F493238
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1351 | 495 | 2702 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100164763|Ga0068868_1001647634 |
| Length | 75 |
| Sequence | LGQVLVLERGPMSEFMSHYLVPAAIIAVAAVLVLGLINMMRGGSPNRSQKLMRLRVLFQFIAIIVIMATIWAMGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 12 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 13 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 14 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 24 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 25 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 26 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 30 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 151 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 152 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 153 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 154 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 155 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 156 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 157 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 158 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 159 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 160 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 161 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 162 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 163 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 175 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 182 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 270 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 274 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 275 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 276 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 278 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 279 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 280 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 281 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 282 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 283 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 284 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 286 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 287 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 288 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 289 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 290 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 291 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 292 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 293 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 294 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 295 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 297 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 299 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 301 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 303 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 304 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 307 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 308 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 310 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 311 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 312 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 313 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 314 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 315 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 316 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 317 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 320 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 325 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 326 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 329 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 330 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 331 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 334 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 335 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 336 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 341 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 342 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 343 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 344 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 345 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 346 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 347 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 348 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 349 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 350 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 351 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 352 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 353 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 354 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 423 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 424 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 425 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 426 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 427 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 428 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 431 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 432 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 433 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 434 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 435 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 436 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 472 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 488 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 489 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 490 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 491 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 495 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.93 |
| Metatranscriptomes | 0.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.26 |
| Nodule | 0 |
| Rhizoplane | 4.96 |
| Rhizosphere | 93.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068868_100164763 | 3300005338 | Bacteria | 1833 |
| 2 | 2214736895 | 2209111006 | Bacteria | 4011 |
| 3 | ARcpr5oldR_c000311 | 3300000041 | Bacteria | 7029 |
| 4 | ARcpr5oldR_c000840 | 3300000041 | Bacteria | 3448 |
| 5 | ARSoilYngRDRAFT_c00517 | 3300000042 | Bacteria | 4490 |
| 6 | ARcpr5yngRDRAFT_c000610 | 3300000043 | Bacteria | 4496 |
| 7 | ARSoilOldRDRAFT_c000709 | 3300000044 | Bacteria | 3455 |
| 8 | ARCol0oldRDRAFT_c00116 | 3300000045 | Bacteria | 6995 |
| 9 | ARCol0yngRDRAFT_1000064 | 3300000652 | Bacteria | 19247 |
| 10 | JGI24032J14994_100183 | 3300001430 | Bacteria | 3195 |
| 11 | JGI24736J21556_1014667 | 3300001904 | Bacteria | 1261 |
| 12 | JGI24741J21665_1037267 | 3300001915 | Bacteria | 720 |
| 13 | JGI24752J21851_1026145 | 3300001976 | Bacteria | 766 |
| 14 | JGI24746J21847_1001338 | 3300001977 | Bacteria | 3928 |
| 15 | JGI24747J21853_1007734 | 3300001978 | Bacteria | 1038 |
| 16 | JGI24739J22299_10006224 | 3300001989 | Bacteria | 4508 |
| 17 | JGI24737J22298_10004778 | 3300001990 | Bacteria | 4705 |
| 18 | JGI24737J22298_10009245 | 3300001990 | Bacteria | 3285 |
| 19 | JGI24743J22301_10032837 | 3300001991 | Bacteria | 1026 |
| 20 | JGI24750J21931_1000306 | 3300002070 | Bacteria | 8424 |
| 21 | JGI24745J21846_1001741 | 3300002073 | Bacteria | 2143 |
| 22 | JGI24745J21846_1016728 | 3300002073 | Bacteria | 851 |
| 23 | JGI24738J21930_10000348 | 3300002075 | Bacteria | 12738 |
| 24 | JGI24749J21850_1006472 | 3300002076 | Bacteria | 1633 |
| 25 | JGI24749J21850_1011879 | 3300002076 | Bacteria | 1222 |
| 26 | JGI24744J21845_10008338 | 3300002077 | Bacteria | 2137 |
| 27 | JGI24035J26624_1002077 | 3300002126 | Bacteria | 1865 |
| 28 | JGI24033J26618_1011225 | 3300002155 | Bacteria | 1065 |
| 29 | JGI24034J26672_10001042 | 3300002239 | Bacteria | 3618 |
| 30 | JGI24034J26672_10034750 | 3300002239 | Bacteria | 832 |
| 31 | JGI24742J22300_10007045 | 3300002244 | Bacteria | 1853 |
| 32 | JGI24742J22300_10084154 | 3300002244 | Bacteria | 604 |
| 33 | Ga0055524_1007164 | 3300003775 | Bacteria | 4773 |
| 34 | JGI25405J52794_10007697 | 3300003911 | Bacteria | 1993 |
| 35 | JGI25405J52794_10009033 | 3300003911 | Bacteria | 1874 |
| 36 | Ga0065717_1004561 | 3300005276 | Bacteria | 1015 |
| 37 | Ga0065716_1000386 | 3300005277 | Bacteria | 1251 |
| 38 | Ga0065714_10358745 | 3300005288 | Bacteria | 627 |
| 39 | Ga0065704_10102914 | 3300005289 | Bacteria | 2189 |
| 40 | Ga0065712_10001837 | 3300005290 | Bacteria | 5553 |
| 41 | Ga0065712_10210982 | 3300005290 | Bacteria | 1073 |
| 42 | Ga0065712_10826253 | 3300005290 | Bacteria | 504 |
| 43 | Ga0065715_10002792 | 3300005293 | Bacteria | 8377 |
| 44 | Ga0065715_10011595 | 3300005293 | Bacteria | 2072 |
| 45 | Ga0065707_10116186 | 3300005295 | Bacteria | 2245 |
| 46 | Ga0065707_10187256 | 3300005295 | Bacteria | 1381 |
| 47 | Ga0070658_10022098 | 3300005327 | Bacteria | 5104 |
| 48 | Ga0070676_10000374 | 3300005328 | Bacteria | 20693 |
| 49 | Ga0070676_10135789 | 3300005328 | Bacteria | 1560 |
| 50 | Ga0070676_10405950 | 3300005328 | Bacteria | 949 |
| 51 | Ga0070683_100003823 | 3300005329 | Bacteria | 12306 |
| 52 | Ga0070683_100314271 | 3300005329 | Bacteria | 1491 |
| 53 | Ga0070683_100695158 | 3300005329 | Unclassified | 974 |
| 54 | Ga0070683_100700523 | 3300005329 | Bacteria | 970 |
| 55 | Ga0070683_101331083 | 3300005329 | Bacteria | 690 |
| 56 | Ga0070690_100133199 | 3300005330 | Bacteria | 1680 |
| 57 | Ga0070690_100228846 | 3300005330 | Bacteria | 1306 |
| 58 | Ga0070670_100055679 | 3300005331 | Bacteria | 3394 |
| 59 | Ga0070677_10000461 | 3300005333 | Bacteria | 13925 |
| 60 | Ga0068869_100001399 | 3300005334 | Bacteria | 14247 |
| 61 | Ga0070666_10014716 | 3300005335 | Bacteria | 4983 |
| 62 | Ga0070666_10041967 | 3300005335 | Bacteria | 3058 |
| 63 | Ga0070666_11047110 | 3300005335 | Bacteria | 606 |
| 64 | Ga0070680_100012044 | 3300005336 | Bacteria | 6711 |
| 65 | Ga0070680_100202372 | 3300005336 | Bacteria | 1675 |
| 66 | Ga0070680_100296175 | 3300005336 | Bacteria | 1371 |
| 67 | Ga0070680_100593257 | 3300005336 | Bacteria | 951 |
| 68 | Ga0070680_100897397 | 3300005336 | Bacteria | 765 |
| 69 | Ga0070682_100001646 | 3300005337 | Bacteria | 12408 |
| 70 | Ga0070682_100073361 | 3300005337 | Bacteria | 2195 |
| 71 | Ga0070682_100909994 | 3300005337 | Bacteria | 723 |
| 72 | Ga0070682_101633390 | 3300005337 | Bacteria | 558 |
| 73 | Ga0068868_100000857 | 3300005338 | Bacteria | 20647 |
| 74 | Ga0070660_100002034 | 3300005339 | Bacteria | 13952 |
| 75 | Ga0070660_100025298 | 3300005339 | Bacteria | 4411 |
| 76 | Ga0070660_100445567 | 3300005339 | Bacteria | 1074 |
| 77 | Ga0070660_101235811 | 3300005339 | Bacteria | 633 |
| 78 | Ga0070660_101322388 | 3300005339 | Bacteria | 612 |
| 79 | Ga0070689_100040860 | 3300005340 | Bacteria | 3557 |
| 80 | Ga0070689_100077743 | 3300005340 | Bacteria | 2601 |
| 81 | Ga0070691_10039715 | 3300005341 | Bacteria | 2223 |
| 82 | Ga0070691_10056343 | 3300005341 | Bacteria | 1884 |
| 83 | Ga0070687_100146638 | 3300005343 | Bacteria | 1380 |
| 84 | Ga0070687_100421442 | 3300005343 | Bacteria | 880 |
| 85 | Ga0070661_100002763 | 3300005344 | Bacteria | 12040 |
| 86 | Ga0070661_100063093 | 3300005344 | Bacteria | 2721 |
| 87 | Ga0070661_100329926 | 3300005344 | Bacteria | 1193 |
| 88 | Ga0070661_100919728 | 3300005344 | Bacteria | 723 |
| 89 | Ga0070661_101112003 | 3300005344 | Bacteria | 659 |
| 90 | Ga0070692_10013586 | 3300005345 | Bacteria | 3799 |
| 91 | Ga0070692_10175784 | 3300005345 | Bacteria | 1237 |
| 92 | Ga0070692_10340229 | 3300005345 | Unclassified | 929 |
| 93 | Ga0070668_100240164 | 3300005347 | Bacteria | 1500 |
| 94 | Ga0070668_100287276 | 3300005347 | Bacteria | 1375 |
| 95 | Ga0070668_100399690 | 3300005347 | Bacteria | 1173 |
| 96 | Ga0070669_100022340 | 3300005353 | Bacteria | 4522 |
| 97 | Ga0070675_100055352 | 3300005354 | Bacteria | 3265 |
| 98 | Ga0070675_100132287 | 3300005354 | Bacteria | 2127 |
| 99 | Ga0070675_100627970 | 3300005354 | Bacteria | 975 |
| 100 | Ga0070671_100000944 | 3300005355 | Bacteria | 21285 |
| 101 | Ga0070671_100024654 | 3300005355 | Bacteria | 4927 |
| 102 | Ga0070671_100142954 | 3300005355 | Bacteria | 2019 |
| 103 | Ga0070674_100042093 | 3300005356 | Bacteria | 3101 |
| 104 | Ga0070674_100053296 | 3300005356 | Bacteria | 2792 |
| 105 | Ga0070674_100061289 | 3300005356 | Bacteria | 2625 |
| 106 | Ga0070674_100621797 | 3300005356 | Bacteria | 915 |
| 107 | Ga0070673_100000633 | 3300005364 | Bacteria | 19280 |
| 108 | Ga0070673_100021643 | 3300005364 | Bacteria | 4667 |
| 109 | Ga0070673_100317111 | 3300005364 | Bacteria | 1376 |
| 110 | Ga0070688_100006703 | 3300005365 | Bacteria | 6169 |
| 111 | Ga0070688_100020601 | 3300005365 | Bacteria | 3836 |
| 112 | Ga0070659_100185474 | 3300005366 | Bacteria | 1708 |
| 113 | Ga0070659_100246600 | 3300005366 | Bacteria | 1479 |
| 114 | Ga0070659_100772188 | 3300005366 | Bacteria | 834 |
| 115 | Ga0070659_101959422 | 3300005366 | Bacteria | 526 |
| 116 | Ga0070667_100001396 | 3300005367 | Bacteria | 21599 |
| 117 | Ga0070667_100045449 | 3300005367 | Bacteria | 3692 |
| 118 | Ga0070667_100078400 | 3300005367 | Bacteria | 2822 |
| 119 | Ga0070667_101321862 | 3300005367 | Bacteria | 675 |
| 120 | Ga0070703_10206707 | 3300005406 | Bacteria | 774 |
| 121 | Ga0070709_10005668 | 3300005434 | Bacteria | 6767 |
| 122 | Ga0070709_10006339 | 3300005434 | Bacteria | 6442 |
| 123 | Ga0070709_10277063 | 3300005434 | Bacteria | 1218 |
| 124 | Ga0070709_10788793 | 3300005434 | Bacteria | 745 |
| 125 | Ga0070709_11722090 | 3300005434 | Bacteria | 512 |
| 126 | Ga0070714_100024472 | 3300005435 | Bacteria | 4973 |
| 127 | Ga0070714_100091275 | 3300005435 | Bacteria | 2668 |
| 128 | Ga0070714_100125523 | 3300005435 | Bacteria | 2288 |
| 129 | Ga0070714_100192333 | 3300005435 | Bacteria | 1863 |
| 130 | Ga0070714_101226898 | 3300005435 | Bacteria | 732 |
| 131 | Ga0070714_101321270 | 3300005435 | Bacteria | 704 |
| 132 | Ga0070713_100011762 | 3300005436 | Bacteria | 6391 |
| 133 | Ga0070713_100018486 | 3300005436 | Bacteria | 5296 |
| 134 | Ga0070713_100027651 | 3300005436 | Bacteria | 4467 |
| 135 | Ga0070713_100216831 | 3300005436 | Bacteria | 1735 |
| 136 | Ga0070713_100482492 | 3300005436 | Bacteria | 1168 |
| 137 | Ga0070713_100831263 | 3300005436 | Bacteria | 886 |
| 138 | Ga0070710_10003944 | 3300005437 | Bacteria | 7030 |
| 139 | Ga0070710_10025481 | 3300005437 | Bacteria | 3132 |
| 140 | Ga0070710_10030724 | 3300005437 | Bacteria | 2892 |
| 141 | Ga0070710_11009764 | 3300005437 | Bacteria | 606 |
| 142 | Ga0070710_11355693 | 3300005437 | Unclassified | 530 |
| 143 | Ga0070710_11456976 | 3300005437 | Bacteria | 513 |
| 144 | Ga0070701_10002950 | 3300005438 | Bacteria | 6642 |
| 145 | Ga0070711_100128434 | 3300005439 | Bacteria | 1884 |
| 146 | Ga0070711_100140581 | 3300005439 | Bacteria | 1809 |
| 147 | Ga0070711_100188181 | 3300005439 | Bacteria | 1584 |
| 148 | Ga0070711_100290711 | 3300005439 | Bacteria | 1296 |
| 149 | Ga0070705_100001427 | 3300005440 | Bacteria | 12645 |
| 150 | Ga0070705_100041318 | 3300005440 | Bacteria | 2628 |
| 151 | Ga0070705_100223386 | 3300005440 | Bacteria | 1305 |
| 152 | Ga0070705_100965285 | 3300005440 | Bacteria | 689 |
| 153 | Ga0070700_100001316 | 3300005441 | Bacteria | 12313 |
| 154 | Ga0070700_100321790 | 3300005441 | Bacteria | 1136 |
| 155 | Ga0070694_100121265 | 3300005444 | Bacteria | 1876 |
| 156 | Ga0070694_101867724 | 3300005444 | Bacteria | 512 |
| 157 | Ga0070708_100212038 | 3300005445 | Bacteria | 1815 |
| 158 | Ga0070708_101930509 | 3300005445 | Bacteria | 547 |
| 159 | Ga0070663_100041246 | 3300005455 | Bacteria | 3236 |
| 160 | Ga0070663_100274035 | 3300005455 | Bacteria | 1342 |
| 161 | Ga0070663_100384697 | 3300005455 | Bacteria | 1143 |
| 162 | Ga0070663_100546701 | 3300005455 | Bacteria | 967 |
| 163 | Ga0070663_101641066 | 3300005455 | Unclassified | 574 |
| 164 | Ga0070678_100001338 | 3300005456 | Bacteria | 13111 |
| 165 | Ga0070678_100253145 | 3300005456 | Bacteria | 1477 |
| 166 | Ga0070662_100020664 | 3300005457 | Bacteria | 4488 |
| 167 | Ga0070662_100197745 | 3300005457 | Bacteria | 1593 |
| 168 | Ga0070662_100283385 | 3300005457 | Bacteria | 1342 |
| 169 | Ga0070681_10013616 | 3300005458 | Bacteria | 8092 |
| 170 | Ga0070681_10020378 | 3300005458 | Bacteria | 6646 |
| 171 | Ga0070681_10076377 | 3300005458 | Bacteria | 3308 |
| 172 | Ga0070681_10263620 | 3300005458 | Bacteria | 1635 |
| 173 | Ga0070681_10416319 | 3300005458 | Bacteria | 1255 |
| 174 | Ga0070681_10666300 | 3300005458 | Bacteria | 956 |
| 175 | Ga0070681_10754447 | 3300005458 | Bacteria | 890 |
| 176 | Ga0070681_10789896 | 3300005458 | Bacteria | 866 |
| 177 | Ga0070681_10804884 | 3300005458 | Bacteria | 857 |
| 178 | Ga0068867_100003745 | 3300005459 | Bacteria | 10708 |
| 179 | Ga0070685_10010368 | 3300005466 | Bacteria | 4841 |
| 180 | Ga0070685_10019913 | 3300005466 | Bacteria | 3626 |
| 181 | Ga0070707_100256385 | 3300005468 | Bacteria | 1702 |
| 182 | Ga0070707_100259696 | 3300005468 | Bacteria | 1690 |
| 183 | Ga0070698_101374633 | 3300005471 | Bacteria | 657 |
| 184 | Ga0074259_10443300 | 3300005507 | Bacteria | 825 |
| 185 | Ga0070699_100376173 | 3300005518 | Bacteria | 1282 |
| 186 | Ga0070679_100014385 | 3300005530 | Bacteria | 7600 |
| 187 | Ga0070679_100024499 | 3300005530 | Bacteria | 5913 |
| 188 | Ga0070679_100118277 | 3300005530 | Bacteria | 2635 |
| 189 | Ga0070679_100134690 | 3300005530 | Bacteria | 2451 |
| 190 | Ga0070679_100202648 | 3300005530 | Bacteria | 1949 |
| 191 | Ga0070684_100138386 | 3300005535 | Bacteria | 2200 |
| 192 | Ga0070684_100151175 | 3300005535 | Bacteria | 2103 |
| 193 | Ga0070684_100596753 | 3300005535 | Bacteria | 1026 |
| 194 | Ga0070684_101726885 | 3300005535 | Bacteria | 590 |
| 195 | Ga0070684_101819163 | 3300005535 | Bacteria | 575 |
| 196 | Ga0070684_102073700 | 3300005535 | Unclassified | 537 |
| 197 | Ga0070697_100925803 | 3300005536 | Bacteria | 774 |
| 198 | Ga0070697_101152522 | 3300005536 | Bacteria | 690 |
| 199 | Ga0070697_101434970 | 3300005536 | Bacteria | 616 |
| 200 | Ga0068853_100002812 | 3300005539 | Bacteria | 13177 |
| 201 | Ga0068853_100220561 | 3300005539 | Bacteria | 1732 |
| 202 | Ga0068853_100784076 | 3300005539 | Bacteria | 912 |
| 203 | Ga0068853_100851263 | 3300005539 | Bacteria | 875 |
| 204 | Ga0068853_101414888 | 3300005539 | Bacteria | 673 |
| 205 | Ga0068853_101634942 | 3300005539 | Bacteria | 624 |
| 206 | Ga0068853_101961692 | 3300005539 | Unclassified | 568 |
| 207 | Ga0070672_100003770 | 3300005543 | Bacteria | 9864 |
| 208 | Ga0070686_100011271 | 3300005544 | Bacteria | 5066 |
| 209 | Ga0070686_100033789 | 3300005544 | Bacteria | 3145 |
| 210 | Ga0070695_100024486 | 3300005545 | Bacteria | 3719 |
| 211 | Ga0070695_101013966 | 3300005545 | Bacteria | 676 |
| 212 | Ga0070696_100021036 | 3300005546 | Bacteria | 4421 |
| 213 | Ga0070696_100021091 | 3300005546 | Bacteria | 4416 |
| 214 | Ga0070693_100062750 | 3300005547 | Bacteria | 2163 |
| 215 | Ga0070693_100068331 | 3300005547 | Bacteria | 2085 |
| 216 | Ga0070693_100168804 | 3300005547 | Bacteria | 1399 |
| 217 | Ga0070693_100468195 | 3300005547 | Unclassified | 888 |
| 218 | Ga0070693_101237549 | 3300005547 | Bacteria | 575 |
| 219 | Ga0070665_100017655 | 3300005548 | Bacteria | 7166 |
| 220 | Ga0070665_100354537 | 3300005548 | Bacteria | 1473 |
| 221 | Ga0070665_100788104 | 3300005548 | Bacteria | 963 |
| 222 | Ga0070704_100002635 | 3300005549 | Bacteria | 10125 |
| 223 | Ga0070704_100040518 | 3300005549 | Bacteria | 3207 |
| 224 | Ga0070704_100276867 | 3300005549 | Bacteria | 1388 |
| 225 | Ga0068855_100081515 | 3300005563 | Bacteria | 3750 |
| 226 | Ga0068855_100095442 | 3300005563 | Bacteria | 3427 |
| 227 | Ga0068855_100329615 | 3300005563 | Bacteria | 1685 |
| 228 | Ga0068855_100473873 | 3300005563 | Bacteria | 1363 |
| 229 | Ga0068855_101339383 | 3300005563 | Bacteria | 740 |
| 230 | Ga0070664_100003713 | 3300005564 | Bacteria | 12306 |
| 231 | Ga0070664_100232890 | 3300005564 | Bacteria | 1651 |
| 232 | Ga0070664_100400858 | 3300005564 | Bacteria | 1254 |
| 233 | Ga0070664_100754209 | 3300005564 | Bacteria | 909 |
| 234 | Ga0070664_101087941 | 3300005564 | Bacteria | 753 |
| 235 | Ga0070664_102150789 | 3300005564 | Bacteria | 529 |
| 236 | Ga0068857_100018167 | 3300005577 | Bacteria | 6169 |
| 237 | Ga0068854_100064999 | 3300005578 | Bacteria | 2651 |
| 238 | Ga0068854_101419759 | 3300005578 | Bacteria | 628 |
| 239 | Ga0068856_100069292 | 3300005614 | Bacteria | 3488 |
| 240 | Ga0068856_100095206 | 3300005614 | Bacteria | 2966 |
| 241 | Ga0068856_100165792 | 3300005614 | Bacteria | 2220 |
| 242 | Ga0068856_100843706 | 3300005614 | Bacteria | 935 |
| 243 | Ga0068856_101668170 | 3300005614 | Bacteria | 650 |
| 244 | Ga0068856_102162476 | 3300005614 | Bacteria | 566 |
| 245 | Ga0070702_100068724 | 3300005615 | Bacteria | 2085 |
| 246 | Ga0070702_100173249 | 3300005615 | Bacteria | 1406 |
| 247 | Ga0070702_100781219 | 3300005615 | Unclassified | 736 |
| 248 | Ga0068852_100009996 | 3300005616 | Bacteria | 7059 |
| 249 | Ga0068852_100153045 | 3300005616 | Bacteria | 2147 |
| 250 | Ga0068852_100626123 | 3300005616 | Bacteria | 1082 |
| 251 | Ga0068852_102674836 | 3300005616 | Bacteria | 518 |
| 252 | Ga0068859_100050266 | 3300005617 | Bacteria | 4188 |
| 253 | Ga0068859_101023240 | 3300005617 | Bacteria | 907 |
| 254 | Ga0068859_101419395 | 3300005617 | Bacteria | 766 |
| 255 | Ga0068859_102407032 | 3300005617 | Bacteria | 580 |
| 256 | Ga0068864_100004113 | 3300005618 | Bacteria | 11936 |
| 257 | Ga0068866_10001778 | 3300005718 | Bacteria | 9078 |
| 258 | Ga0068866_10050206 | 3300005718 | Bacteria | 2117 |
| 259 | Ga0068861_100090462 | 3300005719 | Bacteria | 2414 |
| 260 | Ga0068870_10000630 | 3300005840 | Bacteria | 13448 |
| 261 | Ga0068863_100001487 | 3300005841 | Bacteria | 23230 |
| 262 | Ga0068863_100133784 | 3300005841 | Bacteria | 2368 |
| 263 | Ga0068863_100444244 | 3300005841 | Bacteria | 1272 |
| 264 | Ga0068858_100079144 | 3300005842 | Bacteria | 3054 |
| 265 | Ga0068858_100137231 | 3300005842 | Bacteria | 2295 |
| 266 | Ga0068858_100252503 | 3300005842 | Bacteria | 1675 |
| 267 | Ga0068858_100877164 | 3300005842 | Bacteria | 877 |
| 268 | Ga0068860_100000338 | 3300005843 | Bacteria | 63598 |
| 269 | Ga0068860_100001886 | 3300005843 | Bacteria | 22272 |
| 270 | Ga0068860_100076172 | 3300005843 | Bacteria | 3190 |
| 271 | Ga0068860_100322267 | 3300005843 | Bacteria | 1517 |
| 272 | Ga0068862_100187335 | 3300005844 | Bacteria | 1860 |
| 273 | Ga0068862_100562208 | 3300005844 | Bacteria | 1090 |
| 274 | Ga0081455_10000313 | 3300005937 | Bacteria | 63616 |
| 275 | Ga0081455_10001856 | 3300005937 | Bacteria | 25428 |
| 276 | Ga0081455_10029804 | 3300005937 | Bacteria | 4970 |
| 277 | Ga0081455_10067125 | 3300005937 | Bacteria | 2990 |
| 278 | Ga0081455_10250521 | 3300005937 | Bacteria | 1295 |
| 279 | Ga0081455_10277828 | 3300005937 | Bacteria | 1211 |
| 280 | Ga0081540_1070887 | 3300005983 | Bacteria | 1612 |
| 281 | Ga0070717_10000430 | 3300006028 | Bacteria | 26747 |
| 282 | Ga0070717_10017570 | 3300006028 | Bacteria | 5570 |
| 283 | Ga0070717_10737502 | 3300006028 | Bacteria | 895 |
| 284 | Ga0070717_10883178 | 3300006028 | Bacteria | 814 |
| 285 | Ga0075363_100146151 | 3300006048 | Bacteria | 1333 |
| 286 | Ga0075364_10343519 | 3300006051 | Bacteria | 1017 |
| 287 | Ga0075432_10001349 | 3300006058 | Bacteria | 7961 |
| 288 | Ga0075432_10050289 | 3300006058 | Bacteria | 1470 |
| 289 | Ga0075432_10535433 | 3300006058 | Bacteria | 527 |
| 290 | Ga0070715_10079654 | 3300006163 | Bacteria | 1484 |
| 291 | Ga0070715_10126263 | 3300006163 | Bacteria | 1226 |
| 292 | Ga0070715_10147717 | 3300006163 | Bacteria | 1148 |
| 293 | Ga0070716_100000617 | 3300006173 | Bacteria | 15022 |
| 294 | Ga0070716_100031514 | 3300006173 | Bacteria | 2884 |
| 295 | Ga0070716_100217740 | 3300006173 | Bacteria | 1281 |
| 296 | Ga0070712_100095843 | 3300006175 | Bacteria | 2184 |
| 297 | Ga0070712_100139244 | 3300006175 | Bacteria | 1849 |
| 298 | Ga0070712_100297247 | 3300006175 | Bacteria | 1306 |
| 299 | Ga0075367_10127942 | 3300006178 | Bacteria | 1569 |
| 300 | Ga0075427_10003324 | 3300006194 | Bacteria | 2210 |
| 301 | Ga0097621_100008449 | 3300006237 | Bacteria | 7417 |
| 302 | Ga0097621_100009717 | 3300006237 | Bacteria | 6998 |
| 303 | Ga0097621_100078355 | 3300006237 | Bacteria | 2745 |
| 304 | Ga0075370_10765251 | 3300006353 | Bacteria | 588 |
| 305 | Ga0068871_100001209 | 3300006358 | Bacteria | 17213 |
| 306 | Ga0068871_100011630 | 3300006358 | Bacteria | 6462 |
| 307 | Ga0068871_100026251 | 3300006358 | Bacteria | 4543 |
| 308 | Ga0075428_100004387 | 3300006844 | Bacteria | 15573 |
| 309 | Ga0075428_100205605 | 3300006844 | Bacteria | 2128 |
| 310 | Ga0075428_100329777 | 3300006844 | Bacteria | 1639 |
| 311 | Ga0075428_100768253 | 3300006844 | Bacteria | 1025 |
| 312 | Ga0075430_100047563 | 3300006846 | Bacteria | 3623 |
| 313 | Ga0075430_100062773 | 3300006846 | Bacteria | 3120 |
| 314 | Ga0075430_100234177 | 3300006846 | Bacteria | 1522 |
| 315 | Ga0075431_100000305 | 3300006847 | Bacteria | 38524 |
| 316 | Ga0075431_100511793 | 3300006847 | Bacteria | 1190 |
| 317 | Ga0075433_10000618 | 3300006852 | Bacteria | 23730 |
| 318 | Ga0075433_10162525 | 3300006852 | Bacteria | 1987 |
| 319 | Ga0075433_10260292 | 3300006852 | Bacteria | 1538 |
| 320 | Ga0075434_100004516 | 3300006871 | Bacteria | 12557 |
| 321 | Ga0075434_100004895 | 3300006871 | Bacteria | 12140 |
| 322 | Ga0075434_100202084 | 3300006871 | Bacteria | 2007 |
| 323 | Ga0075434_100325968 | 3300006871 | Bacteria | 1556 |
| 324 | Ga0075434_100449212 | 3300006871 | Bacteria | 1310 |
| 325 | Ga0075434_102349406 | 3300006871 | Bacteria | 536 |
| 326 | Ga0075429_100001751 | 3300006880 | Bacteria | 17978 |
| 327 | Ga0075429_100002026 | 3300006880 | Bacteria | 16859 |
| 328 | Ga0075429_100416782 | 3300006880 | Bacteria | 1176 |
| 329 | Ga0068865_100018285 | 3300006881 | Bacteria | 4521 |
| 330 | Ga0075436_100043548 | 3300006914 | Bacteria | 3095 |
| 331 | Ga0075436_100441390 | 3300006914 | Bacteria | 947 |
| 332 | Ga0075436_100452601 | 3300006914 | Bacteria | 935 |
| 333 | Ga0097620_100050263 | 3300006931 | Bacteria | 4188 |
| 334 | Ga0097620_101023256 | 3300006931 | Bacteria | 907 |
| 335 | Ga0097620_101419275 | 3300006931 | Bacteria | 766 |
| 336 | Ga0097620_102406494 | 3300006931 | Bacteria | 580 |
| 337 | Ga0075435_100004466 | 3300007076 | Bacteria | 9612 |
| 338 | Ga0075435_100068391 | 3300007076 | Bacteria | 2893 |
| 339 | Ga0075435_100069834 | 3300007076 | Bacteria | 2866 |
| 340 | Ga0075435_100108968 | 3300007076 | Bacteria | 2302 |
| 341 | Ga0075435_100385819 | 3300007076 | Bacteria | 1204 |
| 342 | Ga0105251_10009665 | 3300009011 | Bacteria | 5670 |
| 343 | Ga0105251_10256321 | 3300009011 | Bacteria | 789 |
| 344 | Ga0105244_10254702 | 3300009036 | Bacteria | 818 |
| 345 | Ga0105250_10033642 | 3300009092 | Bacteria | 2059 |
| 346 | Ga0105250_10293962 | 3300009092 | Unclassified | 701 |
| 347 | Ga0105240_10329808 | 3300009093 | Bacteria | 1737 |
| 348 | Ga0105240_10373606 | 3300009093 | Bacteria | 1611 |
| 349 | Ga0105240_10544883 | 3300009093 | Bacteria | 1284 |
| 350 | Ga0105240_11173567 | 3300009093 | Bacteria | 814 |
| 351 | Ga0105240_11370540 | 3300009093 | Bacteria | 744 |
| 352 | Ga0111539_10000072 | 3300009094 | Bacteria | 100461 |
| 353 | Ga0111539_10001208 | 3300009094 | Bacteria | 34372 |
| 354 | Ga0111539_10002538 | 3300009094 | Bacteria | 24172 |
| 355 | Ga0111539_10024753 | 3300009094 | Bacteria | 7362 |
| 356 | Ga0111539_10068136 | 3300009094 | Bacteria | 4201 |
| 357 | Ga0111539_11367495 | 3300009094 | Unclassified | 821 |
| 358 | Ga0105245_10001702 | 3300009098 | Bacteria | 20025 |
| 359 | Ga0105245_10010259 | 3300009098 | Bacteria | 8156 |
| 360 | Ga0105245_10130671 | 3300009098 | Bacteria | 2355 |
| 361 | Ga0105245_10407028 | 3300009098 | Bacteria | 1361 |
| 362 | Ga0105245_10445267 | 3300009098 | Unclassified | 1303 |
| 363 | Ga0105245_10863389 | 3300009098 | Bacteria | 945 |
| 364 | Ga0105245_11636724 | 3300009098 | Bacteria | 696 |
| 365 | Ga0105245_13010652 | 3300009098 | Bacteria | 522 |
| 366 | Ga0105247_10060167 | 3300009101 | Bacteria | 2353 |
| 367 | Ga0114129_10009025 | 3300009147 | Bacteria | 14215 |
| 368 | Ga0114129_10322990 | 3300009147 | Bacteria | 2051 |
| 369 | Ga0105243_10010792 | 3300009148 | Bacteria | 6914 |
| 370 | Ga0105243_10172488 | 3300009148 | Bacteria | 1875 |
| 371 | Ga0105243_10250766 | 3300009148 | Bacteria | 1580 |
| 372 | Ga0105243_10636278 | 3300009148 | Bacteria | 1032 |
| 373 | Ga0105241_10008089 | 3300009174 | Bacteria | 7736 |
| 374 | Ga0105241_10022718 | 3300009174 | Bacteria | 4649 |
| 375 | Ga0105241_10377015 | 3300009174 | Bacteria | 1238 |
| 376 | Ga0105241_11754421 | 3300009174 | Bacteria | 605 |
| 377 | Ga0105241_12521352 | 3300009174 | Bacteria | 515 |
| 378 | Ga0105242_10002547 | 3300009176 | Bacteria | 14286 |
| 379 | Ga0105242_10003812 | 3300009176 | Bacteria | 11725 |
| 380 | Ga0105242_10224540 | 3300009176 | Bacteria | 1680 |
| 381 | Ga0105242_11400837 | 3300009176 | Bacteria | 726 |
| 382 | Ga0105242_12605580 | 3300009176 | Bacteria | 555 |
| 383 | Ga0105248_10030754 | 3300009177 | Bacteria | 5997 |
| 384 | Ga0105248_10082675 | 3300009177 | Bacteria | 3612 |
| 385 | Ga0105248_10144963 | 3300009177 | Bacteria | 2680 |
| 386 | Ga0105248_13057615 | 3300009177 | Bacteria | 533 |
| 387 | Ga0105237_10041676 | 3300009545 | Bacteria | 4630 |
| 388 | Ga0105237_10393473 | 3300009545 | Bacteria | 1391 |
| 389 | Ga0105237_10835667 | 3300009545 | Bacteria | 928 |
| 390 | Ga0105237_12226476 | 3300009545 | Bacteria | 558 |
| 391 | Ga0105238_10174906 | 3300009551 | Bacteria | 2123 |
| 392 | Ga0105238_10240578 | 3300009551 | Bacteria | 1787 |
| 393 | Ga0105238_10244817 | 3300009551 | Bacteria | 1771 |
| 394 | Ga0105238_10581366 | 3300009551 | Bacteria | 1126 |
| 395 | Ga0105249_10002932 | 3300009553 | Bacteria | 14716 |
| 396 | Ga0105249_10077851 | 3300009553 | Bacteria | 3076 |
| 397 | Ga0105249_10284120 | 3300009553 | Bacteria | 1654 |
| 398 | Ga0105239_10007571 | 3300010375 | Bacteria | 12453 |
| 399 | Ga0105239_10359706 | 3300010375 | Bacteria | 1644 |
| 400 | Ga0105239_10599296 | 3300010375 | Bacteria | 1257 |
| 401 | Ga0105239_12258715 | 3300010375 | Bacteria | 633 |
| 402 | Ga0105239_12917551 | 3300010375 | Bacteria | 558 |
| 403 | Ga0105246_10000456 | 3300011119 | Bacteria | 21904 |
| 404 | Ga0105246_10034993 | 3300011119 | Bacteria | 3353 |
| 405 | Ga0157340_1017516 | 3300012473 | Bacteria | 576 |
| 406 | Ga0157340_1020878 | 3300012473 | Bacteria | 551 |
| 407 | Ga0157344_1002446 | 3300012476 | Bacteria | 983 |
| 408 | Ga0157346_1005461 | 3300012480 | Unclassified | 789 |
| 409 | Ga0157337_1000995 | 3300012483 | Bacteria | 1375 |
| 410 | Ga0157337_1006072 | 3300012483 | Bacteria | 826 |
| 411 | Ga0157321_1003314 | 3300012487 | Bacteria | 953 |
| 412 | Ga0157341_1011855 | 3300012494 | Bacteria | 759 |
| 413 | Ga0157345_1006853 | 3300012498 | Bacteria | 917 |
| 414 | Ga0157314_1050750 | 3300012500 | Bacteria | 529 |
| 415 | Ga0157324_1000599 | 3300012506 | Bacteria | 1748 |
| 416 | Ga0157342_1000152 | 3300012507 | Bacteria | 3502 |
| 417 | Ga0157315_1000752 | 3300012508 | Bacteria | 1590 |
| 418 | Ga0157326_1023539 | 3300012513 | Bacteria | 775 |
| 419 | Ga0157338_1003303 | 3300012515 | Unclassified | 1329 |
| 420 | Ga0157338_1077607 | 3300012515 | Bacteria | 531 |
| 421 | Ga0157373_10094553 | 3300013100 | Bacteria | 2104 |
| 422 | Ga0157373_10196560 | 3300013100 | Bacteria | 1422 |
| 423 | Ga0157373_10449334 | 3300013100 | Bacteria | 927 |
| 424 | Ga0157373_10491813 | 3300013100 | Bacteria | 886 |
| 425 | Ga0157373_11292724 | 3300013100 | Bacteria | 552 |
| 426 | Ga0157371_10015233 | 3300013102 | Bacteria | 5775 |
| 427 | Ga0157371_10235851 | 3300013102 | Bacteria | 1315 |
| 428 | Ga0157371_10752618 | 3300013102 | Bacteria | 732 |
| 429 | Ga0157370_10208527 | 3300013104 | Bacteria | 1811 |
| 430 | Ga0157370_10509836 | 3300013104 | Bacteria | 1104 |
| 431 | Ga0157370_10639589 | 3300013104 | Unclassified | 972 |
| 432 | Ga0157370_10763642 | 3300013104 | Bacteria | 881 |
| 433 | Ga0157370_11280962 | 3300013104 | Bacteria | 661 |
| 434 | Ga0157369_10196586 | 3300013105 | Bacteria | 2118 |
| 435 | Ga0157369_10334097 | 3300013105 | Bacteria | 1574 |
| 436 | Ga0157369_10693294 | 3300013105 | Bacteria | 1049 |
| 437 | Ga0157369_10783991 | 3300013105 | Bacteria | 980 |
| 438 | Ga0157369_12585143 | 3300013105 | Bacteria | 513 |
| 439 | Ga0157374_10027781 | 3300013296 | Bacteria | 5108 |
| 440 | Ga0157374_10067109 | 3300013296 | Bacteria | 3372 |
| 441 | Ga0157374_10377062 | 3300013296 | Bacteria | 1413 |
| 442 | Ga0157374_11146552 | 3300013296 | Bacteria | 798 |
| 443 | Ga0157378_10002239 | 3300013297 | Bacteria | 17169 |
| 444 | Ga0157378_10694458 | 3300013297 | Bacteria | 1036 |
| 445 | Ga0157378_10719018 | 3300013297 | Bacteria | 1019 |
| 446 | Ga0163162_10005232 | 3300013306 | Bacteria | 12509 |
| 447 | Ga0163162_10085379 | 3300013306 | Bacteria | 3233 |
| 448 | Ga0163162_10413997 | 3300013306 | Bacteria | 1480 |
| 449 | Ga0157372_10097909 | 3300013307 | Bacteria | 3346 |
| 450 | Ga0157372_10144628 | 3300013307 | Bacteria | 2742 |
| 451 | Ga0157372_10207302 | 3300013307 | Bacteria | 2271 |
| 452 | Ga0157372_10523761 | 3300013307 | Bacteria | 1382 |
| 453 | Ga0157375_10001714 | 3300013308 | Bacteria | 18825 |
| 454 | Ga0157375_10030610 | 3300013308 | Bacteria | 5077 |
| 455 | Ga0157375_10190111 | 3300013308 | Bacteria | 2208 |
| 456 | Ga0157375_10225001 | 3300013308 | Bacteria | 2035 |
| 457 | Ga0157375_11047133 | 3300013308 | Bacteria | 954 |
| 458 | Ga0163163_10001518 | 3300014325 | Bacteria | 19614 |
| 459 | Ga0163163_10174616 | 3300014325 | Bacteria | 2195 |
| 460 | Ga0163163_10366798 | 3300014325 | Bacteria | 1497 |
| 461 | Ga0163163_12794896 | 3300014325 | Bacteria | 545 |
| 462 | Ga0157380_10012889 | 3300014326 | Bacteria | 6077 |
| 463 | Ga0157380_10607127 | 3300014326 | Bacteria | 1083 |
| 464 | Ga0182008_10201423 | 3300014497 | Bacteria | 1013 |
| 465 | Ga0182008_10647328 | 3300014497 | Bacteria | 598 |
| 466 | Ga0182008_10823049 | 3300014497 | Bacteria | 541 |
| 467 | Ga0157377_10002411 | 3300014745 | Bacteria | 8256 |
| 468 | Ga0157377_10038150 | 3300014745 | Bacteria | 2651 |
| 469 | Ga0157379_10003150 | 3300014968 | Bacteria | 13956 |
| 470 | Ga0157379_10021868 | 3300014968 | Bacteria | 5666 |
| 471 | Ga0157379_10049294 | 3300014968 | Bacteria | 3760 |
| 472 | Ga0157379_11336340 | 3300014968 | Bacteria | 693 |
| 473 | Ga0157376_10001552 | 3300014969 | Bacteria | 15161 |
| 474 | Ga0157376_10066923 | 3300014969 | Bacteria | 3038 |
| 475 | Ga0157376_10148440 | 3300014969 | Bacteria | 2112 |
| 476 | Ga0182007_10263505 | 3300015262 | Bacteria | 622 |
| 477 | Ga0163161_10002536 | 3300017792 | Bacteria | 13029 |
| 478 | Ga0163161_10100265 | 3300017792 | Bacteria | 2155 |
| 479 | Ga0163161_10180229 | 3300017792 | Bacteria | 1619 |
| 480 | Ga0206353_11323643 | 3300020082 | Bacteria | 1008 |
| 481 | Ga0213872_10352069 | 3300021361 | Bacteria | 604 |
| 482 | Ga0207666_1000186 | 3300025271 | Bacteria | 9311 |
| 483 | Ga0207673_1000346 | 3300025290 | Bacteria | 4664 |
| 484 | Ga0207673_1018184 | 3300025290 | Bacteria | 941 |
| 485 | Ga0209256_1000181 | 3300025299 | Bacteria | 123624 |
| 486 | Ga0207697_10010849 | 3300025315 | Bacteria | 3876 |
| 487 | Ga0207697_10016334 | 3300025315 | Bacteria | 3057 |
| 488 | Ga0207656_10276535 | 3300025321 | Bacteria | 827 |
| 489 | Ga0207696_1092354 | 3300025711 | Bacteria | 829 |
| 490 | Ga0207696_1194706 | 3300025711 | Bacteria | 533 |
| 491 | Ga0207653_10002509 | 3300025885 | Bacteria | 5827 |
| 492 | Ga0207653_10008464 | 3300025885 | Bacteria | 3205 |
| 493 | Ga0207682_10000143 | 3300025893 | Bacteria | 32063 |
| 494 | Ga0207692_10010101 | 3300025898 | Bacteria | 3966 |
| 495 | Ga0207692_10039931 | 3300025898 | Bacteria | 2312 |
| 496 | Ga0207692_10079530 | 3300025898 | Bacteria | 1749 |
| 497 | Ga0207692_11195911 | 3300025898 | Bacteria | 505 |
| 498 | Ga0207642_10003670 | 3300025899 | Bacteria | 4876 |
| 499 | Ga0207642_10090387 | 3300025899 | Bacteria | 1511 |
| 500 | Ga0207642_10442171 | 3300025899 | Bacteria | 786 |
| 501 | Ga0207710_10002851 | 3300025900 | Bacteria | 7872 |
| 502 | Ga0207710_10028478 | 3300025900 | Bacteria | 2425 |
| 503 | Ga0207710_10478767 | 3300025900 | Bacteria | 645 |
| 504 | Ga0207688_10004837 | 3300025901 | Bacteria | 7335 |
| 505 | Ga0207688_10087339 | 3300025901 | Bacteria | 1788 |
| 506 | Ga0207680_10059922 | 3300025903 | Bacteria | 2315 |
| 507 | Ga0207680_10291351 | 3300025903 | Bacteria | 1136 |
| 508 | Ga0207647_10009610 | 3300025904 | Bacteria | 6867 |
| 509 | Ga0207647_10165777 | 3300025904 | Bacteria | 1288 |
| 510 | Ga0207647_10344191 | 3300025904 | Unclassified | 845 |
| 511 | Ga0207685_10214002 | 3300025905 | Bacteria | 913 |
| 512 | Ga0207685_10265698 | 3300025905 | Bacteria | 836 |
| 513 | Ga0207699_10002837 | 3300025906 | Bacteria | 8208 |
| 514 | Ga0207699_10008626 | 3300025906 | Bacteria | 5040 |
| 515 | Ga0207699_10303724 | 3300025906 | Bacteria | 1115 |
| 516 | Ga0207699_11181720 | 3300025906 | Bacteria | 566 |
| 517 | Ga0207645_10003855 | 3300025907 | Bacteria | 11222 |
| 518 | Ga0207645_10062093 | 3300025907 | Bacteria | 2387 |
| 519 | Ga0207645_10334183 | 3300025907 | Bacteria | 1012 |
| 520 | Ga0207645_10342871 | 3300025907 | Bacteria | 999 |
| 521 | Ga0207643_10000336 | 3300025908 | Bacteria | 32116 |
| 522 | Ga0207705_10053004 | 3300025909 | Bacteria | 2922 |
| 523 | Ga0207705_10059508 | 3300025909 | Bacteria | 2757 |
| 524 | Ga0207654_10007173 | 3300025911 | Bacteria | 5614 |
| 525 | Ga0207654_10030175 | 3300025911 | Bacteria | 2974 |
| 526 | Ga0207654_10084852 | 3300025911 | Bacteria | 1916 |
| 527 | Ga0207707_10004481 | 3300025912 | Bacteria | 12289 |
| 528 | Ga0207707_10032305 | 3300025912 | Bacteria | 4581 |
| 529 | Ga0207707_10126505 | 3300025912 | Bacteria | 2235 |
| 530 | Ga0207707_10253668 | 3300025912 | Bacteria | 1528 |
| 531 | Ga0207707_10419007 | 3300025912 | Bacteria | 1148 |
| 532 | Ga0207707_10555626 | 3300025912 | Bacteria | 975 |
| 533 | Ga0207707_10595474 | 3300025912 | Bacteria | 936 |
| 534 | Ga0207695_10072031 | 3300025913 | Bacteria | 3528 |
| 535 | Ga0207671_10017926 | 3300025914 | Bacteria | 5446 |
| 536 | Ga0207671_10140224 | 3300025914 | Bacteria | 1862 |
| 537 | Ga0207671_11003462 | 3300025914 | Bacteria | 658 |
| 538 | Ga0207693_10047659 | 3300025915 | Bacteria | 3366 |
| 539 | Ga0207693_10059188 | 3300025915 | Bacteria | 3001 |
| 540 | Ga0207693_10068794 | 3300025915 | Bacteria | 2771 |
| 541 | Ga0207663_10033186 | 3300025916 | Bacteria | 3072 |
| 542 | Ga0207663_10113738 | 3300025916 | Bacteria | 1841 |
| 543 | Ga0207663_10293326 | 3300025916 | Bacteria | 1212 |
| 544 | Ga0207663_10498782 | 3300025916 | Bacteria | 945 |
| 545 | Ga0207663_10503645 | 3300025916 | Bacteria | 941 |
| 546 | Ga0207660_10002805 | 3300025917 | Bacteria | 11422 |
| 547 | Ga0207660_10067774 | 3300025917 | Bacteria | 2586 |
| 548 | Ga0207660_10247453 | 3300025917 | Bacteria | 1406 |
| 549 | Ga0207660_10329211 | 3300025917 | Bacteria | 1221 |
| 550 | Ga0207660_10816366 | 3300025917 | Bacteria | 761 |
| 551 | Ga0207662_10017545 | 3300025918 | Bacteria | 4051 |
| 552 | Ga0207662_10833726 | 3300025918 | Bacteria | 651 |
| 553 | Ga0207657_10025170 | 3300025919 | Bacteria | 5493 |
| 554 | Ga0207657_10041931 | 3300025919 | Bacteria | 4042 |
| 555 | Ga0207657_10059076 | 3300025919 | Bacteria | 3297 |
| 556 | Ga0207657_10080849 | 3300025919 | Bacteria | 2731 |
| 557 | Ga0207657_10089041 | 3300025919 | Bacteria | 2579 |
| 558 | Ga0207657_10143785 | 3300025919 | Bacteria | 1947 |
| 559 | Ga0207649_10000889 | 3300025920 | Bacteria | 18889 |
| 560 | Ga0207649_10049100 | 3300025920 | Bacteria | 2604 |
| 561 | Ga0207649_10107454 | 3300025920 | Bacteria | 1858 |
| 562 | Ga0207652_10028916 | 3300025921 | Bacteria | 4627 |
| 563 | Ga0207652_10061170 | 3300025921 | Bacteria | 3251 |
| 564 | Ga0207652_10138240 | 3300025921 | Bacteria | 2177 |
| 565 | Ga0207652_10139171 | 3300025921 | Bacteria | 2169 |
| 566 | Ga0207652_10766391 | 3300025921 | Bacteria | 858 |
| 567 | Ga0207652_10840669 | 3300025921 | Bacteria | 813 |
| 568 | Ga0207681_10000782 | 3300025923 | Bacteria | 20961 |
| 569 | Ga0207681_10108107 | 3300025923 | Bacteria | 2018 |
| 570 | Ga0207694_10111928 | 3300025924 | Bacteria | 2172 |
| 571 | Ga0207694_10129294 | 3300025924 | Bacteria | 2023 |
| 572 | Ga0207694_10586500 | 3300025924 | Bacteria | 937 |
| 573 | Ga0207694_10747598 | 3300025924 | Bacteria | 825 |
| 574 | Ga0207650_10021612 | 3300025925 | Bacteria | 4546 |
| 575 | Ga0207650_10216694 | 3300025925 | Bacteria | 1539 |
| 576 | Ga0207659_10000676 | 3300025926 | Bacteria | 20223 |
| 577 | Ga0207659_10473325 | 3300025926 | Bacteria | 1057 |
| 578 | Ga0207687_10001851 | 3300025927 | Bacteria | 14553 |
| 579 | Ga0207687_10032859 | 3300025927 | Bacteria | 3517 |
| 580 | Ga0207687_10046333 | 3300025927 | Bacteria | 3010 |
| 581 | Ga0207687_10862131 | 3300025927 | Bacteria | 774 |
| 582 | Ga0207687_11180836 | 3300025927 | Bacteria | 658 |
| 583 | Ga0207700_10015283 | 3300025928 | Bacteria | 5056 |
| 584 | Ga0207700_10106298 | 3300025928 | Bacteria | 2249 |
| 585 | Ga0207700_10373740 | 3300025928 | Bacteria | 1245 |
| 586 | Ga0207664_10115796 | 3300025929 | Bacteria | 2235 |
| 587 | Ga0207664_10229696 | 3300025929 | Bacteria | 1612 |
| 588 | Ga0207664_10306494 | 3300025929 | Bacteria | 1398 |
| 589 | Ga0207644_10001040 | 3300025931 | Bacteria | 17793 |
| 590 | Ga0207644_10007133 | 3300025931 | Bacteria | 7281 |
| 591 | Ga0207644_10399308 | 3300025931 | Bacteria | 1123 |
| 592 | Ga0207644_10861080 | 3300025931 | Bacteria | 759 |
| 593 | Ga0207690_10001491 | 3300025932 | Bacteria | 14625 |
| 594 | Ga0207690_10295245 | 3300025932 | Bacteria | 1266 |
| 595 | Ga0207690_10715083 | 3300025932 | Bacteria | 824 |
| 596 | Ga0207690_10944347 | 3300025932 | Bacteria | 716 |
| 597 | Ga0207706_10040546 | 3300025933 | Bacteria | 4127 |
| 598 | Ga0207706_10040651 | 3300025933 | Bacteria | 4122 |
| 599 | Ga0207706_10269359 | 3300025933 | Bacteria | 1486 |
| 600 | Ga0207686_10019478 | 3300025934 | Bacteria | 3861 |
| 601 | Ga0207686_10023879 | 3300025934 | Bacteria | 3535 |
| 602 | Ga0207686_10113589 | 3300025934 | Bacteria | 1831 |
| 603 | Ga0207686_10278058 | 3300025934 | Bacteria | 1235 |
| 604 | Ga0207686_11244466 | 3300025934 | Bacteria | 610 |
| 605 | Ga0207709_10017465 | 3300025935 | Bacteria | 4004 |
| 606 | Ga0207709_10066231 | 3300025935 | Bacteria | 2274 |
| 607 | Ga0207709_10258987 | 3300025935 | Unclassified | 1275 |
| 608 | Ga0207670_10002314 | 3300025936 | Bacteria | 9990 |
| 609 | Ga0207670_10036052 | 3300025936 | Bacteria | 3213 |
| 610 | Ga0207670_10118356 | 3300025936 | Bacteria | 1921 |
| 611 | Ga0207669_10001302 | 3300025937 | Bacteria | 10597 |
| 612 | Ga0207669_10039633 | 3300025937 | Bacteria | 2725 |
| 613 | Ga0207669_11481830 | 3300025937 | Bacteria | 578 |
| 614 | Ga0207704_10000410 | 3300025938 | Bacteria | 19429 |
| 615 | Ga0207704_10168583 | 3300025938 | Bacteria | 1567 |
| 616 | Ga0207704_10231464 | 3300025938 | Bacteria | 1374 |
| 617 | Ga0207704_11564573 | 3300025938 | Bacteria | 566 |
| 618 | Ga0207665_10000756 | 3300025939 | Bacteria | 21750 |
| 619 | Ga0207665_10027820 | 3300025939 | Bacteria | 3735 |
| 620 | Ga0207665_10050785 | 3300025939 | Bacteria | 2789 |
| 621 | Ga0207691_10045057 | 3300025940 | Bacteria | 4057 |
| 622 | Ga0207691_10209033 | 3300025940 | Bacteria | 1696 |
| 623 | Ga0207711_10024421 | 3300025941 | Bacteria | 5064 |
| 624 | Ga0207711_10053552 | 3300025941 | Bacteria | 3460 |
| 625 | Ga0207711_10127240 | 3300025941 | Bacteria | 2280 |
| 626 | Ga0207689_10049253 | 3300025942 | Bacteria | 3475 |
| 627 | Ga0207689_10832223 | 3300025942 | Bacteria | 779 |
| 628 | Ga0207689_11128806 | 3300025942 | Bacteria | 660 |
| 629 | Ga0207661_10001346 | 3300025944 | Bacteria | 16497 |
| 630 | Ga0207661_10477821 | 3300025944 | Bacteria | 1137 |
| 631 | Ga0207661_10581480 | 3300025944 | Bacteria | 1027 |
| 632 | Ga0207661_11545714 | 3300025944 | Bacteria | 608 |
| 633 | Ga0207661_12182123 | 3300025944 | Bacteria | 500 |
| 634 | Ga0207679_10000504 | 3300025945 | Bacteria | 26784 |
| 635 | Ga0207679_10326065 | 3300025945 | Bacteria | 1331 |
| 636 | Ga0207679_10983296 | 3300025945 | Bacteria | 773 |
| 637 | Ga0207667_10017518 | 3300025949 | Bacteria | 8060 |
| 638 | Ga0207667_10095367 | 3300025949 | Bacteria | 3071 |
| 639 | Ga0207667_10146645 | 3300025949 | Bacteria | 2429 |
| 640 | Ga0207667_10199974 | 3300025949 | Bacteria | 2050 |
| 641 | Ga0207651_10013105 | 3300025960 | Bacteria | 4728 |
| 642 | Ga0207651_10512810 | 3300025960 | Bacteria | 1038 |
| 643 | Ga0207712_10032107 | 3300025961 | Bacteria | 3542 |
| 644 | Ga0207712_10044100 | 3300025961 | Bacteria | 3080 |
| 645 | Ga0207712_10121122 | 3300025961 | Bacteria | 1980 |
| 646 | Ga0207712_11022459 | 3300025961 | Bacteria | 734 |
| 647 | Ga0207668_10000762 | 3300025972 | Bacteria | 19670 |
| 648 | Ga0207668_10122190 | 3300025972 | Bacteria | 1974 |
| 649 | Ga0207668_10633179 | 3300025972 | Bacteria | 934 |
| 650 | Ga0207640_10002084 | 3300025981 | Bacteria | 10768 |
| 651 | Ga0207640_10653391 | 3300025981 | Bacteria | 896 |
| 652 | Ga0207658_10039358 | 3300025986 | Bacteria | 3411 |
| 653 | Ga0207658_10051921 | 3300025986 | Bacteria | 3023 |
| 654 | Ga0207658_10089822 | 3300025986 | Bacteria | 2379 |
| 655 | Ga0207658_10948196 | 3300025986 | Bacteria | 784 |
| 656 | Ga0207677_10008747 | 3300026023 | Bacteria | 5670 |
| 657 | Ga0207677_10184215 | 3300026023 | Bacteria | 1645 |
| 658 | Ga0207677_10827341 | 3300026023 | Bacteria | 830 |
| 659 | Ga0207703_10021501 | 3300026035 | Bacteria | 5051 |
| 660 | Ga0207703_10115249 | 3300026035 | Bacteria | 2299 |
| 661 | Ga0207703_10165509 | 3300026035 | Bacteria | 1940 |
| 662 | Ga0207703_11098093 | 3300026035 | Bacteria | 764 |
| 663 | Ga0207639_10004202 | 3300026041 | Bacteria | 9702 |
| 664 | Ga0207639_10181271 | 3300026041 | Bacteria | 1792 |
| 665 | Ga0207639_10544362 | 3300026041 | Bacteria | 1065 |
| 666 | Ga0207639_10573459 | 3300026041 | Bacteria | 1038 |
| 667 | Ga0207639_10787967 | 3300026041 | Bacteria | 885 |
| 668 | Ga0207678_10017045 | 3300026067 | Bacteria | 6379 |
| 669 | Ga0207678_10038786 | 3300026067 | Bacteria | 4137 |
| 670 | Ga0207678_11628000 | 3300026067 | Unclassified | 568 |
| 671 | Ga0207708_10031096 | 3300026075 | Bacteria | 4051 |
| 672 | Ga0207708_10040693 | 3300026075 | Bacteria | 3543 |
| 673 | Ga0207702_10212244 | 3300026078 | Bacteria | 1800 |
| 674 | Ga0207702_10217561 | 3300026078 | Bacteria | 1779 |
| 675 | Ga0207702_10432110 | 3300026078 | Bacteria | 1275 |
| 676 | Ga0207702_10648464 | 3300026078 | Bacteria | 1038 |
| 677 | Ga0207641_10003596 | 3300026088 | Bacteria | 13694 |
| 678 | Ga0207641_10414729 | 3300026088 | Bacteria | 1295 |
| 679 | Ga0207641_10533901 | 3300026088 | Bacteria | 1142 |
| 680 | Ga0207648_10054561 | 3300026089 | Bacteria | 3490 |
| 681 | Ga0207648_10087497 | 3300026089 | Bacteria | 2719 |
| 682 | Ga0207648_10732642 | 3300026089 | Bacteria | 917 |
| 683 | Ga0207676_10059220 | 3300026095 | Bacteria | 3023 |
| 684 | Ga0207676_10259371 | 3300026095 | Bacteria | 1568 |
| 685 | Ga0207676_10691415 | 3300026095 | Bacteria | 987 |
| 686 | Ga0207676_10821517 | 3300026095 | Bacteria | 908 |
| 687 | Ga0207676_11890773 | 3300026095 | Bacteria | 595 |
| 688 | Ga0207674_10002908 | 3300026116 | Bacteria | 21261 |
| 689 | Ga0207674_10569242 | 3300026116 | Bacteria | 1094 |
| 690 | Ga0207674_10922287 | 3300026116 | Bacteria | 842 |
| 691 | Ga0207674_12012035 | 3300026116 | Bacteria | 543 |
| 692 | Ga0207675_100034535 | 3300026118 | Bacteria | 4715 |
| 693 | Ga0207675_100131311 | 3300026118 | Bacteria | 2375 |
| 694 | Ga0207675_100626138 | 3300026118 | Bacteria | 1081 |
| 695 | Ga0207683_10001206 | 3300026121 | Bacteria | 23425 |
| 696 | Ga0207683_10007086 | 3300026121 | Bacteria | 9610 |
| 697 | Ga0207683_10018925 | 3300026121 | Bacteria | 5875 |
| 698 | Ga0207683_12165302 | 3300026121 | Bacteria | 504 |
| 699 | Ga0207698_10023084 | 3300026142 | Bacteria | 4340 |
| 700 | Ga0207698_10173913 | 3300026142 | Bacteria | 1899 |
| 701 | Ga0207698_11142829 | 3300026142 | Bacteria | 792 |
| 702 | Ga0207698_11289798 | 3300026142 | Bacteria | 745 |
| 703 | Ga0209973_1012915 | 3300027252 | Bacteria | 1022 |
| 704 | Ga0209969_1004998 | 3300027360 | Bacteria | 1856 |
| 705 | Ga0209967_1002814 | 3300027364 | Bacteria | 2269 |
| 706 | Ga0209981_1030986 | 3300027378 | Bacteria | 784 |
| 707 | Ga0209996_1010995 | 3300027395 | Bacteria | 1206 |
| 708 | Ga0209984_1009301 | 3300027424 | Bacteria | 1247 |
| 709 | Ga0209995_1067414 | 3300027471 | Bacteria | 611 |
| 710 | Ga0209968_1005637 | 3300027526 | Bacteria | 1881 |
| 711 | Ga0209999_1063730 | 3300027543 | Bacteria | 703 |
| 712 | Ga0209982_1020055 | 3300027552 | Bacteria | 1026 |
| 713 | Ga0209970_1001595 | 3300027614 | Bacteria | 3954 |
| 714 | Ga0209983_1028051 | 3300027665 | Bacteria | 1193 |
| 715 | Ga0209971_1010559 | 3300027682 | Bacteria | 2188 |
| 716 | Ga0209966_1037455 | 3300027695 | Bacteria | 1001 |
| 717 | Ga0209998_10003991 | 3300027717 | Bacteria | 3166 |
| 718 | Ga0209998_10020408 | 3300027717 | Bacteria | 1418 |
| 719 | Ga0209998_10180906 | 3300027717 | Bacteria | 548 |
| 720 | Ga0209813_10060298 | 3300027866 | Bacteria | 1209 |
| 721 | Ga0209974_10018508 | 3300027876 | Bacteria | 2311 |
| 722 | Ga0209974_10121909 | 3300027876 | Bacteria | 924 |
| 723 | Ga0209974_10320666 | 3300027876 | Bacteria | 596 |
| 724 | Ga0209974_10472103 | 3300027876 | Bacteria | 500 |
| 725 | Ga0207428_10000141 | 3300027907 | Bacteria | 97064 |
| 726 | Ga0207428_10001593 | 3300027907 | Bacteria | 23627 |
| 727 | Ga0207428_10003355 | 3300027907 | Bacteria | 15563 |
| 728 | Ga0207428_10061609 | 3300027907 | Bacteria | 2969 |
| 729 | Ga0207428_10069072 | 3300027907 | Bacteria | 2778 |
| 730 | Ga0268266_10023949 | 3300028379 | Bacteria | 5196 |
| 731 | Ga0268266_10175755 | 3300028379 | Bacteria | 1947 |
| 732 | Ga0268266_10255707 | 3300028379 | Bacteria | 1621 |
| 733 | Ga0268265_10001135 | 3300028380 | Bacteria | 23498 |
| 734 | Ga0268265_10164860 | 3300028380 | Bacteria | 1887 |
| 735 | Ga0268264_10000051 | 3300028381 | Bacteria | 321565 |
| 736 | Ga0268264_10005920 | 3300028381 | Bacteria | 10351 |
| 737 | Ga0268264_10227206 | 3300028381 | Bacteria | 1721 |
| 738 | Ga0268264_10297826 | 3300028381 | Bacteria | 1517 |
| 739 | Ga0268264_10383694 | 3300028381 | Bacteria | 1346 |
| 740 | Ga0265337_1002114 | 3300028556 | Bacteria | 9374 |
| 741 | Ga0265338_10124983 | 3300028800 | Bacteria | 2042 |
| 742 | Ga0265338_10327807 | 3300028800 | Bacteria | 1107 |
| 743 | Ga0265338_10513659 | 3300028800 | Bacteria | 842 |
| 744 | Ga0265330_10029759 | 3300031235 | Bacteria | 2453 |
| 745 | Ga0265330_10288311 | 3300031235 | Bacteria | 691 |
| 746 | Ga0265332_10152147 | 3300031238 | Bacteria | 968 |
| 747 | Ga0265332_10486998 | 3300031238 | Unclassified | 511 |
| 748 | Ga0265328_10327145 | 3300031239 | Bacteria | 595 |
| 749 | Ga0265325_10000119 | 3300031241 | Bacteria | 54195 |
| 750 | Ga0265325_10018270 | 3300031241 | Bacteria | 3888 |
| 751 | Ga0265325_10411912 | 3300031241 | Bacteria | 591 |
| 752 | Ga0265340_10015371 | 3300031247 | Bacteria | 3977 |
| 753 | Ga0265340_10106826 | 3300031247 | Bacteria | 1297 |
| 754 | Ga0265340_10201257 | 3300031247 | Bacteria | 896 |
| 755 | Ga0265339_10003215 | 3300031249 | Bacteria | 11467 |
| 756 | Ga0265339_10027041 | 3300031249 | Bacteria | 3281 |
| 757 | Ga0265339_10102480 | 3300031249 | Bacteria | 1487 |
| 758 | Ga0265331_10454368 | 3300031250 | Bacteria | 576 |
| 759 | Ga0265316_10038880 | 3300031344 | Bacteria | 3827 |
| 760 | Ga0265316_10136750 | 3300031344 | Bacteria | 1843 |
| 761 | Ga0265316_10149537 | 3300031344 | Bacteria | 1750 |
| 762 | Ga0265316_10149594 | 3300031344 | Bacteria | 1749 |
| 763 | Ga0265313_10032008 | 3300031595 | Bacteria | 2691 |
| 764 | Ga0265313_10037161 | 3300031595 | Bacteria | 2437 |
| 765 | Ga0265313_10042722 | 3300031595 | Bacteria | 2224 |
| 766 | Ga0265313_10142865 | 3300031595 | Unclassified | 1028 |
| 767 | Ga0265314_10014050 | 3300031711 | Bacteria | 6432 |
| 768 | Ga0265314_10190638 | 3300031711 | Bacteria | 1220 |
| 769 | Ga0265342_10000967 | 3300031712 | Bacteria | 28523 |
| 770 | Ga0265342_10019923 | 3300031712 | Bacteria | 4315 |
| 771 | Ga0307405_11224173 | 3300031731 | Bacteria | 650 |
| 772 | Ga0307406_10469671 | 3300031901 | Bacteria | 1013 |
| 773 | Ga0307406_11688402 | 3300031901 | Bacteria | 561 |
| 774 | Ga0316583_10004499 | 3300032133 | Bacteria | 4973 |
| 775 | Ga0373930_0000546 | 3300034816 | Bacteria | 5171 |
| 776 | Ga0373930_0074486 | 3300034816 | Bacteria | 777 |
| 777 | Ga0373948_0006814 | 3300034817 | Bacteria | 1902 |
| 778 | Ga0373958_0000316 | 3300034819 | Bacteria | 5838 |
| 779 | Ga0373958_0028289 | 3300034819 | Bacteria | 1084 |
| 780 | Ga0373959_0006377 | 3300034820 | Bacteria | 1956 |
| 781 | Ga0373938_0000677 | 3300034957 | Bacteria | 5475 |
| 782 | Ga0373938_0015610 | 3300034957 | Bacteria | 1474 |
| 783 | Ga0373938_0053049 | 3300034957 | Bacteria | 931 |
| 784 | Ga0373926_0002819 | 3300035083 | Bacteria | 5555 |
| 785 | Ga0373926_0027341 | 3300035083 | Bacteria | 1998 |
| 786 | Ga0373926_0093576 | 3300035083 | Unclassified | 1119 |
| 787 | Ga0373928_0001944 | 3300035084 | Bacteria | 4026 |
| 788 | Ga0373928_0014038 | 3300035084 | Bacteria | 1614 |
| 789 | Ga0373929_0007130 | 3300035085 | Bacteria | 2035 |
| 790 | Ga0373934_0135065 | 3300035086 | Bacteria | 1007 |
| 791 | Ga0373934_0231347 | 3300035086 | Bacteria | 763 |
| 792 | Ga0373940_0000058 | 3300035088 | Bacteria | 12430 |
| 793 | Ga0373940_0041177 | 3300035088 | Bacteria | 1270 |
| 794 | Ga0373944_0002373 | 3300035089 | Bacteria | 4797 |
| 795 | Ga0373944_0034117 | 3300035089 | Bacteria | 1545 |
| 796 | Ga0373944_0051532 | 3300035089 | Unclassified | 1298 |
| 797 | Ga0373949_0001169 | 3300035090 | Bacteria | 7785 |
| 798 | Ga0373949_0017218 | 3300035090 | Bacteria | 1627 |
| 799 | Ga0373949_0040573 | 3300035090 | Bacteria | 1143 |
| 800 | Ga0373951_0000698 | 3300035091 | Bacteria | 9231 |
| 801 | Ga0373951_0009696 | 3300035091 | Bacteria | 2165 |
| 802 | Ga0373952_0000245 | 3300035092 | Bacteria | 8808 |
| 803 | Ga0373952_0130653 | 3300035092 | Bacteria | 689 |
| 804 | Ga0373952_0142329 | 3300035092 | Bacteria | 667 |
| 805 | Ga0373952_0268291 | 3300035092 | Bacteria | 522 |
| 806 | Ga0373923_0063383 | 3300035111 | Bacteria | 1574 |
| 807 | Ga0373923_0272341 | 3300035111 | Bacteria | 796 |
| 808 | Ga0373923_0662906 | 3300035111 | Unclassified | 516 |
| 809 | Ga0373932_0000784 | 3300035112 | Bacteria | 9414 |
| 810 | Ga0373932_0170147 | 3300035112 | Bacteria | 759 |
| 811 | Ga0373932_0365478 | 3300035112 | Bacteria | 551 |
| 812 | Ga0373936_0000491 | 3300035113 | Bacteria | 13386 |
| 813 | Ga0373936_0076787 | 3300035113 | Bacteria | 1385 |
| 814 | Ga0373936_0360123 | 3300035113 | Bacteria | 663 |
| 815 | Ga0373939_0000350 | 3300035114 | Bacteria | 11731 |
| 816 | Ga0373939_0007984 | 3300035114 | Bacteria | 2584 |
| 817 | Ga0373939_0008981 | 3300035114 | Bacteria | 2465 |
| 818 | Ga0373941_0005512 | 3300035115 | Bacteria | 2983 |
| 819 | Ga0373941_0045377 | 3300035115 | Bacteria | 1376 |
| 820 | Ga0373945_0010389 | 3300035116 | Bacteria | 3064 |
| 821 | Ga0373945_0054339 | 3300035116 | Bacteria | 1480 |
| 822 | Ga0373945_0308162 | 3300035116 | Unclassified | 679 |
| 823 | Ga0373953_0006085 | 3300035117 | Bacteria | 3957 |
| 824 | Ga0373953_0040573 | 3300035117 | Bacteria | 1849 |
| 825 | Ga0373953_0150057 | 3300035117 | Bacteria | 999 |
| 826 | Ga0373953_0274062 | 3300035117 | Bacteria | 735 |
| 827 | Ga0373954_0022723 | 3300035118 | Bacteria | 2848 |
| 828 | Ga0373954_0064678 | 3300035118 | Bacteria | 1730 |
| 829 | Ga0373954_0273000 | 3300035118 | Bacteria | 833 |
| 830 | Ga0373954_0578010 | 3300035118 | Unclassified | 557 |
| 831 | Ga0373954_0596722 | 3300035118 | Bacteria | 547 |
| 832 | Ga0373956_0002568 | 3300035119 | Bacteria | 7375 |
| 833 | Ga0373956_0045063 | 3300035119 | Bacteria | 1967 |
| 834 | Ga0373956_0443472 | 3300035119 | Bacteria | 620 |
| 835 | Ga0373957_0036369 | 3300035120 | Bacteria | 1834 |
| 836 | Ga0373957_0312763 | 3300035120 | Bacteria | 667 |
| 837 | Ga0373957_0473598 | 3300035120 | Bacteria | 543 |
| 838 | Ga0373960_0225966 | 3300035121 | Bacteria | 671 |
| 839 | Ga0373960_0232409 | 3300035121 | Bacteria | 663 |
| 840 | Ga0373960_0242952 | 3300035121 | Bacteria | 652 |
| 841 | Ga0373943_0005755 | 3300035170 | Bacteria | 5563 |
| 842 | Ga0373943_0153622 | 3300035170 | Bacteria | 1248 |
| 843 | Ga0373946_0001418 | 3300035171 | Bacteria | 8314 |
| 844 | Ga0373946_0018824 | 3300035171 | Bacteria | 2654 |
| 845 | Ga0373946_0171061 | 3300035171 | Bacteria | 1025 |
| 846 | Ga0373946_0356096 | 3300035171 | Bacteria | 732 |
| 847 | Ga0373955_0006235 | 3300035172 | Bacteria | 5426 |
| 848 | Ga0373955_0032016 | 3300035172 | Bacteria | 2757 |
| 849 | Ga0373955_0068387 | 3300035172 | Bacteria | 1979 |
| 850 | Ga0373955_0130239 | 3300035172 | Bacteria | 1468 |
| 851 | Ga0373955_0196101 | 3300035172 | Bacteria | 1201 |
| 852 | Ga0373955_0630103 | 3300035172 | Bacteria | 657 |
| 853 | Ga0373942_0000056 | 3300035207 | Bacteria | 22957 |
| 854 | Ga0373942_0055759 | 3300035207 | Bacteria | 1120 |
| 855 | Ga0373961_0000471 | 3300035241 | Bacteria | 15885 |
| 856 | Ga0373961_0022597 | 3300035241 | Bacteria | 1684 |
| 857 | Ga0373961_0292490 | 3300035241 | Bacteria | 600 |
| 858 | Ga0373962_0000608 | 3300035242 | Bacteria | 8073 |
| 859 | Ga0373962_0003921 | 3300035242 | Bacteria | 3581 |
| 860 | Ga0373924_0120621 | 3300035410 | Bacteria | 1137 |
| 861 | Ga0373924_0133528 | 3300035410 | Bacteria | 1080 |
| 862 | Ga0373924_0220078 | 3300035410 | Bacteria | 839 |
| 863 | Ga0373924_0293080 | 3300035410 | Bacteria | 722 |
| 864 | Ga0373931_0083993 | 3300035691 | Bacteria | 1762 |
| 865 | Ga0373931_0086755 | 3300035691 | Bacteria | 1737 |
| 866 | Ga0373931_0087850 | 3300035691 | Bacteria | 1727 |
| 867 | Ga0373931_0137841 | 3300035691 | Unclassified | 1410 |
| 868 | Ga0373931_1271461 | 3300035691 | Bacteria | 505 |
| 869 | Ga0373935_0004417 | 3300035692 | Bacteria | 8259 |
| 870 | Ga0373935_0007391 | 3300035692 | Bacteria | 6572 |
| 871 | Ga0373935_0072609 | 3300035692 | Bacteria | 2222 |
| 872 | Ga0373935_0719669 | 3300035692 | Bacteria | 734 |
| 873 | Ga0373935_0797601 | 3300035692 | Bacteria | 697 |
| 874 | Ga0373935_1507295 | 3300035692 | Bacteria | 503 |
| 875 | Ga0373927_0015530 | 3300035695 | Bacteria | 5030 |
| 876 | Ga0373927_0048634 | 3300035695 | Bacteria | 2743 |
| 877 | Ga0373927_0319931 | 3300035695 | Bacteria | 1021 |
| 878 | Ga0373933_0003495 | 3300035724 | Bacteria | 8748 |
| 879 | Ga0373933_0008121 | 3300035724 | Bacteria | 5725 |
| 880 | Ga0373933_0019789 | 3300035724 | Bacteria | 3809 |
| 881 | Ga0373933_0060623 | 3300035724 | Bacteria | 2281 |
| 882 | Ga0373933_0604107 | 3300035724 | Bacteria | 720 |
| 883 | Ga0373933_0800663 | 3300035724 | Bacteria | 620 |
| 884 | Ga0373947_0001131 | 3300035725 | Bacteria | 16382 |
| 885 | Ga0373947_0032649 | 3300035725 | Bacteria | 3069 |
| 886 | Ga0373947_0513603 | 3300035725 | Bacteria | 814 |
| 887 | Ga0373947_1229268 | 3300035725 | Bacteria | 510 |
| 888 | Ga0373937_0009064 | 3300036401 | Bacteria | 8636 |
| 889 | Ga0373937_0010912 | 3300036401 | Bacteria | 7954 |
| 890 | Ga0373937_0014216 | 3300036401 | Bacteria | 7024 |
| 891 | Ga0373937_0017271 | 3300036401 | Bacteria | 6424 |
| 892 | Ga0373937_0030955 | 3300036401 | Bacteria | 4845 |
| 893 | Ga0373937_0107375 | 3300036401 | Bacteria | 2595 |
| 894 | Ga0373937_0615691 | 3300036401 | Bacteria | 1030 |
| 895 | Ga0373925_0005021 | 3300037068 | Bacteria | 9928 |
| 896 | Ga0373925_0005303 | 3300037068 | Bacteria | 9625 |
| 897 | Ga0373925_0027500 | 3300037068 | Bacteria | 4162 |
| 898 | Ga0373925_0757389 | 3300037068 | Bacteria | 800 |
| 899 | Ga0373925_1251052 | 3300037068 | Bacteria | 609 |
| 900 | Ga0395899_0002845 | 3300037312 | Bacteria | 13930 |
| 901 | Ga0395899_0080610 | 3300037312 | Bacteria | 2369 |
| 902 | Ga0395900_0003630 | 3300037418 | Bacteria | 16592 |
| 903 | Ga0395900_0010878 | 3300037418 | Bacteria | 9305 |
| 904 | Ga0395900_0328325 | 3300037418 | Bacteria | 1508 |
| 905 | Ga0395900_1040984 | 3300037418 | Bacteria | 737 |
| 906 | Ga0395898_0006740 | 3300037466 | Bacteria | 12242 |
| 907 | Ga0395898_0014680 | 3300037466 | Bacteria | 8043 |
| 908 | Ga0395898_0150024 | 3300037466 | Bacteria | 2231 |
| 909 | Ga0436364_0782926 | 3300037853 | Bacteria | 549 |
| 910 | Ga0395901_0020857 | 3300038443 | Bacteria | 6710 |
| 911 | Ga0395901_0170977 | 3300038443 | Bacteria | 2280 |
| 912 | Ga0395901_0297638 | 3300038443 | Bacteria | 1673 |
| 913 | Ga0395901_0916198 | 3300038443 | Bacteria | 857 |
| 914 | Ga0242420_005947 | 3300038996 | Bacteria | 1913 |
| 915 | Ga0436361_0568157 | 3300039447 | Bacteria | 2474 |
| 916 | Ga0439453_0185193 | 3300041408 | Bacteria | 510 |
| 917 | Ga0439453_0192927 | 3300041408 | Bacteria | 502 |
| 918 | Ga0451793_0643023 | 3300041452 | Bacteria | 591 |
| 919 | Ga0451802_0329831 | 3300041460 | Bacteria | 698 |
| 920 | Ga0451804_0516794 | 3300041463 | Bacteria | 1221 |
| 921 | Ga0451807_1208075 | 3300041486 | Bacteria | 865 |
| 922 | Ga0451845_0125542 | 3300041501 | Bacteria | 736 |
| 923 | Ga0439448_0102944 | 3300042005 | Bacteria | 972 |
| 924 | Ga0439448_0333398 | 3300042005 | Unclassified | 540 |
| 925 | Ga0439450_058082 | 3300042008 | Bacteria | 931 |
| 926 | Ga0439456_047188 | 3300042013 | Bacteria | 939 |
| 927 | Ga0439463_040358 | 3300042016 | Bacteria | 1186 |
| 928 | Ga0439458_0084245 | 3300042157 | Bacteria | 814 |
| 929 | Ga0439458_0235193 | 3300042157 | Bacteria | 507 |
| 930 | Ga0439444_0045082 | 3300042437 | Bacteria | 879 |
| 931 | Ga0439464_0051986 | 3300042439 | Bacteria | 1186 |
| 932 | Ga0439460_0040902 | 3300042461 | Bacteria | 1360 |
| 933 | Ga0451577_0416108 | 3300042876 | Bacteria | 1220 |
| 934 | Ga0466963_0232808 | 3300044694 | Bacteria | 1291 |
| 935 | Ga0453684_1352392 | 3300044712 | Unclassified | 741 |
| 936 | Ga0451576_0151880 | 3300045051 | Bacteria | 2415 |
| 937 | Ga0466967_0654065 | 3300045976 | Bacteria | 1039 |
| 938 | Ga0495592_0019497 | 3300046454 | Bacteria | 5158 |
| 939 | Ga0495592_0027776 | 3300046454 | Bacteria | 4286 |
| 940 | Ga0495592_0054230 | 3300046454 | Bacteria | 2971 |
| 941 | Ga0495592_0163822 | 3300046454 | Bacteria | 1528 |
| 942 | Ga0495592_0189339 | 3300046454 | Bacteria | 1395 |
| 943 | Ga0495592_0773830 | 3300046454 | Bacteria | 572 |
| 944 | Ga0495603_0008518 | 3300046455 | Bacteria | 6196 |
| 945 | Ga0495603_0116801 | 3300046455 | Bacteria | 1555 |
| 946 | Ga0495603_0876116 | 3300046455 | Unclassified | 511 |
| 947 | Ga0495590_0213966 | 3300046457 | Bacteria | 711 |
| 948 | Ga0495591_034040 | 3300046458 | Bacteria | 1503 |
| 949 | Ga0495629_0001316 | 3300046459 | Bacteria | 19535 |
| 950 | Ga0495629_0023842 | 3300046459 | Bacteria | 4357 |
| 951 | Ga0495629_0443347 | 3300046459 | Bacteria | 880 |
| 952 | Ga0495641_0064157 | 3300046461 | Bacteria | 1655 |
| 953 | Ga0495641_0101299 | 3300046461 | Unclassified | 1285 |
| 954 | Ga0495641_0275884 | 3300046461 | Bacteria | 756 |
| 955 | Ga0495651_0004833 | 3300046462 | Bacteria | 10309 |
| 956 | Ga0495651_0015103 | 3300046462 | Bacteria | 5968 |
| 957 | Ga0495651_0032128 | 3300046462 | Bacteria | 4095 |
| 958 | Ga0495651_0252104 | 3300046462 | Bacteria | 1205 |
| 959 | Ga0495651_0280736 | 3300046462 | Bacteria | 1125 |
| 960 | Ga0495651_0311912 | 3300046462 | Bacteria | 1052 |
| 961 | Ga0495653_0002640 | 3300046463 | Bacteria | 14272 |
| 962 | Ga0495653_0005895 | 3300046463 | Bacteria | 10031 |
| 963 | Ga0495653_0090080 | 3300046463 | Bacteria | 2246 |
| 964 | Ga0495653_0242775 | 3300046463 | Bacteria | 1199 |
| 965 | Ga0495580_0015463 | 3300046472 | Bacteria | 5753 |
| 966 | Ga0495580_0600318 | 3300046472 | Bacteria | 727 |
| 967 | Ga0495582_0005763 | 3300046473 | Bacteria | 6897 |
| 968 | Ga0495582_0031750 | 3300046473 | Bacteria | 2904 |
| 969 | Ga0495605_0221291 | 3300046474 | Bacteria | 818 |
| 970 | Ga0495639_0004954 | 3300046475 | Bacteria | 5708 |
| 971 | Ga0495662_0001866 | 3300046476 | Bacteria | 10560 |
| 972 | Ga0495662_0037300 | 3300046476 | Bacteria | 2347 |
| 973 | Ga0495662_0231757 | 3300046476 | Bacteria | 910 |
| 974 | Ga0495664_0050283 | 3300046477 | Bacteria | 2475 |
| 975 | Ga0495664_0150710 | 3300046477 | Bacteria | 1410 |
| 976 | Ga0495664_0296401 | 3300046477 | Bacteria | 976 |
| 977 | Ga0495584_0061606 | 3300046491 | Bacteria | 1886 |
| 978 | Ga0495584_0501780 | 3300046491 | Bacteria | 618 |
| 979 | Ga0495585_0001729 | 3300046492 | Bacteria | 16618 |
| 980 | Ga0495594_0009236 | 3300046499 | Bacteria | 5090 |
| 981 | Ga0495594_0024363 | 3300046499 | Bacteria | 3250 |
| 982 | Ga0495594_0121684 | 3300046499 | Bacteria | 1475 |
| 983 | Ga0495608_0007989 | 3300046511 | Bacteria | 7437 |
| 984 | Ga0495608_0058681 | 3300046511 | Bacteria | 2537 |
| 985 | Ga0495608_0074704 | 3300046511 | Bacteria | 2209 |
| 986 | Ga0495608_0942665 | 3300046511 | Bacteria | 504 |
| 987 | Ga0495616_0035425 | 3300046513 | Bacteria | 2583 |
| 988 | Ga0495618_0047174 | 3300046514 | Bacteria | 2719 |
| 989 | Ga0495618_0132385 | 3300046514 | Bacteria | 1595 |
| 990 | Ga0495618_0361354 | 3300046514 | Bacteria | 893 |
| 991 | Ga0495618_0686226 | 3300046514 | Bacteria | 603 |
| 992 | Ga0495628_0011219 | 3300046516 | Bacteria | 7582 |
| 993 | Ga0495628_0135599 | 3300046516 | Bacteria | 1881 |
| 994 | Ga0495628_0193849 | 3300046516 | Bacteria | 1533 |
| 995 | Ga0495628_0193851 | 3300046516 | Bacteria | 1533 |
| 996 | Ga0495628_0953824 | 3300046516 | Bacteria | 592 |
| 997 | Ga0495628_1190218 | 3300046516 | Bacteria | 517 |
| 998 | Ga0495630_0015862 | 3300046517 | Bacteria | 5505 |
| 999 | Ga0495630_0255351 | 3300046517 | Bacteria | 1339 |
| 1000 | Ga0495630_0571960 | 3300046517 | Bacteria | 866 |
| 1001 | Ga0495637_0214234 | 3300046520 | Bacteria | 703 |
| 1002 | Ga0495644_0055943 | 3300046523 | Bacteria | 1482 |
| 1003 | Ga0495663_0055416 | 3300046525 | Bacteria | 1236 |
| 1004 | Ga0495666_0090430 | 3300046526 | Bacteria | 1444 |
| 1005 | Ga0495652_0027253 | 3300046529 | Bacteria | 5036 |
| 1006 | Ga0495652_0038405 | 3300046529 | Bacteria | 4148 |
| 1007 | Ga0495652_0159752 | 3300046529 | Bacteria | 1751 |
| 1008 | Ga0495652_0339058 | 3300046529 | Bacteria | 1080 |
| 1009 | Ga0495665_0070818 | 3300046531 | Bacteria | 1837 |
| 1010 | Ga0495665_0079937 | 3300046531 | Bacteria | 1720 |
| 1011 | Ga0495640_0015679 | 3300046533 | Bacteria | 5692 |
| 1012 | Ga0495640_0087913 | 3300046533 | Bacteria | 2054 |
| 1013 | Ga0495640_0164206 | 3300046533 | Bacteria | 1421 |
| 1014 | Ga0495640_0228663 | 3300046533 | Bacteria | 1171 |
| 1015 | Ga0495640_0731086 | 3300046533 | Bacteria | 592 |
| 1016 | Ga0495586_0011823 | 3300046535 | Bacteria | 4640 |
| 1017 | Ga0495587_0011963 | 3300046536 | Bacteria | 5485 |
| 1018 | Ga0495587_0026702 | 3300046536 | Bacteria | 3519 |
| 1019 | Ga0495587_0079695 | 3300046536 | Bacteria | 1898 |
| 1020 | Ga0495587_0098505 | 3300046536 | Bacteria | 1685 |
| 1021 | Ga0495587_0187350 | 3300046536 | Bacteria | 1172 |
| 1022 | Ga0495598_0135865 | 3300046537 | Bacteria | 847 |
| 1023 | Ga0495645_0018999 | 3300046543 | Bacteria | 4945 |
| 1024 | Ga0495645_0070977 | 3300046543 | Bacteria | 2512 |
| 1025 | Ga0495645_0378945 | 3300046543 | Bacteria | 905 |
| 1026 | Ga0495622_0035567 | 3300046557 | Bacteria | 2322 |
| 1027 | Ga0495622_0070129 | 3300046557 | Bacteria | 1618 |
| 1028 | Ga0495633_0005006 | 3300046558 | Bacteria | 8264 |
| 1029 | Ga0495667_0013026 | 3300046559 | Bacteria | 5633 |
| 1030 | Ga0495667_0017124 | 3300046559 | Bacteria | 4894 |
| 1031 | Ga0495667_0017232 | 3300046559 | Bacteria | 4879 |
| 1032 | Ga0495667_0051253 | 3300046559 | Bacteria | 2723 |
| 1033 | Ga0495667_0318405 | 3300046559 | Bacteria | 984 |
| 1034 | Ga0495667_0845881 | 3300046559 | Bacteria | 563 |
| 1035 | Ga0495656_0003577 | 3300046615 | Bacteria | 5263 |
| 1036 | Ga0495634_0279340 | 3300046642 | Bacteria | 1014 |
| 1037 | Ga0495634_0292081 | 3300046642 | Bacteria | 987 |
| 1038 | Ga0495634_0527038 | 3300046642 | Bacteria | 690 |
| 1039 | Ga0495611_0213732 | 3300046648 | Bacteria | 898 |
| 1040 | Ga0495635_0006791 | 3300046663 | Bacteria | 7999 |
| 1041 | Ga0495635_0064410 | 3300046663 | Bacteria | 2516 |
| 1042 | Ga0495659_0001405 | 3300046664 | Bacteria | 8198 |
| 1043 | Ga0495661_0019380 | 3300046665 | Bacteria | 4458 |
| 1044 | Ga0495588_0058537 | 3300046674 | Bacteria | 1992 |
| 1045 | Ga0495588_0097486 | 3300046674 | Unclassified | 1543 |
| 1046 | Ga0495588_0661499 | 3300046674 | Bacteria | 546 |
| 1047 | Ga0495657_0024510 | 3300046675 | Bacteria | 4296 |
| 1048 | Ga0495657_0045368 | 3300046675 | Bacteria | 2983 |
| 1049 | Ga0495657_0054497 | 3300046675 | Bacteria | 2671 |
| 1050 | Ga0495657_0242325 | 3300046675 | Bacteria | 1088 |
| 1051 | Ga0495599_0011174 | 3300046678 | Bacteria | 5512 |
| 1052 | Ga0495599_0067846 | 3300046678 | Bacteria | 2227 |
| 1053 | Ga0495599_0077683 | 3300046678 | Bacteria | 2072 |
| 1054 | Ga0495623_0006971 | 3300046679 | Bacteria | 7344 |
| 1055 | Ga0495623_0029805 | 3300046679 | Bacteria | 3511 |
| 1056 | Ga0495623_0487814 | 3300046679 | Bacteria | 652 |
| 1057 | Ga0495646_0007298 | 3300046680 | Bacteria | 7022 |
| 1058 | Ga0495646_0017374 | 3300046680 | Bacteria | 4563 |
| 1059 | Ga0495646_0101317 | 3300046680 | Bacteria | 1651 |
| 1060 | Ga0495646_0130269 | 3300046680 | Bacteria | 1416 |
| 1061 | Ga0495647_0006124 | 3300046681 | Bacteria | 3966 |
| 1062 | Ga0495647_0170830 | 3300046681 | Bacteria | 941 |
| 1063 | Ga0495647_0445906 | 3300046681 | Bacteria | 598 |
| 1064 | Ga0495658_0004362 | 3300046683 | Bacteria | 6965 |
| 1065 | Ga0495658_0006637 | 3300046683 | Bacteria | 5687 |
| 1066 | Ga0495658_0471380 | 3300046683 | Bacteria | 802 |
| 1067 | Ga0495658_1044498 | 3300046683 | Bacteria | 521 |
| 1068 | Ga0495669_0258820 | 3300046684 | Bacteria | 836 |
| 1069 | Ga0495613_0001421 | 3300046689 | Bacteria | 18261 |
| 1070 | Ga0495624_0078164 | 3300046690 | Bacteria | 2052 |
| 1071 | Ga0495670_0000579 | 3300046691 | Bacteria | 17498 |
| 1072 | Ga0495589_0126138 | 3300046794 | Bacteria | 1231 |
| 1073 | Ga0495600_0005626 | 3300046809 | Bacteria | 7568 |
| 1074 | Ga0495600_0013325 | 3300046809 | Bacteria | 5163 |
| 1075 | Ga0495600_0075167 | 3300046809 | Bacteria | 2206 |
| 1076 | Ga0495600_0134908 | 3300046809 | Bacteria | 1604 |
| 1077 | Ga0495600_0177451 | 3300046809 | Bacteria | 1373 |
| 1078 | Ga0495581_0030170 | 3300047315 | Bacteria | 3143 |
| 1079 | Ga0495581_0036393 | 3300047315 | Bacteria | 2848 |
| 1080 | Ga0495581_0057219 | 3300047315 | Bacteria | 2250 |
| 1081 | Ga0495604_0013922 | 3300047317 | Bacteria | 6416 |
| 1082 | Ga0495604_0041061 | 3300047317 | Bacteria | 3630 |
| 1083 | Ga0495604_0140785 | 3300047317 | Bacteria | 1723 |
| 1084 | Ga0495674_0036977 | 3300047319 | Bacteria | 4388 |
| 1085 | Ga0495674_0048019 | 3300047319 | Bacteria | 3780 |
| 1086 | Ga0495674_0056005 | 3300047319 | Bacteria | 3456 |
| 1087 | Ga0495674_1357126 | 3300047319 | Bacteria | 531 |
| 1088 | Ga0495676_0146085 | 3300047321 | Bacteria | 1689 |
| 1089 | Ga0495676_0175042 | 3300047321 | Bacteria | 1507 |
| 1090 | Ga0495676_0191878 | 3300047321 | Bacteria | 1424 |
| 1091 | Ga0495680_0040361 | 3300047322 | Bacteria | 3720 |
| 1092 | Ga0495680_0042659 | 3300047322 | Bacteria | 3598 |
| 1093 | Ga0495680_0048604 | 3300047322 | Bacteria | 3330 |
| 1094 | Ga0495680_0094466 | 3300047322 | Bacteria | 2237 |
| 1095 | Ga0495680_0239396 | 3300047322 | Bacteria | 1289 |
| 1096 | Ga0495680_0925659 | 3300047322 | Unclassified | 561 |
| 1097 | Ga0495675_0003995 | 3300047444 | Bacteria | 8937 |
| 1098 | Ga0495675_0007873 | 3300047444 | Bacteria | 6585 |
| 1099 | Ga0495675_0198415 | 3300047444 | Bacteria | 1222 |
| 1100 | Ga0495675_0478999 | 3300047444 | Bacteria | 717 |
| 1101 | Ga0495675_0820944 | 3300047444 | Bacteria | 513 |
| 1102 | Ga0495679_038861 | 3300047446 | Bacteria | 1488 |
| 1103 | Ga0495684_0000281 | 3300047471 | Bacteria | 41079 |
| 1104 | Ga0495684_0058854 | 3300047471 | Bacteria | 2926 |
| 1105 | Ga0495684_0136135 | 3300047471 | Bacteria | 1843 |
| 1106 | Ga0495593_0001313 | 3300047673 | Bacteria | 14566 |
| 1107 | Ga0495593_0045482 | 3300047673 | Bacteria | 2342 |
| 1108 | Ga0495593_0132677 | 3300047673 | Unclassified | 1264 |
| 1109 | Ga0495593_0170894 | 3300047673 | Bacteria | 1096 |
| 1110 | Ga0495602_0010155 | 3300048088 | Bacteria | 9775 |
| 1111 | Ga0495602_0167764 | 3300048088 | Bacteria | 1707 |
| 1112 | Ga0495602_0222154 | 3300048088 | Bacteria | 1425 |
| 1113 | Ga0495602_0280567 | 3300048088 | Bacteria | 1227 |
| 1114 | Ga0495602_0317411 | 3300048088 | Bacteria | 1135 |
| 1115 | Ga0495614_0009362 | 3300048089 | Bacteria | 4332 |
| 1116 | Ga0495614_0281677 | 3300048089 | Unclassified | 765 |
| 1117 | Ga0495614_0499980 | 3300048089 | Bacteria | 578 |
| 1118 | Ga0496100_0010589 | 3300048903 | Bacteria | 5223 |
| 1119 | Ga0496100_0033704 | 3300048903 | Bacteria | 3206 |
| 1120 | Ga0496101_0031405 | 3300048904 | Bacteria | 3733 |
| 1121 | Ga0496101_0126413 | 3300048904 | Bacteria | 1937 |
| 1122 | Ga0496101_0130906 | 3300048904 | Bacteria | 1905 |
| 1123 | Ga0496101_0942249 | 3300048904 | Bacteria | 679 |
| 1124 | Ga0496102_0146497 | 3300048905 | Bacteria | 2216 |
| 1125 | Ga0496102_0309115 | 3300048905 | Bacteria | 1490 |
| 1126 | Ga0496102_0850487 | 3300048905 | Bacteria | 834 |
| 1127 | Ga0496103_0054280 | 3300048906 | Bacteria | 2483 |
| 1128 | Ga0496103_0181320 | 3300048906 | Bacteria | 1353 |
| 1129 | Ga0496104_0000140 | 3300048907 | Bacteria | 67259 |
| 1130 | Ga0496104_0012874 | 3300048907 | Bacteria | 7533 |
| 1131 | Ga0496104_0085385 | 3300048907 | Bacteria | 3013 |
| 1132 | Ga0496104_0251348 | 3300048907 | Bacteria | 1680 |
| 1133 | Ga0496104_0287181 | 3300048907 | Bacteria | 1557 |
| 1134 | Ga0496104_0822785 | 3300048907 | Bacteria | 834 |
| 1135 | Ga0496105_0000576 | 3300048908 | Bacteria | 24313 |
| 1136 | Ga0496105_0070598 | 3300048908 | Bacteria | 2887 |
| 1137 | Ga0496105_0108795 | 3300048908 | Bacteria | 2288 |
| 1138 | Ga0496105_0284122 | 3300048908 | Bacteria | 1333 |
| 1139 | Ga0496105_0442483 | 3300048908 | Bacteria | 1027 |
| 1140 | Ga0496105_1361051 | 3300048908 | Bacteria | 516 |
| 1141 | Ga0496106_0024928 | 3300048909 | Bacteria | 4448 |
| 1142 | Ga0496106_0029544 | 3300048909 | Bacteria | 4085 |
| 1143 | Ga0496106_0046226 | 3300048909 | Bacteria | 3271 |
| 1144 | Ga0496106_1336315 | 3300048909 | Bacteria | 555 |
| 1145 | Ga0496107_0010578 | 3300048910 | Bacteria | 6415 |
| 1146 | Ga0496107_0061801 | 3300048910 | Bacteria | 2712 |
| 1147 | Ga0496107_0164228 | 3300048910 | Bacteria | 1646 |
| 1148 | Ga0496107_0337463 | 3300048910 | Bacteria | 1121 |
| 1149 | Ga0496108_0000639 | 3300048911 | Bacteria | 27304 |
| 1150 | Ga0496108_0016770 | 3300048911 | Bacteria | 5983 |
| 1151 | Ga0496108_0035329 | 3300048911 | Bacteria | 4154 |
| 1152 | Ga0496108_0068074 | 3300048911 | Bacteria | 3003 |
| 1153 | Ga0496108_0246307 | 3300048911 | Bacteria | 1555 |
| 1154 | Ga0496108_0461891 | 3300048911 | Bacteria | 1109 |
| 1155 | Ga0496109_0000619 | 3300048912 | Bacteria | 29616 |
| 1156 | Ga0496109_0031729 | 3300048912 | Bacteria | 4744 |
| 1157 | Ga0496109_0134593 | 3300048912 | Bacteria | 2308 |
| 1158 | Ga0496109_0221900 | 3300048912 | Bacteria | 1777 |
| 1159 | Ga0496109_0280340 | 3300048912 | Bacteria | 1571 |
| 1160 | Ga0496110_0046770 | 3300048913 | Bacteria | 3786 |
| 1161 | Ga0496110_0199125 | 3300048913 | Bacteria | 1819 |
| 1162 | Ga0496110_0230461 | 3300048913 | Bacteria | 1684 |
| 1163 | Ga0496111_0010913 | 3300048914 | Bacteria | 6111 |
| 1164 | Ga0496111_0214910 | 3300048914 | Bacteria | 1428 |
| 1165 | Ga0496111_0319668 | 3300048914 | Unclassified | 1150 |
| 1166 | Ga0496112_0002285 | 3300048915 | Bacteria | 15329 |
| 1167 | Ga0496112_0006392 | 3300048915 | Bacteria | 10343 |
| 1168 | Ga0496112_0908958 | 3300048915 | Unclassified | 802 |
| 1169 | Ga0496113_0006622 | 3300048916 | Bacteria | 7368 |
| 1170 | Ga0496113_0188187 | 3300048916 | Bacteria | 1638 |
| 1171 | Ga0496113_0921350 | 3300048916 | Bacteria | 690 |
| 1172 | Ga0496113_0979835 | 3300048916 | Bacteria | 666 |
| 1173 | Ga0496114_0011636 | 3300048917 | Bacteria | 7036 |
| 1174 | Ga0496114_0016617 | 3300048917 | Bacteria | 5933 |
| 1175 | Ga0496114_0095862 | 3300048917 | Bacteria | 2525 |
| 1176 | Ga0496114_0396394 | 3300048917 | Bacteria | 1222 |
| 1177 | Ga0496115_0015149 | 3300048918 | Bacteria | 5843 |
| 1178 | Ga0496115_0020630 | 3300048918 | Bacteria | 5084 |
| 1179 | Ga0496115_0250423 | 3300048918 | Bacteria | 1458 |
| 1180 | Ga0496115_0563329 | 3300048918 | Bacteria | 909 |
| 1181 | Ga0495682_0372670 | 3300049460 | Bacteria | 503 |
| 1182 | Ga0501031_0019351 | 3300049568 | Bacteria | 4435 |
| 1183 | Ga0501032_0995383 | 3300049569 | Bacteria | 527 |
| 1184 | Ga0501033_0001099 | 3300049570 | Bacteria | 24511 |
| 1185 | Ga0501034_0083711 | 3300049571 | Bacteria | 3192 |
| 1186 | Ga0501034_0137379 | 3300049571 | Bacteria | 2425 |
| 1187 | Ga0501034_0153944 | 3300049571 | Bacteria | 2274 |
| 1188 | Ga0501036_0060843 | 3300049572 | Bacteria | 3198 |
| 1189 | Ga0501036_0612301 | 3300049572 | Bacteria | 903 |
| 1190 | Ga0501036_0801392 | 3300049572 | Bacteria | 776 |
| 1191 | Ga0501037_0002613 | 3300049573 | Bacteria | 13003 |
| 1192 | Ga0501038_0044217 | 3300049574 | Bacteria | 3871 |
| 1193 | Ga0501038_1072737 | 3300049574 | Bacteria | 589 |
| 1194 | Ga0501039_0149882 | 3300049575 | Bacteria | 1832 |
| 1195 | Ga0501039_0155277 | 3300049575 | Bacteria | 1798 |
| 1196 | Ga0501039_0832229 | 3300049575 | Bacteria | 720 |
| 1197 | Ga0501040_0052628 | 3300049576 | Bacteria | 2788 |
| 1198 | Ga0501040_1042857 | 3300049576 | Bacteria | 593 |
| 1199 | Ga0501041_0246800 | 3300049577 | Bacteria | 1122 |
| 1200 | Ga0501042_0067708 | 3300049578 | Bacteria | 2553 |
| 1201 | Ga0501042_0124564 | 3300049578 | Bacteria | 1855 |
| 1202 | Ga0501043_0117522 | 3300049579 | Bacteria | 2086 |
| 1203 | Ga0501046_0036477 | 3300049580 | Bacteria | 3955 |
| 1204 | Ga0501046_0051536 | 3300049580 | Bacteria | 3247 |
| 1205 | Ga0501046_0562196 | 3300049580 | Bacteria | 812 |
| 1206 | Ga0501047_0008549 | 3300049581 | Bacteria | 9658 |
| 1207 | Ga0501047_0046207 | 3300049581 | Bacteria | 4208 |
| 1208 | Ga0501047_1042770 | 3300049581 | Bacteria | 631 |
| 1209 | Ga0501047_1311621 | 3300049581 | Bacteria | 538 |
| 1210 | Ga0501048_0354681 | 3300049582 | Bacteria | 1046 |
| 1211 | Ga0501067_0002227 | 3300049583 | Bacteria | 10726 |
| 1212 | Ga0501067_0068672 | 3300049583 | Bacteria | 1962 |
| 1213 | Ga0501068_0035230 | 3300049584 | Bacteria | 2987 |
| 1214 | Ga0501068_0124689 | 3300049584 | Bacteria | 1608 |
| 1215 | Ga0501069_0050135 | 3300049585 | Bacteria | 2321 |
| 1216 | Ga0501069_0223836 | 3300049585 | Bacteria | 1094 |
| 1217 | Ga0501069_0398242 | 3300049585 | Bacteria | 814 |
| 1218 | Ga0501070_0027855 | 3300049586 | Bacteria | 4739 |
| 1219 | Ga0501070_0160980 | 3300049586 | Bacteria | 1850 |
| 1220 | Ga0501070_0397775 | 3300049586 | Bacteria | 1114 |
| 1221 | Ga0501070_0609232 | 3300049586 | Bacteria | 870 |
| 1222 | Ga0501070_1263559 | 3300049586 | Bacteria | 565 |
| 1223 | Ga0501070_1464559 | 3300049586 | Unclassified | 517 |
| 1224 | Ga0501071_0081885 | 3300049587 | Bacteria | 2363 |
| 1225 | Ga0501071_0197190 | 3300049587 | Bacteria | 1511 |
| 1226 | Ga0501072_0019663 | 3300049588 | Bacteria | 5224 |
| 1227 | Ga0501072_0020222 | 3300049588 | Bacteria | 5155 |
| 1228 | Ga0501072_1516789 | 3300049588 | Bacteria | 517 |
| 1229 | Ga0501073_0098368 | 3300049589 | Bacteria | 2032 |
| 1230 | Ga0501073_0203077 | 3300049589 | Bacteria | 1370 |
| 1231 | Ga0501073_0228447 | 3300049589 | Bacteria | 1286 |
| 1232 | Ga0501073_0304403 | 3300049589 | Bacteria | 1100 |
| 1233 | Ga0501073_0488134 | 3300049589 | Bacteria | 852 |
| 1234 | Ga0501073_0510677 | 3300049589 | Bacteria | 831 |
| 1235 | Ga0501074_0096432 | 3300049590 | Bacteria | 2117 |
| 1236 | Ga0501074_0236637 | 3300049590 | Bacteria | 1299 |
| 1237 | Ga0501075_0448004 | 3300049591 | Bacteria | 984 |
| 1238 | Ga0501075_0635741 | 3300049591 | Bacteria | 814 |
| 1239 | Ga0501076_0012137 | 3300049592 | Bacteria | 6441 |
| 1240 | Ga0501076_0065020 | 3300049592 | Bacteria | 2908 |
| 1241 | Ga0501076_0653337 | 3300049592 | Bacteria | 868 |
| 1242 | Ga0501076_0704391 | 3300049592 | Bacteria | 833 |
| 1243 | Ga0501076_0770996 | 3300049592 | Bacteria | 794 |
| 1244 | Ga0501077_0024392 | 3300049593 | Bacteria | 3841 |
| 1245 | Ga0501077_0097791 | 3300049593 | Bacteria | 1860 |
| 1246 | Ga0501077_0109851 | 3300049593 | Bacteria | 1747 |
| 1247 | Ga0501079_0127033 | 3300049741 | Bacteria | 1983 |
| 1248 | Ga0501079_0988107 | 3300049741 | Bacteria | 663 |
| 1249 | Ga0501080_0073023 | 3300049742 | Bacteria | 3191 |
| 1250 | Ga0501080_0160437 | 3300049742 | Bacteria | 2077 |
| 1251 | Ga0501080_0711444 | 3300049742 | Bacteria | 885 |
| 1252 | Ga0501081_0013430 | 3300049743 | Bacteria | 5386 |
| 1253 | Ga0501083_0023594 | 3300049744 | Bacteria | 4265 |
| 1254 | Ga0501083_0153262 | 3300049744 | Bacteria | 1509 |
| 1255 | Ga0501083_0208457 | 3300049744 | Bacteria | 1274 |
| 1256 | Ga0501083_0211946 | 3300049744 | Bacteria | 1263 |
| 1257 | Ga0501083_0240119 | 3300049744 | Bacteria | 1179 |
| 1258 | Ga0501083_0342841 | 3300049744 | Bacteria | 971 |
| 1259 | Ga0501083_0415413 | 3300049744 | Bacteria | 875 |
| 1260 | Ga0501035_0003995 | 3300049822 | Bacteria | 14069 |
| 1261 | Ga0501035_0023875 | 3300049822 | Bacteria | 5611 |
| 1262 | Ga0501035_0440570 | 3300049822 | Bacteria | 1079 |
| 1263 | Ga0501044_0036955 | 3300049823 | Bacteria | 5106 |
| 1264 | Ga0501044_0102282 | 3300049823 | Bacteria | 2881 |
| 1265 | Ga0501044_0115111 | 3300049823 | Bacteria | 2694 |
| 1266 | Ga0501044_0369420 | 3300049823 | Bacteria | 1351 |
| 1267 | Ga0501044_1031010 | 3300049823 | Bacteria | 694 |
| 1268 | Ga0501045_0090524 | 3300049824 | Bacteria | 2261 |
| 1269 | nmdc:mga03683_147799_c1 | 3300050489 | Bacteria | 1059 |
| 1270 | nmdc:mga03n38_362536_c1 | 3300050490 | Bacteria | 791 |
| 1271 | nmdc:mga00v17_294139_c1 | 3300050491 | Bacteria | 1054 |
| 1272 | nmdc:mga06z11_661061_c1 | 3300050494 | Bacteria | 636 |
| 1273 | nmdc:mga05p37_44027_c1 | 3300050507 | Bacteria | 5492 |
| 1274 | nmdc:mga05p37_51_c1 | 3300050507 | Bacteria | 103396 |
| 1275 | nmdc:mga05p37_819_c2 | 3300050507 | Bacteria | 27529 |
| 1276 | nmdc:mga09592_1078_c1 | 3300050508 | Bacteria | 19140 |
| 1277 | nmdc:mga09592_1891_c1 | 3300050508 | Bacteria | 16858 |
| 1278 | nmdc:mga0qj67_1161078_c1 | 3300050509 | Bacteria | 602 |
| 1279 | nmdc:mga0qj67_23665_c1 | 3300050509 | Bacteria | 4726 |
| 1280 | nmdc:mga0qj67_6890_c1 | 3300050509 | Bacteria | 8361 |
| 1281 | nmdc:mga06r32_153407_c1 | 3300050510 | Bacteria | 2283 |
| 1282 | nmdc:mga06r32_16_c1 | 3300050510 | Bacteria | 101899 |
| 1283 | nmdc:mga06r32_578710_c1 | 3300050510 | Bacteria | 1095 |
| 1284 | nmdc:mga06r32_677396_c1 | 3300050510 | Bacteria | 998 |
| 1285 | nmdc:mga08y16_2600_c1 | 3300050511 | Bacteria | 18544 |
| 1286 | nmdc:mga08y16_697_c1 | 3300050511 | Bacteria | 31905 |
| 1287 | nmdc:mga08y16_794739_c1 | 3300050511 | Bacteria | 939 |
| 1288 | nmdc:mga08y16_79_c2 | 3300050511 | Bacteria | 54400 |
| 1289 | nmdc:mga0n895_1465712_c1 | 3300050512 | Bacteria | 650 |
| 1290 | nmdc:mga0n895_250277_c1 | 3300050512 | Bacteria | 1798 |
| 1291 | nmdc:mga0n895_258404_c1 | 3300050512 | Bacteria | 1768 |
| 1292 | nmdc:mga0n895_609_c1 | 3300050512 | Bacteria | 24818 |
| 1293 | nmdc:mga0rr50_1280098_c1 | 3300050513 | Bacteria | 622 |
| 1294 | nmdc:mga0rr50_417377_c1 | 3300050513 | Bacteria | 1135 |
| 1295 | nmdc:mga0rr50_4488_c1 | 3300050513 | Bacteria | 8220 |
| 1296 | nmdc:mga0rr50_48326_c1 | 3300050513 | Bacteria | 3144 |
| 1297 | nmdc:mga0rr50_56833_c1 | 3300050513 | Bacteria | 2925 |
| 1298 | nmdc:mga08x19_442365_c1 | 3300050514 | Bacteria | 914 |
| 1299 | nmdc:mga08x19_67630_c1 | 3300050514 | Bacteria | 2324 |
| 1300 | nmdc:mga08x19_699687_c1 | 3300050514 | Bacteria | 719 |
| 1301 | nmdc:mga0a205_967_c1 | 3300050515 | Bacteria | 23723 |
| 1302 | Ga0495601_0008343 | 3300053077 | Bacteria | 6119 |
| 1303 | Ga0495601_0011417 | 3300053077 | Bacteria | 5311 |
| 1304 | Ga0495601_0014707 | 3300053077 | Bacteria | 4720 |
| 1305 | Ga0495601_0017667 | 3300053077 | Bacteria | 4332 |
| 1306 | Ga0495601_0024406 | 3300053077 | Bacteria | 3723 |
| 1307 | Ga0495601_0039920 | 3300053077 | Bacteria | 2939 |
| 1308 | Ga0495601_0109933 | 3300053077 | Bacteria | 1785 |
| 1309 | Ga0495612_0001680 | 3300053078 | Bacteria | 9110 |
| 1310 | Ga0495612_0003005 | 3300053078 | Bacteria | 7000 |
| 1311 | Ga0495612_0122302 | 3300053078 | Bacteria | 1120 |
| 1312 | Ga0495612_0168648 | 3300053078 | Bacteria | 958 |
| 1313 | Ga0495612_0271646 | 3300053078 | Bacteria | 756 |
| 1314 | Ga0495612_0532802 | 3300053078 | Bacteria | 540 |
| 1315 | Ga0495595_0004028 | 3300053084 | Bacteria | 5879 |
| 1316 | Ga0495595_0004570 | 3300053084 | Bacteria | 5567 |
| 1317 | Ga0495595_0007466 | 3300053084 | Bacteria | 4477 |
| 1318 | Ga0495595_0012972 | 3300053084 | Bacteria | 3515 |
| 1319 | Ga0495595_0063818 | 3300053084 | Bacteria | 1730 |
| 1320 | Ga0495595_0065786 | 3300053084 | Bacteria | 1705 |
| 1321 | Ga0495595_0582004 | 3300053084 | Bacteria | 572 |
| 1322 | Ga0495619_0001224 | 3300053085 | Bacteria | 16809 |
| 1323 | Ga0495619_0003768 | 3300053085 | Bacteria | 9751 |
| 1324 | Ga0495619_0003841 | 3300053085 | Bacteria | 9670 |
| 1325 | Ga0495619_0004658 | 3300053085 | Bacteria | 8739 |
| 1326 | Ga0495619_0008730 | 3300053085 | Bacteria | 6408 |
| 1327 | Ga0495619_0022348 | 3300053085 | Bacteria | 4046 |
| 1328 | Ga0495619_0056937 | 3300053085 | Bacteria | 2593 |
| 1329 | Ga0500566_0153479 | 3300053094 | Unclassified | 1208 |
| 1330 | Ga0500559_0017732 | 3300053136 | Bacteria | 3009 |
| 1331 | Ga0500568_0051813 | 3300053139 | Bacteria | 1613 |
| 1332 | Ga0500603_059207 | 3300053150 | Bacteria | 1067 |
| 1333 | Ga0500636_0221998 | 3300053177 | Bacteria | 984 |
| 1334 | Ga0500636_0506793 | 3300053177 | Bacteria | 532 |
| 1335 | Ga0501084_0027428 | 3300054114 | Bacteria | 4759 |
| 1336 | Ga0501084_0081748 | 3300054114 | Bacteria | 2710 |
| 1337 | Ga0501084_0081902 | 3300054114 | Bacteria | 2707 |
| 1338 | Ga0501084_0086177 | 3300054114 | Bacteria | 2637 |
| 1339 | Ga0501084_0104404 | 3300054114 | Bacteria | 2380 |
| 1340 | Ga0501084_0317179 | 3300054114 | Bacteria | 1317 |
| 1341 | Ga0501084_1119160 | 3300054114 | Bacteria | 661 |
| 1342 | Ga0501084_1349359 | 3300054114 | Bacteria | 597 |
| 1343 | Ga0501084_1868594 | 3300054114 | Bacteria | 501 |
| 1344 | Ga0501082_0072147 | 3300060353 | Bacteria | 2974 |
| 1345 | Ga0501082_0132410 | 3300060353 | Bacteria | 2163 |
| 1346 | Ga0501082_0134001 | 3300060353 | Bacteria | 2149 |
| 1347 | Ga0501082_0466796 | 3300060353 | Bacteria | 1103 |
| 1348 | Ga0501082_1085089 | 3300060353 | Bacteria | 700 |
| 1349 | Ga0501082_1782244 | 3300060353 | Bacteria | 537 |
| 1350 | Ga0466962_0168550 | 3300061719 | Unclassified | 1066 |
| 1351 | Ga0530510_0082610 | 3300061734 | Bacteria | 2339 |
| 1352 | Ga0068868_100164763 | |||
| 1353 | 2214736895 | |||
| 1354 | ARcpr5oldR_c000311 | |||
| 1355 | ARcpr5oldR_c000840 | |||
| 1356 | ARSoilYngRDRAFT_c00517 | |||
| 1357 | ARcpr5yngRDRAFT_c000610 | |||
| 1358 | ARSoilOldRDRAFT_c000709 | |||
| 1359 | ARCol0oldRDRAFT_c00116 | |||
| 1360 | ARCol0yngRDRAFT_1000064 | |||
| 1361 | JGI24032J14994_100183 | |||
| 1362 | JGI24736J21556_1014667 | |||
| 1363 | JGI24741J21665_1037267 | |||
| 1364 | JGI24752J21851_1026145 | |||
| 1365 | JGI24746J21847_1001338 | |||
| 1366 | JGI24747J21853_1007734 | |||
| 1367 | JGI24739J22299_10006224 | |||
| 1368 | JGI24737J22298_10004778 | |||
| 1369 | JGI24737J22298_10009245 | |||
| 1370 | JGI24743J22301_10032837 | |||
| 1371 | JGI24750J21931_1000306 | |||
| 1372 | JGI24745J21846_1001741 | |||
| 1373 | JGI24745J21846_1016728 | |||
| 1374 | JGI24738J21930_10000348 | |||
| 1375 | JGI24749J21850_1006472 | |||
| 1376 | JGI24749J21850_1011879 | |||
| 1377 | JGI24744J21845_10008338 | |||
| 1378 | JGI24035J26624_1002077 | |||
| 1379 | JGI24033J26618_1011225 | |||
| 1380 | JGI24034J26672_10001042 | |||
| 1381 | JGI24034J26672_10034750 | |||
| 1382 | JGI24742J22300_10007045 | |||
| 1383 | JGI24742J22300_10084154 | |||
| 1384 | Ga0055524_1007164 | |||
| 1385 | JGI25405J52794_10007697 | |||
| 1386 | JGI25405J52794_10009033 | |||
| 1387 | Ga0065717_1004561 | |||
| 1388 | Ga0065716_1000386 | |||
| 1389 | Ga0065714_10358745 | |||
| 1390 | Ga0065704_10102914 | |||
| 1391 | Ga0065712_10001837 | |||
| 1392 | Ga0065712_10210982 | |||
| 1393 | Ga0065712_10826253 | |||
| 1394 | Ga0065715_10002792 | |||
| 1395 | Ga0065715_10011595 | |||
| 1396 | Ga0065707_10116186 | |||
| 1397 | Ga0065707_10187256 | |||
| 1398 | Ga0070658_10022098 | |||
| 1399 | Ga0070676_10000374 | |||
| 1400 | Ga0070676_10135789 | |||
| 1401 | Ga0070676_10405950 | |||
| 1402 | Ga0070683_100003823 | |||
| 1403 | Ga0070683_100314271 | |||
| 1404 | Ga0070683_100695158 | |||
| 1405 | Ga0070683_100700523 | |||
| 1406 | Ga0070683_101331083 | |||
| 1407 | Ga0070690_100133199 | |||
| 1408 | Ga0070690_100228846 | |||
| 1409 | Ga0070670_100055679 | |||
| 1410 | Ga0070677_10000461 | |||
| 1411 | Ga0068869_100001399 | |||
| 1412 | Ga0070666_10014716 | |||
| 1413 | Ga0070666_10041967 | |||
| 1414 | Ga0070666_11047110 | |||
| 1415 | Ga0070680_100012044 | |||
| 1416 | Ga0070680_100202372 | |||
| 1417 | Ga0070680_100296175 | |||
| 1418 | Ga0070680_100593257 | |||
| 1419 | Ga0070680_100897397 | |||
| 1420 | Ga0070682_100001646 | |||
| 1421 | Ga0070682_100073361 | |||
| 1422 | Ga0070682_100909994 | |||
| 1423 | Ga0070682_101633390 | |||
| 1424 | Ga0068868_100000857 | |||
| 1425 | Ga0070660_100002034 | |||
| 1426 | Ga0070660_100025298 | |||
| 1427 | Ga0070660_100445567 | |||
| 1428 | Ga0070660_101235811 | |||
| 1429 | Ga0070660_101322388 | |||
| 1430 | Ga0070689_100040860 | |||
| 1431 | Ga0070689_100077743 | |||
| 1432 | Ga0070691_10039715 | |||
| 1433 | Ga0070691_10056343 | |||
| 1434 | Ga0070687_100146638 | |||
| 1435 | Ga0070687_100421442 | |||
| 1436 | Ga0070661_100002763 | |||
| 1437 | Ga0070661_100063093 | |||
| 1438 | Ga0070661_100329926 | |||
| 1439 | Ga0070661_100919728 | |||
| 1440 | Ga0070661_101112003 | |||
| 1441 | Ga0070692_10013586 | |||
| 1442 | Ga0070692_10175784 | |||
| 1443 | Ga0070692_10340229 | |||
| 1444 | Ga0070668_100240164 | |||
| 1445 | Ga0070668_100287276 | |||
| 1446 | Ga0070668_100399690 | |||
| 1447 | Ga0070669_100022340 | |||
| 1448 | Ga0070675_100055352 | |||
| 1449 | Ga0070675_100132287 | |||
| 1450 | Ga0070675_100627970 | |||
| 1451 | Ga0070671_100000944 | |||
| 1452 | Ga0070671_100024654 | |||
| 1453 | Ga0070671_100142954 | |||
| 1454 | Ga0070674_100042093 | |||
| 1455 | Ga0070674_100053296 | |||
| 1456 | Ga0070674_100061289 | |||
| 1457 | Ga0070674_100621797 | |||
| 1458 | Ga0070673_100000633 | |||
| 1459 | Ga0070673_100021643 | |||
| 1460 | Ga0070673_100317111 | |||
| 1461 | Ga0070688_100006703 | |||
| 1462 | Ga0070688_100020601 | |||
| 1463 | Ga0070659_100185474 | |||
| 1464 | Ga0070659_100246600 | |||
| 1465 | Ga0070659_100772188 | |||
| 1466 | Ga0070659_101959422 | |||
| 1467 | Ga0070667_100001396 | |||
| 1468 | Ga0070667_100045449 | |||
| 1469 | Ga0070667_100078400 | |||
| 1470 | Ga0070667_101321862 | |||
| 1471 | Ga0070703_10206707 | |||
| 1472 | Ga0070709_10005668 | |||
| 1473 | Ga0070709_10006339 | |||
| 1474 | Ga0070709_10277063 | |||
| 1475 | Ga0070709_10788793 | |||
| 1476 | Ga0070709_11722090 | |||
| 1477 | Ga0070714_100024472 | |||
| 1478 | Ga0070714_100091275 | |||
| 1479 | Ga0070714_100125523 | |||
| 1480 | Ga0070714_100192333 | |||
| 1481 | Ga0070714_101226898 | |||
| 1482 | Ga0070714_101321270 | |||
| 1483 | Ga0070713_100011762 | |||
| 1484 | Ga0070713_100018486 | |||
| 1485 | Ga0070713_100027651 | |||
| 1486 | Ga0070713_100216831 | |||
| 1487 | Ga0070713_100482492 | |||
| 1488 | Ga0070713_100831263 | |||
| 1489 | Ga0070710_10003944 | |||
| 1490 | Ga0070710_10025481 | |||
| 1491 | Ga0070710_10030724 | |||
| 1492 | Ga0070710_11009764 | |||
| 1493 | Ga0070710_11355693 | |||
| 1494 | Ga0070710_11456976 | |||
| 1495 | Ga0070701_10002950 | |||
| 1496 | Ga0070711_100128434 | |||
| 1497 | Ga0070711_100140581 | |||
| 1498 | Ga0070711_100188181 | |||
| 1499 | Ga0070711_100290711 | |||
| 1500 | Ga0070705_100001427 | |||
| 1501 | Ga0070705_100041318 | |||
| 1502 | Ga0070705_100223386 | |||
| 1503 | Ga0070705_100965285 | |||
| 1504 | Ga0070700_100001316 | |||
| 1505 | Ga0070700_100321790 | |||
| 1506 | Ga0070694_100121265 | |||
| 1507 | Ga0070694_101867724 | |||
| 1508 | Ga0070708_100212038 | |||
| 1509 | Ga0070708_101930509 | |||
| 1510 | Ga0070663_100041246 | |||
| 1511 | Ga0070663_100274035 | |||
| 1512 | Ga0070663_100384697 | |||
| 1513 | Ga0070663_100546701 | |||
| 1514 | Ga0070663_101641066 | |||
| 1515 | Ga0070678_100001338 | |||
| 1516 | Ga0070678_100253145 | |||
| 1517 | Ga0070662_100020664 | |||
| 1518 | Ga0070662_100197745 | |||
| 1519 | Ga0070662_100283385 | |||
| 1520 | Ga0070681_10013616 | |||
| 1521 | Ga0070681_10020378 | |||
| 1522 | Ga0070681_10076377 | |||
| 1523 | Ga0070681_10263620 | |||
| 1524 | Ga0070681_10416319 | |||
| 1525 | Ga0070681_10666300 | |||
| 1526 | Ga0070681_10754447 | |||
| 1527 | Ga0070681_10789896 | |||
| 1528 | Ga0070681_10804884 | |||
| 1529 | Ga0068867_100003745 | |||
| 1530 | Ga0070685_10010368 | |||
| 1531 | Ga0070685_10019913 | |||
| 1532 | Ga0070707_100256385 | |||
| 1533 | Ga0070707_100259696 | |||
| 1534 | Ga0070698_101374633 | |||
| 1535 | Ga0074259_10443300 | |||
| 1536 | Ga0070699_100376173 | |||
| 1537 | Ga0070679_100014385 | |||
| 1538 | Ga0070679_100024499 | |||
| 1539 | Ga0070679_100118277 | |||
| 1540 | Ga0070679_100134690 | |||
| 1541 | Ga0070679_100202648 | |||
| 1542 | Ga0070684_100138386 | |||
| 1543 | Ga0070684_100151175 | |||
| 1544 | Ga0070684_100596753 | |||
| 1545 | Ga0070684_101726885 | |||
| 1546 | Ga0070684_101819163 | |||
| 1547 | Ga0070684_102073700 | |||
| 1548 | Ga0070697_100925803 | |||
| 1549 | Ga0070697_101152522 | |||
| 1550 | Ga0070697_101434970 | |||
| 1551 | Ga0068853_100002812 | |||
| 1552 | Ga0068853_100220561 | |||
| 1553 | Ga0068853_100784076 | |||
| 1554 | Ga0068853_100851263 | |||
| 1555 | Ga0068853_101414888 | |||
| 1556 | Ga0068853_101634942 | |||
| 1557 | Ga0068853_101961692 | |||
| 1558 | Ga0070672_100003770 | |||
| 1559 | Ga0070686_100011271 | |||
| 1560 | Ga0070686_100033789 | |||
| 1561 | Ga0070695_100024486 | |||
| 1562 | Ga0070695_101013966 | |||
| 1563 | Ga0070696_100021036 | |||
| 1564 | Ga0070696_100021091 | |||
| 1565 | Ga0070693_100062750 | |||
| 1566 | Ga0070693_100068331 | |||
| 1567 | Ga0070693_100168804 | |||
| 1568 | Ga0070693_100468195 | |||
| 1569 | Ga0070693_101237549 | |||
| 1570 | Ga0070665_100017655 | |||
| 1571 | Ga0070665_100354537 | |||
| 1572 | Ga0070665_100788104 | |||
| 1573 | Ga0070704_100002635 | |||
| 1574 | Ga0070704_100040518 | |||
| 1575 | Ga0070704_100276867 | |||
| 1576 | Ga0068855_100081515 | |||
| 1577 | Ga0068855_100095442 | |||
| 1578 | Ga0068855_100329615 | |||
| 1579 | Ga0068855_100473873 | |||
| 1580 | Ga0068855_101339383 | |||
| 1581 | Ga0070664_100003713 | |||
| 1582 | Ga0070664_100232890 | |||
| 1583 | Ga0070664_100400858 | |||
| 1584 | Ga0070664_100754209 | |||
| 1585 | Ga0070664_101087941 | |||
| 1586 | Ga0070664_102150789 | |||
| 1587 | Ga0068857_100018167 | |||
| 1588 | Ga0068854_100064999 | |||
| 1589 | Ga0068854_101419759 | |||
| 1590 | Ga0068856_100069292 | |||
| 1591 | Ga0068856_100095206 | |||
| 1592 | Ga0068856_100165792 | |||
| 1593 | Ga0068856_100843706 | |||
| 1594 | Ga0068856_101668170 | |||
| 1595 | Ga0068856_102162476 | |||
| 1596 | Ga0070702_100068724 | |||
| 1597 | Ga0070702_100173249 | |||
| 1598 | Ga0070702_100781219 | |||
| 1599 | Ga0068852_100009996 | |||
| 1600 | Ga0068852_100153045 | |||
| 1601 | Ga0068852_100626123 | |||
| 1602 | Ga0068852_102674836 | |||
| 1603 | Ga0068859_100050266 | |||
| 1604 | Ga0068859_101023240 | |||
| 1605 | Ga0068859_101419395 | |||
| 1606 | Ga0068859_102407032 | |||
| 1607 | Ga0068864_100004113 | |||
| 1608 | Ga0068866_10001778 | |||
| 1609 | Ga0068866_10050206 | |||
| 1610 | Ga0068861_100090462 | |||
| 1611 | Ga0068870_10000630 | |||
| 1612 | Ga0068863_100001487 | |||
| 1613 | Ga0068863_100133784 | |||
| 1614 | Ga0068863_100444244 | |||
| 1615 | Ga0068858_100079144 | |||
| 1616 | Ga0068858_100137231 | |||
| 1617 | Ga0068858_100252503 | |||
| 1618 | Ga0068858_100877164 | |||
| 1619 | Ga0068860_100000338 | |||
| 1620 | Ga0068860_100001886 | |||
| 1621 | Ga0068860_100076172 | |||
| 1622 | Ga0068860_100322267 | |||
| 1623 | Ga0068862_100187335 | |||
| 1624 | Ga0068862_100562208 | |||
| 1625 | Ga0081455_10000313 | |||
| 1626 | Ga0081455_10001856 | |||
| 1627 | Ga0081455_10029804 | |||
| 1628 | Ga0081455_10067125 | |||
| 1629 | Ga0081455_10250521 | |||
| 1630 | Ga0081455_10277828 | |||
| 1631 | Ga0081540_1070887 | |||
| 1632 | Ga0070717_10000430 | |||
| 1633 | Ga0070717_10017570 | |||
| 1634 | Ga0070717_10737502 | |||
| 1635 | Ga0070717_10883178 | |||
| 1636 | Ga0075363_100146151 | |||
| 1637 | Ga0075364_10343519 | |||
| 1638 | Ga0075432_10001349 | |||
| 1639 | Ga0075432_10050289 | |||
| 1640 | Ga0075432_10535433 | |||
| 1641 | Ga0070715_10079654 | |||
| 1642 | Ga0070715_10126263 | |||
| 1643 | Ga0070715_10147717 | |||
| 1644 | Ga0070716_100000617 | |||
| 1645 | Ga0070716_100031514 | |||
| 1646 | Ga0070716_100217740 | |||
| 1647 | Ga0070712_100095843 | |||
| 1648 | Ga0070712_100139244 | |||
| 1649 | Ga0070712_100297247 | |||
| 1650 | Ga0075367_10127942 | |||
| 1651 | Ga0075427_10003324 | |||
| 1652 | Ga0097621_100008449 | |||
| 1653 | Ga0097621_100009717 | |||
| 1654 | Ga0097621_100078355 | |||
| 1655 | Ga0075370_10765251 | |||
| 1656 | Ga0068871_100001209 | |||
| 1657 | Ga0068871_100011630 | |||
| 1658 | Ga0068871_100026251 | |||
| 1659 | Ga0075428_100004387 | |||
| 1660 | Ga0075428_100205605 | |||
| 1661 | Ga0075428_100329777 | |||
| 1662 | Ga0075428_100768253 | |||
| 1663 | Ga0075430_100047563 | |||
| 1664 | Ga0075430_100062773 | |||
| 1665 | Ga0075430_100234177 | |||
| 1666 | Ga0075431_100000305 | |||
| 1667 | Ga0075431_100511793 | |||
| 1668 | Ga0075433_10000618 | |||
| 1669 | Ga0075433_10162525 | |||
| 1670 | Ga0075433_10260292 | |||
| 1671 | Ga0075434_100004516 | |||
| 1672 | Ga0075434_100004895 | |||
| 1673 | Ga0075434_100202084 | |||
| 1674 | Ga0075434_100325968 | |||
| 1675 | Ga0075434_100449212 | |||
| 1676 | Ga0075434_102349406 | |||
| 1677 | Ga0075429_100001751 | |||
| 1678 | Ga0075429_100002026 | |||
| 1679 | Ga0075429_100416782 | |||
| 1680 | Ga0068865_100018285 | |||
| 1681 | Ga0075436_100043548 | |||
| 1682 | Ga0075436_100441390 | |||
| 1683 | Ga0075436_100452601 | |||
| 1684 | Ga0097620_100050263 | |||
| 1685 | Ga0097620_101023256 | |||
| 1686 | Ga0097620_101419275 | |||
| 1687 | Ga0097620_102406494 | |||
| 1688 | Ga0075435_100004466 | |||
| 1689 | Ga0075435_100068391 | |||
| 1690 | Ga0075435_100069834 | |||
| 1691 | Ga0075435_100108968 | |||
| 1692 | Ga0075435_100385819 | |||
| 1693 | Ga0105251_10009665 | |||
| 1694 | Ga0105251_10256321 | |||
| 1695 | Ga0105244_10254702 | |||
| 1696 | Ga0105250_10033642 | |||
| 1697 | Ga0105250_10293962 | |||
| 1698 | Ga0105240_10329808 | |||
| 1699 | Ga0105240_10373606 | |||
| 1700 | Ga0105240_10544883 | |||
| 1701 | Ga0105240_11173567 | |||
| 1702 | Ga0105240_11370540 | |||
| 1703 | Ga0111539_10000072 | |||
| 1704 | Ga0111539_10001208 | |||
| 1705 | Ga0111539_10002538 | |||
| 1706 | Ga0111539_10024753 | |||
| 1707 | Ga0111539_10068136 | |||
| 1708 | Ga0111539_11367495 | |||
| 1709 | Ga0105245_10001702 | |||
| 1710 | Ga0105245_10010259 | |||
| 1711 | Ga0105245_10130671 | |||
| 1712 | Ga0105245_10407028 | |||
| 1713 | Ga0105245_10445267 | |||
| 1714 | Ga0105245_10863389 | |||
| 1715 | Ga0105245_11636724 | |||
| 1716 | Ga0105245_13010652 | |||
| 1717 | Ga0105247_10060167 | |||
| 1718 | Ga0114129_10009025 | |||
| 1719 | Ga0114129_10322990 | |||
| 1720 | Ga0105243_10010792 | |||
| 1721 | Ga0105243_10172488 | |||
| 1722 | Ga0105243_10250766 | |||
| 1723 | Ga0105243_10636278 | |||
| 1724 | Ga0105241_10008089 | |||
| 1725 | Ga0105241_10022718 | |||
| 1726 | Ga0105241_10377015 | |||
| 1727 | Ga0105241_11754421 | |||
| 1728 | Ga0105241_12521352 | |||
| 1729 | Ga0105242_10002547 | |||
| 1730 | Ga0105242_10003812 | |||
| 1731 | Ga0105242_10224540 | |||
| 1732 | Ga0105242_11400837 | |||
| 1733 | Ga0105242_12605580 | |||
| 1734 | Ga0105248_10030754 | |||
| 1735 | Ga0105248_10082675 | |||
| 1736 | Ga0105248_10144963 | |||
| 1737 | Ga0105248_13057615 | |||
| 1738 | Ga0105237_10041676 | |||
| 1739 | Ga0105237_10393473 | |||
| 1740 | Ga0105237_10835667 | |||
| 1741 | Ga0105237_12226476 | |||
| 1742 | Ga0105238_10174906 | |||
| 1743 | Ga0105238_10240578 | |||
| 1744 | Ga0105238_10244817 | |||
| 1745 | Ga0105238_10581366 | |||
| 1746 | Ga0105249_10002932 | |||
| 1747 | Ga0105249_10077851 | |||
| 1748 | Ga0105249_10284120 | |||
| 1749 | Ga0105239_10007571 | |||
| 1750 | Ga0105239_10359706 | |||
| 1751 | Ga0105239_10599296 | |||
| 1752 | Ga0105239_12258715 | |||
| 1753 | Ga0105239_12917551 | |||
| 1754 | Ga0105246_10000456 | |||
| 1755 | Ga0105246_10034993 | |||
| 1756 | Ga0157340_1017516 | |||
| 1757 | Ga0157340_1020878 | |||
| 1758 | Ga0157344_1002446 | |||
| 1759 | Ga0157346_1005461 | |||
| 1760 | Ga0157337_1000995 | |||
| 1761 | Ga0157337_1006072 | |||
| 1762 | Ga0157321_1003314 | |||
| 1763 | Ga0157341_1011855 | |||
| 1764 | Ga0157345_1006853 | |||
| 1765 | Ga0157314_1050750 | |||
| 1766 | Ga0157324_1000599 | |||
| 1767 | Ga0157342_1000152 | |||
| 1768 | Ga0157315_1000752 | |||
| 1769 | Ga0157326_1023539 | |||
| 1770 | Ga0157338_1003303 | |||
| 1771 | Ga0157338_1077607 | |||
| 1772 | Ga0157373_10094553 | |||
| 1773 | Ga0157373_10196560 | |||
| 1774 | Ga0157373_10449334 | |||
| 1775 | Ga0157373_10491813 | |||
| 1776 | Ga0157373_11292724 | |||
| 1777 | Ga0157371_10015233 | |||
| 1778 | Ga0157371_10235851 | |||
| 1779 | Ga0157371_10752618 | |||
| 1780 | Ga0157370_10208527 | |||
| 1781 | Ga0157370_10509836 | |||
| 1782 | Ga0157370_10639589 | |||
| 1783 | Ga0157370_10763642 | |||
| 1784 | Ga0157370_11280962 | |||
| 1785 | Ga0157369_10196586 | |||
| 1786 | Ga0157369_10334097 | |||
| 1787 | Ga0157369_10693294 | |||
| 1788 | Ga0157369_10783991 | |||
| 1789 | Ga0157369_12585143 | |||
| 1790 | Ga0157374_10027781 | |||
| 1791 | Ga0157374_10067109 | |||
| 1792 | Ga0157374_10377062 | |||
| 1793 | Ga0157374_11146552 | |||
| 1794 | Ga0157378_10002239 | |||
| 1795 | Ga0157378_10694458 | |||
| 1796 | Ga0157378_10719018 | |||
| 1797 | Ga0163162_10005232 | |||
| 1798 | Ga0163162_10085379 | |||
| 1799 | Ga0163162_10413997 | |||
| 1800 | Ga0157372_10097909 | |||
| 1801 | Ga0157372_10144628 | |||
| 1802 | Ga0157372_10207302 | |||
| 1803 | Ga0157372_10523761 | |||
| 1804 | Ga0157375_10001714 | |||
| 1805 | Ga0157375_10030610 | |||
| 1806 | Ga0157375_10190111 | |||
| 1807 | Ga0157375_10225001 | |||
| 1808 | Ga0157375_11047133 | |||
| 1809 | Ga0163163_10001518 | |||
| 1810 | Ga0163163_10174616 | |||
| 1811 | Ga0163163_10366798 | |||
| 1812 | Ga0163163_12794896 | |||
| 1813 | Ga0157380_10012889 | |||
| 1814 | Ga0157380_10607127 | |||
| 1815 | Ga0182008_10201423 | |||
| 1816 | Ga0182008_10647328 | |||
| 1817 | Ga0182008_10823049 | |||
| 1818 | Ga0157377_10002411 | |||
| 1819 | Ga0157377_10038150 | |||
| 1820 | Ga0157379_10003150 | |||
| 1821 | Ga0157379_10021868 | |||
| 1822 | Ga0157379_10049294 | |||
| 1823 | Ga0157379_11336340 | |||
| 1824 | Ga0157376_10001552 | |||
| 1825 | Ga0157376_10066923 | |||
| 1826 | Ga0157376_10148440 | |||
| 1827 | Ga0182007_10263505 | |||
| 1828 | Ga0163161_10002536 | |||
| 1829 | Ga0163161_10100265 | |||
| 1830 | Ga0163161_10180229 | |||
| 1831 | Ga0206353_11323643 | |||
| 1832 | Ga0213872_10352069 | |||
| 1833 | Ga0207666_1000186 | |||
| 1834 | Ga0207673_1000346 | |||
| 1835 | Ga0207673_1018184 | |||
| 1836 | Ga0209256_1000181 | |||
| 1837 | Ga0207697_10010849 | |||
| 1838 | Ga0207697_10016334 | |||
| 1839 | Ga0207656_10276535 | |||
| 1840 | Ga0207696_1092354 | |||
| 1841 | Ga0207696_1194706 | |||
| 1842 | Ga0207653_10002509 | |||
| 1843 | Ga0207653_10008464 | |||
| 1844 | Ga0207682_10000143 | |||
| 1845 | Ga0207692_10010101 | |||
| 1846 | Ga0207692_10039931 | |||
| 1847 | Ga0207692_10079530 | |||
| 1848 | Ga0207692_11195911 | |||
| 1849 | Ga0207642_10003670 | |||
| 1850 | Ga0207642_10090387 | |||
| 1851 | Ga0207642_10442171 | |||
| 1852 | Ga0207710_10002851 | |||
| 1853 | Ga0207710_10028478 | |||
| 1854 | Ga0207710_10478767 | |||
| 1855 | Ga0207688_10004837 | |||
| 1856 | Ga0207688_10087339 | |||
| 1857 | Ga0207680_10059922 | |||
| 1858 | Ga0207680_10291351 | |||
| 1859 | Ga0207647_10009610 | |||
| 1860 | Ga0207647_10165777 | |||
| 1861 | Ga0207647_10344191 | |||
| 1862 | Ga0207685_10214002 | |||
| 1863 | Ga0207685_10265698 | |||
| 1864 | Ga0207699_10002837 | |||
| 1865 | Ga0207699_10008626 | |||
| 1866 | Ga0207699_10303724 | |||
| 1867 | Ga0207699_11181720 | |||
| 1868 | Ga0207645_10003855 | |||
| 1869 | Ga0207645_10062093 | |||
| 1870 | Ga0207645_10334183 | |||
| 1871 | Ga0207645_10342871 | |||
| 1872 | Ga0207643_10000336 | |||
| 1873 | Ga0207705_10053004 | |||
| 1874 | Ga0207705_10059508 | |||
| 1875 | Ga0207654_10007173 | |||
| 1876 | Ga0207654_10030175 | |||
| 1877 | Ga0207654_10084852 | |||
| 1878 | Ga0207707_10004481 | |||
| 1879 | Ga0207707_10032305 | |||
| 1880 | Ga0207707_10126505 | |||
| 1881 | Ga0207707_10253668 | |||
| 1882 | Ga0207707_10419007 | |||
| 1883 | Ga0207707_10555626 | |||
| 1884 | Ga0207707_10595474 | |||
| 1885 | Ga0207695_10072031 | |||
| 1886 | Ga0207671_10017926 | |||
| 1887 | Ga0207671_10140224 | |||
| 1888 | Ga0207671_11003462 | |||
| 1889 | Ga0207693_10047659 | |||
| 1890 | Ga0207693_10059188 | |||
| 1891 | Ga0207693_10068794 | |||
| 1892 | Ga0207663_10033186 | |||
| 1893 | Ga0207663_10113738 | |||
| 1894 | Ga0207663_10293326 | |||
| 1895 | Ga0207663_10498782 | |||
| 1896 | Ga0207663_10503645 | |||
| 1897 | Ga0207660_10002805 | |||
| 1898 | Ga0207660_10067774 | |||
| 1899 | Ga0207660_10247453 | |||
| 1900 | Ga0207660_10329211 | |||
| 1901 | Ga0207660_10816366 | |||
| 1902 | Ga0207662_10017545 | |||
| 1903 | Ga0207662_10833726 | |||
| 1904 | Ga0207657_10025170 | |||
| 1905 | Ga0207657_10041931 | |||
| 1906 | Ga0207657_10059076 | |||
| 1907 | Ga0207657_10080849 | |||
| 1908 | Ga0207657_10089041 | |||
| 1909 | Ga0207657_10143785 | |||
| 1910 | Ga0207649_10000889 | |||
| 1911 | Ga0207649_10049100 | |||
| 1912 | Ga0207649_10107454 | |||
| 1913 | Ga0207652_10028916 | |||
| 1914 | Ga0207652_10061170 | |||
| 1915 | Ga0207652_10138240 | |||
| 1916 | Ga0207652_10139171 | |||
| 1917 | Ga0207652_10766391 | |||
| 1918 | Ga0207652_10840669 | |||
| 1919 | Ga0207681_10000782 | |||
| 1920 | Ga0207681_10108107 | |||
| 1921 | Ga0207694_10111928 | |||
| 1922 | Ga0207694_10129294 | |||
| 1923 | Ga0207694_10586500 | |||
| 1924 | Ga0207694_10747598 | |||
| 1925 | Ga0207650_10021612 | |||
| 1926 | Ga0207650_10216694 | |||
| 1927 | Ga0207659_10000676 | |||
| 1928 | Ga0207659_10473325 | |||
| 1929 | Ga0207687_10001851 | |||
| 1930 | Ga0207687_10032859 | |||
| 1931 | Ga0207687_10046333 | |||
| 1932 | Ga0207687_10862131 | |||
| 1933 | Ga0207687_11180836 | |||
| 1934 | Ga0207700_10015283 | |||
| 1935 | Ga0207700_10106298 | |||
| 1936 | Ga0207700_10373740 | |||
| 1937 | Ga0207664_10115796 | |||
| 1938 | Ga0207664_10229696 | |||
| 1939 | Ga0207664_10306494 | |||
| 1940 | Ga0207644_10001040 | |||
| 1941 | Ga0207644_10007133 | |||
| 1942 | Ga0207644_10399308 | |||
| 1943 | Ga0207644_10861080 | |||
| 1944 | Ga0207690_10001491 | |||
| 1945 | Ga0207690_10295245 | |||
| 1946 | Ga0207690_10715083 | |||
| 1947 | Ga0207690_10944347 | |||
| 1948 | Ga0207706_10040546 | |||
| 1949 | Ga0207706_10040651 | |||
| 1950 | Ga0207706_10269359 | |||
| 1951 | Ga0207686_10019478 | |||
| 1952 | Ga0207686_10023879 | |||
| 1953 | Ga0207686_10113589 | |||
| 1954 | Ga0207686_10278058 | |||
| 1955 | Ga0207686_11244466 | |||
| 1956 | Ga0207709_10017465 | |||
| 1957 | Ga0207709_10066231 | |||
| 1958 | Ga0207709_10258987 | |||
| 1959 | Ga0207670_10002314 | |||
| 1960 | Ga0207670_10036052 | |||
| 1961 | Ga0207670_10118356 | |||
| 1962 | Ga0207669_10001302 | |||
| 1963 | Ga0207669_10039633 | |||
| 1964 | Ga0207669_11481830 | |||
| 1965 | Ga0207704_10000410 | |||
| 1966 | Ga0207704_10168583 | |||
| 1967 | Ga0207704_10231464 | |||
| 1968 | Ga0207704_11564573 | |||
| 1969 | Ga0207665_10000756 | |||
| 1970 | Ga0207665_10027820 | |||
| 1971 | Ga0207665_10050785 | |||
| 1972 | Ga0207691_10045057 | |||
| 1973 | Ga0207691_10209033 | |||
| 1974 | Ga0207711_10024421 | |||
| 1975 | Ga0207711_10053552 | |||
| 1976 | Ga0207711_10127240 | |||
| 1977 | Ga0207689_10049253 | |||
| 1978 | Ga0207689_10832223 | |||
| 1979 | Ga0207689_11128806 | |||
| 1980 | Ga0207661_10001346 | |||
| 1981 | Ga0207661_10477821 | |||
| 1982 | Ga0207661_10581480 | |||
| 1983 | Ga0207661_11545714 | |||
| 1984 | Ga0207661_12182123 | |||
| 1985 | Ga0207679_10000504 | |||
| 1986 | Ga0207679_10326065 | |||
| 1987 | Ga0207679_10983296 | |||
| 1988 | Ga0207667_10017518 | |||
| 1989 | Ga0207667_10095367 | |||
| 1990 | Ga0207667_10146645 | |||
| 1991 | Ga0207667_10199974 | |||
| 1992 | Ga0207651_10013105 | |||
| 1993 | Ga0207651_10512810 | |||
| 1994 | Ga0207712_10032107 | |||
| 1995 | Ga0207712_10044100 | |||
| 1996 | Ga0207712_10121122 | |||
| 1997 | Ga0207712_11022459 | |||
| 1998 | Ga0207668_10000762 | |||
| 1999 | Ga0207668_10122190 | |||
| 2000 | Ga0207668_10633179 | |||
| 2001 | Ga0207640_10002084 | |||
| 2002 | Ga0207640_10653391 | |||
| 2003 | Ga0207658_10039358 | |||
| 2004 | Ga0207658_10051921 | |||
| 2005 | Ga0207658_10089822 | |||
| 2006 | Ga0207658_10948196 | |||
| 2007 | Ga0207677_10008747 | |||
| 2008 | Ga0207677_10184215 | |||
| 2009 | Ga0207677_10827341 | |||
| 2010 | Ga0207703_10021501 | |||
| 2011 | Ga0207703_10115249 | |||
| 2012 | Ga0207703_10165509 | |||
| 2013 | Ga0207703_11098093 | |||
| 2014 | Ga0207639_10004202 | |||
| 2015 | Ga0207639_10181271 | |||
| 2016 | Ga0207639_10544362 | |||
| 2017 | Ga0207639_10573459 | |||
| 2018 | Ga0207639_10787967 | |||
| 2019 | Ga0207678_10017045 | |||
| 2020 | Ga0207678_10038786 | |||
| 2021 | Ga0207678_11628000 | |||
| 2022 | Ga0207708_10031096 | |||
| 2023 | Ga0207708_10040693 | |||
| 2024 | Ga0207702_10212244 | |||
| 2025 | Ga0207702_10217561 | |||
| 2026 | Ga0207702_10432110 | |||
| 2027 | Ga0207702_10648464 | |||
| 2028 | Ga0207641_10003596 | |||
| 2029 | Ga0207641_10414729 | |||
| 2030 | Ga0207641_10533901 | |||
| 2031 | Ga0207648_10054561 | |||
| 2032 | Ga0207648_10087497 | |||
| 2033 | Ga0207648_10732642 | |||
| 2034 | Ga0207676_10059220 | |||
| 2035 | Ga0207676_10259371 | |||
| 2036 | Ga0207676_10691415 | |||
| 2037 | Ga0207676_10821517 | |||
| 2038 | Ga0207676_11890773 | |||
| 2039 | Ga0207674_10002908 | |||
| 2040 | Ga0207674_10569242 | |||
| 2041 | Ga0207674_10922287 | |||
| 2042 | Ga0207674_12012035 | |||
| 2043 | Ga0207675_100034535 | |||
| 2044 | Ga0207675_100131311 | |||
| 2045 | Ga0207675_100626138 | |||
| 2046 | Ga0207683_10001206 | |||
| 2047 | Ga0207683_10007086 | |||
| 2048 | Ga0207683_10018925 | |||
| 2049 | Ga0207683_12165302 | |||
| 2050 | Ga0207698_10023084 | |||
| 2051 | Ga0207698_10173913 | |||
| 2052 | Ga0207698_11142829 | |||
| 2053 | Ga0207698_11289798 | |||
| 2054 | Ga0209973_1012915 | |||
| 2055 | Ga0209969_1004998 | |||
| 2056 | Ga0209967_1002814 | |||
| 2057 | Ga0209981_1030986 | |||
| 2058 | Ga0209996_1010995 | |||
| 2059 | Ga0209984_1009301 | |||
| 2060 | Ga0209995_1067414 | |||
| 2061 | Ga0209968_1005637 | |||
| 2062 | Ga0209999_1063730 | |||
| 2063 | Ga0209982_1020055 | |||
| 2064 | Ga0209970_1001595 | |||
| 2065 | Ga0209983_1028051 | |||
| 2066 | Ga0209971_1010559 | |||
| 2067 | Ga0209966_1037455 | |||
| 2068 | Ga0209998_10003991 | |||
| 2069 | Ga0209998_10020408 | |||
| 2070 | Ga0209998_10180906 | |||
| 2071 | Ga0209813_10060298 | |||
| 2072 | Ga0209974_10018508 | |||
| 2073 | Ga0209974_10121909 | |||
| 2074 | Ga0209974_10320666 | |||
| 2075 | Ga0209974_10472103 | |||
| 2076 | Ga0207428_10000141 | |||
| 2077 | Ga0207428_10001593 | |||
| 2078 | Ga0207428_10003355 | |||
| 2079 | Ga0207428_10061609 | |||
| 2080 | Ga0207428_10069072 | |||
| 2081 | Ga0268266_10023949 | |||
| 2082 | Ga0268266_10175755 | |||
| 2083 | Ga0268266_10255707 | |||
| 2084 | Ga0268265_10001135 | |||
| 2085 | Ga0268265_10164860 | |||
| 2086 | Ga0268264_10000051 | |||
| 2087 | Ga0268264_10005920 | |||
| 2088 | Ga0268264_10227206 | |||
| 2089 | Ga0268264_10297826 | |||
| 2090 | Ga0268264_10383694 | |||
| 2091 | Ga0265337_1002114 | |||
| 2092 | Ga0265338_10124983 | |||
| 2093 | Ga0265338_10327807 | |||
| 2094 | Ga0265338_10513659 | |||
| 2095 | Ga0265330_10029759 | |||
| 2096 | Ga0265330_10288311 | |||
| 2097 | Ga0265332_10152147 | |||
| 2098 | Ga0265332_10486998 | |||
| 2099 | Ga0265328_10327145 | |||
| 2100 | Ga0265325_10000119 | |||
| 2101 | Ga0265325_10018270 | |||
| 2102 | Ga0265325_10411912 | |||
| 2103 | Ga0265340_10015371 | |||
| 2104 | Ga0265340_10106826 | |||
| 2105 | Ga0265340_10201257 | |||
| 2106 | Ga0265339_10003215 | |||
| 2107 | Ga0265339_10027041 | |||
| 2108 | Ga0265339_10102480 | |||
| 2109 | Ga0265331_10454368 | |||
| 2110 | Ga0265316_10038880 | |||
| 2111 | Ga0265316_10136750 | |||
| 2112 | Ga0265316_10149537 | |||
| 2113 | Ga0265316_10149594 | |||
| 2114 | Ga0265313_10032008 | |||
| 2115 | Ga0265313_10037161 | |||
| 2116 | Ga0265313_10042722 | |||
| 2117 | Ga0265313_10142865 | |||
| 2118 | Ga0265314_10014050 | |||
| 2119 | Ga0265314_10190638 | |||
| 2120 | Ga0265342_10000967 | |||
| 2121 | Ga0265342_10019923 | |||
| 2122 | Ga0307405_11224173 | |||
| 2123 | Ga0307406_10469671 | |||
| 2124 | Ga0307406_11688402 | |||
| 2125 | Ga0316583_10004499 | |||
| 2126 | Ga0373930_0000546 | |||
| 2127 | Ga0373930_0074486 | |||
| 2128 | Ga0373948_0006814 | |||
| 2129 | Ga0373958_0000316 | |||
| 2130 | Ga0373958_0028289 | |||
| 2131 | Ga0373959_0006377 | |||
| 2132 | Ga0373938_0000677 | |||
| 2133 | Ga0373938_0015610 | |||
| 2134 | Ga0373938_0053049 | |||
| 2135 | Ga0373926_0002819 | |||
| 2136 | Ga0373926_0027341 | |||
| 2137 | Ga0373926_0093576 | |||
| 2138 | Ga0373928_0001944 | |||
| 2139 | Ga0373928_0014038 | |||
| 2140 | Ga0373929_0007130 | |||
| 2141 | Ga0373934_0135065 | |||
| 2142 | Ga0373934_0231347 | |||
| 2143 | Ga0373940_0000058 | |||
| 2144 | Ga0373940_0041177 | |||
| 2145 | Ga0373944_0002373 | |||
| 2146 | Ga0373944_0034117 | |||
| 2147 | Ga0373944_0051532 | |||
| 2148 | Ga0373949_0001169 | |||
| 2149 | Ga0373949_0017218 | |||
| 2150 | Ga0373949_0040573 | |||
| 2151 | Ga0373951_0000698 | |||
| 2152 | Ga0373951_0009696 | |||
| 2153 | Ga0373952_0000245 | |||
| 2154 | Ga0373952_0130653 | |||
| 2155 | Ga0373952_0142329 | |||
| 2156 | Ga0373952_0268291 | |||
| 2157 | Ga0373923_0063383 | |||
| 2158 | Ga0373923_0272341 | |||
| 2159 | Ga0373923_0662906 | |||
| 2160 | Ga0373932_0000784 | |||
| 2161 | Ga0373932_0170147 | |||
| 2162 | Ga0373932_0365478 | |||
| 2163 | Ga0373936_0000491 | |||
| 2164 | Ga0373936_0076787 | |||
| 2165 | Ga0373936_0360123 | |||
| 2166 | Ga0373939_0000350 | |||
| 2167 | Ga0373939_0007984 | |||
| 2168 | Ga0373939_0008981 | |||
| 2169 | Ga0373941_0005512 | |||
| 2170 | Ga0373941_0045377 | |||
| 2171 | Ga0373945_0010389 | |||
| 2172 | Ga0373945_0054339 | |||
| 2173 | Ga0373945_0308162 | |||
| 2174 | Ga0373953_0006085 | |||
| 2175 | Ga0373953_0040573 | |||
| 2176 | Ga0373953_0150057 | |||
| 2177 | Ga0373953_0274062 | |||
| 2178 | Ga0373954_0022723 | |||
| 2179 | Ga0373954_0064678 | |||
| 2180 | Ga0373954_0273000 | |||
| 2181 | Ga0373954_0578010 | |||
| 2182 | Ga0373954_0596722 | |||
| 2183 | Ga0373956_0002568 | |||
| 2184 | Ga0373956_0045063 | |||
| 2185 | Ga0373956_0443472 | |||
| 2186 | Ga0373957_0036369 | |||
| 2187 | Ga0373957_0312763 | |||
| 2188 | Ga0373957_0473598 | |||
| 2189 | Ga0373960_0225966 | |||
| 2190 | Ga0373960_0232409 | |||
| 2191 | Ga0373960_0242952 | |||
| 2192 | Ga0373943_0005755 | |||
| 2193 | Ga0373943_0153622 | |||
| 2194 | Ga0373946_0001418 | |||
| 2195 | Ga0373946_0018824 | |||
| 2196 | Ga0373946_0171061 | |||
| 2197 | Ga0373946_0356096 | |||
| 2198 | Ga0373955_0006235 | |||
| 2199 | Ga0373955_0032016 | |||
| 2200 | Ga0373955_0068387 | |||
| 2201 | Ga0373955_0130239 | |||
| 2202 | Ga0373955_0196101 | |||
| 2203 | Ga0373955_0630103 | |||
| 2204 | Ga0373942_0000056 | |||
| 2205 | Ga0373942_0055759 | |||
| 2206 | Ga0373961_0000471 | |||
| 2207 | Ga0373961_0022597 | |||
| 2208 | Ga0373961_0292490 | |||
| 2209 | Ga0373962_0000608 | |||
| 2210 | Ga0373962_0003921 | |||
| 2211 | Ga0373924_0120621 | |||
| 2212 | Ga0373924_0133528 | |||
| 2213 | Ga0373924_0220078 | |||
| 2214 | Ga0373924_0293080 | |||
| 2215 | Ga0373931_0083993 | |||
| 2216 | Ga0373931_0086755 | |||
| 2217 | Ga0373931_0087850 | |||
| 2218 | Ga0373931_0137841 | |||
| 2219 | Ga0373931_1271461 | |||
| 2220 | Ga0373935_0004417 | |||
| 2221 | Ga0373935_0007391 | |||
| 2222 | Ga0373935_0072609 | |||
| 2223 | Ga0373935_0719669 | |||
| 2224 | Ga0373935_0797601 | |||
| 2225 | Ga0373935_1507295 | |||
| 2226 | Ga0373927_0015530 | |||
| 2227 | Ga0373927_0048634 | |||
| 2228 | Ga0373927_0319931 | |||
| 2229 | Ga0373933_0003495 | |||
| 2230 | Ga0373933_0008121 | |||
| 2231 | Ga0373933_0019789 | |||
| 2232 | Ga0373933_0060623 | |||
| 2233 | Ga0373933_0604107 | |||
| 2234 | Ga0373933_0800663 | |||
| 2235 | Ga0373947_0001131 | |||
| 2236 | Ga0373947_0032649 | |||
| 2237 | Ga0373947_0513603 | |||
| 2238 | Ga0373947_1229268 | |||
| 2239 | Ga0373937_0009064 | |||
| 2240 | Ga0373937_0010912 | |||
| 2241 | Ga0373937_0014216 | |||
| 2242 | Ga0373937_0017271 | |||
| 2243 | Ga0373937_0030955 | |||
| 2244 | Ga0373937_0107375 | |||
| 2245 | Ga0373937_0615691 | |||
| 2246 | Ga0373925_0005021 | |||
| 2247 | Ga0373925_0005303 | |||
| 2248 | Ga0373925_0027500 | |||
| 2249 | Ga0373925_0757389 | |||
| 2250 | Ga0373925_1251052 | |||
| 2251 | Ga0395899_0002845 | |||
| 2252 | Ga0395899_0080610 | |||
| 2253 | Ga0395900_0003630 | |||
| 2254 | Ga0395900_0010878 | |||
| 2255 | Ga0395900_0328325 | |||
| 2256 | Ga0395900_1040984 | |||
| 2257 | Ga0395898_0006740 | |||
| 2258 | Ga0395898_0014680 | |||
| 2259 | Ga0395898_0150024 | |||
| 2260 | Ga0436364_0782926 | |||
| 2261 | Ga0395901_0020857 | |||
| 2262 | Ga0395901_0170977 | |||
| 2263 | Ga0395901_0297638 | |||
| 2264 | Ga0395901_0916198 | |||
| 2265 | Ga0242420_005947 | |||
| 2266 | Ga0436361_0568157 | |||
| 2267 | Ga0439453_0185193 | |||
| 2268 | Ga0439453_0192927 | |||
| 2269 | Ga0451793_0643023 | |||
| 2270 | Ga0451802_0329831 | |||
| 2271 | Ga0451804_0516794 | |||
| 2272 | Ga0451807_1208075 | |||
| 2273 | Ga0451845_0125542 | |||
| 2274 | Ga0439448_0102944 | |||
| 2275 | Ga0439448_0333398 | |||
| 2276 | Ga0439450_058082 | |||
| 2277 | Ga0439456_047188 | |||
| 2278 | Ga0439463_040358 | |||
| 2279 | Ga0439458_0084245 | |||
| 2280 | Ga0439458_0235193 | |||
| 2281 | Ga0439444_0045082 | |||
| 2282 | Ga0439464_0051986 | |||
| 2283 | Ga0439460_0040902 | |||
| 2284 | Ga0451577_0416108 | |||
| 2285 | Ga0466963_0232808 | |||
| 2286 | Ga0453684_1352392 | |||
| 2287 | Ga0451576_0151880 | |||
| 2288 | Ga0466967_0654065 | |||
| 2289 | Ga0495592_0019497 | |||
| 2290 | Ga0495592_0027776 | |||
| 2291 | Ga0495592_0054230 | |||
| 2292 | Ga0495592_0163822 | |||
| 2293 | Ga0495592_0189339 | |||
| 2294 | Ga0495592_0773830 | |||
| 2295 | Ga0495603_0008518 | |||
| 2296 | Ga0495603_0116801 | |||
| 2297 | Ga0495603_0876116 | |||
| 2298 | Ga0495590_0213966 | |||
| 2299 | Ga0495591_034040 | |||
| 2300 | Ga0495629_0001316 | |||
| 2301 | Ga0495629_0023842 | |||
| 2302 | Ga0495629_0443347 | |||
| 2303 | Ga0495641_0064157 | |||
| 2304 | Ga0495641_0101299 | |||
| 2305 | Ga0495641_0275884 | |||
| 2306 | Ga0495651_0004833 | |||
| 2307 | Ga0495651_0015103 | |||
| 2308 | Ga0495651_0032128 | |||
| 2309 | Ga0495651_0252104 | |||
| 2310 | Ga0495651_0280736 | |||
| 2311 | Ga0495651_0311912 | |||
| 2312 | Ga0495653_0002640 | |||
| 2313 | Ga0495653_0005895 | |||
| 2314 | Ga0495653_0090080 | |||
| 2315 | Ga0495653_0242775 | |||
| 2316 | Ga0495580_0015463 | |||
| 2317 | Ga0495580_0600318 | |||
| 2318 | Ga0495582_0005763 | |||
| 2319 | Ga0495582_0031750 | |||
| 2320 | Ga0495605_0221291 | |||
| 2321 | Ga0495639_0004954 | |||
| 2322 | Ga0495662_0001866 | |||
| 2323 | Ga0495662_0037300 | |||
| 2324 | Ga0495662_0231757 | |||
| 2325 | Ga0495664_0050283 | |||
| 2326 | Ga0495664_0150710 | |||
| 2327 | Ga0495664_0296401 | |||
| 2328 | Ga0495584_0061606 | |||
| 2329 | Ga0495584_0501780 | |||
| 2330 | Ga0495585_0001729 | |||
| 2331 | Ga0495594_0009236 | |||
| 2332 | Ga0495594_0024363 | |||
| 2333 | Ga0495594_0121684 | |||
| 2334 | Ga0495608_0007989 | |||
| 2335 | Ga0495608_0058681 | |||
| 2336 | Ga0495608_0074704 | |||
| 2337 | Ga0495608_0942665 | |||
| 2338 | Ga0495616_0035425 | |||
| 2339 | Ga0495618_0047174 | |||
| 2340 | Ga0495618_0132385 | |||
| 2341 | Ga0495618_0361354 | |||
| 2342 | Ga0495618_0686226 | |||
| 2343 | Ga0495628_0011219 | |||
| 2344 | Ga0495628_0135599 | |||
| 2345 | Ga0495628_0193849 | |||
| 2346 | Ga0495628_0193851 | |||
| 2347 | Ga0495628_0953824 | |||
| 2348 | Ga0495628_1190218 | |||
| 2349 | Ga0495630_0015862 | |||
| 2350 | Ga0495630_0255351 | |||
| 2351 | Ga0495630_0571960 | |||
| 2352 | Ga0495637_0214234 | |||
| 2353 | Ga0495644_0055943 | |||
| 2354 | Ga0495663_0055416 | |||
| 2355 | Ga0495666_0090430 | |||
| 2356 | Ga0495652_0027253 | |||
| 2357 | Ga0495652_0038405 | |||
| 2358 | Ga0495652_0159752 | |||
| 2359 | Ga0495652_0339058 | |||
| 2360 | Ga0495665_0070818 | |||
| 2361 | Ga0495665_0079937 | |||
| 2362 | Ga0495640_0015679 | |||
| 2363 | Ga0495640_0087913 | |||
| 2364 | Ga0495640_0164206 | |||
| 2365 | Ga0495640_0228663 | |||
| 2366 | Ga0495640_0731086 | |||
| 2367 | Ga0495586_0011823 | |||
| 2368 | Ga0495587_0011963 | |||
| 2369 | Ga0495587_0026702 | |||
| 2370 | Ga0495587_0079695 | |||
| 2371 | Ga0495587_0098505 | |||
| 2372 | Ga0495587_0187350 | |||
| 2373 | Ga0495598_0135865 | |||
| 2374 | Ga0495645_0018999 | |||
| 2375 | Ga0495645_0070977 | |||
| 2376 | Ga0495645_0378945 | |||
| 2377 | Ga0495622_0035567 | |||
| 2378 | Ga0495622_0070129 | |||
| 2379 | Ga0495633_0005006 | |||
| 2380 | Ga0495667_0013026 | |||
| 2381 | Ga0495667_0017124 | |||
| 2382 | Ga0495667_0017232 | |||
| 2383 | Ga0495667_0051253 | |||
| 2384 | Ga0495667_0318405 | |||
| 2385 | Ga0495667_0845881 | |||
| 2386 | Ga0495656_0003577 | |||
| 2387 | Ga0495634_0279340 | |||
| 2388 | Ga0495634_0292081 | |||
| 2389 | Ga0495634_0527038 | |||
| 2390 | Ga0495611_0213732 | |||
| 2391 | Ga0495635_0006791 | |||
| 2392 | Ga0495635_0064410 | |||
| 2393 | Ga0495659_0001405 | |||
| 2394 | Ga0495661_0019380 | |||
| 2395 | Ga0495588_0058537 | |||
| 2396 | Ga0495588_0097486 | |||
| 2397 | Ga0495588_0661499 | |||
| 2398 | Ga0495657_0024510 | |||
| 2399 | Ga0495657_0045368 | |||
| 2400 | Ga0495657_0054497 | |||
| 2401 | Ga0495657_0242325 | |||
| 2402 | Ga0495599_0011174 | |||
| 2403 | Ga0495599_0067846 | |||
| 2404 | Ga0495599_0077683 | |||
| 2405 | Ga0495623_0006971 | |||
| 2406 | Ga0495623_0029805 | |||
| 2407 | Ga0495623_0487814 | |||
| 2408 | Ga0495646_0007298 | |||
| 2409 | Ga0495646_0017374 | |||
| 2410 | Ga0495646_0101317 | |||
| 2411 | Ga0495646_0130269 | |||
| 2412 | Ga0495647_0006124 | |||
| 2413 | Ga0495647_0170830 | |||
| 2414 | Ga0495647_0445906 | |||
| 2415 | Ga0495658_0004362 | |||
| 2416 | Ga0495658_0006637 | |||
| 2417 | Ga0495658_0471380 | |||
| 2418 | Ga0495658_1044498 | |||
| 2419 | Ga0495669_0258820 | |||
| 2420 | Ga0495613_0001421 | |||
| 2421 | Ga0495624_0078164 | |||
| 2422 | Ga0495670_0000579 | |||
| 2423 | Ga0495589_0126138 | |||
| 2424 | Ga0495600_0005626 | |||
| 2425 | Ga0495600_0013325 | |||
| 2426 | Ga0495600_0075167 | |||
| 2427 | Ga0495600_0134908 | |||
| 2428 | Ga0495600_0177451 | |||
| 2429 | Ga0495581_0030170 | |||
| 2430 | Ga0495581_0036393 | |||
| 2431 | Ga0495581_0057219 | |||
| 2432 | Ga0495604_0013922 | |||
| 2433 | Ga0495604_0041061 | |||
| 2434 | Ga0495604_0140785 | |||
| 2435 | Ga0495674_0036977 | |||
| 2436 | Ga0495674_0048019 | |||
| 2437 | Ga0495674_0056005 | |||
| 2438 | Ga0495674_1357126 | |||
| 2439 | Ga0495676_0146085 | |||
| 2440 | Ga0495676_0175042 | |||
| 2441 | Ga0495676_0191878 | |||
| 2442 | Ga0495680_0040361 | |||
| 2443 | Ga0495680_0042659 | |||
| 2444 | Ga0495680_0048604 | |||
| 2445 | Ga0495680_0094466 | |||
| 2446 | Ga0495680_0239396 | |||
| 2447 | Ga0495680_0925659 | |||
| 2448 | Ga0495675_0003995 | |||
| 2449 | Ga0495675_0007873 | |||
| 2450 | Ga0495675_0198415 | |||
| 2451 | Ga0495675_0478999 | |||
| 2452 | Ga0495675_0820944 | |||
| 2453 | Ga0495679_038861 | |||
| 2454 | Ga0495684_0000281 | |||
| 2455 | Ga0495684_0058854 | |||
| 2456 | Ga0495684_0136135 | |||
| 2457 | Ga0495593_0001313 | |||
| 2458 | Ga0495593_0045482 | |||
| 2459 | Ga0495593_0132677 | |||
| 2460 | Ga0495593_0170894 | |||
| 2461 | Ga0495602_0010155 | |||
| 2462 | Ga0495602_0167764 | |||
| 2463 | Ga0495602_0222154 | |||
| 2464 | Ga0495602_0280567 | |||
| 2465 | Ga0495602_0317411 | |||
| 2466 | Ga0495614_0009362 | |||
| 2467 | Ga0495614_0281677 | |||
| 2468 | Ga0495614_0499980 | |||
| 2469 | Ga0496100_0010589 | |||
| 2470 | Ga0496100_0033704 | |||
| 2471 | Ga0496101_0031405 | |||
| 2472 | Ga0496101_0126413 | |||
| 2473 | Ga0496101_0130906 | |||
| 2474 | Ga0496101_0942249 | |||
| 2475 | Ga0496102_0146497 | |||
| 2476 | Ga0496102_0309115 | |||
| 2477 | Ga0496102_0850487 | |||
| 2478 | Ga0496103_0054280 | |||
| 2479 | Ga0496103_0181320 | |||
| 2480 | Ga0496104_0000140 | |||
| 2481 | Ga0496104_0012874 | |||
| 2482 | Ga0496104_0085385 | |||
| 2483 | Ga0496104_0251348 | |||
| 2484 | Ga0496104_0287181 | |||
| 2485 | Ga0496104_0822785 | |||
| 2486 | Ga0496105_0000576 | |||
| 2487 | Ga0496105_0070598 | |||
| 2488 | Ga0496105_0108795 | |||
| 2489 | Ga0496105_0284122 | |||
| 2490 | Ga0496105_0442483 | |||
| 2491 | Ga0496105_1361051 | |||
| 2492 | Ga0496106_0024928 | |||
| 2493 | Ga0496106_0029544 | |||
| 2494 | Ga0496106_0046226 | |||
| 2495 | Ga0496106_1336315 | |||
| 2496 | Ga0496107_0010578 | |||
| 2497 | Ga0496107_0061801 | |||
| 2498 | Ga0496107_0164228 | |||
| 2499 | Ga0496107_0337463 | |||
| 2500 | Ga0496108_0000639 | |||
| 2501 | Ga0496108_0016770 | |||
| 2502 | Ga0496108_0035329 | |||
| 2503 | Ga0496108_0068074 | |||
| 2504 | Ga0496108_0246307 | |||
| 2505 | Ga0496108_0461891 | |||
| 2506 | Ga0496109_0000619 | |||
| 2507 | Ga0496109_0031729 | |||
| 2508 | Ga0496109_0134593 | |||
| 2509 | Ga0496109_0221900 | |||
| 2510 | Ga0496109_0280340 | |||
| 2511 | Ga0496110_0046770 | |||
| 2512 | Ga0496110_0199125 | |||
| 2513 | Ga0496110_0230461 | |||
| 2514 | Ga0496111_0010913 | |||
| 2515 | Ga0496111_0214910 | |||
| 2516 | Ga0496111_0319668 | |||
| 2517 | Ga0496112_0002285 | |||
| 2518 | Ga0496112_0006392 | |||
| 2519 | Ga0496112_0908958 | |||
| 2520 | Ga0496113_0006622 | |||
| 2521 | Ga0496113_0188187 | |||
| 2522 | Ga0496113_0921350 | |||
| 2523 | Ga0496113_0979835 | |||
| 2524 | Ga0496114_0011636 | |||
| 2525 | Ga0496114_0016617 | |||
| 2526 | Ga0496114_0095862 | |||
| 2527 | Ga0496114_0396394 | |||
| 2528 | Ga0496115_0015149 | |||
| 2529 | Ga0496115_0020630 | |||
| 2530 | Ga0496115_0250423 | |||
| 2531 | Ga0496115_0563329 | |||
| 2532 | Ga0495682_0372670 | |||
| 2533 | Ga0501031_0019351 | |||
| 2534 | Ga0501032_0995383 | |||
| 2535 | Ga0501033_0001099 | |||
| 2536 | Ga0501034_0083711 | |||
| 2537 | Ga0501034_0137379 | |||
| 2538 | Ga0501034_0153944 | |||
| 2539 | Ga0501036_0060843 | |||
| 2540 | Ga0501036_0612301 | |||
| 2541 | Ga0501036_0801392 | |||
| 2542 | Ga0501037_0002613 | |||
| 2543 | Ga0501038_0044217 | |||
| 2544 | Ga0501038_1072737 | |||
| 2545 | Ga0501039_0149882 | |||
| 2546 | Ga0501039_0155277 | |||
| 2547 | Ga0501039_0832229 | |||
| 2548 | Ga0501040_0052628 | |||
| 2549 | Ga0501040_1042857 | |||
| 2550 | Ga0501041_0246800 | |||
| 2551 | Ga0501042_0067708 | |||
| 2552 | Ga0501042_0124564 | |||
| 2553 | Ga0501043_0117522 | |||
| 2554 | Ga0501046_0036477 | |||
| 2555 | Ga0501046_0051536 | |||
| 2556 | Ga0501046_0562196 | |||
| 2557 | Ga0501047_0008549 | |||
| 2558 | Ga0501047_0046207 | |||
| 2559 | Ga0501047_1042770 | |||
| 2560 | Ga0501047_1311621 | |||
| 2561 | Ga0501048_0354681 | |||
| 2562 | Ga0501067_0002227 | |||
| 2563 | Ga0501067_0068672 | |||
| 2564 | Ga0501068_0035230 | |||
| 2565 | Ga0501068_0124689 | |||
| 2566 | Ga0501069_0050135 | |||
| 2567 | Ga0501069_0223836 | |||
| 2568 | Ga0501069_0398242 | |||
| 2569 | Ga0501070_0027855 | |||
| 2570 | Ga0501070_0160980 | |||
| 2571 | Ga0501070_0397775 | |||
| 2572 | Ga0501070_0609232 | |||
| 2573 | Ga0501070_1263559 | |||
| 2574 | Ga0501070_1464559 | |||
| 2575 | Ga0501071_0081885 | |||
| 2576 | Ga0501071_0197190 | |||
| 2577 | Ga0501072_0019663 | |||
| 2578 | Ga0501072_0020222 | |||
| 2579 | Ga0501072_1516789 | |||
| 2580 | Ga0501073_0098368 | |||
| 2581 | Ga0501073_0203077 | |||
| 2582 | Ga0501073_0228447 | |||
| 2583 | Ga0501073_0304403 | |||
| 2584 | Ga0501073_0488134 | |||
| 2585 | Ga0501073_0510677 | |||
| 2586 | Ga0501074_0096432 | |||
| 2587 | Ga0501074_0236637 | |||
| 2588 | Ga0501075_0448004 | |||
| 2589 | Ga0501075_0635741 | |||
| 2590 | Ga0501076_0012137 | |||
| 2591 | Ga0501076_0065020 | |||
| 2592 | Ga0501076_0653337 | |||
| 2593 | Ga0501076_0704391 | |||
| 2594 | Ga0501076_0770996 | |||
| 2595 | Ga0501077_0024392 | |||
| 2596 | Ga0501077_0097791 | |||
| 2597 | Ga0501077_0109851 | |||
| 2598 | Ga0501079_0127033 | |||
| 2599 | Ga0501079_0988107 | |||
| 2600 | Ga0501080_0073023 | |||
| 2601 | Ga0501080_0160437 | |||
| 2602 | Ga0501080_0711444 | |||
| 2603 | Ga0501081_0013430 | |||
| 2604 | Ga0501083_0023594 | |||
| 2605 | Ga0501083_0153262 | |||
| 2606 | Ga0501083_0208457 | |||
| 2607 | Ga0501083_0211946 | |||
| 2608 | Ga0501083_0240119 | |||
| 2609 | Ga0501083_0342841 | |||
| 2610 | Ga0501083_0415413 | |||
| 2611 | Ga0501035_0003995 | |||
| 2612 | Ga0501035_0023875 | |||
| 2613 | Ga0501035_0440570 | |||
| 2614 | Ga0501044_0036955 | |||
| 2615 | Ga0501044_0102282 | |||
| 2616 | Ga0501044_0115111 | |||
| 2617 | Ga0501044_0369420 | |||
| 2618 | Ga0501044_1031010 | |||
| 2619 | Ga0501045_0090524 | |||
| 2620 | nmdc:mga03683_147799_c1 | |||
| 2621 | nmdc:mga03n38_362536_c1 | |||
| 2622 | nmdc:mga00v17_294139_c1 | |||
| 2623 | nmdc:mga06z11_661061_c1 | |||
| 2624 | nmdc:mga05p37_44027_c1 | |||
| 2625 | nmdc:mga05p37_51_c1 | |||
| 2626 | nmdc:mga05p37_819_c2 | |||
| 2627 | nmdc:mga09592_1078_c1 | |||
| 2628 | nmdc:mga09592_1891_c1 | |||
| 2629 | nmdc:mga0qj67_1161078_c1 | |||
| 2630 | nmdc:mga0qj67_23665_c1 | |||
| 2631 | nmdc:mga0qj67_6890_c1 | |||
| 2632 | nmdc:mga06r32_153407_c1 | |||
| 2633 | nmdc:mga06r32_16_c1 | |||
| 2634 | nmdc:mga06r32_578710_c1 | |||
| 2635 | nmdc:mga06r32_677396_c1 | |||
| 2636 | nmdc:mga08y16_2600_c1 | |||
| 2637 | nmdc:mga08y16_697_c1 | |||
| 2638 | nmdc:mga08y16_794739_c1 | |||
| 2639 | nmdc:mga08y16_79_c2 | |||
| 2640 | nmdc:mga0n895_1465712_c1 | |||
| 2641 | nmdc:mga0n895_250277_c1 | |||
| 2642 | nmdc:mga0n895_258404_c1 | |||
| 2643 | nmdc:mga0n895_609_c1 | |||
| 2644 | nmdc:mga0rr50_1280098_c1 | |||
| 2645 | nmdc:mga0rr50_417377_c1 | |||
| 2646 | nmdc:mga0rr50_4488_c1 | |||
| 2647 | nmdc:mga0rr50_48326_c1 | |||
| 2648 | nmdc:mga0rr50_56833_c1 | |||
| 2649 | nmdc:mga08x19_442365_c1 | |||
| 2650 | nmdc:mga08x19_67630_c1 | |||
| 2651 | nmdc:mga08x19_699687_c1 | |||
| 2652 | nmdc:mga0a205_967_c1 | |||
| 2653 | Ga0495601_0008343 | |||
| 2654 | Ga0495601_0011417 | |||
| 2655 | Ga0495601_0014707 | |||
| 2656 | Ga0495601_0017667 | |||
| 2657 | Ga0495601_0024406 | |||
| 2658 | Ga0495601_0039920 | |||
| 2659 | Ga0495601_0109933 | |||
| 2660 | Ga0495612_0001680 | |||
| 2661 | Ga0495612_0003005 | |||
| 2662 | Ga0495612_0122302 | |||
| 2663 | Ga0495612_0168648 | |||
| 2664 | Ga0495612_0271646 | |||
| 2665 | Ga0495612_0532802 | |||
| 2666 | Ga0495595_0004028 | |||
| 2667 | Ga0495595_0004570 | |||
| 2668 | Ga0495595_0007466 | |||
| 2669 | Ga0495595_0012972 | |||
| 2670 | Ga0495595_0063818 | |||
| 2671 | Ga0495595_0065786 | |||
| 2672 | Ga0495595_0582004 | |||
| 2673 | Ga0495619_0001224 | |||
| 2674 | Ga0495619_0003768 | |||
| 2675 | Ga0495619_0003841 | |||
| 2676 | Ga0495619_0004658 | |||
| 2677 | Ga0495619_0008730 | |||
| 2678 | Ga0495619_0022348 | |||
| 2679 | Ga0495619_0056937 | |||
| 2680 | Ga0500566_0153479 | |||
| 2681 | Ga0500559_0017732 | |||
| 2682 | Ga0500568_0051813 | |||
| 2683 | Ga0500603_059207 | |||
| 2684 | Ga0500636_0221998 | |||
| 2685 | Ga0500636_0506793 | |||
| 2686 | Ga0501084_0027428 | |||
| 2687 | Ga0501084_0081748 | |||
| 2688 | Ga0501084_0081902 | |||
| 2689 | Ga0501084_0086177 | |||
| 2690 | Ga0501084_0104404 | |||
| 2691 | Ga0501084_0317179 | |||
| 2692 | Ga0501084_1119160 | |||
| 2693 | Ga0501084_1349359 | |||
| 2694 | Ga0501084_1868594 | |||
| 2695 | Ga0501082_0072147 | |||
| 2696 | Ga0501082_0132410 | |||
| 2697 | Ga0501082_0134001 | |||
| 2698 | Ga0501082_0466796 | |||
| 2699 | Ga0501082_1085089 | |||
| 2700 | Ga0501082_1782244 | |||
| 2701 | Ga0466962_0168550 | |||
| 2702 | Ga0530510_0082610 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6inr-assembly2.cif.gz_B | the crystal structure of phytoplasmal effector causing phyllody symptoms 1 (phyl1) | 0.6927 | 10 | 60 |
| 4jlr-assembly1.cif.gz_S | crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab | 0.658 | 3 | 60 |
| 3aai-assembly1.cif.gz_A | x-ray crystal structure of csor from thermus thermophilus hb8 | 0.6534 | 10 | 63 |
| 7rh5-assembly1.cif.gz_P | mycobacterial ciii2civ2 supercomplex, inhibitor free | 0.6389 | 10 | 63 |
| 3aai-assembly1.cif.gz_C | x-ray crystal structure of csor from thermus thermophilus hb8 | 0.6381 | 10 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jq5E00 | Special;Helix non-globular;Helix Hairpins; | 0.8544 | 1 | 63 | 6.10.140.1350 |
| 4jq5E00 | Special;Helix non-globular;Helix Hairpins; | 0.8308 | 1 | 63 | 6.10.140.1350 |
| af_I1JPC6_537_798_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.7809 | 11 | 60 | 1.20.58.220 |
| af_A0A2R8QM07_546_651_1.25.40.610 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.7484 | 10 | 61 | 1.25.40.610 |
| af_X1WGA9_335_617_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7076 | 2 | 60 | 1.20.58.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A067KA67-F1-model_v4 | RPW8 domain-containing protein | 0.9095 | 2 | 61 |
|
| AF-A0A482X526-F1-model_v4 | Protein DGCR6 | 0.895 | 3 | 63 |
|
| AF-A0A533VQR5-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.8506 | 1 | 59 |
GO:0000155
GO:0000156 GO:0007234 GO:0016020 GO:0030295 |
| AF-A0A482X526-F1-model_v4 | Protein DGCR6 | 0.8456 | 3 | 63 |
|
| AF-A0A067KA67-F1-model_v4 | RPW8 domain-containing protein | 0.8447 | 2 | 61 |
|