteria | 1282 |
| 231 | Ga0070684_100472027 | 3300005535 | Bacteria | 1161 |
| 232 | Ga0070684_100547671 | 3300005535 | Bacteria | 1074 |
| 233 | Ga0070684_100767332 | 3300005535 | Bacteria | 901 |
| 234 | Ga0070684_101349609 | 3300005535 | Bacteria | 671 |
| 235 | Ga0070684_101548916 | 3300005535 | Unclassified | 625 |
| 236 | Ga0068853_100003672 | 3300005539 | Bacteria | 11770 |
| 237 | Ga0068853_100010717 | 3300005539 | Bacteria | 7424 |
| 238 | Ga0068853_100016724 | 3300005539 | Bacteria | 6041 |
| 239 | Ga0068853_100062299 | 3300005539 | Bacteria | 3227 |
| 240 | Ga0068853_100066698 | 3300005539 | Bacteria | 3126 |
| 241 | Ga0068853_100447405 | 3300005539 | Bacteria | 1215 |
| 242 | Ga0068853_100457503 | 3300005539 | Bacteria | 1201 |
| 243 | Ga0068853_100462983 | 3300005539 | Bacteria | 1193 |
| 244 | Ga0068853_100549427 | 3300005539 | Bacteria | 1094 |
| 245 | Ga0068853_100578372 | 3300005539 | Bacteria | 1066 |
| 246 | Ga0068853_100733003 | 3300005539 | Bacteria | 944 |
| 247 | Ga0068853_101491640 | 3300005539 | Bacteria | 655 |
| 248 | Ga0068853_102026212 | 3300005539 | Unclassified | 558 |
| 249 | Ga0068853_102215898 | 3300005539 | Bacteria | 533 |
| 250 | Ga0070672_100133825 | 3300005543 | Bacteria | 2040 |
| 251 | Ga0070672_100139675 | 3300005543 | Bacteria | 1997 |
| 252 | Ga0070672_100309927 | 3300005543 | Bacteria | 1340 |
| 253 | Ga0070672_100347138 | 3300005543 | Bacteria | 1265 |
| 254 | Ga0070672_100506644 | 3300005543 | Unclassified | 1045 |
| 255 | Ga0070672_100546229 | 3300005543 | Bacteria | 1006 |
| 256 | Ga0070672_100699958 | 3300005543 | Unclassified | 887 |
| 257 | Ga0070672_101194824 | 3300005543 | Bacteria | 677 |
| 258 | Ga0070686_100484062 | 3300005544 | Bacteria | 957 |
| 259 | Ga0070686_100900636 | 3300005544 | Unclassified | 720 |
| 260 | Ga0070665_100025483 | 3300005548 | Bacteria | 5957 |
| 261 | Ga0070665_100030076 | 3300005548 | Bacteria | 5465 |
| 262 | Ga0070665_100599352 | 3300005548 | Bacteria | 1115 |
| 263 | Ga0068855_100008676 | 3300005563 | Bacteria | 12284 |
| 264 | Ga0068855_100013610 | 3300005563 | Bacteria | 9809 |
| 265 | Ga0068855_100033717 | 3300005563 | Bacteria | 6108 |
| 266 | Ga0068855_100433331 | 3300005563 | Bacteria | 1437 |
| 267 | Ga0068855_100613771 | 3300005563 | Bacteria | 1172 |
| 268 | Ga0068855_100895013 | 3300005563 | Bacteria | 938 |
| 269 | Ga0068855_101002585 | 3300005563 | Bacteria | 877 |
| 270 | Ga0068855_101014320 | 3300005563 | Bacteria | 871 |
| 271 | Ga0068855_102346774 | 3300005563 | Bacteria | 533 |
| 272 | Ga0070664_100000266 | 3300005564 | Bacteria | 37671 |
| 273 | Ga0070664_100087741 | 3300005564 | Bacteria | 2690 |
| 274 | Ga0070664_100115621 | 3300005564 | Unclassified | 2345 |
| 275 | Ga0070664_100263733 | 3300005564 | Bacteria | 1550 |
| 276 | Ga0070664_100880505 | 3300005564 | Bacteria | 839 |
| 277 | Ga0070664_100887865 | 3300005564 | Bacteria | 835 |
| 278 | Ga0070664_100907853 | 3300005564 | Bacteria | 826 |
| 279 | Ga0070664_101246263 | 3300005564 | Bacteria | 702 |
| 280 | Ga0068857_100006612 | 3300005577 | Bacteria | 9955 |
| 281 | Ga0068857_100180869 | 3300005577 | Bacteria | 1919 |
| 282 | Ga0068857_100257661 | 3300005577 | Bacteria | 1600 |
| 283 | Ga0068857_100328705 | 3300005577 | Bacteria | 1413 |
| 284 | Ga0068857_100400512 | 3300005577 | Bacteria | 1277 |
| 285 | Ga0068857_100702373 | 3300005577 | Bacteria | 961 |
| 286 | Ga0068857_101368862 | 3300005577 | Unclassified | 688 |
| 287 | Ga0068854_100021292 | 3300005578 | Bacteria | 4399 |
| 288 | Ga0068854_100100913 | 3300005578 | Bacteria | 2164 |
| 289 | Ga0068854_100139820 | 3300005578 | Bacteria | 1857 |
| 290 | Ga0068854_100245718 | 3300005578 | Unclassified | 1427 |
| 291 | Ga0068854_100314063 | 3300005578 | Bacteria | 1272 |
| 292 | Ga0068854_101101763 | 3300005578 | Bacteria | 707 |
| 293 | Ga0068854_101476586 | 3300005578 | Bacteria | 617 |
| 294 | Ga0068854_101557294 | 3300005578 | Bacteria | 601 |
| 295 | Ga0068854_102136890 | 3300005578 | Bacteria | 517 |
| 296 | Ga0068854_102263412 | 3300005578 | Unclassified | 503 |
| 297 | Ga0068856_100254908 | 3300005614 | Bacteria | 1769 |
| 298 | Ga0068856_100446120 | 3300005614 | Bacteria | 1314 |
| 299 | Ga0068856_101871833 | 3300005614 | Bacteria | 611 |
| 300 | Ga0068856_102570338 | 3300005614 | Bacteria | 515 |
| 301 | Ga0070702_100195072 | 3300005615 | Bacteria | 1336 |
| 302 | Ga0070702_100234415 | 3300005615 | Bacteria | 1235 |
| 303 | Ga0070702_100463752 | 3300005615 | Unclassified | 922 |
| 304 | Ga0070702_100775468 | 3300005615 | Bacteria | 739 |
| 305 | Ga0070702_101641100 | 3300005615 | Bacteria | 533 |
| 306 | Ga0068852_100000454 | 3300005616 | Bacteria | 27039 |
| 307 | Ga0068852_100028526 | 3300005616 | Bacteria | 4570 |
| 308 | Ga0068852_100029241 | 3300005616 | Bacteria | 4524 |
| 309 | Ga0068852_100045606 | 3300005616 | Bacteria | 3730 |
| 310 | Ga0068852_100045652 | 3300005616 | Bacteria | 3728 |
| 311 | Ga0068852_100151694 | 3300005616 | Unclassified | 2156 |
| 312 | Ga0068852_100176471 | 3300005616 | Bacteria | 2006 |
| 313 | Ga0068852_100186123 | 3300005616 | Unclassified | 1956 |
| 314 | Ga0068852_100447777 | 3300005616 | Bacteria | 1278 |
| 315 | Ga0068852_100888601 | 3300005616 | Bacteria | 908 |
| 316 | Ga0068852_101703159 | 3300005616 | Bacteria | 653 |
| 317 | Ga0068852_101742132 | 3300005616 | Unclassified | 645 |
| 318 | Ga0068852_101898050 | 3300005616 | Unclassified | 618 |
| 319 | Ga0068852_101908904 | 3300005616 | Unclassified | 616 |
| 320 | Ga0068859_100012944 | 3300005617 | Bacteria | 8382 |
| 321 | Ga0068859_100016137 | 3300005617 | Bacteria | 7501 |
| 322 | Ga0068859_100016352 | 3300005617 | Bacteria | 7453 |
| 323 | Ga0068859_100039683 | 3300005617 | Bacteria | 4724 |
| 324 | Ga0068859_100064024 | 3300005617 | Bacteria | 3709 |
| 325 | Ga0068859_100082452 | 3300005617 | Bacteria | 3259 |
| 326 | Ga0068859_100806587 | 3300005617 | Bacteria | 1026 |
| 327 | Ga0068859_100934465 | 3300005617 | Bacteria | 951 |
| 328 | Ga0068864_100038571 | 3300005618 | Bacteria | 4081 |
| 329 | Ga0068864_100048935 | 3300005618 | Bacteria | 3635 |
| 330 | Ga0068864_100082813 | 3300005618 | Bacteria | 2816 |
| 331 | Ga0068864_100260246 | 3300005618 | Bacteria | 1614 |
| 332 | Ga0068864_100733675 | 3300005618 | Bacteria | 967 |
| 333 | Ga0068864_101199275 | 3300005618 | Bacteria | 757 |
| 334 | Ga0068864_101635732 | 3300005618 | Unclassified | 648 |
| 335 | Ga0068866_10010298 | 3300005718 | Bacteria | 4004 |
| 336 | Ga0068866_10021202 | 3300005718 | Bacteria | 2991 |
| 337 | Ga0068866_10023585 | 3300005718 | Bacteria | 2865 |
| 338 | Ga0068866_10079389 | 3300005718 | Bacteria | 1758 |
| 339 | Ga0068866_10335842 | 3300005718 | Bacteria | 955 |
| 340 | Ga0068861_100051333 | 3300005719 | Bacteria | 3130 |
| 341 | Ga0068861_100073767 | 3300005719 | Bacteria | 2652 |
| 342 | Ga0068861_100120249 | 3300005719 | Bacteria | 2118 |
| 343 | Ga0068861_100161242 | 3300005719 | Bacteria | 1850 |
| 344 | Ga0068861_100279444 | 3300005719 | Bacteria | 1437 |
| 345 | Ga0068861_100413833 | 3300005719 | Unclassified | 1200 |
| 346 | Ga0068861_100818533 | 3300005719 | Bacteria | 875 |
| 347 | Ga0068861_100841951 | 3300005719 | Bacteria | 864 |
| 348 | Ga0068861_100938749 | 3300005719 | Bacteria | 822 |
| 349 | Ga0068851_10014708 | 3300005834 | Bacteria | 3719 |
| 350 | Ga0068851_10050055 | 3300005834 | Bacteria | 2121 |
| 351 | Ga0068851_10772991 | 3300005834 | Bacteria | 595 |
| 352 | Ga0068851_10777152 | 3300005834 | Unclassified | 594 |
| 353 | Ga0068870_10016162 | 3300005840 | Bacteria | 3559 |
| 354 | Ga0068870_10041994 | 3300005840 | Bacteria | 2379 |
| 355 | Ga0068870_10159345 | 3300005840 | Bacteria | 1337 |
| 356 | Ga0068870_10280578 | 3300005840 | Bacteria | 1044 |
| 357 | Ga0068870_10943574 | 3300005840 | Bacteria | 612 |
| 358 | Ga0068863_100029026 | 3300005841 | Bacteria | 5284 |
| 359 | Ga0068863_100090425 | 3300005841 | Bacteria | 2902 |
| 360 | Ga0068863_100448448 | 3300005841 | Bacteria | 1266 |
| 361 | Ga0068863_100630713 | 3300005841 | Bacteria | 1062 |
| 362 | Ga0068863_100694585 | 3300005841 | Bacteria | 1011 |
| 363 | Ga0068858_100012456 | 3300005842 | Bacteria | 8019 |
| 364 | Ga0068858_100187834 | 3300005842 | Bacteria | 1952 |
| 365 | Ga0068858_100532078 | 3300005842 | Bacteria | 1137 |
| 366 | Ga0068858_101198172 | 3300005842 | Bacteria | 746 |
| 367 | Ga0068858_101373923 | 3300005842 | Bacteria | 696 |
| 368 | Ga0068858_101602774 | 3300005842 | Bacteria | 642 |
| 369 | Ga0068860_100023035 | 3300005843 | Bacteria | 6023 |
| 370 | Ga0068860_100062721 | 3300005843 | Bacteria | 3532 |
| 371 | Ga0068860_100097098 | 3300005843 | Bacteria | 2809 |
| 372 | Ga0068860_100189317 | 3300005843 | Bacteria | 1991 |
| 373 | Ga0068860_100307542 | 3300005843 | Bacteria | 1554 |
| 374 | Ga0068860_100532188 | 3300005843 | Unclassified | 1176 |
| 375 | Ga0068860_100953218 | 3300005843 | Bacteria | 875 |
| 376 | Ga0068860_101590741 | 3300005843 | Bacteria | 675 |
| 377 | Ga0068860_102002419 | 3300005843 | Bacteria | 601 |
| 378 | Ga0068862_100011150 | 3300005844 | Bacteria | 7421 |
| 379 | Ga0068862_100059921 | 3300005844 | Bacteria | 3270 |
| 380 | Ga0068862_100098588 | 3300005844 | Unclassified | 2553 |
| 381 | Ga0068862_100799465 | 3300005844 | Bacteria | 921 |
| 382 | Ga0068862_100919936 | 3300005844 | Bacteria | 861 |
| 383 | Ga0068862_101029043 | 3300005844 | Bacteria | 816 |
| 384 | Ga0070717_11521271 | 3300006028 | Bacteria | 607 |
| 385 | Ga0070715_10078967 | 3300006163 | Bacteria | 1489 |
| 386 | Ga0070715_10647350 | 3300006163 | Bacteria | 625 |
| 387 | Ga0075366_10040177 | 3300006195 | Bacteria | 2767 |
| 388 | Ga0075366_10049611 | 3300006195 | Bacteria | 2491 |
| 389 | Ga0097621_100007404 | 3300006237 | Bacteria | 7850 |
| 390 | Ga0097621_100120076 | 3300006237 | Bacteria | 2228 |
| 391 | Ga0097621_100538930 | 3300006237 | Unclassified | 1061 |
| 392 | Ga0097621_100890285 | 3300006237 | Bacteria | 829 |
| 393 | Ga0068871_100054184 | 3300006358 | Bacteria | 3253 |
| 394 | Ga0068871_100487356 | 3300006358 | Bacteria | 1110 |
| 395 | Ga0068871_100537308 | 3300006358 | Bacteria | 1057 |
| 396 | Ga0068871_100704530 | 3300006358 | Bacteria | 925 |
| 397 | Ga0068871_101187381 | 3300006358 | Unclassified | 715 |
| 398 | Ga0068871_102118768 | 3300006358 | Bacteria | 536 |
| 399 | Ga0075428_100638233 | 3300006844 | Bacteria | 1136 |
| 400 | Ga0075434_100162609 | 3300006871 | Bacteria | 2252 |
| 401 | Ga0075434_101171273 | 3300006871 | Unclassified | 781 |
| 402 | Ga0075434_101974918 | 3300006871 | Unclassified | 589 |
| 403 | Ga0068865_100019851 | 3300006881 | Bacteria | 4352 |
| 404 | Ga0068865_100274456 | 3300006881 | Bacteria | 1340 |
| 405 | Ga0068865_100305863 | 3300006881 | Bacteria | 1274 |
| 406 | Ga0068865_100357204 | 3300006881 | Bacteria | 1185 |
| 407 | Ga0068865_100379802 | 3300006881 | Bacteria | 1152 |
| 408 | Ga0097620_100012943 | 3300006931 | Bacteria | 8382 |
| 409 | Ga0097620_100016137 | 3300006931 | Bacteria | 7501 |
| 410 | Ga0097620_100016353 | 3300006931 | Bacteria | 7453 |
| 411 | Ga0097620_100039681 | 3300006931 | Bacteria | 4724 |
| 412 | Ga0097620_100064027 | 3300006931 | Bacteria | 3709 |
| 413 | Ga0097620_100082448 | 3300006931 | Bacteria | 3259 |
| 414 | Ga0097620_100806637 | 3300006931 | Bacteria | 1026 |
| 415 | Ga0097620_100934328 | 3300006931 | Bacteria | 951 |
| 416 | Ga0105251_10045746 | 3300009011 | Unclassified | 2109 |
| 417 | Ga0105240_10152474 | 3300009093 | Bacteria | 2751 |
| 418 | Ga0105240_10850041 | 3300009093 | Bacteria | 985 |
| 419 | Ga0111539_10052316 | 3300009094 | Unclassified | 4861 |
| 420 | Ga0105245_11105189 | 3300009098 | Bacteria | 839 |
| 421 | Ga0105247_10002375 | 3300009101 | Bacteria | 12826 |
| 422 | Ga0105247_10935152 | 3300009101 | Unclassified | 672 |
| 423 | Ga0114129_10239923 | 3300009147 | Bacteria | 2437 |
| 424 | Ga0105243_10758784 | 3300009148 | Bacteria | 952 |
| 425 | Ga0105241_10004448 | 3300009174 | Bacteria | 10363 |
| 426 | Ga0105241_10064271 | 3300009174 | Bacteria | 2833 |
| 427 | Ga0105241_10160475 | 3300009174 | Bacteria | 1848 |
| 428 | Ga0105241_10826120 | 3300009174 | Unclassified | 855 |
| 429 | Ga0105241_10896292 | 3300009174 | Unclassified | 823 |
| 430 | Ga0105241_11318747 | 3300009174 | Unclassified | 688 |
| 431 | Ga0105241_11387541 | 3300009174 | Bacteria | 672 |
| 432 | Ga0105241_11454418 | 3300009174 | Bacteria | 658 |
| 433 | Ga0105242_10012464 | 3300009176 | Bacteria | 6546 |
| 434 | Ga0105242_10023748 | 3300009176 | Bacteria | 4835 |
| 435 | Ga0105242_10152188 | 3300009176 | Unclassified | 2018 |
| 436 | Ga0105242_10338183 | 3300009176 | Bacteria | 1386 |
| 437 | Ga0105242_10350791 | 3300009176 | Bacteria | 1363 |
| 438 | Ga0105242_10972450 | 3300009176 | Bacteria | 855 |
| 439 | Ga0105242_12246589 | 3300009176 | Bacteria | 591 |
| 440 | Ga0105248_10751547 | 3300009177 | Bacteria | 1100 |
| 441 | Ga0105248_11834692 | 3300009177 | Bacteria | 688 |
| 442 | Ga0105248_11895292 | 3300009177 | Bacteria | 676 |
| 443 | Ga0105237_10016034 | 3300009545 | Bacteria | 7791 |
| 444 | Ga0105237_10235089 | 3300009545 | Bacteria | 1834 |
| 445 | Ga0105237_10465390 | 3300009545 | Bacteria | 1270 |
| 446 | Ga0105238_11202961 | 3300009551 | Unclassified | 782 |
| 447 | Ga0105238_11638829 | 3300009551 | Unclassified | 674 |
| 448 | Ga0105249_10015985 | 3300009553 | Bacteria | 6652 |
| 449 | Ga0105249_10061023 | 3300009553 | Bacteria | 3460 |
| 450 | Ga0105249_10070285 | 3300009553 | Bacteria | 3231 |
| 451 | Ga0105249_10077543 | 3300009553 | Bacteria | 3082 |
| 452 | Ga0105249_10204206 | 3300009553 | Bacteria | 1935 |
| 453 | Ga0105249_10406175 | 3300009553 | Bacteria | 1393 |
| 454 | Ga0105249_10460531 | 3300009553 | Bacteria | 1312 |
| 455 | Ga0105249_10620684 | 3300009553 | Bacteria | 1137 |
| 456 | Ga0105249_10935094 | 3300009553 | Bacteria | 934 |
| 457 | Ga0105249_10997775 | 3300009553 | Bacteria | 906 |
| 458 | Ga0105249_11483727 | 3300009553 | Bacteria | 750 |
| 459 | Ga0105249_11925922 | 3300009553 | Unclassified | 664 |
| 460 | Ga0105239_10073188 | 3300010375 | Bacteria | 3767 |
| 461 | Ga0105239_10631921 | 3300010375 | Bacteria | 1222 |
| 462 | Ga0105239_10691313 | 3300010375 | Bacteria | 1166 |
| 463 | Ga0105239_10878834 | 3300010375 | Unclassified | 1028 |
| 464 | Ga0105239_12981080 | 3300010375 | Bacteria | 552 |
| 465 | Ga0105246_10173321 | 3300011119 | Bacteria | 1654 |
| 466 | Ga0105246_10209132 | 3300011119 | Bacteria | 1522 |
| 467 | Ga0105246_12116545 | 3300011119 | Bacteria | 546 |
| 468 | Ga0157373_10000592 | 3300013100 | Bacteria | 28163 |
| 469 | Ga0157373_10021014 | 3300013100 | Bacteria | 4738 |
| 470 | Ga0157373_10025954 | 3300013100 | Bacteria | 4234 |
| 471 | Ga0157373_10028988 | 3300013100 | Bacteria | 3991 |
| 472 | Ga0157373_10038167 | 3300013100 | Bacteria | 3443 |
| 473 | Ga0157373_10062105 | 3300013100 | Bacteria | 2646 |
| 474 | Ga0157373_10249750 | 3300013100 | Unclassified | 1255 |
| 475 | Ga0157373_10249987 | 3300013100 | Unclassified | 1254 |
| 476 | Ga0157373_10516337 | 3300013100 | Bacteria | 864 |
| 477 | Ga0157373_10985261 | 3300013100 | Bacteria | 628 |
| 478 | Ga0157373_10988032 | 3300013100 | Bacteria | 628 |
| 479 | Ga0157373_11157404 | 3300013100 | Unclassified | 582 |
| 480 | Ga0157373_11353516 | 3300013100 | Bacteria | 540 |
| 481 | Ga0157371_10003403 | 3300013102 | Bacteria | 14452 |
| 482 | Ga0157371_10004188 | 3300013102 | Bacteria | 12709 |
| 483 | Ga0157371_10011420 | 3300013102 | Bacteria | 6843 |
| 484 | Ga0157371_10014159 | 3300013102 | Bacteria | 6030 |
| 485 | Ga0157371_10015346 | 3300013102 | Bacteria | 5749 |
| 486 | Ga0157371_10050178 | 3300013102 | Bacteria | 2964 |
| 487 | Ga0157371_10064214 | 3300013102 | Bacteria | 2601 |
| 488 | Ga0157371_10077105 | 3300013102 | Bacteria | 2360 |
| 489 | Ga0157371_10127238 | 3300013102 | Bacteria | 1812 |
| 490 | Ga0157371_10181644 | 3300013102 | Bacteria | 1504 |
| 491 | Ga0157371_10184865 | 3300013102 | Unclassified | 1491 |
| 492 | Ga0157371_10190841 | 3300013102 | Bacteria | 1467 |
| 493 | Ga0157371_10274888 | 3300013102 | Bacteria | 1216 |
| 494 | Ga0157371_10283163 | 3300013102 | Bacteria | 1198 |
| 495 | Ga0157371_10512720 | 3300013102 | Bacteria | 886 |
| 496 | Ga0157371_10586172 | 3300013102 | Bacteria | 829 |
| 497 | Ga0157371_10588824 | 3300013102 | Bacteria | 827 |
| 498 | Ga0157371_11042238 | 3300013102 | Bacteria | 625 |
| 499 | Ga0157370_10002668 | 3300013104 | Bacteria | 21394 |
| 500 | Ga0157370_10006362 | 3300013104 | Bacteria | 13037 |
| 501 | Ga0157370_10008665 | 3300013104 | Bacteria | 10947 |
| 502 | Ga0157370_10008795 | 3300013104 | Bacteria | 10848 |
| 503 | Ga0157370_10186464 | 3300013104 | Bacteria | 1926 |
| 504 | Ga0157370_11114771 | 3300013104 | Bacteria | 713 |
| 505 | Ga0157370_11339363 | 3300013104 | Unclassified | 645 |
| 506 | Ga0157370_11736182 | 3300013104 | Bacteria | 560 |
| 507 | Ga0157370_11747254 | 3300013104 | Bacteria | 558 |
| 508 | Ga0157370_11847793 | 3300013104 | Bacteria | 542 |
| 509 | Ga0157369_10004162 | 3300013105 | Bacteria | 17136 |
| 510 | Ga0157369_10009198 | 3300013105 | Bacteria | 11303 |
| 511 | Ga0157369_10019866 | 3300013105 | Bacteria | 7515 |
| 512 | Ga0157369_10064958 | 3300013105 | Bacteria | 3930 |
| 513 | Ga0157369_10223125 | 3300013105 | Unclassified | 1972 |
| 514 | Ga0157369_10398377 | 3300013105 | Bacteria | 1428 |
| 515 | Ga0157369_10529562 | 3300013105 | Bacteria | 1219 |
| 516 | Ga0157369_10757503 | 3300013105 | Bacteria | 999 |
| 517 | Ga0157369_10894349 | 3300013105 | Bacteria | 911 |
| 518 | Ga0157369_11093559 | 3300013105 | Bacteria | 815 |
| 519 | Ga0157369_11831780 | 3300013105 | Unclassified | 616 |
| 520 | Ga0157374_10003156 | 3300013296 | Bacteria | 13854 |
| 521 | Ga0157374_10014456 | 3300013296 | Bacteria | 6907 |
| 522 | Ga0157374_10061563 | 3300013296 | Bacteria | 3516 |
| 523 | Ga0157374_10062669 | 3300013296 | Unclassified | 3486 |
| 524 | Ga0157374_10259932 | 3300013296 | Bacteria | 1710 |
| 525 | Ga0157374_10415942 | 3300013296 | Bacteria | 1343 |
| 526 | Ga0157374_10567574 | 3300013296 | Bacteria | 1143 |
| 527 | Ga0157374_11647093 | 3300013296 | Bacteria | 666 |
| 528 | Ga0157374_11678788 | 3300013296 | Bacteria | 660 |
| 529 | Ga0157374_12494395 | 3300013296 | Bacteria | 544 |
| 530 | Ga0157378_10072175 | 3300013297 | Bacteria | 3102 |
| 531 | Ga0157378_10104662 | 3300013297 | Bacteria | 2587 |
| 532 | Ga0157378_10119493 | 3300013297 | Bacteria | 2427 |
| 533 | Ga0157378_10151173 | 3300013297 | Bacteria | 2163 |
| 534 | Ga0157378_10237073 | 3300013297 | Bacteria | 1741 |
| 535 | Ga0157378_10539166 | 3300013297 | Bacteria | 1171 |
| 536 | Ga0157378_10553446 | 3300013297 | Bacteria | 1156 |
| 537 | Ga0157378_10756599 | 3300013297 | Bacteria | 995 |
| 538 | Ga0157378_10759312 | 3300013297 | Unclassified | 993 |
| 539 | Ga0157378_11252948 | 3300013297 | Bacteria | 782 |
| 540 | Ga0157378_11468733 | 3300013297 | Bacteria | 726 |
| 541 | Ga0163162_10012546 | 3300013306 | Bacteria | 8276 |
| 542 | Ga0163162_10014394 | 3300013306 | Bacteria | 7730 |
| 543 | Ga0163162_10022713 | 3300013306 | Bacteria | 6185 |
| 544 | Ga0163162_10024304 | 3300013306 | Bacteria | 5980 |
| 545 | Ga0163162_10238238 | 3300013306 | Bacteria | 1950 |
| 546 | Ga0163162_10474200 | 3300013306 | Bacteria | 1383 |
| 547 | Ga0163162_10556412 | 3300013306 | Unclassified | 1275 |
| 548 | Ga0163162_11303811 | 3300013306 | Bacteria | 825 |
| 549 | Ga0163162_11992315 | 3300013306 | Bacteria | 665 |
| 550 | Ga0163162_12936613 | 3300013306 | Unclassified | 548 |
| 551 | Ga0157372_10009464 | 3300013307 | Bacteria | 10362 |
| 552 | Ga0157372_10023397 | 3300013307 | Bacteria | 6696 |
| 553 | Ga0157372_10025178 | 3300013307 | Bacteria | 6467 |
| 554 | Ga0157372_10032959 | 3300013307 | Bacteria | 5686 |
| 555 | Ga0157372_10049169 | 3300013307 | Bacteria | 4688 |
| 556 | Ga0157372_10108205 | 3300013307 | Bacteria | 3181 |
| 557 | Ga0157372_10124997 | 3300013307 | Bacteria | 2957 |
| 558 | Ga0157372_10172006 | 3300013307 | Bacteria | 2506 |
| 559 | Ga0157372_10202576 | 3300013307 | Unclassified | 2299 |
| 560 | Ga0157372_10285220 | 3300013307 | Bacteria | 1920 |
| 561 | Ga0157372_10372015 | 3300013307 | Bacteria | 1665 |
| 562 | Ga0157372_10394828 | 3300013307 | Unclassified | 1612 |
| 563 | Ga0157372_10428568 | 3300013307 | Bacteria | 1542 |
| 564 | Ga0157372_10520690 | 3300013307 | Bacteria | 1386 |
| 565 | Ga0157372_10530484 | 3300013307 | Bacteria | 1372 |
| 566 | Ga0157372_10601330 | 3300013307 | Bacteria | 1282 |
| 567 | Ga0157372_10653775 | 3300013307 | Bacteria | 1224 |
| 568 | Ga0157372_10711445 | 3300013307 | Bacteria | 1169 |
| 569 | Ga0157372_10720938 | 3300013307 | Bacteria | 1160 |
| 570 | Ga0157372_10784638 | 3300013307 | Bacteria | 1107 |
| 571 | Ga0157372_10797009 | 3300013307 | Bacteria | 1098 |
| 572 | Ga0157372_10998344 | 3300013307 | Unclassified | 969 |
| 573 | Ga0157372_11106433 | 3300013307 | Bacteria | 916 |
| 574 | Ga0157372_11114117 | 3300013307 | Bacteria | 913 |
| 575 | Ga0157372_11174214 | 3300013307 | Bacteria | 887 |
| 576 | Ga0157372_11296358 | 3300013307 | Unclassified | 841 |
| 577 | Ga0157372_11486242 | 3300013307 | Bacteria | 781 |
| 578 | Ga0157372_11895544 | 3300013307 | Bacteria | 685 |
| 579 | Ga0157372_12513893 | 3300013307 | Bacteria | 591 |
| 580 | Ga0157375_10010150 | 3300013308 | Bacteria | 8284 |
| 581 | Ga0157375_10091006 | 3300013308 | Unclassified | 3111 |
| 582 | Ga0157375_10174426 | 3300013308 | Bacteria | 2299 |
| 583 | Ga0157375_10234365 | 3300013308 | Bacteria | 1995 |
| 584 | Ga0157375_10332365 | 3300013308 | Bacteria | 1685 |
| 585 | Ga0157375_11340750 | 3300013308 | Bacteria | 842 |
| 586 | Ga0157375_11374148 | 3300013308 | Unclassified | 832 |
| 587 | Ga0157375_11401390 | 3300013308 | Bacteria | 823 |
| 588 | Ga0157375_11551831 | 3300013308 | Bacteria | 782 |
| 589 | Ga0163163_10001563 | 3300014325 | Bacteria | 19320 |
| 590 | Ga0163163_10004743 | 3300014325 | Bacteria | 11653 |
| 591 | Ga0163163_10309897 | 3300014325 | Bacteria | 1631 |
| 592 | Ga0163163_10385178 | 3300014325 | Bacteria | 1460 |
| 593 | Ga0163163_10650339 | 3300014325 | Bacteria | 1118 |
| 594 | Ga0163163_10731420 | 3300014325 | Bacteria | 1053 |
| 595 | Ga0163163_11037756 | 3300014325 | Bacteria | 883 |
| 596 | Ga0163163_11482249 | 3300014325 | Bacteria | 740 |
| 597 | Ga0157380_10024118 | 3300014326 | Bacteria | 4599 |
| 598 | Ga0157380_10492957 | 3300014326 | Bacteria | 1188 |
| 599 | Ga0157380_10744334 | 3300014326 | Bacteria | 991 |
| 600 | Ga0157380_11603831 | 3300014326 | Bacteria | 706 |
| 601 | Ga0157380_12055440 | 3300014326 | Unclassified | 634 |
| 602 | Ga0157380_12181888 | 3300014326 | Bacteria | 617 |
| 603 | Ga0157377_10017170 | 3300014745 | Bacteria | 3739 |
| 604 | Ga0157377_10018690 | 3300014745 | Bacteria | 3606 |
| 605 | Ga0157377_10094906 | 3300014745 | Bacteria | 1767 |
| 606 | Ga0157377_10864936 | 3300014745 | Bacteria | 673 |
| 607 | Ga0157379_10047219 | 3300014968 | Bacteria | 3841 |
| 608 | Ga0157379_10055113 | 3300014968 | Bacteria | 3553 |
| 609 | Ga0157379_10114814 | 3300014968 | Bacteria | 2420 |
| 610 | Ga0157379_10295217 | 3300014968 | Bacteria | 1476 |
| 611 | Ga0157376_10022781 | 3300014969 | Bacteria | 4890 |
| 612 | Ga0157376_10198238 | 3300014969 | Unclassified | 1845 |
| 613 | Ga0157376_10217360 | 3300014969 | Bacteria | 1768 |
| 614 | Ga0157376_10631607 | 3300014969 | Bacteria | 1069 |
| 615 | Ga0157376_10632617 | 3300014969 | Bacteria | 1068 |
| 616 | Ga0157376_11151127 | 3300014969 | Bacteria | 803 |
| 617 | Ga0157376_12362432 | 3300014969 | Unclassified | 571 |
| 618 | Ga0157376_12655559 | 3300014969 | Bacteria | 541 |
| 619 | Ga0182005_1073270 | 3300015265 | Bacteria | 941 |
| 620 | Ga0163161_10224584 | 3300017792 | Bacteria | 1455 |
| 621 | Ga0163161_10823061 | 3300017792 | Unclassified | 782 |
| 622 | Ga0163161_11476468 | 3300017792 | Bacteria | 596 |
| 623 | Ga0206356_10994341 | 3300020070 | Bacteria | 509 |
| 624 | Ga0206356_11687923 | 3300020070 | Bacteria | 563 |
| 625 | Ga0206349_1377899 | 3300020075 | Bacteria | 501 |
| 626 | Ga0206351_10974334 | 3300020077 | Unclassified | 521 |
| 627 | Ga0206352_10819092 | 3300020078 | Bacteria | 942 |
| 628 | Ga0206350_10633921 | 3300020080 | Bacteria | 505 |
| 629 | Ga0206350_11141334 | 3300020080 | Unclassified | 662 |
| 630 | Ga0206350_11435478 | 3300020080 | Unclassified | 538 |
| 631 | Ga0206350_11624967 | 3300020080 | Bacteria | 557 |
| 632 | Ga0206350_11654957 | 3300020080 | Bacteria | 567 |
| 633 | Ga0206354_10173907 | 3300020081 | Bacteria | 543 |
| 634 | Ga0206354_10273940 | 3300020081 | Bacteria | 797 |
| 635 | Ga0206353_11167834 | 3300020082 | Bacteria | 581 |
| 636 | Ga0206353_11715051 | 3300020082 | Unclassified | 506 |
| 637 | Ga0224712_10545855 | 3300022467 | Bacteria | 563 |
| 638 | Ga0207666_1015809 | 3300025271 | Unclassified | 1078 |
| 639 | Ga0207673_1025405 | 3300025290 | Unclassified | 810 |
| 640 | Ga0207697_10021574 | 3300025315 | Bacteria | 2636 |
| 641 | Ga0207697_10033727 | 3300025315 | Bacteria | 2095 |
| 642 | Ga0207697_10311372 | 3300025315 | Unclassified | 699 |
| 643 | Ga0207656_10056099 | 3300025321 | Bacteria | 1716 |
| 644 | Ga0207656_10237043 | 3300025321 | Unclassified | 891 |
| 645 | Ga0207656_10241468 | 3300025321 | Unclassified | 883 |
| 646 | Ga0207682_10029024 | 3300025893 | Bacteria | 2211 |
| 647 | Ga0207682_10102376 | 3300025893 | Bacteria | 1253 |
| 648 | Ga0207682_10367146 | 3300025893 | Bacteria | 679 |
| 649 | Ga0207682_10568521 | 3300025893 | Unclassified | 535 |
| 650 | Ga0207642_10004344 | 3300025899 | Unclassified | 4569 |
| 651 | Ga0207642_10004642 | 3300025899 | Bacteria | 4438 |
| 652 | Ga0207642_10061353 | 3300025899 | Bacteria | 1748 |
| 653 | Ga0207642_10103122 | 3300025899 | Bacteria | 1436 |
| 654 | Ga0207642_11144001 | 3300025899 | Unclassified | 504 |
| 655 | Ga0207710_10006643 | 3300025900 | Bacteria | 4930 |
| 656 | Ga0207688_10058350 | 3300025901 | Bacteria | 2172 |
| 657 | Ga0207688_10468924 | 3300025901 | Bacteria | 786 |
| 658 | Ga0207680_10032788 | 3300025903 | Bacteria | 2956 |
| 659 | Ga0207680_10267887 | 3300025903 | Bacteria | 1184 |
| 660 | Ga0207647_10013718 | 3300025904 | Bacteria | 5611 |
| 661 | Ga0207647_10056774 | 3300025904 | Bacteria | 2401 |
| 662 | Ga0207647_10104095 | 3300025904 | Bacteria | 1682 |
| 663 | Ga0207685_10498195 | 3300025905 | Unclassified | 641 |
| 664 | Ga0207645_10001491 | 3300025907 | Bacteria | 19131 |
| 665 | Ga0207645_10004909 | 3300025907 | Bacteria | 9808 |
| 666 | Ga0207645_10023123 | 3300025907 | Bacteria | 4040 |
| 667 | Ga0207645_10154585 | 3300025907 | Bacteria | 1498 |
| 668 | Ga0207645_10400899 | 3300025907 | Bacteria | 922 |
| 669 | Ga0207645_11000735 | 3300025907 | Bacteria | 566 |
| 670 | Ga0207643_10009019 | 3300025908 | Bacteria | 5355 |
| 671 | Ga0207643_10054565 | 3300025908 | Bacteria | 2272 |
| 672 | Ga0207643_10164151 | 3300025908 | Bacteria | 1337 |
| 673 | Ga0207643_10248003 | 3300025908 | Bacteria | 1096 |
| 674 | Ga0207643_10307580 | 3300025908 | Bacteria | 987 |
| 675 | Ga0207705_10009398 | 3300025909 | Bacteria | 7110 |
| 676 | Ga0207705_10026600 | 3300025909 | Bacteria | 4124 |
| 677 | Ga0207705_10048712 | 3300025909 | Bacteria | 3049 |
| 678 | Ga0207705_10208676 | 3300025909 | Bacteria | 1481 |
| 679 | Ga0207705_10209406 | 3300025909 | Bacteria | 1479 |
| 680 | Ga0207705_10216366 | 3300025909 | Bacteria | 1454 |
| 681 | Ga0207705_10283595 | 3300025909 | Bacteria | 1268 |
| 682 | Ga0207705_10295685 | 3300025909 | Bacteria | 1241 |
| 683 | Ga0207705_10619018 | 3300025909 | Bacteria | 842 |
| 684 | Ga0207654_10272411 | 3300025911 | Bacteria | 1142 |
| 685 | Ga0207654_10373832 | 3300025911 | Bacteria | 986 |
| 686 | Ga0207654_10419197 | 3300025911 | Bacteria | 934 |
| 687 | Ga0207654_10697594 | 3300025911 | Unclassified | 729 |
| 688 | Ga0207654_10806615 | 3300025911 | Bacteria | 678 |
| 689 | Ga0207707_10124335 | 3300025912 | Bacteria | 2256 |
| 690 | Ga0207707_10188789 | 3300025912 | Bacteria | 1798 |
| 691 | Ga0207707_10324338 | 3300025912 | Bacteria | 1329 |
| 692 | Ga0207707_10535864 | 3300025912 | Bacteria | 996 |
| 693 | Ga0207695_10082168 | 3300025913 | Bacteria | 3259 |
| 694 | Ga0207695_10311100 | 3300025913 | Bacteria | 1465 |
| 695 | Ga0207671_11330761 | 3300025914 | Bacteria | 559 |
| 696 | Ga0207660_10007763 | 3300025917 | Bacteria | 6946 |
| 697 | Ga0207660_10029630 | 3300025917 | Bacteria | 3757 |
| 698 | Ga0207660_10098800 | 3300025917 | Bacteria | 2178 |
| 699 | Ga0207660_11344277 | 3300025917 | Unclassified | 580 |
| 700 | Ga0207657_10005870 | 3300025919 | Bacteria | 12791 |
| 701 | Ga0207657_10017331 | 3300025919 | Bacteria | 6911 |
| 702 | Ga0207657_10057007 | 3300025919 | Bacteria | 3369 |
| 703 | Ga0207657_10081676 | 3300025919 | Bacteria | 2714 |
| 704 | Ga0207657_10089484 | 3300025919 | Bacteria | 2571 |
| 705 | Ga0207657_10185647 | 3300025919 | Unclassified | 1679 |
| 706 | Ga0207657_10215296 | 3300025919 | Bacteria | 1540 |
| 707 | Ga0207649_10000644 | 3300025920 | Bacteria | 23288 |
| 708 | Ga0207649_10385775 | 3300025920 | Bacteria | 1045 |
| 709 | Ga0207649_10461186 | 3300025920 | Bacteria | 961 |
| 710 | Ga0207649_10601197 | 3300025920 | Bacteria | 846 |
| 711 | Ga0207652_10000010 | 3300025921 | Bacteria | 247079 |
| 712 | Ga0207652_10000844 | 3300025921 | Bacteria | 29188 |
| 713 | Ga0207652_10007238 | 3300025921 | Bacteria | 8939 |
| 714 | Ga0207652_10021217 | 3300025921 | Bacteria | 5360 |
| 715 | Ga0207652_10032135 | 3300025921 | Bacteria | 4408 |
| 716 | Ga0207652_10059056 | 3300025921 | Bacteria | 3306 |
| 717 | Ga0207652_11649498 | 3300025921 | Unclassified | 546 |
| 718 | Ga0207681_10003840 | 3300025923 | Bacteria | 9323 |
| 719 | Ga0207681_10065387 | 3300025923 | Bacteria | 2514 |
| 720 | Ga0207681_10080903 | 3300025923 | Bacteria | 2292 |
| 721 | Ga0207681_10425614 | 3300025923 | Bacteria | 1076 |
| 722 | Ga0207681_10958497 | 3300025923 | Unclassified | 717 |
| 723 | Ga0207681_11020514 | 3300025923 | Bacteria | 694 |
| 724 | Ga0207650_10002472 | 3300025925 | Bacteria | 12853 |
| 725 | Ga0207650_10013869 | 3300025925 | Bacteria | 5590 |
| 726 | Ga0207650_10062858 | 3300025925 | Unclassified | 2774 |
| 727 | Ga0207650_10108938 | 3300025925 | Bacteria | 2142 |
| 728 | Ga0207650_10167710 | 3300025925 | Bacteria | 1743 |
| 729 | Ga0207650_10459239 | 3300025925 | Bacteria | 1061 |
| 730 | Ga0207650_10762865 | 3300025925 | Bacteria | 819 |
| 731 | Ga0207650_11031792 | 3300025925 | Bacteria | 700 |
| 732 | Ga0207650_11298831 | 3300025925 | Bacteria | 619 |
| 733 | Ga0207650_11694504 | 3300025925 | Unclassified | 536 |
| 734 | Ga0207650_11716284 | 3300025925 | Unclassified | 532 |
| 735 | Ga0207659_10072911 | 3300025926 | Bacteria | 2512 |
| 736 | Ga0207659_10139502 | 3300025926 | Bacteria | 1881 |
| 737 | Ga0207659_10228918 | 3300025926 | Unclassified | 1498 |
| 738 | Ga0207659_10307732 | 3300025926 | Bacteria | 1304 |
| 739 | Ga0207644_10085680 | 3300025931 | Bacteria | 2338 |
| 740 | Ga0207644_10114518 | 3300025931 | Bacteria | 2043 |
| 741 | Ga0207644_10126372 | 3300025931 | Bacteria | 1952 |
| 742 | Ga0207644_10178954 | 3300025931 | Bacteria | 1661 |
| 743 | Ga0207644_10635799 | 3300025931 | Unclassified | 887 |
| 744 | Ga0207690_10006232 | 3300025932 | Bacteria | 7060 |
| 745 | Ga0207690_10023922 | 3300025932 | Bacteria | 3820 |
| 746 | Ga0207690_10050038 | 3300025932 | Unclassified | 2788 |
| 747 | Ga0207690_10072678 | 3300025932 | Bacteria | 2376 |
| 748 | Ga0207690_11599811 | 3300025932 | Bacteria | 544 |
| 749 | Ga0207706_10023357 | 3300025933 | Bacteria | 5553 |
| 750 | Ga0207706_10027153 | 3300025933 | Bacteria | 5120 |
| 751 | Ga0207706_10032203 | 3300025933 | Bacteria | 4669 |
| 752 | Ga0207706_10043173 | 3300025933 | Bacteria | 3996 |
| 753 | Ga0207706_10079253 | 3300025933 | Bacteria | 2888 |
| 754 | Ga0207706_10124679 | 3300025933 | Bacteria | 2266 |
| 755 | Ga0207706_10488731 | 3300025933 | Bacteria | 1063 |
| 756 | Ga0207686_10091395 | 3300025934 | Bacteria | 2010 |
| 757 | Ga0207686_10144137 | 3300025934 | Bacteria | 1650 |
| 758 | Ga0207686_10415035 | 3300025934 | Bacteria | 1028 |
| 759 | Ga0207686_10617505 | 3300025934 | Bacteria | 855 |
| 760 | Ga0207686_10722194 | 3300025934 | Bacteria | 793 |
| 761 | Ga0207686_10889760 | 3300025934 | Bacteria | 718 |
| 762 | Ga0207709_10780416 | 3300025935 | Unclassified | 770 |
| 763 | Ga0207670_10214606 | 3300025936 | Unclassified | 1469 |
| 764 | Ga0207670_11002599 | 3300025936 | Unclassified | 703 |
| 765 | Ga0207670_11356876 | 3300025936 | Unclassified | 603 |
| 766 | Ga0207670_11588139 | 3300025936 | Unclassified | 556 |
| 767 | Ga0207669_10060773 | 3300025937 | Bacteria | 2318 |
| 768 | Ga0207669_10083926 | 3300025937 | Bacteria | 2050 |
| 769 | Ga0207669_10092169 | 3300025937 | Bacteria | 1976 |
| 770 | Ga0207669_10170167 | 3300025937 | Bacteria | 1550 |
| 771 | Ga0207704_10098240 | 3300025938 | Bacteria | 1944 |
| 772 | Ga0207704_10164213 | 3300025938 | Bacteria | 1584 |
| 773 | Ga0207704_10181946 | 3300025938 | Bacteria | 1520 |
| 774 | Ga0207704_10246611 | 3300025938 | Bacteria | 1338 |
| 775 | Ga0207704_11624245 | 3300025938 | Bacteria | 555 |
| 776 | Ga0207704_11682442 | 3300025938 | Bacteria | 545 |
| 777 | Ga0207691_10009018 | 3300025940 | Bacteria | 9565 |
| 778 | Ga0207691_10159330 | 3300025940 | Bacteria | 1981 |
| 779 | Ga0207691_10174361 | 3300025940 | Bacteria | 1882 |
| 780 | Ga0207691_10191807 | 3300025940 | Bacteria | 1782 |
| 781 | Ga0207691_10286766 | 3300025940 | Bacteria | 1416 |
| 782 | Ga0207691_10392947 | 3300025940 | Bacteria | 1183 |
| 783 | Ga0207691_10499520 | 3300025940 | Bacteria | 1033 |
| 784 | Ga0207711_10267123 | 3300025941 | Bacteria | 1573 |
| 785 | Ga0207689_10001227 | 3300025942 | Bacteria | 24647 |
| 786 | Ga0207689_10001306 | 3300025942 | Bacteria | 24017 |
| 787 | Ga0207689_10005140 | 3300025942 | Bacteria | 11766 |
| 788 | Ga0207689_10008581 | 3300025942 | Bacteria | 8905 |
| 789 | Ga0207689_10015923 | 3300025942 | Bacteria | 6366 |
| 790 | Ga0207689_10032199 | 3300025942 | Bacteria | 4361 |
| 791 | Ga0207689_10059258 | 3300025942 | Bacteria | 3149 |
| 792 | Ga0207689_10067810 | 3300025942 | Bacteria | 2932 |
| 793 | Ga0207689_10121552 | 3300025942 | Unclassified | 2148 |
| 794 | Ga0207689_10854575 | 3300025942 | Bacteria | 768 |
| 795 | Ga0207661_10000781 | 3300025944 | Bacteria | 20721 |
| 796 | Ga0207661_10008250 | 3300025944 | Bacteria | 7439 |
| 797 | Ga0207661_10161528 | 3300025944 | Bacteria | 1944 |
| 798 | Ga0207661_10325833 | 3300025944 | Bacteria | 1382 |
| 799 | Ga0207661_10568366 | 3300025944 | Bacteria | 1040 |
| 800 | Ga0207661_11630255 | 3300025944 | Unclassified | 590 |
| 801 | Ga0207679_10000733 | 3300025945 | Bacteria | 21828 |
| 802 | Ga0207679_10053505 | 3300025945 | Bacteria | 2967 |
| 803 | Ga0207679_10072529 | 3300025945 | Unclassified | 2601 |
| 804 | Ga0207679_10141082 | 3300025945 | Bacteria | 1948 |
| 805 | Ga0207679_10156009 | 3300025945 | Bacteria | 1864 |
| 806 | Ga0207679_10249089 | 3300025945 | Bacteria | 1509 |
| 807 | Ga0207679_10435024 | 3300025945 | Bacteria | 1160 |
| 808 | Ga0207679_10615805 | 3300025945 | Unclassified | 979 |
| 809 | Ga0207679_11269232 | 3300025945 | Bacteria | 676 |
| 810 | Ga0207667_10084321 | 3300025949 | Bacteria | 3289 |
| 811 | Ga0207667_10084964 | 3300025949 | Bacteria | 3276 |
| 812 | Ga0207667_10530279 | 3300025949 | Bacteria | 1192 |
| 813 | Ga0207667_10680425 | 3300025949 | Bacteria | 1032 |
| 814 | Ga0207667_10841888 | 3300025949 | Bacteria | 912 |
| 815 | Ga0207667_11603226 | 3300025949 | Unclassified | 619 |
| 816 | Ga0207667_11694124 | 3300025949 | Unclassified | 599 |
| 817 | Ga0207667_11931420 | 3300025949 | Bacteria | 552 |
| 818 | Ga0207651_10072501 | 3300025960 | Bacteria | 2445 |
| 819 | Ga0207651_10216789 | 3300025960 | Unclassified | 1544 |
| 820 | Ga0207651_10225893 | 3300025960 | Bacteria | 1517 |
| 821 | Ga0207651_10264575 | 3300025960 | Bacteria | 1413 |
| 822 | Ga0207651_11556114 | 3300025960 | Bacteria | 596 |
| 823 | Ga0207712_10013550 | 3300025961 | Bacteria | 5228 |
| 824 | Ga0207712_10047438 | 3300025961 | Bacteria | 2982 |
| 825 | Ga0207712_10056675 | 3300025961 | Bacteria | 2761 |
| 826 | Ga0207712_10113360 | 3300025961 | Bacteria | 2038 |
| 827 | Ga0207712_10115165 | 3300025961 | Bacteria | 2023 |
| 828 | Ga0207712_10463209 | 3300025961 | Bacteria | 1077 |
| 829 | Ga0207712_10904136 | 3300025961 | Bacteria | 780 |
| 830 | Ga0207712_11121198 | 3300025961 | Bacteria | 701 |
| 831 | Ga0207712_11673634 | 3300025961 | Bacteria | 570 |
| 832 | Ga0207668_10106752 | 3300025972 | Bacteria | 2092 |
| 833 | Ga0207668_10374600 | 3300025972 | Bacteria | 1196 |
| 834 | Ga0207668_10790971 | 3300025972 | Bacteria | 839 |
| 835 | Ga0207668_11311581 | 3300025972 | Bacteria | 652 |
| 836 | Ga0207668_11525417 | 3300025972 | Bacteria | 603 |
| 837 | Ga0207668_11884211 | 3300025972 | Bacteria | 539 |
| 838 | Ga0207668_12001922 | 3300025972 | Bacteria | 522 |
| 839 | Ga0207640_10045009 | 3300025981 | Bacteria | 2832 |
| 840 | Ga0207640_10111724 | 3300025981 | Bacteria | 1938 |
| 841 | Ga0207640_10192788 | 3300025981 | Bacteria | 1537 |
| 842 | Ga0207640_10210025 | 3300025981 | Bacteria | 1482 |
| 843 | Ga0207640_10452051 | 3300025981 | Unclassified | 1059 |
| 844 | Ga0207640_10936226 | 3300025981 | Bacteria | 759 |
| 845 | Ga0207640_10971783 | 3300025981 | Bacteria | 745 |
| 846 | Ga0207640_11023323 | 3300025981 | Bacteria | 728 |
| 847 | Ga0207640_11795081 | 3300025981 | Bacteria | 554 |
| 848 | Ga0207658_10060668 | 3300025986 | Bacteria | 2823 |
| 849 | Ga0207658_10089383 | 3300025986 | Bacteria | 2384 |
| 850 | Ga0207658_10094559 | 3300025986 | Bacteria | 2326 |
| 851 | Ga0207658_10155481 | 3300025986 | Bacteria | 1868 |
| 852 | Ga0207658_10195342 | 3300025986 | Bacteria | 1685 |
| 853 | Ga0207658_10199918 | 3300025986 | Bacteria | 1668 |
| 854 | Ga0207658_10256647 | 3300025986 | Bacteria | 1488 |
| 855 | Ga0207658_10381397 | 3300025986 | Bacteria | 1235 |
| 856 | Ga0207658_11172073 | 3300025986 | Unclassified | 702 |
| 857 | Ga0207658_11220733 | 3300025986 | Bacteria | 687 |
| 858 | Ga0207677_10026950 | 3300026023 | Bacteria | 3612 |
| 859 | Ga0207677_10098217 | 3300026023 | Bacteria | 2148 |
| 860 | Ga0207677_10267386 | 3300026023 | Bacteria | 1397 |
| 861 | Ga0207677_10357321 | 3300026023 | Bacteria | 1226 |
| 862 | Ga0207677_10477083 | 3300026023 | Bacteria | 1074 |
| 863 | Ga0207677_10526548 | 3300026023 | Bacteria | 1026 |
| 864 | Ga0207677_11092251 | 3300026023 | Bacteria | 727 |
| 865 | Ga0207677_11427023 | 3300026023 | Bacteria | 638 |
| 866 | Ga0207677_11558332 | 3300026023 | Bacteria | 611 |
| 867 | Ga0207703_10864410 | 3300026035 | Bacteria | 865 |
| 868 | Ga0207703_10958773 | 3300026035 | Bacteria | 820 |
| 869 | Ga0207703_11001954 | 3300026035 | Unclassified | 801 |
| 870 | Ga0207703_11836455 | 3300026035 | Bacteria | 582 |
| 871 | Ga0207703_12388597 | 3300026035 | Unclassified | 504 |
| 872 | Ga0207639_10005779 | 3300026041 | Bacteria | 8376 |
| 873 | Ga0207639_10007423 | 3300026041 | Bacteria | 7476 |
| 874 | Ga0207639_10041435 | 3300026041 | Bacteria | 3445 |
| 875 | Ga0207639_10058957 | 3300026041 | Bacteria | 2955 |
| 876 | Ga0207639_10143068 | 3300026041 | Bacteria | 1995 |
| 877 | Ga0207639_10336625 | 3300026041 | Bacteria | 1344 |
| 878 | Ga0207639_10479747 | 3300026041 | Bacteria | 1133 |
| 879 | Ga0207639_10794847 | 3300026041 | Bacteria | 881 |
| 880 | Ga0207639_10985363 | 3300026041 | Bacteria | 789 |
| 881 | Ga0207639_11890669 | 3300026041 | Unclassified | 558 |
| 882 | Ga0207678_10009599 | 3300026067 | Bacteria | 8510 |
| 883 | Ga0207678_10616279 | 3300026067 | Bacteria | 952 |
| 884 | Ga0207678_10677097 | 3300026067 | Unclassified | 907 |
| 885 | Ga0207678_11340383 | 3300026067 | Unclassified | 633 |
| 886 | Ga0207708_10044948 | 3300026075 | Unclassified | 3365 |
| 887 | Ga0207708_10747342 | 3300026075 | Unclassified | 839 |
| 888 | Ga0207708_11263794 | 3300026075 | Bacteria | 646 |
| 889 | Ga0207702_10347041 | 3300026078 | Bacteria | 1419 |
| 890 | Ga0207702_10596127 | 3300026078 | Unclassified | 1084 |
| 891 | Ga0207702_10713515 | 3300026078 | Bacteria | 988 |
| 892 | Ga0207702_11978408 | 3300026078 | Bacteria | 573 |
| 893 | Ga0207641_10020546 | 3300026088 | Bacteria | 5424 |
| 894 | Ga0207641_10097845 | 3300026088 | Bacteria | 2580 |
| 895 | Ga0207641_10337636 | 3300026088 | Bacteria | 1433 |
| 896 | Ga0207641_10696774 | 3300026088 | Bacteria | 1000 |
| 897 | Ga0207641_11243593 | 3300026088 | Unclassified | 745 |
| 898 | Ga0207641_12323467 | 3300026088 | Bacteria | 536 |
| 899 | Ga0207648_10000906 | 3300026089 | Bacteria | 33383 |
| 900 | Ga0207648_10005239 | 3300026089 | Bacteria | 13107 |
| 901 | Ga0207648_10016291 | 3300026089 | Bacteria | 6797 |
| 902 | Ga0207648_10018178 | 3300026089 | Bacteria | 6367 |
| 903 | Ga0207648_10033647 | 3300026089 | Unclassified | 4520 |
| 904 | Ga0207648_10055713 | 3300026089 | Bacteria | 3451 |
| 905 | Ga0207648_10060090 | 3300026089 | Archaea | 3315 |
| 906 | Ga0207648_10066109 | 3300026089 | Bacteria | 3153 |
| 907 | Ga0207648_10179839 | 3300026089 | Bacteria | 1872 |
| 908 | Ga0207648_10221880 | 3300026089 | Bacteria | 1680 |
| 909 | Ga0207648_10587571 | 3300026089 | Bacteria | 1026 |
| 910 | Ga0207676_10014205 | 3300026095 | Bacteria | 5721 |
| 911 | Ga0207676_10025141 | 3300026095 | Bacteria | 4417 |
| 912 | Ga0207676_10036338 | 3300026095 | Bacteria | 3746 |
| 913 | Ga0207676_10211820 | 3300026095 | Bacteria | 1720 |
| 914 | Ga0207676_10299654 | 3300026095 | Bacteria | 1467 |
| 915 | Ga0207676_10855359 | 3300026095 | Bacteria | 890 |
| 916 | Ga0207676_11570661 | 3300026095 | Unclassified | 655 |
| 917 | Ga0207676_11820684 | 3300026095 | Unclassified | 607 |
| 918 | Ga0207674_10003645 | 3300026116 | Bacteria | 18783 |
| 919 | Ga0207674_10014347 | 3300026116 | Bacteria | 8754 |
| 920 | Ga0207674_10023297 | 3300026116 | Bacteria | 6634 |
| 921 | Ga0207674_10106006 | 3300026116 | Bacteria | 2788 |
| 922 | Ga0207674_10237708 | 3300026116 | Bacteria | 1769 |
| 923 | Ga0207674_10245214 | 3300026116 | Bacteria | 1739 |
| 924 | Ga0207674_10308238 | 3300026116 | Bacteria | 1532 |
| 925 | Ga0207674_10371054 | 3300026116 | Bacteria | 1383 |
| 926 | Ga0207674_10729040 | 3300026116 | Bacteria | 957 |
| 927 | Ga0207674_11329563 | 3300026116 | Bacteria | 688 |
| 928 | Ga0207674_11826505 | 3300026116 | Bacteria | 575 |
| 929 | Ga0207675_100000496 | 3300026118 | Bacteria | 38204 |
| 930 | Ga0207675_100003900 | 3300026118 | Bacteria | 14503 |
| 931 | Ga0207675_100094858 | 3300026118 | Unclassified | 2807 |
| 932 | Ga0207675_100130700 | 3300026118 | Bacteria | 2381 |
| 933 | Ga0207675_100189525 | 3300026118 | Bacteria | 1972 |
| 934 | Ga0207675_100235580 | 3300026118 | Bacteria | 1767 |
| 935 | Ga0207675_100361752 | 3300026118 | Bacteria | 1424 |
| 936 | Ga0207675_101227108 | 3300026118 | Bacteria | 770 |
| 937 | Ga0207675_101407816 | 3300026118 | Unclassified | 718 |
| 938 | Ga0207675_101781796 | 3300026118 | Bacteria | 635 |
| 939 | Ga0207675_102278564 | 3300026118 | Bacteria | 556 |
| 940 | Ga0207683_10004237 | 3300026121 | Bacteria | 12380 |
| 941 | Ga0207683_10007976 | 3300026121 | Bacteria | 9060 |
| 942 | Ga0207683_11516036 | 3300026121 | Bacteria | 619 |
| 943 | Ga0207683_11878587 | 3300026121 | Bacteria | 548 |
| 944 | Ga0207683_11943180 | 3300026121 | Unclassified | 537 |
| 945 | Ga0207698_10003198 | 3300026142 | Bacteria | 9833 |
| 946 | Ga0207698_10012551 | 3300026142 | Bacteria | 5551 |
| 947 | Ga0207698_10014378 | 3300026142 | Bacteria | 5259 |
| 948 | Ga0207698_10029763 | 3300026142 | Bacteria | 3916 |
| 949 | Ga0207698_10113516 | 3300026142 | Unclassified | 2276 |
| 950 | Ga0207698_10270413 | 3300026142 | Bacteria | 1566 |
| 951 | Ga0207698_10421632 | 3300026142 | Bacteria | 1281 |
| 952 | Ga0207698_10687150 | 3300026142 | Bacteria | 1017 |
| 953 | Ga0207698_11069317 | 3300026142 | Unclassified | 819 |
| 954 | Ga0207698_11613111 | 3300026142 | Bacteria | 664 |
| 955 | Ga0207698_11708834 | 3300026142 | Bacteria | 645 |
| 956 | Ga0207698_11827991 | 3300026142 | Bacteria | 623 |
| 957 | Ga0209995_1037020 | 3300027471 | Bacteria | 821 |
| 958 | Ga0207428_10372498 | 3300027907 | Bacteria | 1048 |
| 959 | Ga0268266_10480327 | 3300028379 | Bacteria | 1184 |
| 960 | Ga0268266_11333412 | 3300028379 | Bacteria | 693 |
| 961 | Ga0268266_11864541 | 3300028379 | Unclassified | 575 |
| 962 | Ga0268265_10008576 | 3300028380 | Bacteria | 6906 |
| 963 | Ga0268265_10061107 | 3300028380 | Bacteria | 2890 |
| 964 | Ga0268265_10106353 | 3300028380 | Bacteria | 2279 |
| 965 | Ga0268265_10222975 | 3300028380 | Bacteria | 1651 |
| 966 | Ga0268265_10854671 | 3300028380 | Bacteria | 890 |
| 967 | Ga0268265_11158175 | 3300028380 | Bacteria | 769 |
| 968 | Ga0268264_10001295 | 3300028381 | Bacteria | 23620 |
| 969 | Ga0268264_10024319 | 3300028381 | Bacteria | 4946 |
| 970 | Ga0268264_10038507 | 3300028381 | Unclassified | 3947 |
| 971 | Ga0268264_10055818 | 3300028381 | Bacteria | 3301 |
| 972 | Ga0268264_10453748 | 3300028381 | Bacteria | 1242 |
| 973 | Ga0268264_10622929 | 3300028381 | Bacteria | 1065 |
| 974 | Ga0268264_10798299 | 3300028381 | Bacteria | 943 |
| 975 | Ga0268264_12172110 | 3300028381 | Unclassified | 563 |
| 976 | Ga0268264_12580824 | 3300028381 | Bacteria | 513 |
| 977 | Ga0268264_12644500 | 3300028381 | Unclassified | 506 |
| 978 | Ga0265327_10015792 | 3300031251 | Bacteria | 4846 |
| 979 | Ga0265327_10043185 | 3300031251 | Bacteria | 2415 |
| 980 | Ga0265316_10046775 | 3300031344 | Bacteria | 3426 |
| 981 | Ga0307513_10574484 | 3300031456 | Bacteria | 838 |
| 982 | Ga0307509_10491177 | 3300031507 | Bacteria | 914 |
| 983 | Ga0307509_10640912 | 3300031507 | Bacteria | 732 |
| 984 | Ga0307408_100507118 | 3300031548 | Bacteria | 1057 |
| 985 | Ga0307408_101094699 | 3300031548 | Bacteria | 739 |
| 986 | Ga0307405_10111142 | 3300031731 | Bacteria | 1857 |
| 987 | Ga0307405_10479317 | 3300031731 | Bacteria | 993 |
| 988 | Ga0307405_11259116 | 3300031731 | Bacteria | 642 |
| 989 | Ga0307405_11490336 | 3300031731 | Bacteria | 594 |
| 990 | Ga0307413_10115271 | 3300031824 | Bacteria | 1808 |
| 991 | Ga0307413_11644679 | 3300031824 | Bacteria | 571 |
| 992 | Ga0307410_10153075 | 3300031852 | Bacteria | 1719 |
| 993 | Ga0307410_11164357 | 3300031852 | Unclassified | 670 |
| 994 | Ga0307410_11413355 | 3300031852 | Unclassified | 611 |
| 995 | Ga0307410_11831560 | 3300031852 | Unclassified | 539 |
| 996 | Ga0307406_10318421 | 3300031901 | Unclassified | 1202 |
| 997 | Ga0307406_10969437 | 3300031901 | Bacteria | 728 |
| 998 | Ga0307407_10346477 | 3300031903 | Bacteria | 1051 |
| 999 | Ga0307407_10740564 | 3300031903 | Bacteria | 743 |
| 1000 | Ga0307412_10081682 | 3300031911 | Bacteria | 2236 |
| 1001 | Ga0307412_11437011 | 3300031911 | Bacteria | 625 |
| 1002 | Ga0307412_11718953 | 3300031911 | Bacteria | 575 |
| 1003 | Ga0307409_100575929 | 3300031995 | Bacteria | 1109 |
| 1004 | Ga0307409_100838540 | 3300031995 | Bacteria | 929 |
| 1005 | Ga0307409_100979952 | 3300031995 | Bacteria | 863 |
| 1006 | Ga0307409_101186670 | 3300031995 | Bacteria | 786 |
| 1007 | Ga0307416_100218735 | 3300032002 | Bacteria | 1825 |
| 1008 | Ga0307416_100307269 | 3300032002 | Bacteria | 1580 |
| 1009 | Ga0307416_100604728 | 3300032002 | Bacteria | 1176 |
| 1010 | Ga0307416_100662298 | 3300032002 | Bacteria | 1130 |
| 1011 | Ga0307416_101696177 | 3300032002 | Bacteria | 736 |
| 1012 | Ga0307416_102048396 | 3300032002 | Bacteria | 675 |
| 1013 | Ga0307414_10322595 | 3300032004 | Bacteria | 1315 |
| 1014 | Ga0307414_10333185 | 3300032004 | Bacteria | 1296 |
| 1015 | Ga0307414_10364209 | 3300032004 | Bacteria | 1245 |
| 1016 | Ga0307414_10698407 | 3300032004 | Bacteria | 918 |
| 1017 | Ga0307414_10710030 | 3300032004 | Bacteria | 911 |
| 1018 | Ga0307414_11101502 | 3300032004 | Bacteria | 733 |
| 1019 | Ga0307411_10320100 | 3300032005 | Bacteria | 1252 |
| 1020 | Ga0307411_10380459 | 3300032005 | Bacteria | 1161 |
| 1021 | Ga0307411_10784192 | 3300032005 | Bacteria | 838 |
| 1022 | Ga0307411_11137867 | 3300032005 | Bacteria | 705 |
| 1023 | Ga0307411_11891096 | 3300032005 | Unclassified | 555 |
| 1024 | Ga0307415_100171612 | 3300032126 | Bacteria | 1692 |
| 1025 | Ga0307415_100518824 | 3300032126 | Bacteria | 1045 |
| 1026 | Ga0373934_0024614 | 3300035086 | Bacteria | 2328 |
| 1027 | Ga0373957_0129104 | 3300035120 | Unclassified | 1028 |
| 1028 | Ga0373955_0342799 | 3300035172 | Unclassified | 904 |
| 1029 | Ga0373924_0035738 | 3300035410 | Bacteria | 2016 |
| 1030 | Ga0373935_0395323 | 3300035692 | Bacteria | 992 |
| 1031 | Ga0373933_1154390 | 3300035724 | Bacteria | 510 |
| 1032 | Ga0373947_0057918 | 3300035725 | Bacteria | 2346 |
| 1033 | Ga0373947_1084024 | 3300035725 | Bacteria | 546 |
| 1034 | Ga0373937_0156276 | 3300036401 | Bacteria | 2137 |
| 1035 | Ga0373925_0409562 | 3300037068 | Bacteria | 1107 |
| 1036 | Ga0395899_0000248 | 3300037312 | Bacteria | 72047 |
| 1037 | Ga0395899_0014814 | 3300037312 | Bacteria | 5950 |
| 1038 | Ga0395899_0043261 | 3300037312 | Bacteria | 3360 |
| 1039 | Ga0395899_0118039 | 3300037312 | Bacteria | 1902 |
| 1040 | Ga0395899_0189212 | 3300037312 | Unclassified | 1441 |
| 1041 | Ga0395899_0206187 | 3300037312 | Bacteria | 1368 |
| 1042 | Ga0395899_0245842 | 3300037312 | Bacteria | 1229 |
| 1043 | Ga0395899_0302035 | 3300037312 | Bacteria | 1083 |
| 1044 | Ga0395900_0005223 | 3300037418 | Bacteria | 13624 |
| 1045 | Ga0395900_0015001 | 3300037418 | Bacteria | 7897 |
| 1046 | Ga0395900_0018816 | 3300037418 | Bacteria | 7045 |
| 1047 | Ga0395900_0041998 | 3300037418 | Bacteria | 4711 |
| 1048 | Ga0395900_0138186 | 3300037418 | Bacteria | 2496 |
| 1049 | Ga0395900_0159137 | 3300037418 | Bacteria | 2304 |
| 1050 | Ga0395900_0232969 | 3300037418 | Unclassified | 1851 |
| 1051 | Ga0395900_0434999 | 3300037418 | Bacteria | 1270 |
| 1052 | Ga0395900_0978770 | 3300037418 | Bacteria | 766 |
| 1053 | Ga0395898_0003603 | 3300037466 | Bacteria | 17248 |
| 1054 | Ga0395898_0043780 | 3300037466 | Bacteria | 4410 |
| 1055 | Ga0395898_0179806 | 3300037466 | Bacteria | 2022 |
| 1056 | Ga0395898_0416002 | 3300037466 | Bacteria | 1281 |
| 1057 | Ga0395898_0519908 | 3300037466 | Bacteria | 1131 |
| 1058 | Ga0395898_0550665 | 3300037466 | Bacteria | 1096 |
| 1059 | Ga0395898_0555286 | 3300037466 | Bacteria | 1090 |
| 1060 | Ga0395905_0002268 | 3300037471 | Bacteria | 21601 |
| 1061 | Ga0395905_0615760 | 3300037471 | Unclassified | 988 |
| 1062 | Ga0395905_0645488 | 3300037471 | Bacteria | 960 |
| 1063 | Ga0395905_1029246 | 3300037471 | Bacteria | 727 |
| 1064 | Ga0395905_1230702 | 3300037471 | Unclassified | 652 |
| 1065 | Ga0395905_1594571 | 3300037471 | Unclassified | 557 |
| 1066 | Ga0395901_0002328 | 3300038443 | Bacteria | 19351 |
| 1067 | Ga0395901_0007090 | 3300038443 | Bacteria | 11330 |
| 1068 | Ga0395901_0039606 | 3300038443 | Bacteria | 4878 |
| 1069 | Ga0395901_0064162 | 3300038443 | Bacteria | 3823 |
| 1070 | Ga0395901_0089136 | 3300038443 | Unclassified | 3227 |
| 1071 | Ga0395901_0324917 | 3300038443 | Bacteria | 1591 |
| 1072 | Ga0395901_0730800 | 3300038443 | Bacteria | 984 |
| 1073 | Ga0436365_1917912 | 3300039437 | Bacteria | 29135 |
| 1074 | Ga0436363_0188068 | 3300039450 | Bacteria | 604 |
| 1075 | Ga0436363_1545009 | 3300039450 | Bacteria | 835 |
| 1076 | Ga0439447_055322 | 3300041407 | Bacteria | 941 |
| 1077 | Ga0439465_0018267 | 3300041413 | Bacteria | 2192 |
| 1078 | Ga0439465_0018786 | 3300041413 | Bacteria | 2160 |
| 1079 | Ga0451787_175855 | 3300041441 | Bacteria | 889 |
| 1080 | Ga0451789_0302099 | 3300041443 | Bacteria | 544 |
| 1081 | Ga0451790_10861 | 3300041444 | Bacteria | 557 |
| 1082 | Ga0451791_0474555 | 3300041451 | Bacteria | 622 |
| 1083 | Ga0451800_0208990 | 3300041459 | Bacteria | 544 |
| 1084 | Ga0451802_0225735 | 3300041460 | Bacteria | 1186 |
| 1085 | Ga0451807_0456267 | 3300041486 | Bacteria | 596 |
| 1086 | Ga0451807_0825022 | 3300041486 | Bacteria | 825 |
| 1087 | Ga0451807_1125245 | 3300041486 | Bacteria | 941 |
| 1088 | Ga0451807_1196384 | 3300041486 | Bacteria | 656 |
| 1089 | Ga0451807_1384814 | 3300041486 | Bacteria | 786 |
| 1090 | Ga0451807_1403346 | 3300041486 | Unclassified | 580 |
| 1091 | Ga0451843_0946552 | 3300041509 | Bacteria | 748 |
| 1092 | Ga0451855_1068511 | 3300041511 | Unclassified | 550 |
| 1093 | Ga0439431_0024267 | 3300041997 | Bacteria | 1474 |
| 1094 | Ga0439442_006943 | 3300042002 | Unclassified | 2274 |
| 1095 | Ga0439445_0046399 | 3300042004 | Bacteria | 1165 |
| 1096 | Ga0439445_0107356 | 3300042004 | Bacteria | 795 |
| 1097 | Ga0439449_0176728 | 3300042007 | Bacteria | 798 |
| 1098 | Ga0439452_031447 | 3300042010 | Bacteria | 1302 |
| 1099 | Ga0439457_010179 | 3300042014 | Bacteria | 2169 |
| 1100 | Ga0450922_008749 | 3300042124 | Bacteria | 958 |
| 1101 | Ga0450922_032820 | 3300042124 | Unclassified | 570 |
| 1102 | Ga0450923_035171 | 3300042125 | Bacteria | 1036 |
| 1103 | Ga0450923_074150 | 3300042125 | Bacteria | 758 |
| 1104 | Ga0450897_000424 | 3300042128 | Bacteria | 2302 |
| 1105 | Ga0450894_017598 | 3300042131 | Unclassified | 952 |
| 1106 | Ga0450898_007895 | 3300042134 | Bacteria | 1666 |
| 1107 | Ga0450899_017547 | 3300042135 | Unclassified | 824 |
| 1108 | Ga0439446_0145801 | 3300042156 | Bacteria | 776 |
| 1109 | Ga0450909_075809 | 3300042185 | Unclassified | 541 |
| 1110 | Ga0439434_0021642 | 3300042435 | Bacteria | 1932 |
| 1111 | Ga0466972_0397662 | 3300044658 | Bacteria | 646 |
| 1112 | Ga0453683_0965757 | 3300044673 | Unclassified | 565 |
| 1113 | Ga0466965_0263098 | 3300044683 | Bacteria | 928 |
| 1114 | Ga0466966_0533852 | 3300044684 | Bacteria | 706 |
| 1115 | Ga0466966_0869026 | 3300044684 | Bacteria | 544 |
| 1116 | Ga0453684_0090631 | 3300044712 | Bacteria | 3777 |
| 1117 | Ga0466957_0391781 | 3300044842 | Unclassified | 949 |
| 1118 | Ga0466957_0423314 | 3300044842 | Bacteria | 914 |
| 1119 | Ga0466959_0087819 | 3300045049 | Bacteria | 2236 |
| 1120 | Ga0495592_0216098 | 3300046454 | Bacteria | 1285 |
| 1121 | Ga0495629_0257410 | 3300046459 | Unclassified | 1200 |
| 1122 | Ga0495653_0308387 | 3300046463 | Unclassified | 1030 |
| 1123 | Ga0495608_0235595 | 3300046511 | Unclassified | 1145 |
| 1124 | Ga0495618_0310230 | 3300046514 | Unclassified | 979 |
| 1125 | Ga0495628_0300099 | 3300046516 | Unclassified | 1189 |
| 1126 | Ga0495630_0397373 | 3300046517 | Unclassified | 1056 |
| 1127 | Ga0495645_0822106 | 3300046543 | Unclassified | 556 |
| 1128 | Ga0495667_0073158 | 3300046559 | Bacteria | 2233 |
| 1129 | Ga0495668_0000114 | 3300046616 | Bacteria | 127503 |
| 1130 | Ga0495625_0711521 | 3300046660 | Unclassified | 592 |
| 1131 | Ga0495657_0337428 | 3300046675 | Bacteria | 894 |
| 1132 | Ga0495600_0236075 | 3300046809 | Unclassified | 1166 |
| 1133 | Ga0495674_0558200 | 3300047319 | Unclassified | 911 |
| 1134 | Ga0495672_0062722 | 3300047320 | Bacteria | 2136 |
| 1135 | Ga0495676_0398433 | 3300047321 | Bacteria | 914 |
| 1136 | Ga0495676_0626630 | 3300047321 | Bacteria | 699 |
| 1137 | Ga0495684_0625569 | 3300047471 | Unclassified | 723 |
| 1138 | Ga0496101_0548459 | 3300048904 | Bacteria | 914 |
| 1139 | Ga0496104_1137122 | 3300048907 | Unclassified | 684 |
| 1140 | Ga0496105_0817204 | 3300048908 | Unclassified | 708 |
| 1141 | Ga0496105_1210400 | 3300048908 | Unclassified | 556 |
| 1142 | Ga0496108_0404646 | 3300048911 | Bacteria | 1192 |
| 1143 | Ga0496108_1051099 | 3300048911 | Bacteria | 694 |
| 1144 | Ga0496109_0820303 | 3300048912 | Unclassified | 868 |
| 1145 | Ga0496110_0155711 | 3300048913 | Unclassified | 2070 |
| 1146 | Ga0496110_1141114 | 3300048913 | Bacteria | 688 |
| 1147 | Ga0496111_0152411 | 3300048914 | Bacteria | 1715 |
| 1148 | Ga0496111_0704150 | 3300048914 | Bacteria | 734 |
| 1149 | Ga0496112_0971154 | 3300048915 | Bacteria | 770 |
| 1150 | Ga0496112_1559510 | 3300048915 | Unclassified | 574 |
| 1151 | Ga0501306_071612 | 3300049127 | Bacteria | 586 |
| 1152 | Ga0501306_109724 | 3300049127 | Bacteria | 500 |
| 1153 | Ga0501308_060379 | 3300049128 | Bacteria | 571 |
| 1154 | Ga0501309_029104 | 3300049129 | Bacteria | 808 |
| 1155 | Ga0501343_020000 | 3300049132 | Unclassified | 588 |
| 1156 | Ga0501343_027694 | 3300049132 | Bacteria | 517 |
| 1157 | Ga0501305_058570 | 3300049161 | Bacteria | 659 |
| 1158 | Ga0501307_078896 | 3300049162 | Unclassified | 535 |
| 1159 | Ga0501290_011714 | 3300049513 | Bacteria | 1132 |
| 1160 | Ga0501291_044826 | 3300049514 | Bacteria | 789 |
| 1161 | Ga0501292_031629 | 3300049515 | Bacteria | 891 |
| 1162 | Ga0501292_054778 | 3300049515 | Bacteria | 713 |
| 1163 | Ga0501292_083530 | 3300049515 | Bacteria | 611 |
| 1164 | Ga0501294_007346 | 3300049517 | Bacteria | 1063 |
| 1165 | Ga0501296_067272 | 3300049519 | Bacteria | 550 |
| 1166 | Ga0501298_007240 | 3300049521 | Bacteria | 1837 |
| 1167 | Ga0501298_038717 | 3300049521 | Bacteria | 961 |
| 1168 | Ga0501300_017076 | 3300049523 | Bacteria | 1059 |
| 1169 | Ga0501300_060283 | 3300049523 | Unclassified | 599 |
| 1170 | Ga0501311_072243 | 3300049527 | Bacteria | 574 |
| 1171 | Ga0501312_055850 | 3300049528 | Bacteria | 675 |
| 1172 | Ga0501315_016985 | 3300049531 | Bacteria | 947 |
| 1173 | Ga0501316_044824 | 3300049532 | Bacteria | 625 |
| 1174 | Ga0501316_056787 | 3300049532 | Bacteria | 573 |
| 1175 | Ga0501318_075573 | 3300049534 | Bacteria | 538 |
| 1176 | Ga0501323_073987 | 3300049539 | Unclassified | 549 |
| 1177 | Ga0501325_041696 | 3300049541 | Bacteria | 561 |
| 1178 | Ga0501330_005645 | 3300049546 | Bacteria | 803 |
| 1179 | Ga0501335_022393 | 3300049551 | Bacteria | 681 |
| 1180 | Ga0501335_049356 | 3300049551 | Bacteria | 510 |
| 1181 | Ga0501336_011409 | 3300049552 | Bacteria | 724 |
| 1182 | Ga0501336_017612 | 3300049552 | Bacteria | 628 |
| 1183 | Ga0501336_019397 | 3300049552 | Bacteria | 609 |
| 1184 | Ga0501031_0026007 | 3300049568 | Bacteria | 3818 |
| 1185 | Ga0501031_0225837 | 3300049568 | Bacteria | 1219 |
| 1186 | Ga0501031_1119795 | 3300049568 | Unclassified | 502 |
| 1187 | Ga0501032_0010076 | 3300049569 | Bacteria | 6823 |
| 1188 | Ga0501032_0043622 | 3300049569 | Bacteria | 3036 |
| 1189 | Ga0501032_0269697 | 3300049569 | Bacteria | 1103 |
| 1190 | Ga0501033_0018072 | 3300049570 | Bacteria | 5327 |
| 1191 | Ga0501033_0111743 | 3300049570 | Bacteria | 1988 |
| 1192 | Ga0501033_0506976 | 3300049570 | Bacteria | 834 |
| 1193 | Ga0501034_0000007 | 3300049571 | Bacteria | 357805 |
| 1194 | Ga0501034_0005034 | 3300049571 | Bacteria | 14519 |
| 1195 | Ga0501034_0023352 | 3300049571 | Bacteria | 6302 |
| 1196 | Ga0501034_0040596 | 3300049571 | Bacteria | 4710 |
| 1197 | Ga0501034_0057802 | 3300049571 | Bacteria | 3899 |
| 1198 | Ga0501034_0180504 | 3300049571 | Bacteria | 2075 |
| 1199 | Ga0501034_0966504 | 3300049571 | Bacteria | 737 |
| 1200 | Ga0501036_0043431 | 3300049572 | Bacteria | 3807 |
| 1201 | Ga0501036_0079155 | 3300049572 | Bacteria | 2780 |
| 1202 | Ga0501037_0021694 | 3300049573 | Bacteria | 4750 |
| 1203 | Ga0501038_0021012 | 3300049574 | Bacteria | 5865 |
| 1204 | Ga0501038_0131224 | 3300049574 | Bacteria | 2057 |
| 1205 | Ga0501038_0783293 | 3300049574 | Bacteria | 710 |
| 1206 | Ga0501039_0337383 | 3300049575 | Bacteria | 1184 |
| 1207 | Ga0501043_0050958 | 3300049579 | Bacteria | 3254 |
| 1208 | Ga0501043_0091378 | 3300049579 | Bacteria | 2393 |
| 1209 | Ga0501043_0237703 | 3300049579 | Bacteria | 1406 |
| 1210 | Ga0501046_0006756 | 3300049580 | Bacteria | 10131 |
| 1211 | Ga0501046_0272495 | 3300049580 | Unclassified | 1241 |
| 1212 | Ga0501047_0178701 | 3300049581 | Unclassified | 1989 |
| 1213 | Ga0501047_0245711 | 3300049581 | Bacteria | 1639 |
| 1214 | Ga0501048_0597865 | 3300049582 | Unclassified | 792 |
| 1215 | Ga0501070_0080956 | 3300049586 | Bacteria | 2687 |
| 1216 | Ga0501072_1430110 | 3300049588 | Unclassified | 534 |
| 1217 | Ga0501073_0428554 | 3300049589 | Bacteria | 914 |
| 1218 | Ga0501074_1076566 | 3300049590 | Unclassified | 565 |
| 1219 | Ga0501198_001580 | 3300049649 | Bacteria | 3000 |
| 1220 | Ga0501201_001270 | 3300049651 | Bacteria | 2371 |
| 1221 | Ga0501201_014368 | 3300049651 | Bacteria | 799 |
| 1222 | Ga0501201_047672 | 3300049651 | Bacteria | 528 |
| 1223 | Ga0501202_000790 | 3300049652 | Bacteria | 4748 |
| 1224 | Ga0501202_001791 | 3300049652 | Bacteria | 3513 |
| 1225 | Ga0501202_060439 | 3300049652 | Bacteria | 856 |
| 1226 | Ga0501202_069430 | 3300049652 | Bacteria | 809 |
| 1227 | Ga0501202_219117 | 3300049652 | Bacteria | 526 |
| 1228 | Ga0501202_236393 | 3300049652 | Bacteria | 510 |
| 1229 | Ga0501206_003625 | 3300049653 | Bacteria | 1963 |
| 1230 | Ga0501207_016617 | 3300049654 | Bacteria | 1142 |
| 1231 | Ga0501208_035825 | 3300049655 | Bacteria | 898 |
| 1232 | Ga0501209_078617 | 3300049656 | Bacteria | 948 |
| 1233 | Ga0501209_095888 | 3300049656 | Bacteria | 866 |
| 1234 | Ga0501216_034590 | 3300049660 | Bacteria | 947 |
| 1235 | Ga0501217_002203 | 3300049661 | Bacteria | 3793 |
| 1236 | Ga0501217_076286 | 3300049661 | Bacteria | 921 |
| 1237 | Ga0501217_159378 | 3300049661 | Bacteria | 680 |
| 1238 | Ga0501217_317435 | 3300049661 | Bacteria | 518 |
| 1239 | Ga0501222_010583 | 3300049662 | Bacteria | 1218 |
| 1240 | Ga0501223_009991 | 3300049663 | Bacteria | 1914 |
| 1241 | Ga0501223_038304 | 3300049663 | Unclassified | 931 |
| 1242 | Ga0501224_002212 | 3300049664 | Bacteria | 2639 |
| 1243 | Ga0501224_011100 | 3300049664 | Bacteria | 1324 |
| 1244 | Ga0501224_043505 | 3300049664 | Bacteria | 681 |
| 1245 | Ga0501228_008389 | 3300049666 | Bacteria | 987 |
| 1246 | Ga0501233_006024 | 3300049668 | Bacteria | 2266 |
| 1247 | Ga0501233_028403 | 3300049668 | Bacteria | 1249 |
| 1248 | Ga0501233_057526 | 3300049668 | Bacteria | 957 |
| 1249 | Ga0501235_001211 | 3300049669 | Bacteria | 5430 |
| 1250 | Ga0501235_018918 | 3300049669 | Bacteria | 1528 |
| 1251 | Ga0501235_024447 | 3300049669 | Bacteria | 1349 |
| 1252 | Ga0501235_072232 | 3300049669 | Bacteria | 817 |
| 1253 | Ga0501242_000073 | 3300049674 | Bacteria | 6442 |
| 1254 | Ga0501242_000250 | 3300049674 | Bacteria | 4284 |
| 1255 | Ga0501242_029783 | 3300049674 | Bacteria | 734 |
| 1256 | Ga0501243_014076 | 3300049675 | Bacteria | 1276 |
| 1257 | Ga0501243_048493 | 3300049675 | Bacteria | 761 |
| 1258 | Ga0501246_032311 | 3300049676 | Bacteria | 594 |
| 1259 | Ga0501246_034226 | 3300049676 | Bacteria | 584 |
| 1260 | Ga0501246_042643 | 3300049676 | Unclassified | 547 |
| 1261 | Ga0501247_070938 | 3300049677 | Bacteria | 550 |
| 1262 | Ga0501249_050515 | 3300049679 | Bacteria | 954 |
| 1263 | Ga0501249_058812 | 3300049679 | Bacteria | 889 |
| 1264 | Ga0501249_108585 | 3300049679 | Bacteria | 669 |
| 1265 | Ga0501250_048450 | 3300049680 | Bacteria | 645 |
| 1266 | Ga0501251_004398 | 3300049681 | Bacteria | 1455 |
| 1267 | Ga0501251_007862 | 3300049681 | Bacteria | 1195 |
| 1268 | Ga0501252_000172 | 3300049682 | Bacteria | 4110 |
| 1269 | Ga0501252_019383 | 3300049682 | Bacteria | 878 |
| 1270 | Ga0501253_003050 | 3300049683 | Bacteria | 1965 |
| 1271 | Ga0501256_020221 | 3300049685 | Bacteria | 694 |
| 1272 | Ga0501257_001060 | 3300049686 | Bacteria | 5563 |
| 1273 | Ga0501257_030087 | 3300049686 | Bacteria | 1306 |
| 1274 | Ga0501257_173910 | 3300049686 | Bacteria | 606 |
| 1275 | Ga0501257_276937 | 3300049686 | Bacteria | 504 |
| 1276 | Ga0501259_002647 | 3300049688 | Bacteria | 2881 |
| 1277 | Ga0501259_026209 | 3300049688 | Bacteria | 1072 |
| 1278 | Ga0501259_043126 | 3300049688 | Bacteria | 893 |
| 1279 | Ga0501261_010240 | 3300049690 | Bacteria | 1232 |
| 1280 | Ga0501261_029325 | 3300049690 | Bacteria | 826 |
| 1281 | Ga0501261_054018 | 3300049690 | Bacteria | 666 |
| 1282 | Ga0501219_000098 | 3300049703 | Bacteria | 15144 |
| 1283 | Ga0501219_013282 | 3300049703 | Bacteria | 647 |
| 1284 | Ga0501219_025542 | 3300049703 | Unclassified | 534 |
| 1285 | Ga0501221_006060 | 3300049704 | Bacteria | 2034 |
| 1286 | Ga0501221_006642 | 3300049704 | Bacteria | 1961 |
| 1287 | Ga0501221_007562 | 3300049704 | Bacteria | 1868 |
| 1288 | Ga0501225_0010047 | 3300049705 | Bacteria | 2687 |
| 1289 | Ga0501225_0091965 | 3300049705 | Bacteria | 879 |
| 1290 | Ga0501225_0106549 | 3300049705 | Bacteria | 823 |
| 1291 | Ga0501229_019627 | 3300049706 | Bacteria | 891 |
| 1292 | Ga0501234_008763 | 3300049707 | Bacteria | 1576 |
| 1293 | Ga0501234_045729 | 3300049707 | Bacteria | 722 |
| 1294 | Ga0501234_092997 | 3300049707 | Unclassified | 542 |
| 1295 | Ga0501245_003293 | 3300049708 | Bacteria | 2189 |
| 1296 | Ga0501245_020847 | 3300049708 | Bacteria | 1025 |
| 1297 | Ga0501080_0301267 | 3300049742 | Bacteria | 1454 |
| 1298 | Ga0501080_0491848 | 3300049742 | Unclassified | 1097 |
| 1299 | Ga0501232_080362 | 3300049757 | Bacteria | 551 |
| 1300 | Ga0501241_008833 | 3300049758 | Bacteria | 1837 |
| 1301 | Ga0501241_123474 | 3300049758 | Bacteria | 577 |
| 1302 | Ga0501241_151258 | 3300049758 | Bacteria | 535 |
| 1303 | Ga0501263_005319 | 3300049760 | Bacteria | 1450 |
| 1304 | Ga0501264_009859 | 3300049761 | Bacteria | 915 |
| 1305 | Ga0501265_078489 | 3300049762 | Bacteria | 570 |
| 1306 | Ga0501266_034487 | 3300049763 | Bacteria | 733 |
| 1307 | Ga0501267_056423 | 3300049764 | Bacteria | 522 |
| 1308 | Ga0501268_108753 | 3300049765 | Bacteria | 602 |
| 1309 | Ga0501270_020550 | 3300049767 | Bacteria | 1001 |
| 1310 | Ga0501270_030346 | 3300049767 | Bacteria | 888 |
| 1311 | Ga0501270_039931 | 3300049767 | Bacteria | 813 |
| 1312 | Ga0501270_085763 | 3300049767 | Bacteria | 634 |
| 1313 | Ga0501273_041528 | 3300049770 | Unclassified | 682 |
| 1314 | Ga0501274_022279 | 3300049771 | Bacteria | 666 |
| 1315 | Ga0501275_011233 | 3300049772 | Bacteria | 969 |
| 1316 | Ga0501276_002039 | 3300049773 | Bacteria | 1408 |
| 1317 | Ga0501276_045818 | 3300049773 | Bacteria | 500 |
| 1318 | Ga0501279_032072 | 3300049775 | Bacteria | 782 |
| 1319 | Ga0501281_04140 | 3300049777 | Bacteria | 1023 |
| 1320 | Ga0501035_0004551 | 3300049822 | Bacteria | 13161 |
| 1321 | Ga0501035_0012875 | 3300049822 | Bacteria | 7724 |
| 1322 | Ga0501035_0028671 | 3300049822 | Bacteria | 5080 |
| 1323 | Ga0501035_1155202 | 3300049822 | Bacteria | 602 |
| 1324 | Ga0501044_0021980 | 3300049823 | Bacteria | 6802 |
| 1325 | Ga0501044_0052997 | 3300049823 | Bacteria | 4176 |
| 1326 | Ga0501044_0602278 | 3300049823 | Bacteria | 992 |
| 1327 | Ga0501045_0680010 | 3300049824 | Bacteria | 760 |
| 1328 | Ga0501045_0751636 | 3300049824 | Unclassified | 719 |
| 1329 | Ga0501284_00036 | 3300050005 | Bacteria | 57905 |
| 1330 | nmdc:mga0k408_3233_c1 | 3300050493 | Bacteria | 8623 |
| 1331 | nmdc:mga0k408_355923_c1 | 3300050493 | Bacteria | 873 |
| 1332 | nmdc:mga0k408_76325_c1 | 3300050493 | Bacteria | 1958 |
| 1333 | nmdc:mga09592_19360_c1 | 3300050508 | Bacteria | 5589 |
| 1334 | nmdc:mga08y16_304943_c1 | 3300050511 | Unclassified | 1641 |
| 1335 | nmdc:mga0n895_125677_c1 | 3300050512 | Bacteria | 2588 |
| 1336 | nmdc:mga0n895_1599605_c1 | 3300050512 | Unclassified | 616 |
| 1337 | nmdc:mga0n895_911130_c1 | 3300050512 | Bacteria | 864 |
| 1338 | Ga0495619_0145973 | 3300053085 | Bacteria | 1631 |
| 1339 | Ga0500650_0466189 | 3300053098 | Unclassified | 540 |
| 1340 | Ga0500628_066294 | 3300053129 | Bacteria | 894 |
| 1341 | Ga0500568_0000459 | 3300053139 | Bacteria | 30347 |
| 1342 | Ga0500616_0120548 | 3300053153 | Bacteria | 1254 |
| 1343 | Ga0500616_0400153 | 3300053153 | Unclassified | 549 |
| 1344 | Ga0500622_0001989 | 3300053156 | Bacteria | 15325 |
| 1345 | Ga0500611_000008 | 3300053727 | Bacteria | 198346 |
| 1346 | Ga0500645_009288 | 3300053730 | Bacteria | 3308 |
| 1347 | Ga0500661_001406 | 3300055283 | Bacteria | 4500 |
| 1348 | Ga0587066_192175 | 3300059490 | Bacteria | 532 |
| 1349 | Ga0587080_162991 | 3300059503 | Bacteria | 524 |
| 1350 | Ga0587091_112400 | 3300059511 | Unclassified | 652 |
| 1351 | Ga0587115_097623 | 3300059626 | Unclassified | 541 |
| 1352 | Ga0587067_185738 | 3300059640 | Bacteria | 544 |
| 1353 | Ga0587069_091107 | 3300059642 | Unclassified | 609 |
| 1354 | Ga0587079_097162 | 3300059647 | Bacteria | 698 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009553 | Ga0105249_11925922 | Ga0105249_119259221 | 102 |
| 2 | 3300031548 | Ga0307408_100507118 | Ga0307408_1005071181 | 102 |
| 3 | 3300031731 | Ga0307405_10111142 | Ga0307405_101111423 | 102 |
| 4 | 3300031824 | Ga0307413_10115271 | Ga0307413_101152711 | 102 |
| 5 | 3300031852 | Ga0307410_11831560 | Ga0307410_118315601 | 102 |
| 6 | 3300031903 | Ga0307407_10740564 | Ga0307407_107405641 | 102 |
| 7 | 3300031911 | Ga0307412_10081682 | Ga0307412_100816822 | 102 |
| 8 | 3300031995 | Ga0307409_100838540 | Ga0307409_1008385401 | 102 |
| 9 | 3300032002 | Ga0307416_101696177 | Ga0307416_1016961771 | 102 |
| 10 | 3300032004 | Ga0307414_10710030 | Ga0307414_107100301 | 102 |
| 11 | 3300032005 | Ga0307411_10320100 | Ga0307411_103201001 | 102 |
| 12 | 3300032126 | Ga0307415_100171612 | Ga0307415_1001716122 | 102 |
| 13 | 3300049652 | Ga0501202_069430 | Ga0501202_069430_149_490 | 102 |
| 14 | 3300049656 | Ga0501209_078617 | Ga0501209_078617_267_608 | 102 |
| 15 | 3300049660 | Ga0501216_034590 | Ga0501216_034590_458_799 | 102 |
| 16 | 3300049664 | Ga0501224_011100 | Ga0501224_011100_332_673 | 102 |
| 17 | 3300049705 | Ga0501225_0091965 | Ga0501225_0091965_99_440 | 102 |
| 18 | 3300049773 | Ga0501276_045818 | Ga0501276_045818_16_357 | 102 |
| 19 | 3300031901 | Ga0307406_10318421 | Ga0307406_103184211 | 103 |
| 20 | 3300049552 | Ga0501336_011409 | Ga0501336_011409_328_687 | 103 |
| 21 | 3300005336 | Ga0070680_101656178 | Ga0070680_1016561781 | 104 |
| 22 | 3300005458 | Ga0070681_10332775 | Ga0070681_103327751 | 104 |
| 23 | 3300005577 | Ga0068857_100180869 | Ga0068857_1001808692 | 104 |
| 24 | 3300009545 | Ga0105237_10016034 | Ga0105237_100160346 | 104 |
| 25 | 3300013100 | Ga0157373_10025954 | Ga0157373_100259545 | 104 |
| 26 | 3300013307 | Ga0157372_10428568 | Ga0157372_104285682 | 104 |
| 27 | 3300013307 | Ga0157372_11296358 | Ga0157372_112963582 | 104 |
| 28 | 3300031251 | Ga0265327_10043185 | Ga0265327_100431853 | 104 |
| 29 | 3300031344 | Ga0265316_10046775 | Ga0265316_100467752 | 104 |
| 30 | 3300031852 | Ga0307410_11413355 | Ga0307410_114133551 | 104 |
| 31 | 3300044712 | Ga0453684_0090631 | Ga0453684_0090631_679_1008 | 104 |
| 32 | 3300049579 | Ga0501043_0237703 | Ga0501043_0237703_1057_1386 | 104 |
| 33 | 3300049664 | Ga0501224_043505 | Ga0501224_043505_93_422 | 104 |
| 34 | 3300002459 | JGI24751J29686_10019570 | JGI24751J29686_100195702 | 105 |
| 35 | 3300005290 | Ga0065712_10026861 | Ga0065712_100268611 | 105 |
| 36 | 3300005290 | Ga0065712_10148035 | Ga0065712_101480351 | 105 |
| 37 | 3300005290 | Ga0065712_10361631 | Ga0065712_103616312 | 105 |
| 38 | 3300005293 | Ga0065715_10230257 | Ga0065715_102302571 | 105 |
| 39 | 3300005293 | Ga0065715_10704909 | Ga0065715_107049091 | 105 |
| 40 | 3300005327 | Ga0070658_10062639 | Ga0070658_100626395 | 105 |
| 41 | 3300005327 | Ga0070658_10280764 | Ga0070658_102807642 | 105 |
| 42 | 3300005329 | Ga0070683_100035848 | Ga0070683_1000358484 | 105 |
| 43 | 3300005330 | Ga0070690_101512723 | Ga0070690_1015127231 | 105 |
| 44 | 3300005331 | Ga0070670_100029206 | Ga0070670_1000292063 | 105 |
| 45 | 3300005331 | Ga0070670_100399657 | Ga0070670_1003996572 | 105 |
| 46 | 3300005335 | Ga0070666_10847220 | Ga0070666_108472201 | 105 |
| 47 | 3300005337 | Ga0070682_101046657 | Ga0070682_1010466572 | 105 |
| 48 | 3300005338 | Ga0068868_100189892 | Ga0068868_1001898922 | 105 |
| 49 | 3300005340 | Ga0070689_101527653 | Ga0070689_1015276531 | 105 |
| 50 | 3300005343 | Ga0070687_100088757 | Ga0070687_1000887573 | 105 |
| 51 | 3300005343 | Ga0070687_100421644 | Ga0070687_1004216442 | 105 |
| 52 | 3300005343 | Ga0070687_100651995 | Ga0070687_1006519952 | 105 |
| 53 | 3300005344 | Ga0070661_100215522 | Ga0070661_1002155222 | 105 |
| 54 | 3300005344 | Ga0070661_100578471 | Ga0070661_1005784712 | 105 |
| 55 | 3300005344 | Ga0070661_101010148 | Ga0070661_1010101482 | 105 |
| 56 | 3300005347 | Ga0070668_100844109 | Ga0070668_1008441092 | 105 |
| 57 | 3300005353 | Ga0070669_100964811 | Ga0070669_1009648112 | 105 |
| 58 | 3300005354 | Ga0070675_100031074 | Ga0070675_1000310743 | 105 |
| 59 | 3300005354 | Ga0070675_100348931 | Ga0070675_1003489312 | 105 |
| 60 | 3300005355 | Ga0070671_100317391 | Ga0070671_1003173912 | 105 |
| 61 | 3300005355 | Ga0070671_100346544 | Ga0070671_1003465442 | 105 |
| 62 | 3300005355 | Ga0070671_101287338 | Ga0070671_1012873381 | 105 |
| 63 | 3300005356 | Ga0070674_100147980 | Ga0070674_1001479802 | 105 |
| 64 | 3300005365 | Ga0070688_100464982 | Ga0070688_1004649821 | 105 |
| 65 | 3300005366 | Ga0070659_100151481 | Ga0070659_1001514812 | 105 |
| 66 | 3300005366 | Ga0070659_100855305 | Ga0070659_1008553051 | 105 |
| 67 | 3300005367 | Ga0070667_101361336 | Ga0070667_1013613361 | 105 |
| 68 | 3300005466 | Ga0070685_10211790 | Ga0070685_102117902 | 105 |
| 69 | 3300005535 | Ga0070684_100001194 | Ga0070684_10000119411 | 105 |
| 70 | 3300005535 | Ga0070684_100547671 | Ga0070684_1005476712 | 105 |
| 71 | 3300005539 | Ga0068853_100733003 | Ga0068853_1007330031 | 105 |
| 72 | 3300005543 | Ga0070672_100309927 | Ga0070672_1003099272 | 105 |
| 73 | 3300005543 | Ga0070672_101194824 | Ga0070672_1011948242 | 105 |
| 74 | 3300005564 | Ga0070664_100887865 | Ga0070664_1008878652 | 105 |
| 75 | 3300005614 | Ga0068856_102570338 | Ga0068856_1025703382 | 105 |
| 76 | 3300005616 | Ga0068852_100029241 | Ga0068852_1000292414 | 105 |
| 77 | 3300005616 | Ga0068852_100176471 | Ga0068852_1001764712 | 105 |
| 78 | 3300005616 | Ga0068852_100186123 | Ga0068852_1001861233 | 105 |
| 79 | 3300005616 | Ga0068852_100888601 | Ga0068852_1008886012 | 105 |
| 80 | 3300005618 | Ga0068864_101199275 | Ga0068864_1011992751 | 105 |
| 81 | 3300005834 | Ga0068851_10014708 | Ga0068851_100147082 | 105 |
| 82 | 3300005840 | Ga0068870_10280578 | Ga0068870_102805781 | 105 |
| 83 | 3300005840 | Ga0068870_10943574 | Ga0068870_109435741 | 105 |
| 84 | 3300006028 | Ga0070717_11521271 | Ga0070717_115212712 | 105 |
| 85 | 3300009174 | Ga0105241_10896292 | Ga0105241_108962921 | 105 |
| 86 | 3300009551 | Ga0105238_11638829 | Ga0105238_116388291 | 105 |
| 87 | 3300013100 | Ga0157373_10062105 | Ga0157373_100621053 | 105 |
| 88 | 3300013100 | Ga0157373_10516337 | Ga0157373_105163372 | 105 |
| 89 | 3300013100 | Ga0157373_11353516 | Ga0157373_113535162 | 105 |
| 90 | 3300013102 | Ga0157371_10011420 | Ga0157371_100114205 | 105 |
| 91 | 3300013102 | Ga0157371_10077105 | Ga0157371_100771052 | 105 |
| 92 | 3300013102 | Ga0157371_10184865 | Ga0157371_101848652 | 105 |
| 93 | 3300013102 | Ga0157371_10512720 | Ga0157371_105127201 | 105 |
| 94 | 3300013102 | Ga0157371_10586172 | Ga0157371_105861722 | 105 |
| 95 | 3300013104 | Ga0157370_11339363 | Ga0157370_113393631 | 105 |
| 96 | 3300013105 | Ga0157369_10223125 | Ga0157369_102231252 | 105 |
| 97 | 3300013105 | Ga0157369_10757503 | Ga0157369_107575032 | 105 |
| 98 | 3300013105 | Ga0157369_10894349 | Ga0157369_108943492 | 105 |
| 99 | 3300013105 | Ga0157369_11093559 | Ga0157369_110935592 | 105 |
| 100 | 3300013105 | Ga0157369_11831780 | Ga0157369_118317802 | 105 |
| 101 | 3300013296 | Ga0157374_10415942 | Ga0157374_104159422 | 105 |
| 102 | 3300013306 | Ga0163162_12936613 | Ga0163162_129366131 | 105 |
| 103 | 3300013307 | Ga0157372_10108205 | Ga0157372_101082053 | 105 |
| 104 | 3300013307 | Ga0157372_10202576 | Ga0157372_102025762 | 105 |
| 105 | 3300013307 | Ga0157372_10285220 | Ga0157372_102852204 | 105 |
| 106 | 3300013307 | Ga0157372_10372015 | Ga0157372_103720152 | 105 |
| 107 | 3300013307 | Ga0157372_10394828 | Ga0157372_103948281 | 105 |
| 108 | 3300013307 | Ga0157372_10520690 | Ga0157372_105206902 | 105 |
| 109 | 3300013307 | Ga0157372_10653775 | Ga0157372_106537752 | 105 |
| 110 | 3300013307 | Ga0157372_10711445 | Ga0157372_107114452 | 105 |
| 111 | 3300013307 | Ga0157372_10720938 | Ga0157372_107209382 | 105 |
| 112 | 3300013307 | Ga0157372_10797009 | Ga0157372_107970092 | 105 |
| 113 | 3300013307 | Ga0157372_11106433 | Ga0157372_111064331 | 105 |
| 114 | 3300013307 | Ga0157372_11114117 | Ga0157372_111141172 | 105 |
| 115 | 3300013308 | Ga0157375_11374148 | Ga0157375_113741482 | 105 |
| 116 | 3300013308 | Ga0157375_11401390 | Ga0157375_114013902 | 105 |
| 117 | 3300014325 | Ga0163163_10004743 | Ga0163163_1000474316 | 105 |
| 118 | 3300014325 | Ga0163163_10650339 | Ga0163163_106503392 | 105 |
| 119 | 3300014326 | Ga0157380_10024118 | Ga0157380_100241182 | 105 |
| 120 | 3300014745 | Ga0157377_10018690 | Ga0157377_100186906 | 105 |
| 121 | 3300014969 | Ga0157376_10632617 | Ga0157376_106326172 | 105 |
| 122 | 3300015265 | Ga0182005_1073270 | Ga0182005_10732702 | 105 |
| 123 | 3300025321 | Ga0207656_10237043 | Ga0207656_102370432 | 105 |
| 124 | 3300025893 | Ga0207682_10568521 | Ga0207682_105685211 | 105 |
| 125 | 3300025908 | Ga0207643_10307580 | Ga0207643_103075802 | 105 |
| 126 | 3300025909 | Ga0207705_10216366 | Ga0207705_102163662 | 105 |
| 127 | 3300025909 | Ga0207705_10619018 | Ga0207705_106190181 | 105 |
| 128 | 3300025911 | Ga0207654_10806615 | Ga0207654_108066151 | 105 |
| 129 | 3300025920 | Ga0207649_10461186 | Ga0207649_104611862 | 105 |
| 130 | 3300025920 | Ga0207649_10601197 | Ga0207649_106011972 | 105 |
| 131 | 3300025923 | Ga0207681_11020514 | Ga0207681_110205142 | 105 |
| 132 | 3300025925 | Ga0207650_10002472 | Ga0207650_1000247211 | 105 |
| 133 | 3300025925 | Ga0207650_11694504 | Ga0207650_116945041 | 105 |
| 134 | 3300025926 | Ga0207659_10139502 | Ga0207659_101395021 | 105 |
| 135 | 3300025926 | Ga0207659_10307732 | Ga0207659_103077322 | 105 |
| 136 | 3300025931 | Ga0207644_10126372 | Ga0207644_101263722 | 105 |
| 137 | 3300025931 | Ga0207644_10635799 | Ga0207644_106357992 | 105 |
| 138 | 3300025932 | Ga0207690_11599811 | Ga0207690_115998111 | 105 |
| 139 | 3300025933 | Ga0207706_10488731 | Ga0207706_104887311 | 105 |
| 140 | 3300025936 | Ga0207670_11356876 | Ga0207670_113568761 | 105 |
| 141 | 3300025936 | Ga0207670_11588139 | Ga0207670_115881392 | 105 |
| 142 | 3300025937 | Ga0207669_10092169 | Ga0207669_100921692 | 105 |
| 143 | 3300025940 | Ga0207691_10392947 | Ga0207691_103929472 | 105 |
| 144 | 3300025944 | Ga0207661_10008250 | Ga0207661_100082505 | 105 |
| 145 | 3300025944 | Ga0207661_11630255 | Ga0207661_116302552 | 105 |
| 146 | 3300025945 | Ga0207679_10053505 | Ga0207679_100535052 | 105 |
| 147 | 3300025960 | Ga0207651_10225893 | Ga0207651_102258932 | 105 |
| 148 | 3300025972 | Ga0207668_11311581 | Ga0207668_113115811 | 105 |
| 149 | 3300025986 | Ga0207658_11172073 | Ga0207658_111720732 | 105 |
| 150 | 3300026023 | Ga0207677_10477083 | Ga0207677_104770831 | 105 |
| 151 | 3300026041 | Ga0207639_10058957 | Ga0207639_100589575 | 105 |
| 152 | 3300026078 | Ga0207702_10596127 | Ga0207702_105961272 | 105 |
| 153 | 3300026095 | Ga0207676_11570661 | Ga0207676_115706612 | 105 |
| 154 | 3300026116 | Ga0207674_10308238 | Ga0207674_103082382 | 105 |
| 155 | 3300026142 | Ga0207698_10014378 | Ga0207698_100143782 | 105 |
| 156 | 3300026142 | Ga0207698_10029763 | Ga0207698_100297633 | 105 |
| 157 | 3300026142 | Ga0207698_11613111 | Ga0207698_116131112 | 105 |
| 158 | 3300031731 | Ga0307405_10479317 | Ga0307405_104793172 | 105 |
| 159 | 3300031731 | Ga0307405_11490336 | Ga0307405_114903361 | 105 |
| 160 | 3300031901 | Ga0307406_10969437 | Ga0307406_109694372 | 105 |
| 161 | 3300031911 | Ga0307412_11437011 | Ga0307412_114370111 | 105 |
| 162 | 3300031911 | Ga0307412_11718953 | Ga0307412_117189532 | 105 |
| 163 | 3300031995 | Ga0307409_100979952 | Ga0307409_1009799522 | 105 |
| 164 | 3300031995 | Ga0307409_101186670 | Ga0307409_1011866701 | 105 |
| 165 | 3300032002 | Ga0307416_100604728 | Ga0307416_1006047282 | 105 |
| 166 | 3300032002 | Ga0307416_102048396 | Ga0307416_1020483962 | 105 |
| 167 | 3300032004 | Ga0307414_10322595 | Ga0307414_103225953 | 105 |
| 168 | 3300032004 | Ga0307414_10333185 | Ga0307414_103331852 | 105 |
| 169 | 3300032004 | Ga0307414_10364209 | Ga0307414_103642092 | 105 |
| 170 | 3300032004 | Ga0307414_10698407 | Ga0307414_106984072 | 105 |
| 171 | 3300032004 | Ga0307414_11101502 | Ga0307414_111015022 | 105 |
| 172 | 3300032005 | Ga0307411_11137867 | Ga0307411_111378672 | 105 |
| 173 | 3300032005 | Ga0307411_11891096 | Ga0307411_118910961 | 105 |
| 174 | 3300037312 | Ga0395899_0302035 | Ga0395899_0302035_403_735 | 105 |
| 175 | 3300037418 | Ga0395900_0018816 | Ga0395900_0018816_67_399 | 105 |
| 176 | 3300037466 | Ga0395898_0550665 | Ga0395898_0550665_91_423 | 105 |
| 177 | 3300037471 | Ga0395905_0002268 | Ga0395905_0002268_10168_10500 | 105 |
| 178 | 3300037471 | Ga0395905_0645488 | Ga0395905_0645488_12_344 | 105 |
| 179 | 3300037471 | Ga0395905_1029246 | Ga0395905_1029246_312_644 | 105 |
| 180 | 3300039450 | Ga0436363_1545009 | Ga0436363_1545009_41_364 | 105 |
| 181 | 3300041486 | Ga0451807_1384814 | Ga0451807_1384814_242_565 | 105 |
| 182 | 3300042004 | Ga0439445_0107356 | Ga0439445_0107356_422_754 | 105 |
| 183 | 3300044684 | Ga0466966_0533852 | Ga0466966_0533852_345_674 | 105 |
| 184 | 3300044842 | Ga0466957_0423314 | Ga0466957_0423314_376_705 | 105 |
| 185 | 3300045049 | Ga0466959_0087819 | Ga0466959_0087819_263_595 | 105 |
| 186 | 3300048911 | Ga0496108_1051099 | Ga0496108_1051099_102_434 | 105 |
| 187 | 3300049127 | Ga0501306_071612 | Ga0501306_071612_153_482 | 105 |
| 188 | 3300049127 | Ga0501306_109724 | Ga0501306_109724_79_411 | 105 |
| 189 | 3300049128 | Ga0501308_060379 | Ga0501308_060379_94_423 | 105 |
| 190 | 3300049129 | Ga0501309_029104 | Ga0501309_029104_149_478 | 105 |
| 191 | 3300049132 | Ga0501343_027694 | Ga0501343_027694_105_473 | 105 |
| 192 | 3300049161 | Ga0501305_058570 | Ga0501305_058570_10_339 | 105 |
| 193 | 3300049513 | Ga0501290_011714 | Ga0501290_011714_47_379 | 105 |
| 194 | 3300049515 | Ga0501292_031629 | Ga0501292_031629_345_677 | 105 |
| 195 | 3300049515 | Ga0501292_054778 | Ga0501292_054778_232_600 | 105 |
| 196 | 3300049515 | Ga0501292_083530 | Ga0501292_083530_159_491 | 105 |
| 197 | 3300049517 | Ga0501294_007346 | Ga0501294_007346_600_932 | 105 |
| 198 | 3300049519 | Ga0501296_067272 | Ga0501296_067272_16_348 | 105 |
| 199 | 3300049521 | Ga0501298_007240 | Ga0501298_007240_1261_1593 | 105 |
| 200 | 3300049523 | Ga0501300_017076 | Ga0501300_017076_482_814 | 105 |
| 201 | 3300049523 | Ga0501300_060283 | Ga0501300_060283_145_477 | 105 |
| 202 | 3300049527 | Ga0501311_072243 | Ga0501311_072243_94_423 | 105 |
| 203 | 3300049528 | Ga0501312_055850 | Ga0501312_055850_33_365 | 105 |
| 204 | 3300049531 | Ga0501315_016985 | Ga0501315_016985_460_789 | 105 |
| 205 | 3300049532 | Ga0501316_056787 | Ga0501316_056787_149_481 | 105 |
| 206 | 3300049534 | Ga0501318_075573 | Ga0501318_075573_117_446 | 105 |
| 207 | 3300049541 | Ga0501325_041696 | Ga0501325_041696_79_411 | 105 |
| 208 | 3300049546 | Ga0501330_005645 | Ga0501330_005645_332_664 | 105 |
| 209 | 3300049551 | Ga0501335_022393 | Ga0501335_022393_10_333 | 105 |
| 210 | 3300049551 | Ga0501335_049356 | Ga0501335_049356_63_392 | 105 |
| 211 | 3300049552 | Ga0501336_017612 | Ga0501336_017612_150_482 | 105 |
| 212 | 3300049552 | Ga0501336_019397 | Ga0501336_019397_25_357 | 105 |
| 213 | 3300049649 | Ga0501198_001580 | Ga0501198_001580_1493_1825 | 105 |
| 214 | 3300049651 | Ga0501201_001270 | Ga0501201_001270_375_707 | 105 |
| 215 | 3300049651 | Ga0501201_014368 | Ga0501201_014368_158_490 | 105 |
| 216 | 3300049651 | Ga0501201_047672 | Ga0501201_047672_163_495 | 105 |
| 217 | 3300049652 | Ga0501202_000790 | Ga0501202_000790_1010_1342 | 105 |
| 218 | 3300049652 | Ga0501202_001791 | Ga0501202_001791_2745_3077 | 105 |
| 219 | 3300049652 | Ga0501202_060439 | Ga0501202_060439_248_580 | 105 |
| 220 | 3300049652 | Ga0501202_219117 | Ga0501202_219117_74_406 | 105 |
| 221 | 3300049653 | Ga0501206_003625 | Ga0501206_003625_567_899 | 105 |
| 222 | 3300049654 | Ga0501207_016617 | Ga0501207_016617_740_1072 | 105 |
| 223 | 3300049655 | Ga0501208_035825 | Ga0501208_035825_206_538 | 105 |
| 224 | 3300049656 | Ga0501209_095888 | Ga0501209_095888_173_505 | 105 |
| 225 | 3300049661 | Ga0501217_002203 | Ga0501217_002203_787_1119 | 105 |
| 226 | 3300049661 | Ga0501217_076286 | Ga0501217_076286_319_687 | 105 |
| 227 | 3300049661 | Ga0501217_159378 | Ga0501217_159378_165_488 | 105 |
| 228 | 3300049661 | Ga0501217_317435 | Ga0501217_317435_15_347 | 105 |
| 229 | 3300049662 | Ga0501222_010583 | Ga0501222_010583_575_907 | 105 |
| 230 | 3300049663 | Ga0501223_009991 | Ga0501223_009991_571_903 | 105 |
| 231 | 3300049663 | Ga0501223_038304 | Ga0501223_038304_316_684 | 105 |
| 232 | 3300049664 | Ga0501224_002212 | Ga0501224_002212_952_1284 | 105 |
| 233 | 3300049666 | Ga0501228_008389 | Ga0501228_008389_306_638 | 105 |
| 234 | 3300049668 | Ga0501233_006024 | Ga0501233_006024_1383_1715 | 105 |
| 235 | 3300049668 | Ga0501233_028403 | Ga0501233_028403_140_508 | 105 |
| 236 | 3300049668 | Ga0501233_057526 | Ga0501233_057526_189_521 | 105 |
| 237 | 3300049669 | Ga0501235_001211 | Ga0501235_001211_963_1295 | 105 |
| 238 | 3300049669 | Ga0501235_018918 | Ga0501235_018918_482_814 | 105 |
| 239 | 3300049669 | Ga0501235_024447 | Ga0501235_024447_578_946 | 105 |
| 240 | 3300049669 | Ga0501235_072232 | Ga0501235_072232_196_528 | 105 |
| 241 | 3300049674 | Ga0501242_000073 | Ga0501242_000073_844_1176 | 105 |
| 242 | 3300049674 | Ga0501242_000250 | Ga0501242_000250_1050_1382 | 105 |
| 243 | 3300049674 | Ga0501242_029783 | Ga0501242_029783_79_411 | 105 |
| 244 | 3300049675 | Ga0501243_014076 | Ga0501243_014076_869_1201 | 105 |
| 245 | 3300049675 | Ga0501243_048493 | Ga0501243_048493_268_600 | 105 |
| 246 | 3300049676 | Ga0501246_032311 | Ga0501246_032311_114_482 | 105 |
| 247 | 3300049676 | Ga0501246_042643 | Ga0501246_042643_95_427 | 105 |
| 248 | 3300049677 | Ga0501247_070938 | Ga0501247_070938_109_477 | 105 |
| 249 | 3300049679 | Ga0501249_050515 | Ga0501249_050515_478_810 | 105 |
| 250 | 3300049679 | Ga0501249_108585 | Ga0501249_108585_145_513 | 105 |
| 251 | 3300049680 | Ga0501250_048450 | Ga0501250_048450_117_449 | 105 |
| 252 | 3300049681 | Ga0501251_004398 | Ga0501251_004398_907_1239 | 105 |
| 253 | 3300049681 | Ga0501251_007862 | Ga0501251_007862_206_538 | 105 |
| 254 | 3300049682 | Ga0501252_000172 | Ga0501252_000172_11_343 | 105 |
| 255 | 3300049682 | Ga0501252_019383 | Ga0501252_019383_293_625 | 105 |
| 256 | 3300049683 | Ga0501253_003050 | Ga0501253_003050_1145_1477 | 105 |
| 257 | 3300049685 | Ga0501256_020221 | Ga0501256_020221_221_553 | 105 |
| 258 | 3300049686 | Ga0501257_001060 | Ga0501257_001060_1075_1407 | 105 |
| 259 | 3300049686 | Ga0501257_030087 | Ga0501257_030087_864_1196 | 105 |
| 260 | 3300049686 | Ga0501257_173910 | Ga0501257_173910_145_513 | 105 |
| 261 | 3300049686 | Ga0501257_276937 | Ga0501257_276937_75_398 | 105 |
| 262 | 3300049688 | Ga0501259_002647 | Ga0501259_002647_2079_2411 | 105 |
| 263 | 3300049688 | Ga0501259_026209 | Ga0501259_026209_274_606 | 105 |
| 264 | 3300049688 | Ga0501259_043126 | Ga0501259_043126_415_783 | 105 |
| 265 | 3300049690 | Ga0501261_010240 | Ga0501261_010240_756_1088 | 105 |
| 266 | 3300049690 | Ga0501261_029325 | Ga0501261_029325_311_643 | 105 |
| 267 | 3300049690 | Ga0501261_054018 | Ga0501261_054018_105_437 | 105 |
| 268 | 3300049703 | Ga0501219_013282 | Ga0501219_013282_200_532 | 105 |
| 269 | 3300049703 | Ga0501219_025542 | Ga0501219_025542_132_464 | 105 |
| 270 | 3300049704 | Ga0501221_006060 | Ga0501221_006060_767_1099 | 105 |
| 271 | 3300049704 | Ga0501221_006642 | Ga0501221_006642_37_369 | 105 |
| 272 | 3300049704 | Ga0501221_007562 | Ga0501221_007562_1457_1825 | 105 |
| 273 | 3300049705 | Ga0501225_0010047 | Ga0501225_0010047_1524_1856 | 105 |
| 274 | 3300049705 | Ga0501225_0106549 | Ga0501225_0106549_230_598 | 105 |
| 275 | 3300049706 | Ga0501229_019627 | Ga0501229_019627_73_405 | 105 |
| 276 | 3300049707 | Ga0501234_008763 | Ga0501234_008763_249_581 | 105 |
| 277 | 3300049707 | Ga0501234_045729 | Ga0501234_045729_176_544 | 105 |
| 278 | 3300049707 | Ga0501234_092997 | Ga0501234_092997_197_529 | 105 |
| 279 | 3300049708 | Ga0501245_003293 | Ga0501245_003293_656_988 | 105 |
| 280 | 3300049708 | Ga0501245_020847 | Ga0501245_020847_310_678 | 105 |
| 281 | 3300049757 | Ga0501232_080362 | Ga0501232_080362_133_501 | 105 |
| 282 | 3300049758 | Ga0501241_123474 | Ga0501241_123474_158_481 | 105 |
| 283 | 3300049758 | Ga0501241_151258 | Ga0501241_151258_120_452 | 105 |
| 284 | 3300049760 | Ga0501263_005319 | Ga0501263_005319_516_848 | 105 |
| 285 | 3300049761 | Ga0501264_009859 | Ga0501264_009859_114_437 | 105 |
| 286 | 3300049762 | Ga0501265_078489 | Ga0501265_078489_71_403 | 105 |
| 287 | 3300049763 | Ga0501266_034487 | Ga0501266_034487_223_555 | 105 |
| 288 | 3300049764 | Ga0501267_056423 | Ga0501267_056423_150_482 | 105 |
| 289 | 3300049765 | Ga0501268_108753 | Ga0501268_108753_62_430 | 105 |
| 290 | 3300049767 | Ga0501270_020550 | Ga0501270_020550_383_715 | 105 |
| 291 | 3300049767 | Ga0501270_030346 | Ga0501270_030346_158_490 | 105 |
| 292 | 3300049767 | Ga0501270_039931 | Ga0501270_039931_406_738 | 105 |
| 293 | 3300049767 | Ga0501270_085763 | Ga0501270_085763_33_356 | 105 |
| 294 | 3300049770 | Ga0501273_041528 | Ga0501273_041528_324_656 | 105 |
| 295 | 3300049771 | Ga0501274_022279 | Ga0501274_022279_186_509 | 105 |
| 296 | 3300049772 | Ga0501275_011233 | Ga0501275_011233_127_459 | 105 |
| 297 | 3300049773 | Ga0501276_002039 | Ga0501276_002039_1034_1366 | 105 |
| 298 | 3300049775 | Ga0501279_032072 | Ga0501279_032072_273_641 | 105 |
| 299 | 3300049777 | Ga0501281_04140 | Ga0501281_04140_43_375 | 105 |
| 300 | 3300005345 | Ga0070692_11428399 | Ga0070692_114283991 | 106 |
| 301 | 3300005347 | Ga0070668_102272089 | Ga0070668_1022720891 | 106 |
| 302 | 3300005355 | Ga0070671_100058203 | Ga0070671_1000582032 | 106 |
| 303 | 3300005364 | Ga0070673_101553553 | Ga0070673_1015535531 | 106 |
| 304 | 3300005367 | Ga0070667_100553316 | Ga0070667_1005533162 | 106 |
| 305 | 3300005455 | Ga0070663_100814180 | Ga0070663_1008141801 | 106 |
| 306 | 3300005539 | Ga0068853_102026212 | Ga0068853_1020262121 | 106 |
| 307 | 3300005543 | Ga0070672_100347138 | Ga0070672_1003471382 | 106 |
| 308 | 3300005543 | Ga0070672_100546229 | Ga0070672_1005462291 | 106 |
| 309 | 3300005834 | Ga0068851_10050055 | Ga0068851_100500552 | 106 |
| 310 | 3300013296 | Ga0157374_12494395 | Ga0157374_124943951 | 106 |
| 311 | 3300013306 | Ga0163162_11992315 | Ga0163162_119923152 | 106 |
| 312 | 3300013308 | Ga0157375_10234365 | Ga0157375_102343652 | 106 |
| 313 | 3300014325 | Ga0163163_11482249 | Ga0163163_114822492 | 106 |
| 314 | 3300014326 | Ga0157380_11603831 | Ga0157380_116038311 | 106 |
| 315 | 3300014326 | Ga0157380_12055440 | Ga0157380_120554402 | 106 |
| 316 | 3300017792 | Ga0163161_10224584 | Ga0163161_102245842 | 106 |
| 317 | 3300017792 | Ga0163161_11476468 | Ga0163161_114764682 | 106 |
| 318 | 3300025321 | Ga0207656_10056099 | Ga0207656_100560991 | 106 |
| 319 | 3300025893 | Ga0207682_10102376 | Ga0207682_101023762 | 106 |
| 320 | 3300025925 | Ga0207650_10108938 | Ga0207650_101089382 | 106 |
| 321 | 3300025940 | Ga0207691_10286766 | Ga0207691_102867662 | 106 |
| 322 | 3300025940 | Ga0207691_10499520 | Ga0207691_104995202 | 106 |
| 323 | 3300025960 | Ga0207651_11556114 | Ga0207651_115561141 | 106 |
| 324 | 3300025986 | Ga0207658_10381397 | Ga0207658_103813972 | 106 |
| 325 | 3300026041 | Ga0207639_11890669 | Ga0207639_118906691 | 106 |
| 326 | 3300026067 | Ga0207678_10616279 | Ga0207678_106162792 | 106 |
| 327 | 3300026088 | Ga0207641_12323467 | Ga0207641_123234672 | 106 |
| 328 | 3300026142 | Ga0207698_11708834 | Ga0207698_117088341 | 106 |
| 329 | 3300031731 | Ga0307405_11259116 | Ga0307405_112591162 | 106 |
| 330 | 3300031824 | Ga0307413_11644679 | Ga0307413_116446791 | 106 |
| 331 | 3300031852 | Ga0307410_10153075 | Ga0307410_101530752 | 106 |
| 332 | 3300031903 | Ga0307407_10346477 | Ga0307407_103464772 | 106 |
| 333 | 3300032002 | Ga0307416_100307269 | Ga0307416_1003072692 | 106 |
| 334 | 3300032005 | Ga0307411_10380459 | Ga0307411_103804592 | 106 |
| 335 | 3300032126 | Ga0307415_100518824 | Ga0307415_1005188242 | 106 |
| 336 | 3300039450 | Ga0436363_0188068 | Ga0436363_0188068_50_385 | 106 |
| 337 | 3300041486 | Ga0451807_0456267 | Ga0451807_0456267_46_381 | 106 |
| 338 | 3300042124 | Ga0450922_008749 | Ga0450922_008749_511_834 | 106 |
| 339 | 3300042125 | Ga0450923_035171 | Ga0450923_035171_309_632 | 106 |
| 340 | 3300044684 | Ga0466966_0869026 | Ga0466966_0869026_57_392 | 106 |
| 341 | 3300049132 | Ga0501343_020000 | Ga0501343_020000_205_540 | 106 |
| 342 | 3300049162 | Ga0501307_078896 | Ga0501307_078896_38_373 | 106 |
| 343 | 3300049532 | Ga0501316_044824 | Ga0501316_044824_30_365 | 106 |
| 344 | 3300049539 | Ga0501323_073987 | Ga0501323_073987_110_445 | 106 |
| 345 | 3300049589 | Ga0501073_0428554 | Ga0501073_0428554_272_607 | 106 |
| 346 | 3300002077 | JGI24744J21845_10009003 | JGI24744J21845_100090032 | 107 |
| 347 | 3300003162 | Ga0006778J45830_1013083 | Ga0006778J45830_10130831 | 107 |
| 348 | 3300003162 | Ga0006778J45830_1091642 | Ga0006778J45830_10916421 | 107 |
| 349 | 3300003308 | Ga0006777J48905_1002824 | Ga0006777J48905_10028241 | 107 |
| 350 | 3300003308 | Ga0006777J48905_1016926 | Ga0006777J48905_10169262 | 107 |
| 351 | 3300003323 | rootH1_10183607 | rootH1_101836073 | 107 |
| 352 | 3300003544 | Ga0007417J51691_1011400 | Ga0007417J51691_10114001 | 107 |
| 353 | 3300003577 | Ga0007416J51690_1008420 | Ga0007416J51690_10084201 | 107 |
| 354 | 3300003577 | Ga0007416J51690_1081396 | Ga0007416J51690_10813961 | 107 |
| 355 | 3300003579 | Ga0007429J51699_1010111 | Ga0007429J51699_10101111 | 107 |
| 356 | 3300003579 | Ga0007429J51699_1095847 | Ga0007429J51699_10958471 | 107 |
| 357 | 3300003693 | Ga0032354_1046868 | Ga0032354_10468681 | 107 |
| 358 | 3300003693 | Ga0032354_1049471 | Ga0032354_10494711 | 107 |
| 359 | 3300003693 | Ga0032354_1057186 | Ga0032354_10571861 | 107 |
| 360 | 3300004798 | Ga0058859_11674870 | Ga0058859_116748701 | 107 |
| 361 | 3300004799 | Ga0058863_11776965 | Ga0058863_117769651 | 107 |
| 362 | 3300004801 | Ga0058860_10045833 | Ga0058860_100458331 | 107 |
| 363 | 3300004801 | Ga0058860_12154840 | Ga0058860_121548401 | 107 |
| 364 | 3300005290 | Ga0065712_10087786 | Ga0065712_100877863 | 107 |
| 365 | 3300005295 | Ga0065707_10721520 | Ga0065707_107215201 | 107 |
| 366 | 3300005295 | Ga0065707_10987347 | Ga0065707_109873472 | 107 |
| 367 | 3300005327 | Ga0070658_10516094 | Ga0070658_105160942 | 107 |
| 368 | 3300005328 | Ga0070676_10000340 | Ga0070676_1000034014 | 107 |
| 369 | 3300005328 | Ga0070676_10017698 | Ga0070676_100176985 | 107 |
| 370 | 3300005328 | Ga0070676_10085446 | Ga0070676_100854462 | 107 |
| 371 | 3300005328 | Ga0070676_10200590 | Ga0070676_102005902 | 107 |
| 372 | 3300005328 | Ga0070676_10890368 | Ga0070676_108903681 | 107 |
| 373 | 3300005329 | Ga0070683_100001004 | Ga0070683_10000100410 | 107 |
| 374 | 3300005329 | Ga0070683_100003956 | Ga0070683_1000039564 | 107 |
| 375 | 3300005329 | Ga0070683_100187047 | Ga0070683_1001870472 | 107 |
| 376 | 3300005329 | Ga0070683_100199184 | Ga0070683_1001991842 | 107 |
| 377 | 3300005329 | Ga0070683_101765980 | Ga0070683_1017659802 | 107 |
| 378 | 3300005330 | Ga0070690_100003006 | Ga0070690_1000030066 | 107 |
| 379 | 3300005330 | Ga0070690_100141322 | Ga0070690_1001413222 | 107 |
| 380 | 3300005330 | Ga0070690_100866033 | Ga0070690_1008660332 | 107 |
| 381 | 3300005330 | Ga0070690_101499843 | Ga0070690_1014998431 | 107 |
| 382 | 3300005331 | Ga0070670_100057109 | Ga0070670_1000571092 | 107 |
| 383 | 3300005331 | Ga0070670_100286752 | Ga0070670_1002867522 | 107 |
| 384 | 3300005331 | Ga0070670_100426281 | Ga0070670_1004262811 | 107 |
| 385 | 3300005331 | Ga0070670_101006189 | Ga0070670_1010061892 | 107 |
| 386 | 3300005333 | Ga0070677_10022958 | Ga0070677_100229582 | 107 |
| 387 | 3300005333 | Ga0070677_10707447 | Ga0070677_107074471 | 107 |
| 388 | 3300005334 | Ga0068869_100000814 | Ga0068869_10000081412 | 107 |
| 389 | 3300005334 | Ga0068869_100006000 | Ga0068869_1000060004 | 107 |
| 390 | 3300005334 | Ga0068869_100009437 | Ga0068869_1000094373 | 107 |
| 391 | 3300005334 | Ga0068869_100034895 | Ga0068869_1000348954 | 107 |
| 392 | 3300005334 | Ga0068869_100053625 | Ga0068869_1000536254 | 107 |
| 393 | 3300005334 | Ga0068869_100078925 | Ga0068869_1000789253 | 107 |
| 394 | 3300005334 | Ga0068869_100117581 | Ga0068869_1001175812 | 107 |
| 395 | 3300005334 | Ga0068869_101832079 | Ga0068869_1018320791 | 107 |
| 396 | 3300005335 | Ga0070666_10018034 | Ga0070666_100180344 | 107 |
| 397 | 3300005335 | Ga0070666_10047710 | Ga0070666_100477102 | 107 |
| 398 | 3300005335 | Ga0070666_10392737 | Ga0070666_103927372 | 107 |
| 399 | 3300005336 | Ga0070680_101406973 | Ga0070680_1014069732 | 107 |
| 400 | 3300005337 | Ga0070682_100015226 | Ga0070682_1000152262 | 107 |
| 401 | 3300005337 | Ga0070682_100126080 | Ga0070682_1001260803 | 107 |
| 402 | 3300005337 | Ga0070682_100847295 | Ga0070682_1008472951 | 107 |
| 403 | 3300005338 | Ga0068868_100001169 | Ga0068868_1000011699 | 107 |
| 404 | 3300005338 | Ga0068868_100005060 | Ga0068868_1000050606 | 107 |
| 405 | 3300005338 | Ga0068868_100025302 | Ga0068868_1000253024 | 107 |
| 406 | 3300005338 | Ga0068868_100159717 | Ga0068868_1001597171 | 107 |
| 407 | 3300005339 | Ga0070660_100142017 | Ga0070660_1001420172 | 107 |
| 408 | 3300005339 | Ga0070660_100739479 | Ga0070660_1007394792 | 107 |
| 409 | 3300005340 | Ga0070689_100026770 | Ga0070689_1000267703 | 107 |
| 410 | 3300005340 | Ga0070689_100562504 | Ga0070689_1005625042 | 107 |
| 411 | 3300005340 | Ga0070689_100573594 | Ga0070689_1005735941 | 107 |
| 412 | 3300005343 | Ga0070687_100563885 | Ga0070687_1005638852 | 107 |
| 413 | 3300005343 | Ga0070687_100972578 | Ga0070687_1009725782 | 107 |
| 414 | 3300005344 | Ga0070661_100000922 | Ga0070661_10000092212 | 107 |
| 415 | 3300005344 | Ga0070661_100033516 | Ga0070661_1000335164 | 107 |
| 416 | 3300005344 | Ga0070661_100183306 | Ga0070661_1001833063 | 107 |
| 417 | 3300005344 | Ga0070661_101285064 | Ga0070661_1012850641 | 107 |
| 418 | 3300005347 | Ga0070668_100017076 | Ga0070668_1000170766 | 107 |
| 419 | 3300005347 | Ga0070668_100082150 | Ga0070668_1000821502 | 107 |
| 420 | 3300005347 | Ga0070668_100258355 | Ga0070668_1002583552 | 107 |
| 421 | 3300005347 | Ga0070668_100347465 | Ga0070668_1003474652 | 107 |
| 422 | 3300005347 | Ga0070668_100437687 | Ga0070668_1004376872 | 107 |
| 423 | 3300005353 | Ga0070669_100015753 | Ga0070669_1000157532 | 107 |
| 424 | 3300005353 | Ga0070669_100037656 | Ga0070669_1000376562 | 107 |
| 425 | 3300005353 | Ga0070669_100043024 | Ga0070669_1000430242 | 107 |
| 426 | 3300005354 | Ga0070675_100046713 | Ga0070675_1000467134 | 107 |
| 427 | 3300005354 | Ga0070675_100075723 | Ga0070675_1000757232 | 107 |
| 428 | 3300005354 | Ga0070675_100610286 | Ga0070675_1006102861 | 107 |
| 429 | 3300005355 | Ga0070671_100135511 | Ga0070671_1001355112 | 107 |
| 430 | 3300005355 | Ga0070671_100467074 | Ga0070671_1004670742 | 107 |
| 431 | 3300005355 | Ga0070671_100522016 | Ga0070671_1005220162 | 107 |
| 432 | 3300005356 | Ga0070674_100008110 | Ga0070674_1000081106 | 107 |
| 433 | 3300005356 | Ga0070674_100021467 | Ga0070674_1000214674 | 107 |
| 434 | 3300005356 | Ga0070674_100188454 | Ga0070674_1001884541 | 107 |
| 435 | 3300005364 | Ga0070673_100017493 | Ga0070673_1000174936 | 107 |
| 436 | 3300005364 | Ga0070673_100020326 | Ga0070673_1000203262 | 107 |
| 437 | 3300005364 | Ga0070673_100022986 | Ga0070673_1000229863 | 107 |
| 438 | 3300005364 | Ga0070673_100023551 | Ga0070673_1000235515 | 107 |
| 439 | 3300005365 | Ga0070688_100015010 | Ga0070688_1000150101 | 107 |
| 440 | 3300005365 | Ga0070688_100098477 | Ga0070688_1000984772 | 107 |
| 441 | 3300005366 | Ga0070659_100070336 | Ga0070659_1000703362 | 107 |
| 442 | 3300005366 | Ga0070659_100151246 | Ga0070659_1001512462 | 107 |
| 443 | 3300005366 | Ga0070659_100824509 | Ga0070659_1008245091 | 107 |
| 444 | 3300005367 | Ga0070667_100046741 | Ga0070667_1000467414 | 107 |
| 445 | 3300005367 | Ga0070667_100074526 | Ga0070667_1000745264 | 107 |
| 446 | 3300005367 | Ga0070667_100128173 | Ga0070667_1001281732 | 107 |
| 447 | 3300005367 | Ga0070667_100130441 | Ga0070667_1001304412 | 107 |
| 448 | 3300005367 | Ga0070667_100339234 | Ga0070667_1003392342 | 107 |
| 449 | 3300005367 | Ga0070667_100357374 | Ga0070667_1003573742 | 107 |
| 450 | 3300005367 | Ga0070667_101167865 | Ga0070667_1011678652 | 107 |
| 451 | 3300005367 | Ga0070667_102248834 | Ga0070667_1022488341 | 107 |
| 452 | 3300005438 | Ga0070701_10196341 | Ga0070701_101963412 | 107 |
| 453 | 3300005441 | Ga0070700_100447705 | Ga0070700_1004477052 | 107 |
| 454 | 3300005455 | Ga0070663_100290961 | Ga0070663_1002909611 | 107 |
| 455 | 3300005455 | Ga0070663_100417760 | Ga0070663_1004177601 | 107 |
| 456 | 3300005455 | Ga0070663_100761800 | Ga0070663_1007618001 | 107 |
| 457 | 3300005455 | Ga0070663_101010045 | Ga0070663_1010100452 | 107 |
| 458 | 3300005455 | Ga0070663_101461080 | Ga0070663_1014610801 | 107 |
| 459 | 3300005456 | Ga0070678_100008073 | Ga0070678_1000080731 | 107 |
| 460 | 3300005456 | Ga0070678_100016088 | Ga0070678_1000160884 | 107 |
| 461 | 3300005456 | Ga0070678_100716497 | Ga0070678_1007164972 | 107 |
| 462 | 3300005457 | Ga0070662_100004730 | Ga0070662_1000047306 | 107 |
| 463 | 3300005457 | Ga0070662_100018859 | Ga0070662_1000188595 | 107 |
| 464 | 3300005457 | Ga0070662_100081231 | Ga0070662_1000812312 | 107 |
| 465 | 3300005457 | Ga0070662_100207859 | Ga0070662_1002078592 | 107 |
| 466 | 3300005457 | Ga0070662_100873016 | Ga0070662_1008730162 | 107 |
| 467 | 3300005458 | Ga0070681_11116016 | Ga0070681_111160162 | 107 |
| 468 | 3300005459 | Ga0068867_100005364 | Ga0068867_1000053645 | 107 |
| 469 | 3300005459 | Ga0068867_100006725 | Ga0068867_1000067258 | 107 |
| 470 | 3300005459 | Ga0068867_100026845 | Ga0068867_1000268452 | 107 |
| 471 | 3300005459 | Ga0068867_100089568 | Ga0068867_1000895682 | 107 |
| 472 | 3300005459 | Ga0068867_101233311 | Ga0068867_1012333112 | 107 |
| 473 | 3300005466 | Ga0070685_10123019 | Ga0070685_101230192 | 107 |
| 474 | 3300005466 | Ga0070685_10129128 | Ga0070685_101291282 | 107 |
| 475 | 3300005466 | Ga0070685_10175524 | Ga0070685_101755242 | 107 |
| 476 | 3300005535 | Ga0070684_100000042 | Ga0070684_10000004213 | 107 |
| 477 | 3300005535 | Ga0070684_100005415 | Ga0070684_1000054156 | 107 |
| 478 | 3300005535 | Ga0070684_100126335 | Ga0070684_1001263352 | 107 |
| 479 | 3300005535 | Ga0070684_101548916 | Ga0070684_1015489162 | 107 |
| 480 | 3300005539 | Ga0068853_100003672 | Ga0068853_1000036729 | 107 |
| 481 | 3300005539 | Ga0068853_100066698 | Ga0068853_1000666982 | 107 |
| 482 | 3300005539 | Ga0068853_100457503 | Ga0068853_1004575031 | 107 |
| 483 | 3300005539 | Ga0068853_100549427 | Ga0068853_1005494272 | 107 |
| 484 | 3300005539 | Ga0068853_100578372 | Ga0068853_1005783722 | 107 |
| 485 | 3300005539 | Ga0068853_102215898 | Ga0068853_1022158981 | 107 |
| 486 | 3300005543 | Ga0070672_100133825 | Ga0070672_1001338252 | 107 |
| 487 | 3300005543 | Ga0070672_100139675 | Ga0070672_1001396752 | 107 |
| 488 | 3300005543 | Ga0070672_100506644 | Ga0070672_1005066442 | 107 |
| 489 | 3300005543 | Ga0070672_100699958 | Ga0070672_1006999582 | 107 |
| 490 | 3300005544 | Ga0070686_100484062 | Ga0070686_1004840621 | 107 |
| 491 | 3300005544 | Ga0070686_100900636 | Ga0070686_1009006361 | 107 |
| 492 | 3300005548 | Ga0070665_100025483 | Ga0070665_1000254832 | 107 |
| 493 | 3300005548 | Ga0070665_100030076 | Ga0070665_1000300762 | 107 |
| 494 | 3300005548 | Ga0070665_100599352 | Ga0070665_1005993521 | 107 |
| 495 | 3300005563 | Ga0068855_100613771 | Ga0068855_1006137712 | 107 |
| 496 | 3300005564 | Ga0070664_100000266 | Ga0070664_10000026631 | 107 |
| 497 | 3300005564 | Ga0070664_100087741 | Ga0070664_1000877412 | 107 |
| 498 | 3300005564 | Ga0070664_100115621 | Ga0070664_1001156212 | 107 |
| 499 | 3300005564 | Ga0070664_100263733 | Ga0070664_1002637333 | 107 |
| 500 | 3300005564 | Ga0070664_100880505 | Ga0070664_1008805051 | 107 |
| 501 | 3300005564 | Ga0070664_101246263 | Ga0070664_1012462632 | 107 |
| 502 | 3300005577 | Ga0068857_100006612 | Ga0068857_10000661210 | 107 |
| 503 | 3300005577 | Ga0068857_100257661 | Ga0068857_1002576612 | 107 |
| 504 | 3300005577 | Ga0068857_100702373 | Ga0068857_1007023732 | 107 |
| 505 | 3300005577 | Ga0068857_101368862 | Ga0068857_1013688622 | 107 |
| 506 | 3300005578 | Ga0068854_100021292 | Ga0068854_1000212922 | 107 |
| 507 | 3300005578 | Ga0068854_100100913 | Ga0068854_1001009131 | 107 |
| 508 | 3300005578 | Ga0068854_100245718 | Ga0068854_1002457182 | 107 |
| 509 | 3300005578 | Ga0068854_100314063 | Ga0068854_1003140632 | 107 |
| 510 | 3300005578 | Ga0068854_101476586 | Ga0068854_1014765861 | 107 |
| 511 | 3300005615 | Ga0070702_100195072 | Ga0070702_1001950722 | 107 |
| 512 | 3300005615 | Ga0070702_100463752 | Ga0070702_1004637521 | 107 |
| 513 | 3300005615 | Ga0070702_100775468 | Ga0070702_1007754682 | 107 |
| 514 | 3300005615 | Ga0070702_101641100 | Ga0070702_1016411001 | 107 |
| 515 | 3300005616 | Ga0068852_100045606 | Ga0068852_1000456062 | 107 |
| 516 | 3300005616 | Ga0068852_100151694 | Ga0068852_1001516943 | 107 |
| 517 | 3300005616 | Ga0068852_101742132 | Ga0068852_1017421322 | 107 |
| 518 | 3300005616 | Ga0068852_101908904 | Ga0068852_1019089041 | 107 |
| 519 | 3300005617 | Ga0068859_100012944 | Ga0068859_1000129449 | 107 |
| 520 | 3300005617 | Ga0068859_100016137 | Ga0068859_1000161372 | 107 |
| 521 | 3300005617 | Ga0068859_100016352 | Ga0068859_1000163527 | 107 |
| 522 | 3300005617 | Ga0068859_100064024 | Ga0068859_1000640243 | 107 |
| 523 | 3300005617 | Ga0068859_100082452 | Ga0068859_1000824524 | 107 |
| 524 | 3300005617 | Ga0068859_100806587 | Ga0068859_1008065871 | 107 |
| 525 | 3300005617 | Ga0068859_100934465 | Ga0068859_1009344652 | 107 |
| 526 | 3300005618 | Ga0068864_100038571 | Ga0068864_1000385712 | 107 |
| 527 | 3300005618 | Ga0068864_100048935 | Ga0068864_1000489353 | 107 |
| 528 | 3300005618 | Ga0068864_100260246 | Ga0068864_1002602461 | 107 |
| 529 | 3300005618 | Ga0068864_100733675 | Ga0068864_1007336752 | 107 |
| 530 | 3300005618 | Ga0068864_101635732 | Ga0068864_1016357321 | 107 |
| 531 | 3300005718 | Ga0068866_10010298 | Ga0068866_100102983 | 107 |
| 532 | 3300005718 | Ga0068866_10021202 | Ga0068866_100212023 | 107 |
| 533 | 3300005718 | Ga0068866_10023585 | Ga0068866_100235853 | 107 |
| 534 | 3300005718 | Ga0068866_10335842 | Ga0068866_103358421 | 107 |
| 535 | 3300005719 | Ga0068861_100051333 | Ga0068861_1000513335 | 107 |
| 536 | 3300005719 | Ga0068861_100073767 | Ga0068861_1000737673 | 107 |
| 537 | 3300005719 | Ga0068861_100120249 | Ga0068861_1001202492 | 107 |
| 538 | 3300005719 | Ga0068861_100279444 | Ga0068861_1002794442 | 107 |
| 539 | 3300005719 | Ga0068861_100413833 | Ga0068861_1004138331 | 107 |
| 540 | 3300005719 | Ga0068861_100818533 | Ga0068861_1008185332 | 107 |
| 541 | 3300005719 | Ga0068861_100938749 | Ga0068861_1009387492 | 107 |
| 542 | 3300005834 | Ga0068851_10777152 | Ga0068851_107771522 | 107 |
| 543 | 3300005840 | Ga0068870_10016162 | Ga0068870_100161623 | 107 |
| 544 | 3300005840 | Ga0068870_10041994 | Ga0068870_100419943 | 107 |
| 545 | 3300005841 | Ga0068863_100029026 | Ga0068863_1000290262 | 107 |
| 546 | 3300005841 | Ga0068863_100090425 | Ga0068863_1000904251 | 107 |
| 547 | 3300005841 | Ga0068863_100448448 | Ga0068863_1004484482 | 107 |
| 548 | 3300005841 | Ga0068863_100694585 | Ga0068863_1006945852 | 107 |
| 549 | 3300005842 | Ga0068858_100012456 | Ga0068858_1000124563 | 107 |
| 550 | 3300005842 | Ga0068858_100187834 | Ga0068858_1001878342 | 107 |
| 551 | 3300005842 | Ga0068858_100532078 | Ga0068858_1005320782 | 107 |
| 552 | 3300005842 | Ga0068858_101198172 | Ga0068858_1011981722 | 107 |
| 553 | 3300005842 | Ga0068858_101373923 | Ga0068858_1013739231 | 107 |
| 554 | 3300005843 | Ga0068860_100023035 | Ga0068860_1000230356 | 107 |
| 555 | 3300005843 | Ga0068860_100062721 | Ga0068860_1000627213 | 107 |
| 556 | 3300005843 | Ga0068860_100307542 | Ga0068860_1003075422 | 107 |
| 557 | 3300005843 | Ga0068860_100532188 | Ga0068860_1005321882 | 107 |
| 558 | 3300005843 | Ga0068860_100953218 | Ga0068860_1009532182 | 107 |
| 559 | 3300005843 | Ga0068860_102002419 | Ga0068860_1020024191 | 107 |
| 560 | 3300005844 | Ga0068862_100059921 | Ga0068862_1000599213 | 107 |
| 561 | 3300005844 | Ga0068862_100098588 | Ga0068862_1000985883 | 107 |
| 562 | 3300005844 | Ga0068862_100799465 | Ga0068862_1007994652 | 107 |
| 563 | 3300005844 | Ga0068862_100919936 | Ga0068862_1009199362 | 107 |
| 564 | 3300005844 | Ga0068862_101029043 | Ga0068862_1010290432 | 107 |
| 565 | 3300006163 | Ga0070715_10078967 | Ga0070715_100789672 | 107 |
| 566 | 3300006163 | Ga0070715_10647350 | Ga0070715_106473502 | 107 |
| 567 | 3300006195 | Ga0075366_10040177 | Ga0075366_100401773 | 107 |
| 568 | 3300006195 | Ga0075366_10049611 | Ga0075366_100496112 | 107 |
| 569 | 3300006237 | Ga0097621_100007404 | Ga0097621_1000074047 | 107 |
| 570 | 3300006237 | Ga0097621_100120076 | Ga0097621_1001200763 | 107 |
| 571 | 3300006237 | Ga0097621_100890285 | Ga0097621_1008902851 | 107 |
| 572 | 3300006358 | Ga0068871_100054184 | Ga0068871_1000541842 | 107 |
| 573 | 3300006358 | Ga0068871_100487356 | Ga0068871_1004873562 | 107 |
| 574 | 3300006358 | Ga0068871_100537308 | Ga0068871_1005373081 | 107 |
| 575 | 3300006358 | Ga0068871_100704530 | Ga0068871_1007045302 | 107 |
| 576 | 3300006358 | Ga0068871_102118768 | Ga0068871_1021187681 | 107 |
| 577 | 3300006844 | Ga0075428_100638233 | Ga0075428_1006382332 | 107 |
| 578 | 3300006871 | Ga0075434_100162609 | Ga0075434_1001626092 | 107 |
| 579 | 3300006871 | Ga0075434_101974918 | Ga0075434_1019749181 | 107 |
| 580 | 3300006881 | Ga0068865_100019851 | Ga0068865_1000198513 | 107 |
| 581 | 3300006881 | Ga0068865_100274456 | Ga0068865_1002744562 | 107 |
| 582 | 3300006881 | Ga0068865_100357204 | Ga0068865_1003572042 | 107 |
| 583 | 3300006881 | Ga0068865_100379802 | Ga0068865_1003798022 | 107 |
| 584 | 3300006931 | Ga0097620_100012943 | Ga0097620_1000129439 | 107 |
| 585 | 3300006931 | Ga0097620_100016137 | Ga0097620_1000161372 | 107 |
| 586 | 3300006931 | Ga0097620_100016353 | Ga0097620_1000163537 | 107 |
| 587 | 3300006931 | Ga0097620_100064027 | Ga0097620_1000640273 | 107 |
| 588 | 3300006931 | Ga0097620_100082448 | Ga0097620_1000824484 | 107 |
| 589 | 3300006931 | Ga0097620_100806637 | Ga0097620_1008066372 | 107 |
| 590 | 3300006931 | Ga0097620_100934328 | Ga0097620_1009343282 | 107 |
| 591 | 3300009011 | Ga0105251_10045746 | Ga0105251_100457462 | 107 |
| 592 | 3300009094 | Ga0111539_10052316 | Ga0111539_100523165 | 107 |
| 593 | 3300009101 | Ga0105247_10002375 | Ga0105247_100023754 | 107 |
| 594 | 3300009101 | Ga0105247_10935152 | Ga0105247_109351521 | 107 |
| 595 | 3300009147 | Ga0114129_10239923 | Ga0114129_102399234 | 107 |
| 596 | 3300009148 | Ga0105243_10758784 | Ga0105243_107587842 | 107 |
| 597 | 3300009174 | Ga0105241_10064271 | Ga0105241_100642713 | 107 |
| 598 | 3300009174 | Ga0105241_10160475 | Ga0105241_101604753 | 107 |
| 599 | 3300009174 | Ga0105241_10826120 | Ga0105241_108261201 | 107 |
| 600 | 3300009174 | Ga0105241_11318747 | Ga0105241_113187472 | 107 |
| 601 | 3300009176 | Ga0105242_10012464 | Ga0105242_100124644 | 107 |
| 602 | 3300009176 | Ga0105242_10023748 | Ga0105242_100237482 | 107 |
| 603 | 3300009176 | Ga0105242_10152188 | Ga0105242_101521881 | 107 |
| 604 | 3300009176 | Ga0105242_10338183 | Ga0105242_103381832 | 107 |
| 605 | 3300009176 | Ga0105242_10350791 | Ga0105242_103507912 | 107 |
| 606 | 3300009176 | Ga0105242_10972450 | Ga0105242_109724501 | 107 |
| 607 | 3300009177 | Ga0105248_10751547 | Ga0105248_107515472 | 107 |
| 608 | 3300009177 | Ga0105248_11834692 | Ga0105248_118346921 | 107 |
| 609 | 3300009177 | Ga0105248_11895292 | Ga0105248_118952921 | 107 |
| 610 | 3300009545 | Ga0105237_10235089 | Ga0105237_102350892 | 107 |
| 611 | 3300009551 | Ga0105238_11202961 | Ga0105238_112029611 | 107 |
| 612 | 3300009553 | Ga0105249_10015985 | Ga0105249_100159854 | 107 |
| 613 | 3300009553 | Ga0105249_10061023 | Ga0105249_100610232 | 107 |
| 614 | 3300009553 | Ga0105249_10070285 | Ga0105249_100702853 | 107 |
| 615 | 3300009553 | Ga0105249_10077543 | Ga0105249_100775431 | 107 |
| 616 | 3300009553 | Ga0105249_10204206 | Ga0105249_102042062 | 107 |
| 617 | 3300009553 | Ga0105249_10460531 | Ga0105249_104605312 | 107 |
| 618 | 3300009553 | Ga0105249_11483727 | Ga0105249_114837271 | 107 |
| 619 | 3300010375 | Ga0105239_10631921 | Ga0105239_106319212 | 107 |
| 620 | 3300010375 | Ga0105239_10691313 | Ga0105239_106913131 | 107 |
| 621 | 3300010375 | Ga0105239_10878834 | Ga0105239_108788342 | 107 |
| 622 | 3300011119 | Ga0105246_10173321 | Ga0105246_101733213 | 107 |
| 623 | 3300011119 | Ga0105246_12116545 | Ga0105246_121165451 | 107 |
| 624 | 3300013100 | Ga0157373_10249750 | Ga0157373_102497502 | 107 |
| 625 | 3300013100 | Ga0157373_10249987 | Ga0157373_102499871 | 107 |
| 626 | 3300013100 | Ga0157373_10988032 | Ga0157373_109880321 | 107 |
| 627 | 3300013100 | Ga0157373_11157404 | Ga0157373_111574041 | 107 |
| 628 | 3300013102 | Ga0157371_10190841 | Ga0157371_101908412 | 107 |
| 629 | 3300013102 | Ga0157371_10588824 | Ga0157371_105888241 | 107 |
| 630 | 3300013102 | Ga0157371_11042238 | Ga0157371_110422382 | 107 |
| 631 | 3300013296 | Ga0157374_10003156 | Ga0157374_1000315610 | 107 |
| 632 | 3300013296 | Ga0157374_10014456 | Ga0157374_100144569 | 107 |
| 633 | 3300013296 | Ga0157374_10061563 | Ga0157374_100615632 | 107 |
| 634 | 3300013296 | Ga0157374_10062669 | Ga0157374_100626692 | 107 |
| 635 | 3300013296 | Ga0157374_11678788 | Ga0157374_116787882 | 107 |
| 636 | 3300013297 | Ga0157378_10072175 | Ga0157378_100721753 | 107 |
| 637 | 3300013297 | Ga0157378_10104662 | Ga0157378_101046623 | 107 |
| 638 | 3300013297 | Ga0157378_10119493 | Ga0157378_101194933 | 107 |
| 639 | 3300013297 | Ga0157378_10539166 | Ga0157378_105391662 | 107 |
| 640 | 3300013297 | Ga0157378_10759312 | Ga0157378_107593122 | 107 |
| 641 | 3300013306 | Ga0163162_10014394 | Ga0163162_100143944 | 107 |
| 642 | 3300013306 | Ga0163162_10022713 | Ga0163162_100227136 | 107 |
| 643 | 3300013306 | Ga0163162_10024304 | Ga0163162_100243042 | 107 |
| 644 | 3300013306 | Ga0163162_10238238 | Ga0163162_102382382 | 107 |
| 645 | 3300013306 | Ga0163162_10556412 | Ga0163162_105564122 | 107 |
| 646 | 3300013306 | Ga0163162_11303811 | Ga0163162_113038111 | 107 |
| 647 | 3300013307 | Ga0157372_10998344 | Ga0157372_109983441 | 107 |
| 648 | 3300013307 | Ga0157372_11486242 | Ga0157372_114862421 | 107 |
| 649 | 3300013308 | Ga0157375_10010150 | Ga0157375_100101509 | 107 |
| 650 | 3300013308 | Ga0157375_10091006 | Ga0157375_100910063 | 107 |
| 651 | 3300013308 | Ga0157375_10174426 | Ga0157375_101744262 | 107 |
| 652 | 3300013308 | Ga0157375_10332365 | Ga0157375_103323652 | 107 |
| 653 | 3300013308 | Ga0157375_11340750 | Ga0157375_113407502 | 107 |
| 654 | 3300013308 | Ga0157375_11551831 | Ga0157375_115518312 | 107 |
| 655 | 3300014325 | Ga0163163_10001563 | Ga0163163_1000156311 | 107 |
| 656 | 3300014325 | Ga0163163_10309897 | Ga0163163_103098972 | 107 |
| 657 | 3300014325 | Ga0163163_10385178 | Ga0163163_103851781 | 107 |
| 658 | 3300014325 | Ga0163163_10731420 | Ga0163163_107314202 | 107 |
| 659 | 3300014325 | Ga0163163_11037756 | Ga0163163_110377561 | 107 |
| 660 | 3300014326 | Ga0157380_10492957 | Ga0157380_104929571 | 107 |
| 661 | 3300014326 | Ga0157380_10744334 | Ga0157380_107443341 | 107 |
| 662 | 3300014745 | Ga0157377_10017170 | Ga0157377_100171704 | 107 |
| 663 | 3300014745 | Ga0157377_10094906 | Ga0157377_100949062 | 107 |
| 664 | 3300014968 | Ga0157379_10047219 | Ga0157379_100472194 | 107 |
| 665 | 3300014968 | Ga0157379_10055113 | Ga0157379_100551132 | 107 |
| 666 | 3300014968 | Ga0157379_10114814 | Ga0157379_101148144 | 107 |
| 667 | 3300014968 | Ga0157379_10295217 | Ga0157379_102952173 | 107 |
| 668 | 3300014969 | Ga0157376_10022781 | Ga0157376_100227813 | 107 |
| 669 | 3300014969 | Ga0157376_10198238 | Ga0157376_101982382 | 107 |
| 670 | 3300014969 | Ga0157376_10217360 | Ga0157376_102173602 | 107 |
| 671 | 3300014969 | Ga0157376_10631607 | Ga0157376_106316072 | 107 |
| 672 | 3300014969 | Ga0157376_12362432 | Ga0157376_123624321 | 107 |
| 673 | 3300017792 | Ga0163161_10823061 | Ga0163161_108230611 | 107 |
| 674 | 3300020080 | Ga0206350_11435478 | Ga0206350_114354782 | 107 |
| 675 | 3300020081 | Ga0206354_10273940 | Ga0206354_102739401 | 107 |
| 676 | 3300025271 | Ga0207666_1015809 | Ga0207666_10158092 | 107 |
| 677 | 3300025290 | Ga0207673_1025405 | Ga0207673_10254052 | 107 |
| 678 | 3300025315 | Ga0207697_10021574 | Ga0207697_100215743 | 107 |
| 679 | 3300025315 | Ga0207697_10033727 | Ga0207697_100337273 | 107 |
| 680 | 3300025315 | Ga0207697_10311372 | Ga0207697_103113722 | 107 |
| 681 | 3300025321 | Ga0207656_10241468 | Ga0207656_102414682 | 107 |
| 682 | 3300025893 | Ga0207682_10029024 | Ga0207682_100290242 | 107 |
| 683 | 3300025893 | Ga0207682_10367146 | Ga0207682_103671461 | 107 |
| 684 | 3300025899 | Ga0207642_10004642 | Ga0207642_100046424 | 107 |
| 685 | 3300025899 | Ga0207642_10061353 | Ga0207642_100613532 | 107 |
| 686 | 3300025899 | Ga0207642_10103122 | Ga0207642_101031221 | 107 |
| 687 | 3300025899 | Ga0207642_11144001 | Ga0207642_111440011 | 107 |
| 688 | 3300025900 | Ga0207710_10006643 | Ga0207710_100066435 | 107 |
| 689 | 3300025901 | Ga0207688_10058350 | Ga0207688_100583502 | 107 |
| 690 | 3300025901 | Ga0207688_10468924 | Ga0207688_104689241 | 107 |
| 691 | 3300025903 | Ga0207680_10032788 | Ga0207680_100327882 | 107 |
| 692 | 3300025903 | Ga0207680_10267887 | Ga0207680_102678872 | 107 |
| 693 | 3300025904 | Ga0207647_10013718 | Ga0207647_100137183 | 107 |
| 694 | 3300025904 | Ga0207647_10104095 | Ga0207647_101040952 | 107 |
| 695 | 3300025905 | Ga0207685_10498195 | Ga0207685_104981951 | 107 |
| 696 | 3300025907 | Ga0207645_10001491 | Ga0207645_100014917 | 107 |
| 697 | 3300025907 | Ga0207645_10004909 | Ga0207645_1000490911 | 107 |
| 698 | 3300025907 | Ga0207645_10023123 | Ga0207645_100231232 | 107 |
| 699 | 3300025907 | Ga0207645_10154585 | Ga0207645_101545853 | 107 |
| 700 | 3300025907 | Ga0207645_10400899 | Ga0207645_104008992 | 107 |
| 701 | 3300025908 | Ga0207643_10009019 | Ga0207643_100090194 | 107 |
| 702 | 3300025908 | Ga0207643_10054565 | Ga0207643_100545652 | 107 |
| 703 | 3300025908 | Ga0207643_10248003 | Ga0207643_102480031 | 107 |
| 704 | 3300025911 | Ga0207654_10272411 | Ga0207654_102724112 | 107 |
| 705 | 3300025911 | Ga0207654_10419197 | Ga0207654_104191972 | 107 |
| 706 | 3300025911 | Ga0207654_10697594 | Ga0207654_106975942 | 107 |
| 707 | 3300025919 | Ga0207657_10185647 | Ga0207657_101856472 | 107 |
| 708 | 3300025920 | Ga0207649_10000644 | Ga0207649_1000064410 | 107 |
| 709 | 3300025920 | Ga0207649_10385775 | Ga0207649_103857752 | 107 |
| 710 | 3300025923 | Ga0207681_10003840 | Ga0207681_100038406 | 107 |
| 711 | 3300025923 | Ga0207681_10065387 | Ga0207681_100653872 | 107 |
| 712 | 3300025923 | Ga0207681_10080903 | Ga0207681_100809032 | 107 |
| 713 | 3300025923 | Ga0207681_10425614 | Ga0207681_104256142 | 107 |
| 714 | 3300025923 | Ga0207681_10958497 | Ga0207681_109584971 | 107 |
| 715 | 3300025925 | Ga0207650_10013869 | Ga0207650_100138697 | 107 |
| 716 | 3300025925 | Ga0207650_10062858 | Ga0207650_100628582 | 107 |
| 717 | 3300025925 | Ga0207650_10167710 | Ga0207650_101677102 | 107 |
| 718 | 3300025925 | Ga0207650_11031792 | Ga0207650_110317921 | 107 |
| 719 | 3300025925 | Ga0207650_11298831 | Ga0207650_112988311 | 107 |
| 720 | 3300025925 | Ga0207650_11716284 | Ga0207650_117162841 | 107 |
| 721 | 3300025926 | Ga0207659_10072911 | Ga0207659_100729112 | 107 |
| 722 | 3300025926 | Ga0207659_10228918 | Ga0207659_102289181 | 107 |
| 723 | 3300025931 | Ga0207644_10085680 | Ga0207644_100856802 | 107 |
| 724 | 3300025931 | Ga0207644_10114518 | Ga0207644_101145181 | 107 |
| 725 | 3300025931 | Ga0207644_10178954 | Ga0207644_101789542 | 107 |
| 726 | 3300025932 | Ga0207690_10050038 | Ga0207690_100500382 | 107 |
| 727 | 3300025933 | Ga0207706_10023357 | Ga0207706_100233573 | 107 |
| 728 | 3300025933 | Ga0207706_10027153 | Ga0207706_100271535 | 107 |
| 729 | 3300025933 | Ga0207706_10032203 | Ga0207706_100322035 | 107 |
| 730 | 3300025933 | Ga0207706_10043173 | Ga0207706_100431735 | 107 |
| 731 | 3300025933 | Ga0207706_10079253 | Ga0207706_100792533 | 107 |
| 732 | 3300025933 | Ga0207706_10124679 | Ga0207706_101246793 | 107 |
| 733 | 3300025934 | Ga0207686_10091395 | Ga0207686_100913952 | 107 |
| 734 | 3300025934 | Ga0207686_10144137 | Ga0207686_101441372 | 107 |
| 735 | 3300025934 | Ga0207686_10415035 | Ga0207686_104150352 | 107 |
| 736 | 3300025934 | Ga0207686_10617505 | Ga0207686_106175051 | 107 |
| 737 | 3300025934 | Ga0207686_10722194 | Ga0207686_107221941 | 107 |
| 738 | 3300025934 | Ga0207686_10889760 | Ga0207686_108897601 | 107 |
| 739 | 3300025935 | Ga0207709_10780416 | Ga0207709_107804161 | 107 |
| 740 | 3300025936 | Ga0207670_10214606 | Ga0207670_102146063 | 107 |
| 741 | 3300025936 | Ga0207670_11002599 | Ga0207670_110025991 | 107 |
| 742 | 3300025937 | Ga0207669_10060773 | Ga0207669_100607733 | 107 |
| 743 | 3300025937 | Ga0207669_10083926 | Ga0207669_100839263 | 107 |
| 744 | 3300025937 | Ga0207669_10170167 | Ga0207669_101701672 | 107 |
| 745 | 3300025938 | Ga0207704_10098240 | Ga0207704_100982403 | 107 |
| 746 | 3300025938 | Ga0207704_10164213 | Ga0207704_101642132 | 107 |
| 747 | 3300025938 | Ga0207704_10181946 | Ga0207704_101819461 | 107 |
| 748 | 3300025938 | Ga0207704_11624245 | Ga0207704_116242451 | 107 |
| 749 | 3300025940 | Ga0207691_10009018 | Ga0207691_100090189 | 107 |
| 750 | 3300025940 | Ga0207691_10159330 | Ga0207691_101593302 | 107 |
| 751 | 3300025940 | Ga0207691_10174361 | Ga0207691_101743612 | 107 |
| 752 | 3300025940 | Ga0207691_10191807 | Ga0207691_101918073 | 107 |
| 753 | 3300025941 | Ga0207711_10267123 | Ga0207711_102671232 | 107 |
| 754 | 3300025942 | Ga0207689_10001227 | Ga0207689_1000122722 | 107 |
| 755 | 3300025942 | Ga0207689_10001306 | Ga0207689_1000130619 | 107 |
| 756 | 3300025942 | Ga0207689_10005140 | Ga0207689_100051403 | 107 |
| 757 | 3300025942 | Ga0207689_10008581 | Ga0207689_100085815 | 107 |
| 758 | 3300025942 | Ga0207689_10032199 | Ga0207689_100321996 | 107 |
| 759 | 3300025942 | Ga0207689_10059258 | Ga0207689_100592582 | 107 |
| 760 | 3300025942 | Ga0207689_10067810 | Ga0207689_100678102 | 107 |
| 761 | 3300025942 | Ga0207689_10121552 | Ga0207689_101215523 | 107 |
| 762 | 3300025942 | Ga0207689_10854575 | Ga0207689_108545751 | 107 |
| 763 | 3300025944 | Ga0207661_10000781 | Ga0207661_100007819 | 107 |
| 764 | 3300025944 | Ga0207661_10161528 | Ga0207661_101615282 | 107 |
| 765 | 3300025944 | Ga0207661_10325833 | Ga0207661_103258332 | 107 |
| 766 | 3300025945 | Ga0207679_10000733 | Ga0207679_1000073313 | 107 |
| 767 | 3300025945 | Ga0207679_10072529 | Ga0207679_100725294 | 107 |
| 768 | 3300025945 | Ga0207679_10141082 | Ga0207679_101410821 | 107 |
| 769 | 3300025945 | Ga0207679_10156009 | Ga0207679_101560092 | 107 |
| 770 | 3300025945 | Ga0207679_10249089 | Ga0207679_102490892 | 107 |
| 771 | 3300025945 | Ga0207679_10435024 | Ga0207679_104350242 | 107 |
| 772 | 3300025945 | Ga0207679_10615805 | Ga0207679_106158052 | 107 |
| 773 | 3300025949 | Ga0207667_11603226 | Ga0207667_116032261 | 107 |
| 774 | 3300025960 | Ga0207651_10072501 | Ga0207651_100725011 | 107 |
| 775 | 3300025960 | Ga0207651_10216789 | Ga0207651_102167892 | 107 |
| 776 | 3300025960 | Ga0207651_10264575 | Ga0207651_102645752 | 107 |
| 777 | 3300025961 | Ga0207712_10013550 | Ga0207712_100135506 | 107 |
| 778 | 3300025961 | Ga0207712_10047438 | Ga0207712_100474382 | 107 |
| 779 | 3300025961 | Ga0207712_10056675 | Ga0207712_100566752 | 107 |
| 780 | 3300025961 | Ga0207712_10113360 | Ga0207712_101133602 | 107 |
| 781 | 3300025961 | Ga0207712_10115165 | Ga0207712_101151652 | 107 |
| 782 | 3300025961 | Ga0207712_10904136 | Ga0207712_109041362 | 107 |
| 783 | 3300025961 | Ga0207712_11121198 | Ga0207712_111211981 | 107 |
| 784 | 3300025961 | Ga0207712_11673634 | Ga0207712_116736341 | 107 |
| 785 | 3300025972 | Ga0207668_10106752 | Ga0207668_101067523 | 107 |
| 786 | 3300025972 | Ga0207668_10374600 | Ga0207668_103746002 | 107 |
| 787 | 3300025972 | Ga0207668_11525417 | Ga0207668_115254171 | 107 |
| 788 | 3300025972 | Ga0207668_11884211 | Ga0207668_118842111 | 107 |
| 789 | 3300025972 | Ga0207668_12001922 | Ga0207668_120019221 | 107 |
| 790 | 3300025981 | Ga0207640_10045009 | Ga0207640_100450093 | 107 |
| 791 | 3300025981 | Ga0207640_10111724 | Ga0207640_101117242 | 107 |
| 792 | 3300025981 | Ga0207640_10210025 | Ga0207640_102100252 | 107 |
| 793 | 3300025981 | Ga0207640_10452051 | Ga0207640_104520512 | 107 |
| 794 | 3300025981 | Ga0207640_10936226 | Ga0207640_109362262 | 107 |
| 795 | 3300025986 | Ga0207658_10060668 | Ga0207658_100606683 | 107 |
| 796 | 3300025986 | Ga0207658_10089383 | Ga0207658_100893833 | 107 |
| 797 | 3300025986 | Ga0207658_10155481 | Ga0207658_101554812 | 107 |
| 798 | 3300025986 | Ga0207658_10195342 | Ga0207658_101953422 | 107 |
| 799 | 3300025986 | Ga0207658_10199918 | Ga0207658_101999182 | 107 |
| 800 | 3300025986 | Ga0207658_10256647 | Ga0207658_102566472 | 107 |
| 801 | 3300025986 | Ga0207658_11220733 | Ga0207658_112207332 | 107 |
| 802 | 3300026023 | Ga0207677_10026950 | Ga0207677_100269505 | 107 |
| 803 | 3300026023 | Ga0207677_10098217 | Ga0207677_100982172 | 107 |
| 804 | 3300026023 | Ga0207677_10357321 | Ga0207677_103573212 | 107 |
| 805 | 3300026023 | Ga0207677_10526548 | Ga0207677_105265482 | 107 |
| 806 | 3300026035 | Ga0207703_10864410 | Ga0207703_108644102 | 107 |
| 807 | 3300026035 | Ga0207703_10958773 | Ga0207703_109587732 | 107 |
| 808 | 3300026035 | Ga0207703_11001954 | Ga0207703_110019541 | 107 |
| 809 | 3300026035 | Ga0207703_11836455 | Ga0207703_118364551 | 107 |
| 810 | 3300026035 | Ga0207703_12388597 | Ga0207703_123885972 | 107 |
| 811 | 3300026041 | Ga0207639_10005779 | Ga0207639_100057797 | 107 |
| 812 | 3300026041 | Ga0207639_10041435 | Ga0207639_100414354 | 107 |
| 813 | 3300026041 | Ga0207639_10479747 | Ga0207639_104797472 | 107 |
| 814 | 3300026041 | Ga0207639_10794847 | Ga0207639_107948471 | 107 |
| 815 | 3300026067 | Ga0207678_10677097 | Ga0207678_106770971 | 107 |
| 816 | 3300026075 | Ga0207708_10044948 | Ga0207708_100449484 | 107 |
| 817 | 3300026075 | Ga0207708_10747342 | Ga0207708_107473421 | 107 |
| 818 | 3300026075 | Ga0207708_11263794 | Ga0207708_112637942 | 107 |
| 819 | 3300026078 | Ga0207702_10713515 | Ga0207702_107135152 | 107 |
| 820 | 3300026088 | Ga0207641_10020546 | Ga0207641_100205462 | 107 |
| 821 | 3300026088 | Ga0207641_10097845 | Ga0207641_100978454 | 107 |
| 822 | 3300026088 | Ga0207641_10337636 | Ga0207641_103376362 | 107 |
| 823 | 3300026088 | Ga0207641_11243593 | Ga0207641_112435932 | 107 |
| 824 | 3300026089 | Ga0207648_10000906 | Ga0207648_1000090610 | 107 |
| 825 | 3300026089 | Ga0207648_10005239 | Ga0207648_100052395 | 107 |
| 826 | 3300026089 | Ga0207648_10016291 | Ga0207648_100162913 | 107 |
| 827 | 3300026089 | Ga0207648_10018178 | Ga0207648_100181782 | 107 |
| 828 | 3300026089 | Ga0207648_10033647 | Ga0207648_100336476 | 107 |
| 829 | 3300026089 | Ga0207648_10055713 | Ga0207648_100557131 | 107 |
| 830 | 3300026089 | Ga0207648_10179839 | Ga0207648_101798392 | 107 |
| 831 | 3300026089 | Ga0207648_10587571 | Ga0207648_105875712 | 107 |
| 832 | 3300026095 | Ga0207676_10014205 | Ga0207676_100142051 | 107 |
| 833 | 3300026095 | Ga0207676_10025141 | Ga0207676_100251415 | 107 |
| 834 | 3300026095 | Ga0207676_10036338 | Ga0207676_100363382 | 107 |
| 835 | 3300026095 | Ga0207676_10211820 | Ga0207676_102118203 | 107 |
| 836 | 3300026095 | Ga0207676_10855359 | Ga0207676_108553592 | 107 |
| 837 | 3300026095 | Ga0207676_11820684 | Ga0207676_118206841 | 107 |
| 838 | 3300026116 | Ga0207674_10003645 | Ga0207674_1000364510 | 107 |
| 839 | 3300026116 | Ga0207674_10014347 | Ga0207674_100143472 | 107 |
| 840 | 3300026116 | Ga0207674_10023297 | Ga0207674_100232977 | 107 |
| 841 | 3300026116 | Ga0207674_10371054 | Ga0207674_103710542 | 107 |
| 842 | 3300026116 | Ga0207674_10729040 | Ga0207674_107290402 | 107 |
| 843 | 3300026118 | Ga0207675_100000496 | Ga0207675_10000049618 | 107 |
| 844 | 3300026118 | Ga0207675_100003900 | Ga0207675_10000390011 | 107 |
| 845 | 3300026118 | Ga0207675_100094858 | Ga0207675_1000948582 | 107 |
| 846 | 3300026118 | Ga0207675_100130700 | Ga0207675_1001307005 | 107 |
| 847 | 3300026118 | Ga0207675_100189525 | Ga0207675_1001895252 | 107 |
| 848 | 3300026118 | Ga0207675_100361752 | Ga0207675_1003617522 | 107 |
| 849 | 3300026118 | Ga0207675_101227108 | Ga0207675_1012271081 | 107 |
| 850 | 3300026118 | Ga0207675_101407816 | Ga0207675_1014078161 | 107 |
| 851 | 3300026121 | Ga0207683_10004237 | Ga0207683_100042377 | 107 |
| 852 | 3300026121 | Ga0207683_10007976 | Ga0207683_100079764 | 107 |
| 853 | 3300026121 | Ga0207683_11516036 | Ga0207683_115160361 | 107 |
| 854 | 3300026121 | Ga0207683_11943180 | Ga0207683_119431801 | 107 |
| 855 | 3300026142 | Ga0207698_10113516 | Ga0207698_101135162 | 107 |
| 856 | 3300026142 | Ga0207698_10270413 | Ga0207698_102704133 | 107 |
| 857 | 3300026142 | Ga0207698_11069317 | Ga0207698_110693172 | 107 |
| 858 | 3300027471 | Ga0209995_1037020 | Ga0209995_10370202 | 107 |
| 859 | 3300027907 | Ga0207428_10372498 | Ga0207428_103724982 | 107 |
| 860 | 3300028379 | Ga0268266_10480327 | Ga0268266_104803272 | 107 |
| 861 | 3300028379 | Ga0268266_11333412 | Ga0268266_113334121 | 107 |
| 862 | 3300028379 | Ga0268266_11864541 | Ga0268266_118645411 | 107 |
| 863 | 3300028380 | Ga0268265_10008576 | Ga0268265_100085763 | 107 |
| 864 | 3300028380 | Ga0268265_10106353 | Ga0268265_101063532 | 107 |
| 865 | 3300028380 | Ga0268265_10222975 | Ga0268265_102229752 | 107 |
| 866 | 3300028380 | Ga0268265_10854671 | Ga0268265_108546712 | 107 |
| 867 | 3300028380 | Ga0268265_11158175 | Ga0268265_111581751 | 107 |
| 868 | 3300028381 | Ga0268264_10024319 | Ga0268264_100243192 | 107 |
| 869 | 3300028381 | Ga0268264_10055818 | Ga0268264_100558183 | 107 |
| 870 | 3300028381 | Ga0268264_10453748 | Ga0268264_104537482 | 107 |
| 871 | 3300028381 | Ga0268264_10622929 | Ga0268264_106229291 | 107 |
| 872 | 3300028381 | Ga0268264_12172110 | Ga0268264_121721101 | 107 |
| 873 | 3300028381 | Ga0268264_12580824 | Ga0268264_125808241 | 107 |
| 874 | 3300028381 | Ga0268264_12644500 | Ga0268264_126445001 | 107 |
| 875 | 3300031456 | Ga0307513_10574484 | Ga0307513_105744842 | 107 |
| 876 | 3300031507 | Ga0307509_10491177 | Ga0307509_104911771 | 107 |
| 877 | 3300031507 | Ga0307509_10640912 | Ga0307509_106409121 | 107 |
| 878 | 3300031548 | Ga0307408_101094699 | Ga0307408_1010946991 | 107 |
| 879 | 3300031852 | Ga0307410_11164357 | Ga0307410_111643571 | 107 |
| 880 | 3300031995 | Ga0307409_100575929 | Ga0307409_1005759292 | 107 |
| 881 | 3300032002 | Ga0307416_100218735 | Ga0307416_1002187352 | 107 |
| 882 | 3300032002 | Ga0307416_100662298 | Ga0307416_1006622981 | 107 |
| 883 | 3300032005 | Ga0307411_10784192 | Ga0307411_107841922 | 107 |
| 884 | 3300035086 | Ga0373934_0024614 | Ga0373934_0024614_1134_1472 | 107 |
| 885 | 3300035120 | Ga0373957_0129104 | Ga0373957_0129104_166_504 | 107 |
| 886 | 3300035172 | Ga0373955_0342799 | Ga0373955_0342799_412_750 | 107 |
| 887 | 3300035410 | Ga0373924_0035738 | Ga0373924_0035738_881_1219 | 107 |
| 888 | 3300035692 | Ga0373935_0395323 | Ga0373935_0395323_143_481 | 107 |
| 889 | 3300035724 | Ga0373933_1154390 | Ga0373933_1154390_37_375 | 107 |
| 890 | 3300035725 | Ga0373947_0057918 | Ga0373947_0057918_1177_1515 | 107 |
| 891 | 3300035725 | Ga0373947_1084024 | Ga0373947_1084024_112_450 | 107 |
| 892 | 3300036401 | Ga0373937_0156276 | Ga0373937_0156276_1331_1669 | 107 |
| 893 | 3300037068 | Ga0373925_0409562 | Ga0373925_0409562_188_526 | 107 |
| 894 | 3300041407 | Ga0439447_055322 | Ga0439447_055322_349_687 | 107 |
| 895 | 3300041413 | Ga0439465_0018267 | Ga0439465_0018267_1458_1796 | 107 |
| 896 | 3300041413 | Ga0439465_0018786 | Ga0439465_0018786_851_1189 | 107 |
| 897 | 3300041441 | Ga0451787_175855 | Ga0451787_175855_483_869 | 107 |
| 898 | 3300041443 | Ga0451789_0302099 | Ga0451789_0302099_25_363 | 107 |
| 899 | 3300041451 | Ga0451791_0474555 | Ga0451791_0474555_246_584 | 107 |
| 900 | 3300041459 | Ga0451800_0208990 | Ga0451800_0208990_16_354 | 107 |
| 901 | 3300041486 | Ga0451807_0825022 | Ga0451807_0825022_395_733 | 107 |
| 902 | 3300041486 | Ga0451807_1196384 | Ga0451807_1196384_295_633 | 107 |
| 903 | 3300041486 | Ga0451807_1403346 | Ga0451807_1403346_61_399 | 107 |
| 904 | 3300041511 | Ga0451855_1068511 | Ga0451855_1068511_51_437 | 107 |
| 905 | 3300041997 | Ga0439431_0024267 | Ga0439431_0024267_579_917 | 107 |
| 906 | 3300042002 | Ga0439442_006943 | Ga0439442_006943_1730_2068 | 107 |
| 907 | 3300042004 | Ga0439445_0046399 | Ga0439445_0046399_598_936 | 107 |
| 908 | 3300042007 | Ga0439449_0176728 | Ga0439449_0176728_127_465 | 107 |
| 909 | 3300042010 | Ga0439452_031447 | Ga0439452_031447_589_927 | 107 |
| 910 | 3300042014 | Ga0439457_010179 | Ga0439457_010179_1421_1759 | 107 |
| 911 | 3300042124 | Ga0450922_032820 | Ga0450922_032820_97_435 | 107 |
| 912 | 3300042125 | Ga0450923_074150 | Ga0450923_074150_96_434 | 107 |
| 913 | 3300042128 | Ga0450897_000424 | Ga0450897_000424_1608_1946 | 107 |
| 914 | 3300042131 | Ga0450894_017598 | Ga0450894_017598_398_736 | 107 |
| 915 | 3300042134 | Ga0450898_007895 | Ga0450898_007895_1294_1632 | 107 |
| 916 | 3300042135 | Ga0450899_017547 | Ga0450899_017547_271_609 | 107 |
| 917 | 3300042156 | Ga0439446_0145801 | Ga0439446_0145801_172_510 | 107 |
| 918 | 3300042185 | Ga0450909_075809 | Ga0450909_075809_25_363 | 107 |
| 919 | 3300042435 | Ga0439434_0021642 | Ga0439434_0021642_589_927 | 107 |
| 920 | 3300044658 | Ga0466972_0397662 | Ga0466972_0397662_153_491 | 107 |
| 921 | 3300044673 | Ga0453683_0965757 | Ga0453683_0965757_134_472 | 107 |
| 922 | 3300044683 | Ga0466965_0263098 | Ga0466965_0263098_379_702 | 107 |
| 923 | 3300046454 | Ga0495592_0216098 | Ga0495592_0216098_824_1162 | 107 |
| 924 | 3300046459 | Ga0495629_0257410 | Ga0495629_0257410_142_480 | 107 |
| 925 | 3300046463 | Ga0495653_0308387 | Ga0495653_0308387_581_919 | 107 |
| 926 | 3300046511 | Ga0495608_0235595 | Ga0495608_0235595_542_880 | 107 |
| 927 | 3300046514 | Ga0495618_0310230 | Ga0495618_0310230_401_739 | 107 |
| 928 | 3300046516 | Ga0495628_0300099 | Ga0495628_0300099_526_864 | 107 |
| 929 | 3300046517 | Ga0495630_0397373 | Ga0495630_0397373_699_1037 | 107 |
| 930 | 3300046543 | Ga0495645_0822106 | Ga0495645_0822106_25_363 | 107 |
| 931 | 3300046559 | Ga0495667_0073158 | Ga0495667_0073158_1650_1988 | 107 |
| 932 | 3300046660 | Ga0495625_0711521 | Ga0495625_0711521_109_447 | 107 |
| 933 | 3300046675 | Ga0495657_0337428 | Ga0495657_0337428_264_602 | 107 |
| 934 | 3300046809 | Ga0495600_0236075 | Ga0495600_0236075_548_886 | 107 |
| 935 | 3300047319 | Ga0495674_0558200 | Ga0495674_0558200_345_683 | 107 |
| 936 | 3300047320 | Ga0495672_0062722 | Ga0495672_0062722_741_1067 | 107 |
| 937 | 3300047321 | Ga0495676_0398433 | Ga0495676_0398433_281_619 | 107 |
| 938 | 3300047321 | Ga0495676_0626630 | Ga0495676_0626630_214_552 | 107 |
| 939 | 3300047471 | Ga0495684_0625569 | Ga0495684_0625569_277_615 | 107 |
| 940 | 3300048904 | Ga0496101_0548459 | Ga0496101_0548459_294_632 | 107 |
| 941 | 3300048907 | Ga0496104_1137122 | Ga0496104_1137122_34_372 | 107 |
| 942 | 3300048908 | Ga0496105_0817204 | Ga0496105_0817204_251_589 | 107 |
| 943 | 3300048908 | Ga0496105_1210400 | Ga0496105_1210400_202_540 | 107 |
| 944 | 3300048911 | Ga0496108_0404646 | Ga0496108_0404646_605_943 | 107 |
| 945 | 3300048912 | Ga0496109_0820303 | Ga0496109_0820303_267_605 | 107 |
| 946 | 3300048913 | Ga0496110_0155711 | Ga0496110_0155711_1224_1562 | 107 |
| 947 | 3300048913 | Ga0496110_1141114 | Ga0496110_1141114_37_375 | 107 |
| 948 | 3300048914 | Ga0496111_0152411 | Ga0496111_0152411_1010_1348 | 107 |
| 949 | 3300048914 | Ga0496111_0704150 | Ga0496111_0704150_293_631 | 107 |
| 950 | 3300048915 | Ga0496112_0971154 | Ga0496112_0971154_266_604 | 107 |
| 951 | 3300048915 | Ga0496112_1559510 | Ga0496112_1559510_181_519 | 107 |
| 952 | 3300049521 | Ga0501298_038717 | Ga0501298_038717_243_566 | 107 |
| 953 | 3300049568 | Ga0501031_0026007 | Ga0501031_0026007_693_1031 | 107 |
| 954 | 3300049569 | Ga0501032_0010076 | Ga0501032_0010076_4558_4881 | 107 |
| 955 | 3300049569 | Ga0501032_0043622 | Ga0501032_0043622_1674_2012 | 107 |
| 956 | 3300049570 | Ga0501033_0111743 | Ga0501033_0111743_432_755 | 107 |
| 957 | 3300049571 | Ga0501034_0023352 | Ga0501034_0023352_5381_5704 | 107 |
| 958 | 3300049571 | Ga0501034_0180504 | Ga0501034_0180504_1044_1382 | 107 |
| 959 | 3300049571 | Ga0501034_0966504 | Ga0501034_0966504_63_386 | 107 |
| 960 | 3300049572 | Ga0501036_0043431 | Ga0501036_0043431_3048_3371 | 107 |
| 961 | 3300049572 | Ga0501036_0079155 | Ga0501036_0079155_1171_1509 | 107 |
| 962 | 3300049573 | Ga0501037_0021694 | Ga0501037_0021694_1081_1419 | 107 |
| 963 | 3300049574 | Ga0501038_0021012 | Ga0501038_0021012_439_777 | 107 |
| 964 | 3300049574 | Ga0501038_0131224 | Ga0501038_0131224_921_1244 | 107 |
| 965 | 3300049575 | Ga0501039_0337383 | Ga0501039_0337383_680_1018 | 107 |
| 966 | 3300049579 | Ga0501043_0050958 | Ga0501043_0050958_311_634 | 107 |
| 967 | 3300049579 | Ga0501043_0091378 | Ga0501043_0091378_166_504 | 107 |
| 968 | 3300049580 | Ga0501046_0006756 | Ga0501046_0006756_8708_9046 | 107 |
| 969 | 3300049580 | Ga0501046_0272495 | Ga0501046_0272495_409_732 | 107 |
| 970 | 3300049581 | Ga0501047_0178701 | Ga0501047_0178701_1390_1713 | 107 |
| 971 | 3300049581 | Ga0501047_0245711 | Ga0501047_0245711_133_471 | 107 |
| 972 | 3300049582 | Ga0501048_0597865 | Ga0501048_0597865_457_780 | 107 |
| 973 | 3300049588 | Ga0501072_1430110 | Ga0501072_1430110_146_484 | 107 |
| 974 | 3300049652 | Ga0501202_236393 | Ga0501202_236393_109_432 | 107 |
| 975 | 3300049676 | Ga0501246_034226 | Ga0501246_034226_118_441 | 107 |
| 976 | 3300049679 | Ga0501249_058812 | Ga0501249_058812_146_469 | 107 |
| 977 | 3300049703 | Ga0501219_000098 | Ga0501219_000098_4588_4911 | 107 |
| 978 | 3300049758 | Ga0501241_008833 | Ga0501241_008833_112_435 | 107 |
| 979 | 3300049822 | Ga0501035_0004551 | Ga0501035_0004551_529_867 | 107 |
| 980 | 3300049822 | Ga0501035_0028671 | Ga0501035_0028671_1406_1729 | 107 |
| 981 | 3300049823 | Ga0501044_0021980 | Ga0501044_0021980_2244_2582 | 107 |
| 982 | 3300049823 | Ga0501044_0052997 | Ga0501044_0052997_1727_2050 | 107 |
| 983 | 3300049824 | Ga0501045_0680010 | Ga0501045_0680010_224_562 | 107 |
| 984 | 3300049824 | Ga0501045_0751636 | Ga0501045_0751636_101_424 | 107 |
| 985 | 3300050005 | Ga0501284_00036 | Ga0501284_00036_8213_8536 | 107 |
| 986 | 3300050493 | nmdc:mga0k408_3233_c1 | nmdc:mga0k408_3233_c1_5131_5457 | 107 |
| 987 | 3300050493 | nmdc:mga0k408_355923_c1 | nmdc:mga0k408_355923_c1_212_550 | 107 |
| 988 | 3300050493 | nmdc:mga0k408_76325_c1 | nmdc:mga0k408_76325_c1_1017_1355 | 107 |
| 989 | 3300050508 | nmdc:mga09592_19360_c1 | nmdc:mga09592_19360_c1_3236_3559 | 107 |
| 990 | 3300050511 | nmdc:mga08y16_304943_c1 | nmdc:mga08y16_304943_c1_838_1176 | 107 |
| 991 | 3300050512 | nmdc:mga0n895_125677_c1 | nmdc:mga0n895_125677_c1_1065_1403 | 107 |
| 992 | 3300050512 | nmdc:mga0n895_1599605_c1 | nmdc:mga0n895_1599605_c1_203_541 | 107 |
| 993 | 3300053085 | Ga0495619_0145973 | Ga0495619_0145973_982_1320 | 107 |
| 994 | 3300053129 | Ga0500628_066294 | Ga0500628_066294_522_860 | 107 |
| 995 | 3300053139 | Ga0500568_0000459 | Ga0500568_0000459_25372_25710 | 107 |
| 996 | 3300053153 | Ga0500616_0400153 | Ga0500616_0400153_151_489 | 107 |
| 997 | 3300053727 | Ga0500611_000008 | Ga0500611_000008_62993_63331 | 107 |
| 998 | 3300059511 | Ga0587091_112400 | Ga0587091_112400_85_423 | 107 |
| 999 | 3300005578 | Ga0068854_101557294 | Ga0068854_1015572942 | 108 |
| 1000 | 3300005578 | Ga0068854_102263412 | Ga0068854_1022634121 | 108 |
| 1001 | 3300006237 | Ga0097621_100538930 | Ga0097621_1005389302 | 108 |
| 1002 | 3300006358 | Ga0068871_101187381 | Ga0068871_1011873811 | 108 |
| 1003 | 3300006871 | Ga0075434_101171273 | Ga0075434_1011712731 | 108 |
| 1004 | 3300009176 | Ga0105242_12246589 | Ga0105242_122465891 | 108 |
| 1005 | 3300009553 | Ga0105249_10997775 | Ga0105249_109977752 | 108 |
| 1006 | 3300013297 | Ga0157378_10151173 | Ga0157378_101511731 | 108 |
| 1007 | 3300025981 | Ga0207640_11795081 | Ga0207640_117950811 | 108 |
| 1008 | 3300026116 | Ga0207674_10237708 | Ga0207674_102377082 | 108 |
| 1009 | 3300050512 | nmdc:mga0n895_911130_c1 | nmdc:mga0n895_911130_c1_65_412 | 108 |
| 1010 | 3300005331 | Ga0070670_101101227 | Ga0070670_1011012271 | 109 |
| 1011 | 3300005336 | Ga0070680_100958779 | Ga0070680_1009587792 | 109 |
| 1012 | 3300005340 | Ga0070689_101278567 | Ga0070689_1012785671 | 109 |
| 1013 | 3300005539 | Ga0068853_100010717 | Ga0068853_1000107172 | 109 |
| 1014 | 3300009553 | Ga0105249_10620684 | Ga0105249_106206842 | 109 |
| 1015 | 3300026041 | Ga0207639_10007423 | Ga0207639_100074232 | 109 |
| 1016 | 3300049514 | Ga0501291_044826 | Ga0501291_044826_27_359 | 109 |
| 1017 | 3300005616 | Ga0068852_101703159 | Ga0068852_1017031591 | 110 |
| 1018 | 3300053156 | Ga0500622_0001989 | Ga0500622_0001989_11695_12027 | 110 |
| 1019 | 3300053730 | Ga0500645_009288 | Ga0500645_009288_2668_3000 | 110 |
| 1020 | 3300055283 | Ga0500661_001406 | Ga0500661_001406_1321_1653 | 110 |
| 1021 | 3300005616 | Ga0068852_101898050 | Ga0068852_1018980501 | 111 |
| 1022 | 3300009098 | Ga0105245_11105189 | Ga0105245_111051892 | 111 |
| 1023 | 3300013296 | Ga0157374_10567574 | Ga0157374_105675742 | 111 |
| 1024 | 3300031251 | Ga0265327_10015792 | Ga0265327_100157923 | 111 |
| 1025 | 3300039437 | Ga0436365_1917912 | Ga0436365_1917912_3425_3760 | 111 |
| 1026 | 3300041486 | Ga0451807_1125245 | Ga0451807_1125245_548_883 | 111 |
| 1027 | 3300049570 | Ga0501033_0018072 | Ga0501033_0018072_4405_4740 | 111 |
| 1028 | 3300049571 | Ga0501034_0005034 | Ga0501034_0005034_13424_13759 | 111 |
| 1029 | 3300049590 | Ga0501074_1076566 | Ga0501074_1076566_33_368 | 111 |
| 1030 | 3300049742 | Ga0501080_0301267 | Ga0501080_0301267_765_1100 | 111 |
| 1031 | 3300049742 | Ga0501080_0491848 | Ga0501080_0491848_612_947 | 111 |
| 1032 | 3300053098 | Ga0500650_0466189 | Ga0500650_0466189_64_399 | 111 |
| 1033 | 3300005327 | Ga0070658_10459066 | Ga0070658_104590661 | 112 |
| 1034 | 3300005366 | Ga0070659_101137156 | Ga0070659_1011371562 | 112 |
| 1035 | 3300013104 | Ga0157370_11847793 | Ga0157370_118477931 | 112 |
| 1036 | 3300020078 | Ga0206352_10819092 | Ga0206352_108190922 | 112 |
| 1037 | 3300026121 | Ga0207683_11878587 | Ga0207683_118785871 | 112 |
| 1038 | 3300037312 | Ga0395899_0189212 | Ga0395899_0189212_576_923 | 112 |
| 1039 | 3300037418 | Ga0395900_0232969 | Ga0395900_0232969_278_625 | 112 |
| 1040 | 3300044842 | Ga0466957_0391781 | Ga0466957_0391781_228_575 | 112 |
| 1041 | 3300005834 | Ga0068851_10772991 | Ga0068851_107729911 | 114 |
| 1042 | 3300005843 | Ga0068860_101590741 | Ga0068860_1015907411 | 114 |
| 1043 | 3300014969 | Ga0157376_11151127 | Ga0157376_111511271 | 114 |
| 1044 | 3300028381 | Ga0268264_10798299 | Ga0268264_107982992 | 114 |
| 1045 | 3300002077 | JGI24744J21845_10004710 | JGI24744J21845_100047103 | 115 |
| 1046 | 3300005459 | Ga0068867_100133475 | Ga0068867_1001334753 | 115 |
| 1047 | 3300013104 | Ga0157370_10008665 | Ga0157370_100086654 | 115 |
| 1048 | 3300013306 | Ga0163162_10012546 | Ga0163162_100125461 | 115 |
| 1049 | 3300026089 | Ga0207648_10066109 | Ga0207648_100661092 | 115 |
| 1050 | 3300041460 | Ga0451802_0225735 | Ga0451802_0225735_19_369 | 115 |
| 1051 | 3300049571 | Ga0501034_0000007 | Ga0501034_0000007_36782_37132 | 115 |
| 1052 | 3300046616 | Ga0495668_0000114 | Ga0495668_0000114_35836_36186 | 116 |
| 1053 | 3300002067 | JGI24735J21928_10120710 | JGI24735J21928_101207101 | 117 |
| 1054 | 3300004799 | Ga0058863_11581661 | Ga0058863_115816611 | 117 |
| 1055 | 3300004803 | Ga0058862_12659472 | Ga0058862_126594722 | 117 |
| 1056 | 3300005327 | Ga0070658_10012624 | Ga0070658_100126244 | 117 |
| 1057 | 3300005327 | Ga0070658_10029509 | Ga0070658_100295095 | 117 |
| 1058 | 3300005327 | Ga0070658_10126103 | Ga0070658_101261032 | 117 |
| 1059 | 3300005327 | Ga0070658_10229184 | Ga0070658_102291841 | 117 |
| 1060 | 3300005327 | Ga0070658_10550401 | Ga0070658_105504012 | 117 |
| 1061 | 3300005327 | Ga0070658_10915549 | Ga0070658_109155492 | 117 |
| 1062 | 3300005328 | Ga0070676_11246259 | Ga0070676_112462591 | 117 |
| 1063 | 3300005329 | Ga0070683_101209375 | Ga0070683_1012093751 | 117 |
| 1064 | 3300005329 | Ga0070683_101643660 | Ga0070683_1016436601 | 117 |
| 1065 | 3300005331 | Ga0070670_100040999 | Ga0070670_1000409993 | 117 |
| 1066 | 3300005334 | Ga0068869_100011329 | Ga0068869_10001132910 | 117 |
| 1067 | 3300005334 | Ga0068869_100810229 | Ga0068869_1008102291 | 117 |
| 1068 | 3300005336 | Ga0070680_100020264 | Ga0070680_1000202644 | 117 |
| 1069 | 3300005336 | Ga0070680_100075158 | Ga0070680_1000751582 | 117 |
| 1070 | 3300005336 | Ga0070680_100784742 | Ga0070680_1007847422 | 117 |
| 1071 | 3300005337 | Ga0070682_100012263 | Ga0070682_1000122632 | 117 |
| 1072 | 3300005337 | Ga0070682_100485120 | Ga0070682_1004851201 | 117 |
| 1073 | 3300005339 | Ga0070660_100055941 | Ga0070660_1000559415 | 117 |
| 1074 | 3300005339 | Ga0070660_100106511 | Ga0070660_1001065112 | 117 |
| 1075 | 3300005339 | Ga0070660_100164804 | Ga0070660_1001648042 | 117 |
| 1076 | 3300005339 | Ga0070660_100167402 | Ga0070660_1001674022 | 117 |
| 1077 | 3300005339 | Ga0070660_100341239 | Ga0070660_1003412391 | 117 |
| 1078 | 3300005339 | Ga0070660_101716378 | Ga0070660_1017163781 | 117 |
| 1079 | 3300005344 | Ga0070661_101338823 | Ga0070661_1013388231 | 117 |
| 1080 | 3300005345 | Ga0070692_10070014 | Ga0070692_100700141 | 117 |
| 1081 | 3300005355 | Ga0070671_101554485 | Ga0070671_1015544851 | 117 |
| 1082 | 3300005366 | Ga0070659_100007055 | Ga0070659_1000070555 | 117 |
| 1083 | 3300005366 | Ga0070659_100029021 | Ga0070659_1000290213 | 117 |
| 1084 | 3300005366 | Ga0070659_100064481 | Ga0070659_1000644815 | 117 |
| 1085 | 3300005367 | Ga0070667_100035482 | Ga0070667_1000354823 | 117 |
| 1086 | 3300005455 | Ga0070663_100012531 | Ga0070663_1000125316 | 117 |
| 1087 | 3300005458 | Ga0070681_10051236 | Ga0070681_100512361 | 117 |
| 1088 | 3300005458 | Ga0070681_10061709 | Ga0070681_100617096 | 117 |
| 1089 | 3300005458 | Ga0070681_10116108 | Ga0070681_101161082 | 117 |
| 1090 | 3300005458 | Ga0070681_10211758 | Ga0070681_102117582 | 117 |
| 1091 | 3300005458 | Ga0070681_10865798 | Ga0070681_108657982 | 117 |
| 1092 | 3300005459 | Ga0068867_101983939 | Ga0068867_1019839391 | 117 |
| 1093 | 3300005530 | Ga0070679_100005664 | Ga0070679_1000056642 | 117 |
| 1094 | 3300005530 | Ga0070679_100010208 | Ga0070679_1000102088 | 117 |
| 1095 | 3300005530 | Ga0070679_100011076 | Ga0070679_1000110762 | 117 |
| 1096 | 3300005530 | Ga0070679_100349398 | Ga0070679_1003493982 | 117 |
| 1097 | 3300005530 | Ga0070679_102080695 | Ga0070679_1020806951 | 117 |
| 1098 | 3300005535 | Ga0070684_100390623 | Ga0070684_1003906232 | 117 |
| 1099 | 3300005535 | Ga0070684_100472027 | Ga0070684_1004720272 | 117 |
| 1100 | 3300005535 | Ga0070684_100767332 | Ga0070684_1007673322 | 117 |
| 1101 | 3300005535 | Ga0070684_101349609 | Ga0070684_1013496091 | 117 |
| 1102 | 3300005539 | Ga0068853_100016724 | Ga0068853_1000167244 | 117 |
| 1103 | 3300005539 | Ga0068853_100062299 | Ga0068853_1000622993 | 117 |
| 1104 | 3300005539 | Ga0068853_100447405 | Ga0068853_1004474051 | 117 |
| 1105 | 3300005539 | Ga0068853_100462983 | Ga0068853_1004629831 | 117 |
| 1106 | 3300005539 | Ga0068853_101491640 | Ga0068853_1014916401 | 117 |
| 1107 | 3300005563 | Ga0068855_100008676 | Ga0068855_10000867611 | 117 |
| 1108 | 3300005563 | Ga0068855_100013610 | Ga0068855_10001361016 | 117 |
| 1109 | 3300005563 | Ga0068855_100033717 | Ga0068855_1000337174 | 117 |
| 1110 | 3300005563 | Ga0068855_100433331 | Ga0068855_1004333311 | 117 |
| 1111 | 3300005563 | Ga0068855_100895013 | Ga0068855_1008950132 | 117 |
| 1112 | 3300005563 | Ga0068855_101002585 | Ga0068855_1010025852 | 117 |
| 1113 | 3300005563 | Ga0068855_101014320 | Ga0068855_1010143202 | 117 |
| 1114 | 3300005563 | Ga0068855_102346774 | Ga0068855_1023467742 | 117 |
| 1115 | 3300005564 | Ga0070664_100907853 | Ga0070664_1009078531 | 117 |
| 1116 | 3300005577 | Ga0068857_100328705 | Ga0068857_1003287051 | 117 |
| 1117 | 3300005577 | Ga0068857_100400512 | Ga0068857_1004005122 | 117 |
| 1118 | 3300005578 | Ga0068854_100139820 | Ga0068854_1001398203 | 117 |
| 1119 | 3300005578 | Ga0068854_101101763 | Ga0068854_1011017632 | 117 |
| 1120 | 3300005578 | Ga0068854_102136890 | Ga0068854_1021368901 | 117 |
| 1121 | 3300005614 | Ga0068856_100254908 | Ga0068856_1002549083 | 117 |
| 1122 | 3300005614 | Ga0068856_100446120 | Ga0068856_1004461202 | 117 |
| 1123 | 3300005614 | Ga0068856_101871833 | Ga0068856_1018718332 | 117 |
| 1124 | 3300005615 | Ga0070702_100234415 | Ga0070702_1002344151 | 117 |
| 1125 | 3300005616 | Ga0068852_100000454 | Ga0068852_10000045413 | 117 |
| 1126 | 3300005616 | Ga0068852_100028526 | Ga0068852_1000285265 | 117 |
| 1127 | 3300005616 | Ga0068852_100045652 | Ga0068852_1000456523 | 117 |
| 1128 | 3300005616 | Ga0068852_100447777 | Ga0068852_1004477772 | 117 |
| 1129 | 3300005617 | Ga0068859_100039683 | Ga0068859_1000396833 | 117 |
| 1130 | 3300005618 | Ga0068864_100082813 | Ga0068864_1000828133 | 117 |
| 1131 | 3300005718 | Ga0068866_10079389 | Ga0068866_100793892 | 117 |
| 1132 | 3300005719 | Ga0068861_100161242 | Ga0068861_1001612422 | 117 |
| 1133 | 3300005719 | Ga0068861_100841951 | Ga0068861_1008419511 | 117 |
| 1134 | 3300005840 | Ga0068870_10159345 | Ga0068870_101593452 | 117 |
| 1135 | 3300005841 | Ga0068863_100630713 | Ga0068863_1006307133 | 117 |
| 1136 | 3300005842 | Ga0068858_101602774 | Ga0068858_1016027741 | 117 |
| 1137 | 3300005843 | Ga0068860_100097098 | Ga0068860_1000970984 | 117 |
| 1138 | 3300005843 | Ga0068860_100189317 | Ga0068860_1001893172 | 117 |
| 1139 | 3300005844 | Ga0068862_100011150 | Ga0068862_1000111507 | 117 |
| 1140 | 3300006881 | Ga0068865_100305863 | Ga0068865_1003058632 | 117 |
| 1141 | 3300006931 | Ga0097620_100039681 | Ga0097620_1000396813 | 117 |
| 1142 | 3300009093 | Ga0105240_10152474 | Ga0105240_101524742 | 117 |
| 1143 | 3300009093 | Ga0105240_10850041 | Ga0105240_108500411 | 117 |
| 1144 | 3300009174 | Ga0105241_10004448 | Ga0105241_100044485 | 117 |
| 1145 | 3300009174 | Ga0105241_11387541 | Ga0105241_113875412 | 117 |
| 1146 | 3300009174 | Ga0105241_11454418 | Ga0105241_114544181 | 117 |
| 1147 | 3300009545 | Ga0105237_10465390 | Ga0105237_104653901 | 117 |
| 1148 | 3300009553 | Ga0105249_10406175 | Ga0105249_104061752 | 117 |
| 1149 | 3300009553 | Ga0105249_10935094 | Ga0105249_109350941 | 117 |
| 1150 | 3300010375 | Ga0105239_10073188 | Ga0105239_100731882 | 117 |
| 1151 | 3300010375 | Ga0105239_12981080 | Ga0105239_129810801 | 117 |
| 1152 | 3300011119 | Ga0105246_10209132 | Ga0105246_102091322 | 117 |
| 1153 | 3300013100 | Ga0157373_10000592 | Ga0157373_1000059219 | 117 |
| 1154 | 3300013100 | Ga0157373_10021014 | Ga0157373_100210143 | 117 |
| 1155 | 3300013100 | Ga0157373_10028988 | Ga0157373_100289883 | 117 |
| 1156 | 3300013100 | Ga0157373_10038167 | Ga0157373_100381674 | 117 |
| 1157 | 3300013100 | Ga0157373_10985261 | Ga0157373_109852611 | 117 |
| 1158 | 3300013102 | Ga0157371_10003403 | Ga0157371_100034032 | 117 |
| 1159 | 3300013102 | Ga0157371_10004188 | Ga0157371_100041888 | 117 |
| 1160 | 3300013102 | Ga0157371_10014159 | Ga0157371_100141592 | 117 |
| 1161 | 3300013102 | Ga0157371_10015346 | Ga0157371_100153464 | 117 |
| 1162 | 3300013102 | Ga0157371_10050178 | Ga0157371_100501782 | 117 |
| 1163 | 3300013102 | Ga0157371_10064214 | Ga0157371_100642142 | 117 |
| 1164 | 3300013102 | Ga0157371_10127238 | Ga0157371_101272381 | 117 |
| 1165 | 3300013102 | Ga0157371_10181644 | Ga0157371_101816442 | 117 |
| 1166 | 3300013102 | Ga0157371_10274888 | Ga0157371_102748882 | 117 |
| 1167 | 3300013102 | Ga0157371_10283163 | Ga0157371_102831631 | 117 |
| 1168 | 3300013104 | Ga0157370_10002668 | Ga0157370_100026687 | 117 |
| 1169 | 3300013104 | Ga0157370_10006362 | Ga0157370_100063628 | 117 |
| 1170 | 3300013104 | Ga0157370_10008795 | Ga0157370_100087955 | 117 |
| 1171 | 3300013104 | Ga0157370_10186464 | Ga0157370_101864642 | 117 |
| 1172 | 3300013104 | Ga0157370_11114771 | Ga0157370_111147712 | 117 |
| 1173 | 3300013104 | Ga0157370_11736182 | Ga0157370_117361821 | 117 |
| 1174 | 3300013104 | Ga0157370_11747254 | Ga0157370_117472541 | 117 |
| 1175 | 3300013105 | Ga0157369_10004162 | Ga0157369_100041622 | 117 |
| 1176 | 3300013105 | Ga0157369_10009198 | Ga0157369_1000919812 | 117 |
| 1177 | 3300013105 | Ga0157369_10019866 | Ga0157369_100198662 | 117 |
| 1178 | 3300013105 | Ga0157369_10064958 | Ga0157369_100649583 | 117 |
| 1179 | 3300013105 | Ga0157369_10398377 | Ga0157369_103983773 | 117 |
| 1180 | 3300013105 | Ga0157369_10529562 | Ga0157369_105295622 | 117 |
| 1181 | 3300013296 | Ga0157374_10259932 | Ga0157374_102599322 | 117 |
| 1182 | 3300013296 | Ga0157374_11647093 | Ga0157374_116470932 | 117 |
| 1183 | 3300013297 | Ga0157378_10237073 | Ga0157378_102370732 | 117 |
| 1184 | 3300013297 | Ga0157378_10553446 | Ga0157378_105534462 | 117 |
| 1185 | 3300013297 | Ga0157378_10756599 | Ga0157378_107565992 | 117 |
| 1186 | 3300013297 | Ga0157378_11252948 | Ga0157378_112529481 | 117 |
| 1187 | 3300013297 | Ga0157378_11468733 | Ga0157378_114687332 | 117 |
| 1188 | 3300013306 | Ga0163162_10474200 | Ga0163162_104742002 | 117 |
| 1189 | 3300013307 | Ga0157372_10009464 | Ga0157372_1000946411 | 117 |
| 1190 | 3300013307 | Ga0157372_10023397 | Ga0157372_100233975 | 117 |
| 1191 | 3300013307 | Ga0157372_10025178 | Ga0157372_100251788 | 117 |
| 1192 | 3300013307 | Ga0157372_10032959 | Ga0157372_100329598 | 117 |
| 1193 | 3300013307 | Ga0157372_10049169 | Ga0157372_100491694 | 117 |
| 1194 | 3300013307 | Ga0157372_10124997 | Ga0157372_101249974 | 117 |
| 1195 | 3300013307 | Ga0157372_10172006 | Ga0157372_101720062 | 117 |
| 1196 | 3300013307 | Ga0157372_10530484 | Ga0157372_105304842 | 117 |
| 1197 | 3300013307 | Ga0157372_10601330 | Ga0157372_106013303 | 117 |
| 1198 | 3300013307 | Ga0157372_10784638 | Ga0157372_107846381 | 117 |
| 1199 | 3300013307 | Ga0157372_11174214 | Ga0157372_111742142 | 117 |
| 1200 | 3300013307 | Ga0157372_11895544 | Ga0157372_118955441 | 117 |
| 1201 | 3300013307 | Ga0157372_12513893 | Ga0157372_125138931 | 117 |
| 1202 | 3300014326 | Ga0157380_12181888 | Ga0157380_121818881 | 117 |
| 1203 | 3300014745 | Ga0157377_10864936 | Ga0157377_108649361 | 117 |
| 1204 | 3300014969 | Ga0157376_12655559 | Ga0157376_126555591 | 117 |
| 1205 | 3300020070 | Ga0206356_10994341 | Ga0206356_109943411 | 117 |
| 1206 | 3300020070 | Ga0206356_11687923 | Ga0206356_116879231 | 117 |
| 1207 | 3300020075 | Ga0206349_1377899 | Ga0206349_13778991 | 117 |
| 1208 | 3300020077 | Ga0206351_10974334 | Ga0206351_109743341 | 117 |
| 1209 | 3300020080 | Ga0206350_10633921 | Ga0206350_106339211 | 117 |
| 1210 | 3300020080 | Ga0206350_11141334 | Ga0206350_111413342 | 117 |
| 1211 | 3300020080 | Ga0206350_11624967 | Ga0206350_116249671 | 117 |
| 1212 | 3300020080 | Ga0206350_11654957 | Ga0206350_116549571 | 117 |
| 1213 | 3300020081 | Ga0206354_10173907 | Ga0206354_101739071 | 117 |
| 1214 | 3300020082 | Ga0206353_11167834 | Ga0206353_111678342 | 117 |
| 1215 | 3300020082 | Ga0206353_11715051 | Ga0206353_117150511 | 117 |
| 1216 | 3300022467 | Ga0224712_10545855 | Ga0224712_105458551 | 117 |
| 1217 | 3300025899 | Ga0207642_10004344 | Ga0207642_100043442 | 117 |
| 1218 | 3300025904 | Ga0207647_10056774 | Ga0207647_100567742 | 117 |
| 1219 | 3300025907 | Ga0207645_11000735 | Ga0207645_110007351 | 117 |
| 1220 | 3300025908 | Ga0207643_10164151 | Ga0207643_101641512 | 117 |
| 1221 | 3300025909 | Ga0207705_10009398 | Ga0207705_100093987 | 117 |
| 1222 | 3300025909 | Ga0207705_10026600 | Ga0207705_100266004 | 117 |
| 1223 | 3300025909 | Ga0207705_10048712 | Ga0207705_100487125 | 117 |
| 1224 | 3300025909 | Ga0207705_10208676 | Ga0207705_102086762 | 117 |
| 1225 | 3300025909 | Ga0207705_10209406 | Ga0207705_102094062 | 117 |
| 1226 | 3300025909 | Ga0207705_10283595 | Ga0207705_102835952 | 117 |
| 1227 | 3300025909 | Ga0207705_10295685 | Ga0207705_102956852 | 117 |
| 1228 | 3300025911 | Ga0207654_10373832 | Ga0207654_103738322 | 117 |
| 1229 | 3300025912 | Ga0207707_10124335 | Ga0207707_101243352 | 117 |
| 1230 | 3300025912 | Ga0207707_10188789 | Ga0207707_101887893 | 117 |
| 1231 | 3300025912 | Ga0207707_10324338 | Ga0207707_103243382 | 117 |
| 1232 | 3300025912 | Ga0207707_10535864 | Ga0207707_105358642 | 117 |
| 1233 | 3300025913 | Ga0207695_10082168 | Ga0207695_100821685 | 117 |
| 1234 | 3300025913 | Ga0207695_10311100 | Ga0207695_103111002 | 117 |
| 1235 | 3300025914 | Ga0207671_11330761 | Ga0207671_113307611 | 117 |
| 1236 | 3300025917 | Ga0207660_10007763 | Ga0207660_100077635 | 117 |
| 1237 | 3300025917 | Ga0207660_10029630 | Ga0207660_100296305 | 117 |
| 1238 | 3300025917 | Ga0207660_10098800 | Ga0207660_100988002 | 117 |
| 1239 | 3300025917 | Ga0207660_11344277 | Ga0207660_113442771 | 117 |
| 1240 | 3300025919 | Ga0207657_10005870 | Ga0207657_100058705 | 117 |
| 1241 | 3300025919 | Ga0207657_10017331 | Ga0207657_100173319 | 117 |
| 1242 | 3300025919 | Ga0207657_10057007 | Ga0207657_100570073 | 117 |
| 1243 | 3300025919 | Ga0207657_10081676 | Ga0207657_100816763 | 117 |
| 1244 | 3300025919 | Ga0207657_10089484 | Ga0207657_100894843 | 117 |
| 1245 | 3300025919 | Ga0207657_10215296 | Ga0207657_102152962 | 117 |
| 1246 | 3300025921 | Ga0207652_10000010 | Ga0207652_1000001030 | 117 |
| 1247 | 3300025921 | Ga0207652_10000844 | Ga0207652_100008444 | 117 |
| 1248 | 3300025921 | Ga0207652_10007238 | Ga0207652_100072389 | 117 |
| 1249 | 3300025921 | Ga0207652_10021217 | Ga0207652_100212175 | 117 |
| 1250 | 3300025921 | Ga0207652_10032135 | Ga0207652_100321356 | 117 |
| 1251 | 3300025921 | Ga0207652_10059056 | Ga0207652_100590562 | 117 |
| 1252 | 3300025921 | Ga0207652_11649498 | Ga0207652_116494981 | 117 |
| 1253 | 3300025925 | Ga0207650_10459239 | Ga0207650_104592392 | 117 |
| 1254 | 3300025925 | Ga0207650_10762865 | Ga0207650_107628651 | 117 |
| 1255 | 3300025932 | Ga0207690_10006232 | Ga0207690_100062324 | 117 |
| 1256 | 3300025932 | Ga0207690_10023922 | Ga0207690_100239222 | 117 |
| 1257 | 3300025932 | Ga0207690_10072678 | Ga0207690_100726782 | 117 |
| 1258 | 3300025938 | Ga0207704_10246611 | Ga0207704_102466112 | 117 |
| 1259 | 3300025938 | Ga0207704_11682442 | Ga0207704_116824422 | 117 |
| 1260 | 3300025942 | Ga0207689_10015923 | Ga0207689_100159239 | 117 |
| 1261 | 3300025944 | Ga0207661_10568366 | Ga0207661_105683662 | 117 |
| 1262 | 3300025945 | Ga0207679_11269232 | Ga0207679_112692321 | 117 |
| 1263 | 3300025949 | Ga0207667_10084321 | Ga0207667_100843212 | 117 |
| 1264 | 3300025949 | Ga0207667_10084964 | Ga0207667_100849642 | 117 |
| 1265 | 3300025949 | Ga0207667_10530279 | Ga0207667_105302792 | 117 |
| 1266 | 3300025949 | Ga0207667_10680425 | Ga0207667_106804252 | 117 |
| 1267 | 3300025949 | Ga0207667_10841888 | Ga0207667_108418882 | 117 |
| 1268 | 3300025949 | Ga0207667_11694124 | Ga0207667_116941241 | 117 |
| 1269 | 3300025949 | Ga0207667_11931420 | Ga0207667_119314202 | 117 |
| 1270 | 3300025961 | Ga0207712_10463209 | Ga0207712_104632092 | 117 |
| 1271 | 3300025972 | Ga0207668_10790971 | Ga0207668_107909711 | 117 |
| 1272 | 3300025981 | Ga0207640_10192788 | Ga0207640_101927883 | 117 |
| 1273 | 3300025981 | Ga0207640_10971783 | Ga0207640_109717831 | 117 |
| 1274 | 3300025981 | Ga0207640_11023323 | Ga0207640_110233231 | 117 |
| 1275 | 3300025986 | Ga0207658_10094559 | Ga0207658_100945592 | 117 |
| 1276 | 3300026023 | Ga0207677_10267386 | Ga0207677_102673861 | 117 |
| 1277 | 3300026023 | Ga0207677_11092251 | Ga0207677_110922511 | 117 |
| 1278 | 3300026023 | Ga0207677_11427023 | Ga0207677_114270231 | 117 |
| 1279 | 3300026023 | Ga0207677_11558332 | Ga0207677_115583321 | 117 |
| 1280 | 3300026041 | Ga0207639_10143068 | Ga0207639_101430683 | 117 |
| 1281 | 3300026041 | Ga0207639_10336625 | Ga0207639_103366251 | 117 |
| 1282 | 3300026041 | Ga0207639_10985363 | Ga0207639_109853631 | 117 |
| 1283 | 3300026067 | Ga0207678_10009599 | Ga0207678_100095997 | 117 |
| 1284 | 3300026067 | Ga0207678_11340383 | Ga0207678_113403831 | 117 |
| 1285 | 3300026078 | Ga0207702_10347041 | Ga0207702_103470412 | 117 |
| 1286 | 3300026078 | Ga0207702_11978408 | Ga0207702_119784081 | 117 |
| 1287 | 3300026088 | Ga0207641_10696774 | Ga0207641_106967742 | 117 |
| 1288 | 3300026089 | Ga0207648_10060090 | Ga0207648_100600904 | 117 |
| 1289 | 3300026089 | Ga0207648_10221880 | Ga0207648_102218801 | 117 |
| 1290 | 3300026095 | Ga0207676_10299654 | Ga0207676_102996542 | 117 |
| 1291 | 3300026116 | Ga0207674_10106006 | Ga0207674_101060064 | 117 |
| 1292 | 3300026116 | Ga0207674_10245214 | Ga0207674_102452143 | 117 |
| 1293 | 3300026116 | Ga0207674_11329563 | Ga0207674_113295631 | 117 |
| 1294 | 3300026116 | Ga0207674_11826505 | Ga0207674_118265051 | 117 |
| 1295 | 3300026118 | Ga0207675_100235580 | Ga0207675_1002355803 | 117 |
| 1296 | 3300026118 | Ga0207675_101781796 | Ga0207675_1017817961 | 117 |
| 1297 | 3300026118 | Ga0207675_102278564 | Ga0207675_1022785641 | 117 |
| 1298 | 3300026142 | Ga0207698_10003198 | Ga0207698_100031988 | 117 |
| 1299 | 3300026142 | Ga0207698_10012551 | Ga0207698_100125516 | 117 |
| 1300 | 3300026142 | Ga0207698_10421632 | Ga0207698_104216321 | 117 |
| 1301 | 3300026142 | Ga0207698_10687150 | Ga0207698_106871502 | 117 |
| 1302 | 3300026142 | Ga0207698_11827991 | Ga0207698_118279911 | 117 |
| 1303 | 3300028380 | Ga0268265_10061107 | Ga0268265_100611073 | 117 |
| 1304 | 3300028381 | Ga0268264_10001295 | Ga0268264_100012953 | 117 |
| 1305 | 3300028381 | Ga0268264_10038507 | Ga0268264_100385075 | 117 |
| 1306 | 3300037312 | Ga0395899_0000248 | Ga0395899_0000248_20186_20539 | 117 |
| 1307 | 3300037312 | Ga0395899_0014814 | Ga0395899_0014814_3765_4118 | 117 |
| 1308 | 3300037312 | Ga0395899_0043261 | Ga0395899_0043261_2996_3349 | 117 |
| 1309 | 3300037312 | Ga0395899_0118039 | Ga0395899_0118039_53_406 | 117 |
| 1310 | 3300037312 | Ga0395899_0206187 | Ga0395899_0206187_382_735 | 117 |
| 1311 | 3300037312 | Ga0395899_0245842 | Ga0395899_0245842_605_958 | 117 |
| 1312 | 3300037418 | Ga0395900_0005223 | Ga0395900_0005223_9267_9620 | 117 |
| 1313 | 3300037418 | Ga0395900_0015001 | Ga0395900_0015001_4108_4461 | 117 |
| 1314 | 3300037418 | Ga0395900_0041998 | Ga0395900_0041998_2701_3054 | 117 |
| 1315 | 3300037418 | Ga0395900_0138186 | Ga0395900_0138186_607_960 | 117 |
| 1316 | 3300037418 | Ga0395900_0159137 | Ga0395900_0159137_438_791 | 117 |
| 1317 | 3300037418 | Ga0395900_0434999 | Ga0395900_0434999_699_1052 | 117 |
| 1318 | 3300037418 | Ga0395900_0978770 | Ga0395900_0978770_147_500 | 117 |
| 1319 | 3300037466 | Ga0395898_0003603 | Ga0395898_0003603_8405_8758 | 117 |
| 1320 | 3300037466 | Ga0395898_0043780 | Ga0395898_0043780_2377_2730 | 117 |
| 1321 | 3300037466 | Ga0395898_0179806 | Ga0395898_0179806_152_505 | 117 |
| 1322 | 3300037466 | Ga0395898_0416002 | Ga0395898_0416002_23_376 | 117 |
| 1323 | 3300037466 | Ga0395898_0519908 | Ga0395898_0519908_574_927 | 117 |
| 1324 | 3300037466 | Ga0395898_0555286 | Ga0395898_0555286_537_890 | 117 |
| 1325 | 3300037471 | Ga0395905_0615760 | Ga0395905_0615760_577_930 | 117 |
| 1326 | 3300037471 | Ga0395905_1230702 | Ga0395905_1230702_100_453 | 117 |
| 1327 | 3300037471 | Ga0395905_1594571 | Ga0395905_1594571_59_412 | 117 |
| 1328 | 3300038443 | Ga0395901_0002328 | Ga0395901_0002328_18959_19312 | 117 |
| 1329 | 3300038443 | Ga0395901_0007090 | Ga0395901_0007090_8766_9119 | 117 |
| 1330 | 3300038443 | Ga0395901_0039606 | Ga0395901_0039606_4254_4607 | 117 |
| 1331 | 3300038443 | Ga0395901_0064162 | Ga0395901_0064162_548_901 | 117 |
| 1332 | 3300038443 | Ga0395901_0089136 | Ga0395901_0089136_2089_2442 | 117 |
| 1333 | 3300038443 | Ga0395901_0324917 | Ga0395901_0324917_887_1240 | 117 |
| 1334 | 3300038443 | Ga0395901_0730800 | Ga0395901_0730800_513_866 | 117 |
| 1335 | 3300041444 | Ga0451790_10861 | Ga0451790_10861_10_369 | 117 |
| 1336 | 3300041509 | Ga0451843_0946552 | Ga0451843_0946552_353_706 | 117 |
| 1337 | 3300049568 | Ga0501031_0225837 | Ga0501031_0225837_236_589 | 117 |
| 1338 | 3300049568 | Ga0501031_1119795 | Ga0501031_1119795_57_410 | 117 |
| 1339 | 3300049569 | Ga0501032_0269697 | Ga0501032_0269697_720_1073 | 117 |
| 1340 | 3300049570 | Ga0501033_0506976 | Ga0501033_0506976_383_736 | 117 |
| 1341 | 3300049571 | Ga0501034_0040596 | Ga0501034_0040596_3554_3907 | 117 |
| 1342 | 3300049571 | Ga0501034_0057802 | Ga0501034_0057802_2156_2509 | 117 |
| 1343 | 3300049574 | Ga0501038_0783293 | Ga0501038_0783293_236_589 | 117 |
| 1344 | 3300049586 | Ga0501070_0080956 | Ga0501070_0080956_122_475 | 117 |
| 1345 | 3300049822 | Ga0501035_0012875 | Ga0501035_0012875_591_944 | 117 |
| 1346 | 3300049822 | Ga0501035_1155202 | Ga0501035_1155202_102_455 | 117 |
| 1347 | 3300049823 | Ga0501044_0602278 | Ga0501044_0602278_224_577 | 117 |
| 1348 | 3300053153 | Ga0500616_0120548 | Ga0500616_0120548_710_1063 | 117 |
| 1349 | 3300059490 | Ga0587066_192175 | Ga0587066_192175_18_371 | 117 |
| 1350 | 3300059503 | Ga0587080_162991 | Ga0587080_162991_155_508 | 117 |
| 1351 | 3300059626 | Ga0587115_097623 | Ga0587115_097623_143_496 | 117 |
| 1352 | 3300059640 | Ga0587067_185738 | Ga0587067_185738_51_404 | 117 |
| 1353 | 3300059642 | Ga0587069_091107 | Ga0587069_091107_39_392 | 117 |
| 1354 | 3300059647 | Ga0587079_097162 | Ga0587079_097162_143_496 | 117 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9742 | 45 | 100 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9464 | 43 | 100 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9348 | 44 | 102 |
| 7rhe-assembly1.cif.gz_A-2 | crystal structure of rok family protein from burkholderia vietnamiensis g4 | 0.9326 | 45 | 104 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.926 | 29 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9788 | 42 | 99 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9742 | 45 | 100 | 1.10.10.10 |
| 1saxB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.947 | 42 | 100 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9464 | 43 | 100 | 1.10.10.10 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9402 | 26 | 111 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I5Z3L0-F1-model_v4 | Transcriptional regulator, ArsR family | 1.002 | 25 | 117 |
GO:0003700
GO:0005737 |
| AF-A0A5B8V8R0-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9975 | 25 | 117 |
GO:0003700
GO:0005737 |
| AF-A0A1V5GE74-F1-model_v4 | Transcriptional repressor SdpR | 0.9968 | 25 | 117 |
GO:0003700
GO:0005737 |
| AF-A0A832BRN3-F1-model_v4 | Transcriptional regulator | 0.9967 | 25 | 117 |
GO:0003700
GO:0005737 |
| AF-A0A4U3L8U0-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9956 | 25 | 117 |
GO:0003700
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar