F493238

General Info

Members Datasets Scaffolds Average Seq Length
1351 495 2702 65

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100164763|Ga0068868_1001647634
Length 75
Sequence LGQVLVLERGPMSEFMSHYLVPAAIIAVAAVLVLGLINMMRGGSPNRSQKLMRLRVLFQFIAIIVIMATIWAMGR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
24 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
30 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
151 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
152 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
153 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
154 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
155 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
156 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
157 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
158 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
159 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
160 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
161 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
162 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
163 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
164 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
176 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
177 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
178 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
179 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
180 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
182 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
268 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
270 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
274 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
275 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
276 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
277 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
278 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
279 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
280 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
281 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
282 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
283 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
284 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
285 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
286 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
287 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
288 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
289 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
290 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
291 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
292 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
293 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
294 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
295 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
296 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
297 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
298 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
299 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
300 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
301 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
302 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
303 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
304 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
305 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
307 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
308 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
309 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
310 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
311 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
312 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
313 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
314 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
315 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
316 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
317 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
318 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
319 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
320 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
321 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
322 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
325 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
326 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
329 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
334 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
335 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
336 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
337 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
338 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
339 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
340 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
341 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
342 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
343 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
344 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
345 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
346 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
347 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
348 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
349 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
350 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
351 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
352 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
353 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
354 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
355 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
356 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
357 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
358 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
359 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
360 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
361 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
362 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
363 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
364 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
365 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
366 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
367 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
368 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
369 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
370 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
371 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
378 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
379 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
382 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
383 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
386 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
387 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
388 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
389 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
390 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
391 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
392 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
393 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
394 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
395 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
396 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
397 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
398 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
399 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
400 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
401 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
402 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
403 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
404 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
405 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
406 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
407 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
408 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
409 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
410 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
411 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
412 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
413 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
414 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
415 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
416 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
417 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
418 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
419 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
420 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
421 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
422 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
423 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
424 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
425 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
426 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
427 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
428 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
429 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
430 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
431 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
432 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
433 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
434 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
435 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
436 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
437 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
453 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
454 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
455 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
456 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
457 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
458 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
459 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
460 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
461 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
462 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
463 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
464 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
465 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
466 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
467 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
470 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
471 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
476 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
477 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
480 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
481 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
488 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
489 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
490 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
491 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
495 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.93
Metatranscriptomes 0.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 4.96
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100164763 3300005338 Bacteria 1833
2 2214736895 2209111006 Bacteria 4011
3 ARcpr5oldR_c000311 3300000041 Bacteria 7029
4 ARcpr5oldR_c000840 3300000041 Bacteria 3448
5 ARSoilYngRDRAFT_c00517 3300000042 Bacteria 4490
6 ARcpr5yngRDRAFT_c000610 3300000043 Bacteria 4496
7 ARSoilOldRDRAFT_c000709 3300000044 Bacteria 3455
8 ARCol0oldRDRAFT_c00116 3300000045 Bacteria 6995
9 ARCol0yngRDRAFT_1000064 3300000652 Bacteria 19247
10 JGI24032J14994_100183 3300001430 Bacteria 3195
11 JGI24736J21556_1014667 3300001904 Bacteria 1261
12 JGI24741J21665_1037267 3300001915 Bacteria 720
13 JGI24752J21851_1026145 3300001976 Bacteria 766
14 JGI24746J21847_1001338 3300001977 Bacteria 3928
15 JGI24747J21853_1007734 3300001978 Bacteria 1038
16 JGI24739J22299_10006224 3300001989 Bacteria 4508
17 JGI24737J22298_10004778 3300001990 Bacteria 4705
18 JGI24737J22298_10009245 3300001990 Bacteria 3285
19 JGI24743J22301_10032837 3300001991 Bacteria 1026
20 JGI24750J21931_1000306 3300002070 Bacteria 8424
21 JGI24745J21846_1001741 3300002073 Bacteria 2143
22 JGI24745J21846_1016728 3300002073 Bacteria 851
23 JGI24738J21930_10000348 3300002075 Bacteria 12738
24 JGI24749J21850_1006472 3300002076 Bacteria 1633
25 JGI24749J21850_1011879 3300002076 Bacteria 1222
26 JGI24744J21845_10008338 3300002077 Bacteria 2137
27 JGI24035J26624_1002077 3300002126 Bacteria 1865
28 JGI24033J26618_1011225 3300002155 Bacteria 1065
29 JGI24034J26672_10001042 3300002239 Bacteria 3618
30 JGI24034J26672_10034750 3300002239 Bacteria 832
31 JGI24742J22300_10007045 3300002244 Bacteria 1853
32 JGI24742J22300_10084154 3300002244 Bacteria 604
33 Ga0055524_1007164 3300003775 Bacteria 4773
34 JGI25405J52794_10007697 3300003911 Bacteria 1993
35 JGI25405J52794_10009033 3300003911 Bacteria 1874
36 Ga0065717_1004561 3300005276 Bacteria 1015
37 Ga0065716_1000386 3300005277 Bacteria 1251
38 Ga0065714_10358745 3300005288 Bacteria 627
39 Ga0065704_10102914 3300005289 Bacteria 2189
40 Ga0065712_10001837 3300005290 Bacteria 5553
41 Ga0065712_10210982 3300005290 Bacteria 1073
42 Ga0065712_10826253 3300005290 Bacteria 504
43 Ga0065715_10002792 3300005293 Bacteria 8377
44 Ga0065715_10011595 3300005293 Bacteria 2072
45 Ga0065707_10116186 3300005295 Bacteria 2245
46 Ga0065707_10187256 3300005295 Bacteria 1381
47 Ga0070658_10022098 3300005327 Bacteria 5104
48 Ga0070676_10000374 3300005328 Bacteria 20693
49 Ga0070676_10135789 3300005328 Bacteria 1560
50 Ga0070676_10405950 3300005328 Bacteria 949
51 Ga0070683_100003823 3300005329 Bacteria 12306
52 Ga0070683_100314271 3300005329 Bacteria 1491
53 Ga0070683_100695158 3300005329 Unclassified 974
54 Ga0070683_100700523 3300005329 Bacteria 970
55 Ga0070683_101331083 3300005329 Bacteria 690
56 Ga0070690_100133199 3300005330 Bacteria 1680
57 Ga0070690_100228846 3300005330 Bacteria 1306
58 Ga0070670_100055679 3300005331 Bacteria 3394
59 Ga0070677_10000461 3300005333 Bacteria 13925
60 Ga0068869_100001399 3300005334 Bacteria 14247
61 Ga0070666_10014716 3300005335 Bacteria 4983
62 Ga0070666_10041967 3300005335 Bacteria 3058
63 Ga0070666_11047110 3300005335 Bacteria 606
64 Ga0070680_100012044 3300005336 Bacteria 6711
65 Ga0070680_100202372 3300005336 Bacteria 1675
66 Ga0070680_100296175 3300005336 Bacteria 1371
67 Ga0070680_100593257 3300005336 Bacteria 951
68 Ga0070680_100897397 3300005336 Bacteria 765
69 Ga0070682_100001646 3300005337 Bacteria 12408
70 Ga0070682_100073361 3300005337 Bacteria 2195
71 Ga0070682_100909994 3300005337 Bacteria 723
72 Ga0070682_101633390 3300005337 Bacteria 558
73 Ga0068868_100000857 3300005338 Bacteria 20647
74 Ga0070660_100002034 3300005339 Bacteria 13952
75 Ga0070660_100025298 3300005339 Bacteria 4411
76 Ga0070660_100445567 3300005339 Bacteria 1074
77 Ga0070660_101235811 3300005339 Bacteria 633
78 Ga0070660_101322388 3300005339 Bacteria 612
79 Ga0070689_100040860 3300005340 Bacteria 3557
80 Ga0070689_100077743 3300005340 Bacteria 2601
81 Ga0070691_10039715 3300005341 Bacteria 2223
82 Ga0070691_10056343 3300005341 Bacteria 1884
83 Ga0070687_100146638 3300005343 Bacteria 1380
84 Ga0070687_100421442 3300005343 Bacteria 880
85 Ga0070661_100002763 3300005344 Bacteria 12040
86 Ga0070661_100063093 3300005344 Bacteria 2721
87 Ga0070661_100329926 3300005344 Bacteria 1193
88 Ga0070661_100919728 3300005344 Bacteria 723
89 Ga0070661_101112003 3300005344 Bacteria 659
90 Ga0070692_10013586 3300005345 Bacteria 3799
91 Ga0070692_10175784 3300005345 Bacteria 1237
92 Ga0070692_10340229 3300005345 Unclassified 929
93 Ga0070668_100240164 3300005347 Bacteria 1500
94 Ga0070668_100287276 3300005347 Bacteria 1375
95 Ga0070668_100399690 3300005347 Bacteria 1173
96 Ga0070669_100022340 3300005353 Bacteria 4522
97 Ga0070675_100055352 3300005354 Bacteria 3265
98 Ga0070675_100132287 3300005354 Bacteria 2127
99 Ga0070675_100627970 3300005354 Bacteria 975
100 Ga0070671_100000944 3300005355 Bacteria 21285
101 Ga0070671_100024654 3300005355 Bacteria 4927
102 Ga0070671_100142954 3300005355 Bacteria 2019
103 Ga0070674_100042093 3300005356 Bacteria 3101
104 Ga0070674_100053296 3300005356 Bacteria 2792
105 Ga0070674_100061289 3300005356 Bacteria 2625
106 Ga0070674_100621797 3300005356 Bacteria 915
107 Ga0070673_100000633 3300005364 Bacteria 19280
108 Ga0070673_100021643 3300005364 Bacteria 4667
109 Ga0070673_100317111 3300005364 Bacteria 1376
110 Ga0070688_100006703 3300005365 Bacteria 6169
111 Ga0070688_100020601 3300005365 Bacteria 3836
112 Ga0070659_100185474 3300005366 Bacteria 1708
113 Ga0070659_100246600 3300005366 Bacteria 1479
114 Ga0070659_100772188 3300005366 Bacteria 834
115 Ga0070659_101959422 3300005366 Bacteria 526
116 Ga0070667_100001396 3300005367 Bacteria 21599
117 Ga0070667_100045449 3300005367 Bacteria 3692
118 Ga0070667_100078400 3300005367 Bacteria 2822
119 Ga0070667_101321862 3300005367 Bacteria 675
120 Ga0070703_10206707 3300005406 Bacteria 774
121 Ga0070709_10005668 3300005434 Bacteria 6767
122 Ga0070709_10006339 3300005434 Bacteria 6442
123 Ga0070709_10277063 3300005434 Bacteria 1218
124 Ga0070709_10788793 3300005434 Bacteria 745
125 Ga0070709_11722090 3300005434 Bacteria 512
126 Ga0070714_100024472 3300005435 Bacteria 4973
127 Ga0070714_100091275 3300005435 Bacteria 2668
128 Ga0070714_100125523 3300005435 Bacteria 2288
129 Ga0070714_100192333 3300005435 Bacteria 1863
130 Ga0070714_101226898 3300005435 Bacteria 732
131 Ga0070714_101321270 3300005435 Bacteria 704
132 Ga0070713_100011762 3300005436 Bacteria 6391
133 Ga0070713_100018486 3300005436 Bacteria 5296
134 Ga0070713_100027651 3300005436 Bacteria 4467
135 Ga0070713_100216831 3300005436 Bacteria 1735
136 Ga0070713_100482492 3300005436 Bacteria 1168
137 Ga0070713_100831263 3300005436 Bacteria 886
138 Ga0070710_10003944 3300005437 Bacteria 7030
139 Ga0070710_10025481 3300005437 Bacteria 3132
140 Ga0070710_10030724 3300005437 Bacteria 2892
141 Ga0070710_11009764 3300005437 Bacteria 606
142 Ga0070710_11355693 3300005437 Unclassified 530
143 Ga0070710_11456976 3300005437 Bacteria 513
144 Ga0070701_10002950 3300005438 Bacteria 6642
145 Ga0070711_100128434 3300005439 Bacteria 1884
146 Ga0070711_100140581 3300005439 Bacteria 1809
147 Ga0070711_100188181 3300005439 Bacteria 1584
148 Ga0070711_100290711 3300005439 Bacteria 1296
149 Ga0070705_100001427 3300005440 Bacteria 12645
150 Ga0070705_100041318 3300005440 Bacteria 2628
151 Ga0070705_100223386 3300005440 Bacteria 1305
152 Ga0070705_100965285 3300005440 Bacteria 689
153 Ga0070700_100001316 3300005441 Bacteria 12313
154 Ga0070700_100321790 3300005441 Bacteria 1136
155 Ga0070694_100121265 3300005444 Bacteria 1876
156 Ga0070694_101867724 3300005444 Bacteria 512
157 Ga0070708_100212038 3300005445 Bacteria 1815
158 Ga0070708_101930509 3300005445 Bacteria 547
159 Ga0070663_100041246 3300005455 Bacteria 3236
160 Ga0070663_100274035 3300005455 Bacteria 1342
161 Ga0070663_100384697 3300005455 Bacteria 1143
162 Ga0070663_100546701 3300005455 Bacteria 967
163 Ga0070663_101641066 3300005455 Unclassified 574
164 Ga0070678_100001338 3300005456 Bacteria 13111
165 Ga0070678_100253145 3300005456 Bacteria 1477
166 Ga0070662_100020664 3300005457 Bacteria 4488
167 Ga0070662_100197745 3300005457 Bacteria 1593
168 Ga0070662_100283385 3300005457 Bacteria 1342
169 Ga0070681_10013616 3300005458 Bacteria 8092
170 Ga0070681_10020378 3300005458 Bacteria 6646
171 Ga0070681_10076377 3300005458 Bacteria 3308
172 Ga0070681_10263620 3300005458 Bacteria 1635
173 Ga0070681_10416319 3300005458 Bacteria 1255
174 Ga0070681_10666300 3300005458 Bacteria 956
175 Ga0070681_10754447 3300005458 Bacteria 890
176 Ga0070681_10789896 3300005458 Bacteria 866
177 Ga0070681_10804884 3300005458 Bacteria 857
178 Ga0068867_100003745 3300005459 Bacteria 10708
179 Ga0070685_10010368 3300005466 Bacteria 4841
180 Ga0070685_10019913 3300005466 Bacteria 3626
181 Ga0070707_100256385 3300005468 Bacteria 1702
182 Ga0070707_100259696 3300005468 Bacteria 1690
183 Ga0070698_101374633 3300005471 Bacteria 657
184 Ga0074259_10443300 3300005507 Bacteria 825
185 Ga0070699_100376173 3300005518 Bacteria 1282
186 Ga0070679_100014385 3300005530 Bacteria 7600
187 Ga0070679_100024499 3300005530 Bacteria 5913
188 Ga0070679_100118277 3300005530 Bacteria 2635
189 Ga0070679_100134690 3300005530 Bacteria 2451
190 Ga0070679_100202648 3300005530 Bacteria 1949
191 Ga0070684_100138386 3300005535 Bacteria 2200
192 Ga0070684_100151175 3300005535 Bacteria 2103
193 Ga0070684_100596753 3300005535 Bacteria 1026
194 Ga0070684_101726885 3300005535 Bacteria 590
195 Ga0070684_101819163 3300005535 Bacteria 575
196 Ga0070684_102073700 3300005535 Unclassified 537
197 Ga0070697_100925803 3300005536 Bacteria 774
198 Ga0070697_101152522 3300005536 Bacteria 690
199 Ga0070697_101434970 3300005536 Bacteria 616
200 Ga0068853_100002812 3300005539 Bacteria 13177
201 Ga0068853_100220561 3300005539 Bacteria 1732
202 Ga0068853_100784076 3300005539 Bacteria 912
203 Ga0068853_100851263 3300005539 Bacteria 875
204 Ga0068853_101414888 3300005539 Bacteria 673
205 Ga0068853_101634942 3300005539 Bacteria 624
206 Ga0068853_101961692 3300005539 Unclassified 568
207 Ga0070672_100003770 3300005543 Bacteria 9864
208 Ga0070686_100011271 3300005544 Bacteria 5066
209 Ga0070686_100033789 3300005544 Bacteria 3145
210 Ga0070695_100024486 3300005545 Bacteria 3719
211 Ga0070695_101013966 3300005545 Bacteria 676
212 Ga0070696_100021036 3300005546 Bacteria 4421
213 Ga0070696_100021091 3300005546 Bacteria 4416
214 Ga0070693_100062750 3300005547 Bacteria 2163
215 Ga0070693_100068331 3300005547 Bacteria 2085
216 Ga0070693_100168804 3300005547 Bacteria 1399
217 Ga0070693_100468195 3300005547 Unclassified 888
218 Ga0070693_101237549 3300005547 Bacteria 575
219 Ga0070665_100017655 3300005548 Bacteria 7166
220 Ga0070665_100354537 3300005548 Bacteria 1473
221 Ga0070665_100788104 3300005548 Bacteria 963
222 Ga0070704_100002635 3300005549 Bacteria 10125
223 Ga0070704_100040518 3300005549 Bacteria 3207
224 Ga0070704_100276867 3300005549 Bacteria 1388
225 Ga0068855_100081515 3300005563 Bacteria 3750
226 Ga0068855_100095442 3300005563 Bacteria 3427
227 Ga0068855_100329615 3300005563 Bacteria 1685
228 Ga0068855_100473873 3300005563 Bacteria 1363
229 Ga0068855_101339383 3300005563 Bacteria 740
230 Ga0070664_100003713 3300005564 Bacteria 12306
231 Ga0070664_100232890 3300005564 Bacteria 1651
232 Ga0070664_100400858 3300005564 Bacteria 1254
233 Ga0070664_100754209 3300005564 Bacteria 909
234 Ga0070664_101087941 3300005564 Bacteria 753
235 Ga0070664_102150789 3300005564 Bacteria 529
236 Ga0068857_100018167 3300005577 Bacteria 6169
237 Ga0068854_100064999 3300005578 Bacteria 2651
238 Ga0068854_101419759 3300005578 Bacteria 628
239 Ga0068856_100069292 3300005614 Bacteria 3488
240 Ga0068856_100095206 3300005614 Bacteria 2966
241 Ga0068856_100165792 3300005614 Bacteria 2220
242 Ga0068856_100843706 3300005614 Bacteria 935
243 Ga0068856_101668170 3300005614 Bacteria 650
244 Ga0068856_102162476 3300005614 Bacteria 566
245 Ga0070702_100068724 3300005615 Bacteria 2085
246 Ga0070702_100173249 3300005615 Bacteria 1406
247 Ga0070702_100781219 3300005615 Unclassified 736
248 Ga0068852_100009996 3300005616 Bacteria 7059
249 Ga0068852_100153045 3300005616 Bacteria 2147
250 Ga0068852_100626123 3300005616 Bacteria 1082
251 Ga0068852_102674836 3300005616 Bacteria 518
252 Ga0068859_100050266 3300005617 Bacteria 4188
253 Ga0068859_101023240 3300005617 Bacteria 907
254 Ga0068859_101419395 3300005617 Bacteria 766
255 Ga0068859_102407032 3300005617 Bacteria 580
256 Ga0068864_100004113 3300005618 Bacteria 11936
257 Ga0068866_10001778 3300005718 Bacteria 9078
258 Ga0068866_10050206 3300005718 Bacteria 2117
259 Ga0068861_100090462 3300005719 Bacteria 2414
260 Ga0068870_10000630 3300005840 Bacteria 13448
261 Ga0068863_100001487 3300005841 Bacteria 23230
262 Ga0068863_100133784 3300005841 Bacteria 2368
263 Ga0068863_100444244 3300005841 Bacteria 1272
264 Ga0068858_100079144 3300005842 Bacteria 3054
265 Ga0068858_100137231 3300005842 Bacteria 2295
266 Ga0068858_100252503 3300005842 Bacteria 1675
267 Ga0068858_100877164 3300005842 Bacteria 877
268 Ga0068860_100000338 3300005843 Bacteria 63598
269 Ga0068860_100001886 3300005843 Bacteria 22272
270 Ga0068860_100076172 3300005843 Bacteria 3190
271 Ga0068860_100322267 3300005843 Bacteria 1517
272 Ga0068862_100187335 3300005844 Bacteria 1860
273 Ga0068862_100562208 3300005844 Bacteria 1090
274 Ga0081455_10000313 3300005937 Bacteria 63616
275 Ga0081455_10001856 3300005937 Bacteria 25428
276 Ga0081455_10029804 3300005937 Bacteria 4970
277 Ga0081455_10067125 3300005937 Bacteria 2990
278 Ga0081455_10250521 3300005937 Bacteria 1295
279 Ga0081455_10277828 3300005937 Bacteria 1211
280 Ga0081540_1070887 3300005983 Bacteria 1612
281 Ga0070717_10000430 3300006028 Bacteria 26747
282 Ga0070717_10017570 3300006028 Bacteria 5570
283 Ga0070717_10737502 3300006028 Bacteria 895
284 Ga0070717_10883178 3300006028 Bacteria 814
285 Ga0075363_100146151 3300006048 Bacteria 1333
286 Ga0075364_10343519 3300006051 Bacteria 1017
287 Ga0075432_10001349 3300006058 Bacteria 7961
288 Ga0075432_10050289 3300006058 Bacteria 1470
289 Ga0075432_10535433 3300006058 Bacteria 527
290 Ga0070715_10079654 3300006163 Bacteria 1484
291 Ga0070715_10126263 3300006163 Bacteria 1226
292 Ga0070715_10147717 3300006163 Bacteria 1148
293 Ga0070716_100000617 3300006173 Bacteria 15022
294 Ga0070716_100031514 3300006173 Bacteria 2884
295 Ga0070716_100217740 3300006173 Bacteria 1281
296 Ga0070712_100095843 3300006175 Bacteria 2184
297 Ga0070712_100139244 3300006175 Bacteria 1849
298 Ga0070712_100297247 3300006175 Bacteria 1306
299 Ga0075367_10127942 3300006178 Bacteria 1569
300 Ga0075427_10003324 3300006194 Bacteria 2210
301 Ga0097621_100008449 3300006237 Bacteria 7417
302 Ga0097621_100009717 3300006237 Bacteria 6998
303 Ga0097621_100078355 3300006237 Bacteria 2745
304 Ga0075370_10765251 3300006353 Bacteria 588
305 Ga0068871_100001209 3300006358 Bacteria 17213
306 Ga0068871_100011630 3300006358 Bacteria 6462
307 Ga0068871_100026251 3300006358 Bacteria 4543
308 Ga0075428_100004387 3300006844 Bacteria 15573
309 Ga0075428_100205605 3300006844 Bacteria 2128
310 Ga0075428_100329777 3300006844 Bacteria 1639
311 Ga0075428_100768253 3300006844 Bacteria 1025
312 Ga0075430_100047563 3300006846 Bacteria 3623
313 Ga0075430_100062773 3300006846 Bacteria 3120
314 Ga0075430_100234177 3300006846 Bacteria 1522
315 Ga0075431_100000305 3300006847 Bacteria 38524
316 Ga0075431_100511793 3300006847 Bacteria 1190
317 Ga0075433_10000618 3300006852 Bacteria 23730
318 Ga0075433_10162525 3300006852 Bacteria 1987
319 Ga0075433_10260292 3300006852 Bacteria 1538
320 Ga0075434_100004516 3300006871 Bacteria 12557
321 Ga0075434_100004895 3300006871 Bacteria 12140
322 Ga0075434_100202084 3300006871 Bacteria 2007
323 Ga0075434_100325968 3300006871 Bacteria 1556
324 Ga0075434_100449212 3300006871 Bacteria 1310
325 Ga0075434_102349406 3300006871 Bacteria 536
326 Ga0075429_100001751 3300006880 Bacteria 17978
327 Ga0075429_100002026 3300006880 Bacteria 16859
328 Ga0075429_100416782 3300006880 Bacteria 1176
329 Ga0068865_100018285 3300006881 Bacteria 4521
330 Ga0075436_100043548 3300006914 Bacteria 3095
331 Ga0075436_100441390 3300006914 Bacteria 947
332 Ga0075436_100452601 3300006914 Bacteria 935
333 Ga0097620_100050263 3300006931 Bacteria 4188
334 Ga0097620_101023256 3300006931 Bacteria 907
335 Ga0097620_101419275 3300006931 Bacteria 766
336 Ga0097620_102406494 3300006931 Bacteria 580
337 Ga0075435_100004466 3300007076 Bacteria 9612
338 Ga0075435_100068391 3300007076 Bacteria 2893
339 Ga0075435_100069834 3300007076 Bacteria 2866
340 Ga0075435_100108968 3300007076 Bacteria 2302
341 Ga0075435_100385819 3300007076 Bacteria 1204
342 Ga0105251_10009665 3300009011 Bacteria 5670
343 Ga0105251_10256321 3300009011 Bacteria 789
344 Ga0105244_10254702 3300009036 Bacteria 818
345 Ga0105250_10033642 3300009092 Bacteria 2059
346 Ga0105250_10293962 3300009092 Unclassified 701
347 Ga0105240_10329808 3300009093 Bacteria 1737
348 Ga0105240_10373606 3300009093 Bacteria 1611
349 Ga0105240_10544883 3300009093 Bacteria 1284
350 Ga0105240_11173567 3300009093 Bacteria 814
351 Ga0105240_11370540 3300009093 Bacteria 744
352 Ga0111539_10000072 3300009094 Bacteria 100461
353 Ga0111539_10001208 3300009094 Bacteria 34372
354 Ga0111539_10002538 3300009094 Bacteria 24172
355 Ga0111539_10024753 3300009094 Bacteria 7362
356 Ga0111539_10068136 3300009094 Bacteria 4201
357 Ga0111539_11367495 3300009094 Unclassified 821
358 Ga0105245_10001702 3300009098 Bacteria 20025
359 Ga0105245_10010259 3300009098 Bacteria 8156
360 Ga0105245_10130671 3300009098 Bacteria 2355
361 Ga0105245_10407028 3300009098 Bacteria 1361
362 Ga0105245_10445267 3300009098 Unclassified 1303
363 Ga0105245_10863389 3300009098 Bacteria 945
364 Ga0105245_11636724 3300009098 Bacteria 696
365 Ga0105245_13010652 3300009098 Bacteria 522
366 Ga0105247_10060167 3300009101 Bacteria 2353
367 Ga0114129_10009025 3300009147 Bacteria 14215
368 Ga0114129_10322990 3300009147 Bacteria 2051
369 Ga0105243_10010792 3300009148 Bacteria 6914
370 Ga0105243_10172488 3300009148 Bacteria 1875
371 Ga0105243_10250766 3300009148 Bacteria 1580
372 Ga0105243_10636278 3300009148 Bacteria 1032
373 Ga0105241_10008089 3300009174 Bacteria 7736
374 Ga0105241_10022718 3300009174 Bacteria 4649
375 Ga0105241_10377015 3300009174 Bacteria 1238
376 Ga0105241_11754421 3300009174 Bacteria 605
377 Ga0105241_12521352 3300009174 Bacteria 515
378 Ga0105242_10002547 3300009176 Bacteria 14286
379 Ga0105242_10003812 3300009176 Bacteria 11725
380 Ga0105242_10224540 3300009176 Bacteria 1680
381 Ga0105242_11400837 3300009176 Bacteria 726
382 Ga0105242_12605580 3300009176 Bacteria 555
383 Ga0105248_10030754 3300009177 Bacteria 5997
384 Ga0105248_10082675 3300009177 Bacteria 3612
385 Ga0105248_10144963 3300009177 Bacteria 2680
386 Ga0105248_13057615 3300009177 Bacteria 533
387 Ga0105237_10041676 3300009545 Bacteria 4630
388 Ga0105237_10393473 3300009545 Bacteria 1391
389 Ga0105237_10835667 3300009545 Bacteria 928
390 Ga0105237_12226476 3300009545 Bacteria 558
391 Ga0105238_10174906 3300009551 Bacteria 2123
392 Ga0105238_10240578 3300009551 Bacteria 1787
393 Ga0105238_10244817 3300009551 Bacteria 1771
394 Ga0105238_10581366 3300009551 Bacteria 1126
395 Ga0105249_10002932 3300009553 Bacteria 14716
396 Ga0105249_10077851 3300009553 Bacteria 3076
397 Ga0105249_10284120 3300009553 Bacteria 1654
398 Ga0105239_10007571 3300010375 Bacteria 12453
399 Ga0105239_10359706 3300010375 Bacteria 1644
400 Ga0105239_10599296 3300010375 Bacteria 1257
401 Ga0105239_12258715 3300010375 Bacteria 633
402 Ga0105239_12917551 3300010375 Bacteria 558
403 Ga0105246_10000456 3300011119 Bacteria 21904
404 Ga0105246_10034993 3300011119 Bacteria 3353
405 Ga0157340_1017516 3300012473 Bacteria 576
406 Ga0157340_1020878 3300012473 Bacteria 551
407 Ga0157344_1002446 3300012476 Bacteria 983
408 Ga0157346_1005461 3300012480 Unclassified 789
409 Ga0157337_1000995 3300012483 Bacteria 1375
410 Ga0157337_1006072 3300012483 Bacteria 826
411 Ga0157321_1003314 3300012487 Bacteria 953
412 Ga0157341_1011855 3300012494 Bacteria 759
413 Ga0157345_1006853 3300012498 Bacteria 917
414 Ga0157314_1050750 3300012500 Bacteria 529
415 Ga0157324_1000599 3300012506 Bacteria 1748
416 Ga0157342_1000152 3300012507 Bacteria 3502
417 Ga0157315_1000752 3300012508 Bacteria 1590
418 Ga0157326_1023539 3300012513 Bacteria 775
419 Ga0157338_1003303 3300012515 Unclassified 1329
420 Ga0157338_1077607 3300012515 Bacteria 531
421 Ga0157373_10094553 3300013100 Bacteria 2104
422 Ga0157373_10196560 3300013100 Bacteria 1422
423 Ga0157373_10449334 3300013100 Bacteria 927
424 Ga0157373_10491813 3300013100 Bacteria 886
425 Ga0157373_11292724 3300013100 Bacteria 552
426 Ga0157371_10015233 3300013102 Bacteria 5775
427 Ga0157371_10235851 3300013102 Bacteria 1315
428 Ga0157371_10752618 3300013102 Bacteria 732
429 Ga0157370_10208527 3300013104 Bacteria 1811
430 Ga0157370_10509836 3300013104 Bacteria 1104
431 Ga0157370_10639589 3300013104 Unclassified 972
432 Ga0157370_10763642 3300013104 Bacteria 881
433 Ga0157370_11280962 3300013104 Bacteria 661
434 Ga0157369_10196586 3300013105 Bacteria 2118
435 Ga0157369_10334097 3300013105 Bacteria 1574
436 Ga0157369_10693294 3300013105 Bacteria 1049
437 Ga0157369_10783991 3300013105 Bacteria 980
438 Ga0157369_12585143 3300013105 Bacteria 513
439 Ga0157374_10027781 3300013296 Bacteria 5108
440 Ga0157374_10067109 3300013296 Bacteria 3372
441 Ga0157374_10377062 3300013296 Bacteria 1413
442 Ga0157374_11146552 3300013296 Bacteria 798
443 Ga0157378_10002239 3300013297 Bacteria 17169
444 Ga0157378_10694458 3300013297 Bacteria 1036
445 Ga0157378_10719018 3300013297 Bacteria 1019
446 Ga0163162_10005232 3300013306 Bacteria 12509
447 Ga0163162_10085379 3300013306 Bacteria 3233
448 Ga0163162_10413997 3300013306 Bacteria 1480
449 Ga0157372_10097909 3300013307 Bacteria 3346
450 Ga0157372_10144628 3300013307 Bacteria 2742
451 Ga0157372_10207302 3300013307 Bacteria 2271
452 Ga0157372_10523761 3300013307 Bacteria 1382
453 Ga0157375_10001714 3300013308 Bacteria 18825
454 Ga0157375_10030610 3300013308 Bacteria 5077
455 Ga0157375_10190111 3300013308 Bacteria 2208
456 Ga0157375_10225001 3300013308 Bacteria 2035
457 Ga0157375_11047133 3300013308 Bacteria 954
458 Ga0163163_10001518 3300014325 Bacteria 19614
459 Ga0163163_10174616 3300014325 Bacteria 2195
460 Ga0163163_10366798 3300014325 Bacteria 1497
461 Ga0163163_12794896 3300014325 Bacteria 545
462 Ga0157380_10012889 3300014326 Bacteria 6077
463 Ga0157380_10607127 3300014326 Bacteria 1083
464 Ga0182008_10201423 3300014497 Bacteria 1013
465 Ga0182008_10647328 3300014497 Bacteria 598
466 Ga0182008_10823049 3300014497 Bacteria 541
467 Ga0157377_10002411 3300014745 Bacteria 8256
468 Ga0157377_10038150 3300014745 Bacteria 2651
469 Ga0157379_10003150 3300014968 Bacteria 13956
470 Ga0157379_10021868 3300014968 Bacteria 5666
471 Ga0157379_10049294 3300014968 Bacteria 3760
472 Ga0157379_11336340 3300014968 Bacteria 693
473 Ga0157376_10001552 3300014969 Bacteria 15161
474 Ga0157376_10066923 3300014969 Bacteria 3038
475 Ga0157376_10148440 3300014969 Bacteria 2112
476 Ga0182007_10263505 3300015262 Bacteria 622
477 Ga0163161_10002536 3300017792 Bacteria 13029
478 Ga0163161_10100265 3300017792 Bacteria 2155
479 Ga0163161_10180229 3300017792 Bacteria 1619
480 Ga0206353_11323643 3300020082 Bacteria 1008
481 Ga0213872_10352069 3300021361 Bacteria 604
482 Ga0207666_1000186 3300025271 Bacteria 9311
483 Ga0207673_1000346 3300025290 Bacteria 4664
484 Ga0207673_1018184 3300025290 Bacteria 941
485 Ga0209256_1000181 3300025299 Bacteria 123624
486 Ga0207697_10010849 3300025315 Bacteria 3876
487 Ga0207697_10016334 3300025315 Bacteria 3057
488 Ga0207656_10276535 3300025321 Bacteria 827
489 Ga0207696_1092354 3300025711 Bacteria 829
490 Ga0207696_1194706 3300025711 Bacteria 533
491 Ga0207653_10002509 3300025885 Bacteria 5827
492 Ga0207653_10008464 3300025885 Bacteria 3205
493 Ga0207682_10000143 3300025893 Bacteria 32063
494 Ga0207692_10010101 3300025898 Bacteria 3966
495 Ga0207692_10039931 3300025898 Bacteria 2312
496 Ga0207692_10079530 3300025898 Bacteria 1749
497 Ga0207692_11195911 3300025898 Bacteria 505
498 Ga0207642_10003670 3300025899 Bacteria 4876
499 Ga0207642_10090387 3300025899 Bacteria 1511
500 Ga0207642_10442171 3300025899 Bacteria 786
501 Ga0207710_10002851 3300025900 Bacteria 7872
502 Ga0207710_10028478 3300025900 Bacteria 2425
503 Ga0207710_10478767 3300025900 Bacteria 645
504 Ga0207688_10004837 3300025901 Bacteria 7335
505 Ga0207688_10087339 3300025901 Bacteria 1788
506 Ga0207680_10059922 3300025903 Bacteria 2315
507 Ga0207680_10291351 3300025903 Bacteria 1136
508 Ga0207647_10009610 3300025904 Bacteria 6867
509 Ga0207647_10165777 3300025904 Bacteria 1288
510 Ga0207647_10344191 3300025904 Unclassified 845
511 Ga0207685_10214002 3300025905 Bacteria 913
512 Ga0207685_10265698 3300025905 Bacteria 836
513 Ga0207699_10002837 3300025906 Bacteria 8208
514 Ga0207699_10008626 3300025906 Bacteria 5040
515 Ga0207699_10303724 3300025906 Bacteria 1115
516 Ga0207699_11181720 3300025906 Bacteria 566
517 Ga0207645_10003855 3300025907 Bacteria 11222
518 Ga0207645_10062093 3300025907 Bacteria 2387
519 Ga0207645_10334183 3300025907 Bacteria 1012
520 Ga0207645_10342871 3300025907 Bacteria 999
521 Ga0207643_10000336 3300025908 Bacteria 32116
522 Ga0207705_10053004 3300025909 Bacteria 2922
523 Ga0207705_10059508 3300025909 Bacteria 2757
524 Ga0207654_10007173 3300025911 Bacteria 5614
525 Ga0207654_10030175 3300025911 Bacteria 2974
526 Ga0207654_10084852 3300025911 Bacteria 1916
527 Ga0207707_10004481 3300025912 Bacteria 12289
528 Ga0207707_10032305 3300025912 Bacteria 4581
529 Ga0207707_10126505 3300025912 Bacteria 2235
530 Ga0207707_10253668 3300025912 Bacteria 1528
531 Ga0207707_10419007 3300025912 Bacteria 1148
532 Ga0207707_10555626 3300025912 Bacteria 975
533 Ga0207707_10595474 3300025912 Bacteria 936
534 Ga0207695_10072031 3300025913 Bacteria 3528
535 Ga0207671_10017926 3300025914 Bacteria 5446
536 Ga0207671_10140224 3300025914 Bacteria 1862
537 Ga0207671_11003462 3300025914 Bacteria 658
538 Ga0207693_10047659 3300025915 Bacteria 3366
539 Ga0207693_10059188 3300025915 Bacteria 3001
540 Ga0207693_10068794 3300025915 Bacteria 2771
541 Ga0207663_10033186 3300025916 Bacteria 3072
542 Ga0207663_10113738 3300025916 Bacteria 1841
543 Ga0207663_10293326 3300025916 Bacteria 1212
544 Ga0207663_10498782 3300025916 Bacteria 945
545 Ga0207663_10503645 3300025916 Bacteria 941
546 Ga0207660_10002805 3300025917 Bacteria 11422
547 Ga0207660_10067774 3300025917 Bacteria 2586
548 Ga0207660_10247453 3300025917 Bacteria 1406
549 Ga0207660_10329211 3300025917 Bacteria 1221
550 Ga0207660_10816366 3300025917 Bacteria 761
551 Ga0207662_10017545 3300025918 Bacteria 4051
552 Ga0207662_10833726 3300025918 Bacteria 651
553 Ga0207657_10025170 3300025919 Bacteria 5493
554 Ga0207657_10041931 3300025919 Bacteria 4042
555 Ga0207657_10059076 3300025919 Bacteria 3297
556 Ga0207657_10080849 3300025919 Bacteria 2731
557 Ga0207657_10089041 3300025919 Bacteria 2579
558 Ga0207657_10143785 3300025919 Bacteria 1947
559 Ga0207649_10000889 3300025920 Bacteria 18889
560 Ga0207649_10049100 3300025920 Bacteria 2604
561 Ga0207649_10107454 3300025920 Bacteria 1858
562 Ga0207652_10028916 3300025921 Bacteria 4627
563 Ga0207652_10061170 3300025921 Bacteria 3251
564 Ga0207652_10138240 3300025921 Bacteria 2177
565 Ga0207652_10139171 3300025921 Bacteria 2169
566 Ga0207652_10766391 3300025921 Bacteria 858
567 Ga0207652_10840669 3300025921 Bacteria 813
568 Ga0207681_10000782 3300025923 Bacteria 20961
569 Ga0207681_10108107 3300025923 Bacteria 2018
570 Ga0207694_10111928 3300025924 Bacteria 2172
571 Ga0207694_10129294 3300025924 Bacteria 2023
572 Ga0207694_10586500 3300025924 Bacteria 937
573 Ga0207694_10747598 3300025924 Bacteria 825
574 Ga0207650_10021612 3300025925 Bacteria 4546
575 Ga0207650_10216694 3300025925 Bacteria 1539
576 Ga0207659_10000676 3300025926 Bacteria 20223
577 Ga0207659_10473325 3300025926 Bacteria 1057
578 Ga0207687_10001851 3300025927 Bacteria 14553
579 Ga0207687_10032859 3300025927 Bacteria 3517
580 Ga0207687_10046333 3300025927 Bacteria 3010
581 Ga0207687_10862131 3300025927 Bacteria 774
582 Ga0207687_11180836 3300025927 Bacteria 658
583 Ga0207700_10015283 3300025928 Bacteria 5056
584 Ga0207700_10106298 3300025928 Bacteria 2249
585 Ga0207700_10373740 3300025928 Bacteria 1245
586 Ga0207664_10115796 3300025929 Bacteria 2235
587 Ga0207664_10229696 3300025929 Bacteria 1612
588 Ga0207664_10306494 3300025929 Bacteria 1398
589 Ga0207644_10001040 3300025931 Bacteria 17793
590 Ga0207644_10007133 3300025931 Bacteria 7281
591 Ga0207644_10399308 3300025931 Bacteria 1123
592 Ga0207644_10861080 3300025931 Bacteria 759
593 Ga0207690_10001491 3300025932 Bacteria 14625
594 Ga0207690_10295245 3300025932 Bacteria 1266
595 Ga0207690_10715083 3300025932 Bacteria 824
596 Ga0207690_10944347 3300025932 Bacteria 716
597 Ga0207706_10040546 3300025933 Bacteria 4127
598 Ga0207706_10040651 3300025933 Bacteria 4122
599 Ga0207706_10269359 3300025933 Bacteria 1486
600 Ga0207686_10019478 3300025934 Bacteria 3861
601 Ga0207686_10023879 3300025934 Bacteria 3535
602 Ga0207686_10113589 3300025934 Bacteria 1831
603 Ga0207686_10278058 3300025934 Bacteria 1235
604 Ga0207686_11244466 3300025934 Bacteria 610
605 Ga0207709_10017465 3300025935 Bacteria 4004
606 Ga0207709_10066231 3300025935 Bacteria 2274
607 Ga0207709_10258987 3300025935 Unclassified 1275
608 Ga0207670_10002314 3300025936 Bacteria 9990
609 Ga0207670_10036052 3300025936 Bacteria 3213
610 Ga0207670_10118356 3300025936 Bacteria 1921
611 Ga0207669_10001302 3300025937 Bacteria 10597
612 Ga0207669_10039633 3300025937 Bacteria 2725
613 Ga0207669_11481830 3300025937 Bacteria 578
614 Ga0207704_10000410 3300025938 Bacteria 19429
615 Ga0207704_10168583 3300025938 Bacteria 1567
616 Ga0207704_10231464 3300025938 Bacteria 1374
617 Ga0207704_11564573 3300025938 Bacteria 566
618 Ga0207665_10000756 3300025939 Bacteria 21750
619 Ga0207665_10027820 3300025939 Bacteria 3735
620 Ga0207665_10050785 3300025939 Bacteria 2789
621 Ga0207691_10045057 3300025940 Bacteria 4057
622 Ga0207691_10209033 3300025940 Bacteria 1696
623 Ga0207711_10024421 3300025941 Bacteria 5064
624 Ga0207711_10053552 3300025941 Bacteria 3460
625 Ga0207711_10127240 3300025941 Bacteria 2280
626 Ga0207689_10049253 3300025942 Bacteria 3475
627 Ga0207689_10832223 3300025942 Bacteria 779
628 Ga0207689_11128806 3300025942 Bacteria 660
629 Ga0207661_10001346 3300025944 Bacteria 16497
630 Ga0207661_10477821 3300025944 Bacteria 1137
631 Ga0207661_10581480 3300025944 Bacteria 1027
632 Ga0207661_11545714 3300025944 Bacteria 608
633 Ga0207661_12182123 3300025944 Bacteria 500
634 Ga0207679_10000504 3300025945 Bacteria 26784
635 Ga0207679_10326065 3300025945 Bacteria 1331
636 Ga0207679_10983296 3300025945 Bacteria 773
637 Ga0207667_10017518 3300025949 Bacteria 8060
638 Ga0207667_10095367 3300025949 Bacteria 3071
639 Ga0207667_10146645 3300025949 Bacteria 2429
640 Ga0207667_10199974 3300025949 Bacteria 2050
641 Ga0207651_10013105 3300025960 Bacteria 4728
642 Ga0207651_10512810 3300025960 Bacteria 1038
643 Ga0207712_10032107 3300025961 Bacteria 3542
644 Ga0207712_10044100 3300025961 Bacteria 3080
645 Ga0207712_10121122 3300025961 Bacteria 1980
646 Ga0207712_11022459 3300025961 Bacteria 734
647 Ga0207668_10000762 3300025972 Bacteria 19670
648 Ga0207668_10122190 3300025972 Bacteria 1974
649 Ga0207668_10633179 3300025972 Bacteria 934
650 Ga0207640_10002084 3300025981 Bacteria 10768
651 Ga0207640_10653391 3300025981 Bacteria 896
652 Ga0207658_10039358 3300025986 Bacteria 3411
653 Ga0207658_10051921 3300025986 Bacteria 3023
654 Ga0207658_10089822 3300025986 Bacteria 2379
655 Ga0207658_10948196 3300025986 Bacteria 784
656 Ga0207677_10008747 3300026023 Bacteria 5670
657 Ga0207677_10184215 3300026023 Bacteria 1645
658 Ga0207677_10827341 3300026023 Bacteria 830
659 Ga0207703_10021501 3300026035 Bacteria 5051
660 Ga0207703_10115249 3300026035 Bacteria 2299
661 Ga0207703_10165509 3300026035 Bacteria 1940
662 Ga0207703_11098093 3300026035 Bacteria 764
663 Ga0207639_10004202 3300026041 Bacteria 9702
664 Ga0207639_10181271 3300026041 Bacteria 1792
665 Ga0207639_10544362 3300026041 Bacteria 1065
666 Ga0207639_10573459 3300026041 Bacteria 1038
667 Ga0207639_10787967 3300026041 Bacteria 885
668 Ga0207678_10017045 3300026067 Bacteria 6379
669 Ga0207678_10038786 3300026067 Bacteria 4137
670 Ga0207678_11628000 3300026067 Unclassified 568
671 Ga0207708_10031096 3300026075 Bacteria 4051
672 Ga0207708_10040693 3300026075 Bacteria 3543
673 Ga0207702_10212244 3300026078 Bacteria 1800
674 Ga0207702_10217561 3300026078 Bacteria 1779
675 Ga0207702_10432110 3300026078 Bacteria 1275
676 Ga0207702_10648464 3300026078 Bacteria 1038
677 Ga0207641_10003596 3300026088 Bacteria 13694
678 Ga0207641_10414729 3300026088 Bacteria 1295
679 Ga0207641_10533901 3300026088 Bacteria 1142
680 Ga0207648_10054561 3300026089 Bacteria 3490
681 Ga0207648_10087497 3300026089 Bacteria 2719
682 Ga0207648_10732642 3300026089 Bacteria 917
683 Ga0207676_10059220 3300026095 Bacteria 3023
684 Ga0207676_10259371 3300026095 Bacteria 1568
685 Ga0207676_10691415 3300026095 Bacteria 987
686 Ga0207676_10821517 3300026095 Bacteria 908
687 Ga0207676_11890773 3300026095 Bacteria 595
688 Ga0207674_10002908 3300026116 Bacteria 21261
689 Ga0207674_10569242 3300026116 Bacteria 1094
690 Ga0207674_10922287 3300026116 Bacteria 842
691 Ga0207674_12012035 3300026116 Bacteria 543
692 Ga0207675_100034535 3300026118 Bacteria 4715
693 Ga0207675_100131311 3300026118 Bacteria 2375
694 Ga0207675_100626138 3300026118 Bacteria 1081
695 Ga0207683_10001206 3300026121 Bacteria 23425
696 Ga0207683_10007086 3300026121 Bacteria 9610
697 Ga0207683_10018925 3300026121 Bacteria 5875
698 Ga0207683_12165302 3300026121 Bacteria 504
699 Ga0207698_10023084 3300026142 Bacteria 4340
700 Ga0207698_10173913 3300026142 Bacteria 1899
701 Ga0207698_11142829 3300026142 Bacteria 792
702 Ga0207698_11289798 3300026142 Bacteria 745
703 Ga0209973_1012915 3300027252 Bacteria 1022
704 Ga0209969_1004998 3300027360 Bacteria 1856
705 Ga0209967_1002814 3300027364 Bacteria 2269
706 Ga0209981_1030986 3300027378 Bacteria 784
707 Ga0209996_1010995 3300027395 Bacteria 1206
708 Ga0209984_1009301 3300027424 Bacteria 1247
709 Ga0209995_1067414 3300027471 Bacteria 611
710 Ga0209968_1005637 3300027526 Bacteria 1881
711 Ga0209999_1063730 3300027543 Bacteria 703
712 Ga0209982_1020055 3300027552 Bacteria 1026
713 Ga0209970_1001595 3300027614 Bacteria 3954
714 Ga0209983_1028051 3300027665 Bacteria 1193
715 Ga0209971_1010559 3300027682 Bacteria 2188
716 Ga0209966_1037455 3300027695 Bacteria 1001
717 Ga0209998_10003991 3300027717 Bacteria 3166
718 Ga0209998_10020408 3300027717 Bacteria 1418
719 Ga0209998_10180906 3300027717 Bacteria 548
720 Ga0209813_10060298 3300027866 Bacteria 1209
721 Ga0209974_10018508 3300027876 Bacteria 2311
722 Ga0209974_10121909 3300027876 Bacteria 924
723 Ga0209974_10320666 3300027876 Bacteria 596
724 Ga0209974_10472103 3300027876 Bacteria 500
725 Ga0207428_10000141 3300027907 Bacteria 97064
726 Ga0207428_10001593 3300027907 Bacteria 23627
727 Ga0207428_10003355 3300027907 Bacteria 15563
728 Ga0207428_10061609 3300027907 Bacteria 2969
729 Ga0207428_10069072 3300027907 Bacteria 2778
730 Ga0268266_10023949 3300028379 Bacteria 5196
731 Ga0268266_10175755 3300028379 Bacteria 1947
732 Ga0268266_10255707 3300028379 Bacteria 1621
733 Ga0268265_10001135 3300028380 Bacteria 23498
734 Ga0268265_10164860 3300028380 Bacteria 1887
735 Ga0268264_10000051 3300028381 Bacteria 321565
736 Ga0268264_10005920 3300028381 Bacteria 10351
737 Ga0268264_10227206 3300028381 Bacteria 1721
738 Ga0268264_10297826 3300028381 Bacteria 1517
739 Ga0268264_10383694 3300028381 Bacteria 1346
740 Ga0265337_1002114 3300028556 Bacteria 9374
741 Ga0265338_10124983 3300028800 Bacteria 2042
742 Ga0265338_10327807 3300028800 Bacteria 1107
743 Ga0265338_10513659 3300028800 Bacteria 842
744 Ga0265330_10029759 3300031235 Bacteria 2453
745 Ga0265330_10288311 3300031235 Bacteria 691
746 Ga0265332_10152147 3300031238 Bacteria 968
747 Ga0265332_10486998 3300031238 Unclassified 511
748 Ga0265328_10327145 3300031239 Bacteria 595
749 Ga0265325_10000119 3300031241 Bacteria 54195
750 Ga0265325_10018270 3300031241 Bacteria 3888
751 Ga0265325_10411912 3300031241 Bacteria 591
752 Ga0265340_10015371 3300031247 Bacteria 3977
753 Ga0265340_10106826 3300031247 Bacteria 1297
754 Ga0265340_10201257 3300031247 Bacteria 896
755 Ga0265339_10003215 3300031249 Bacteria 11467
756 Ga0265339_10027041 3300031249 Bacteria 3281
757 Ga0265339_10102480 3300031249 Bacteria 1487
758 Ga0265331_10454368 3300031250 Bacteria 576
759 Ga0265316_10038880 3300031344 Bacteria 3827
760 Ga0265316_10136750 3300031344 Bacteria 1843
761 Ga0265316_10149537 3300031344 Bacteria 1750
762 Ga0265316_10149594 3300031344 Bacteria 1749
763 Ga0265313_10032008 3300031595 Bacteria 2691
764 Ga0265313_10037161 3300031595 Bacteria 2437
765 Ga0265313_10042722 3300031595 Bacteria 2224
766 Ga0265313_10142865 3300031595 Unclassified 1028
767 Ga0265314_10014050 3300031711 Bacteria 6432
768 Ga0265314_10190638 3300031711 Bacteria 1220
769 Ga0265342_10000967 3300031712 Bacteria 28523
770 Ga0265342_10019923 3300031712 Bacteria 4315
771 Ga0307405_11224173 3300031731 Bacteria 650
772 Ga0307406_10469671 3300031901 Bacteria 1013
773 Ga0307406_11688402 3300031901 Bacteria 561
774 Ga0316583_10004499 3300032133 Bacteria 4973
775 Ga0373930_0000546 3300034816 Bacteria 5171
776 Ga0373930_0074486 3300034816 Bacteria 777
777 Ga0373948_0006814 3300034817 Bacteria 1902
778 Ga0373958_0000316 3300034819 Bacteria 5838
779 Ga0373958_0028289 3300034819 Bacteria 1084
780 Ga0373959_0006377 3300034820 Bacteria 1956
781 Ga0373938_0000677 3300034957 Bacteria 5475
782 Ga0373938_0015610 3300034957 Bacteria 1474
783 Ga0373938_0053049 3300034957 Bacteria 931
784 Ga0373926_0002819 3300035083 Bacteria 5555
785 Ga0373926_0027341 3300035083 Bacteria 1998
786 Ga0373926_0093576 3300035083 Unclassified 1119
787 Ga0373928_0001944 3300035084 Bacteria 4026
788 Ga0373928_0014038 3300035084 Bacteria 1614
789 Ga0373929_0007130 3300035085 Bacteria 2035
790 Ga0373934_0135065 3300035086 Bacteria 1007
791 Ga0373934_0231347 3300035086 Bacteria 763
792 Ga0373940_0000058 3300035088 Bacteria 12430
793 Ga0373940_0041177 3300035088 Bacteria 1270
794 Ga0373944_0002373 3300035089 Bacteria 4797
795 Ga0373944_0034117 3300035089 Bacteria 1545
796 Ga0373944_0051532 3300035089 Unclassified 1298
797 Ga0373949_0001169 3300035090 Bacteria 7785
798 Ga0373949_0017218 3300035090 Bacteria 1627
799 Ga0373949_0040573 3300035090 Bacteria 1143
800 Ga0373951_0000698 3300035091 Bacteria 9231
801 Ga0373951_0009696 3300035091 Bacteria 2165
802 Ga0373952_0000245 3300035092 Bacteria 8808
803 Ga0373952_0130653 3300035092 Bacteria 689
804 Ga0373952_0142329 3300035092 Bacteria 667
805 Ga0373952_0268291 3300035092 Bacteria 522
806 Ga0373923_0063383 3300035111 Bacteria 1574
807 Ga0373923_0272341 3300035111 Bacteria 796
808 Ga0373923_0662906 3300035111 Unclassified 516
809 Ga0373932_0000784 3300035112 Bacteria 9414
810 Ga0373932_0170147 3300035112 Bacteria 759
811 Ga0373932_0365478 3300035112 Bacteria 551
812 Ga0373936_0000491 3300035113 Bacteria 13386
813 Ga0373936_0076787 3300035113 Bacteria 1385
814 Ga0373936_0360123 3300035113 Bacteria 663
815 Ga0373939_0000350 3300035114 Bacteria 11731
816 Ga0373939_0007984 3300035114 Bacteria 2584
817 Ga0373939_0008981 3300035114 Bacteria 2465
818 Ga0373941_0005512 3300035115 Bacteria 2983
819 Ga0373941_0045377 3300035115 Bacteria 1376
820 Ga0373945_0010389 3300035116 Bacteria 3064
821 Ga0373945_0054339 3300035116 Bacteria 1480
822 Ga0373945_0308162 3300035116 Unclassified 679
823 Ga0373953_0006085 3300035117 Bacteria 3957
824 Ga0373953_0040573 3300035117 Bacteria 1849
825 Ga0373953_0150057 3300035117 Bacteria 999
826 Ga0373953_0274062 3300035117 Bacteria 735
827 Ga0373954_0022723 3300035118 Bacteria 2848
828 Ga0373954_0064678 3300035118 Bacteria 1730
829 Ga0373954_0273000 3300035118 Bacteria 833
830 Ga0373954_0578010 3300035118 Unclassified 557
831 Ga0373954_0596722 3300035118 Bacteria 547
832 Ga0373956_0002568 3300035119 Bacteria 7375
833 Ga0373956_0045063 3300035119 Bacteria 1967
834 Ga0373956_0443472 3300035119 Bacteria 620
835 Ga0373957_0036369 3300035120 Bacteria 1834
836 Ga0373957_0312763 3300035120 Bacteria 667
837 Ga0373957_0473598 3300035120 Bacteria 543
838 Ga0373960_0225966 3300035121 Bacteria 671
839 Ga0373960_0232409 3300035121 Bacteria 663
840 Ga0373960_0242952 3300035121 Bacteria 652
841 Ga0373943_0005755 3300035170 Bacteria 5563
842 Ga0373943_0153622 3300035170 Bacteria 1248
843 Ga0373946_0001418 3300035171 Bacteria 8314
844 Ga0373946_0018824 3300035171 Bacteria 2654
845 Ga0373946_0171061 3300035171 Bacteria 1025
846 Ga0373946_0356096 3300035171 Bacteria 732
847 Ga0373955_0006235 3300035172 Bacteria 5426
848 Ga0373955_0032016 3300035172 Bacteria 2757
849 Ga0373955_0068387 3300035172 Bacteria 1979
850 Ga0373955_0130239 3300035172 Bacteria 1468
851 Ga0373955_0196101 3300035172 Bacteria 1201
852 Ga0373955_0630103 3300035172 Bacteria 657
853 Ga0373942_0000056 3300035207 Bacteria 22957
854 Ga0373942_0055759 3300035207 Bacteria 1120
855 Ga0373961_0000471 3300035241 Bacteria 15885
856 Ga0373961_0022597 3300035241 Bacteria 1684
857 Ga0373961_0292490 3300035241 Bacteria 600
858 Ga0373962_0000608 3300035242 Bacteria 8073
859 Ga0373962_0003921 3300035242 Bacteria 3581
860 Ga0373924_0120621 3300035410 Bacteria 1137
861 Ga0373924_0133528 3300035410 Bacteria 1080
862 Ga0373924_0220078 3300035410 Bacteria 839
863 Ga0373924_0293080 3300035410 Bacteria 722
864 Ga0373931_0083993 3300035691 Bacteria 1762
865 Ga0373931_0086755 3300035691 Bacteria 1737
866 Ga0373931_0087850 3300035691 Bacteria 1727
867 Ga0373931_0137841 3300035691 Unclassified 1410
868 Ga0373931_1271461 3300035691 Bacteria 505
869 Ga0373935_0004417 3300035692 Bacteria 8259
870 Ga0373935_0007391 3300035692 Bacteria 6572
871 Ga0373935_0072609 3300035692 Bacteria 2222
872 Ga0373935_0719669 3300035692 Bacteria 734
873 Ga0373935_0797601 3300035692 Bacteria 697
874 Ga0373935_1507295 3300035692 Bacteria 503
875 Ga0373927_0015530 3300035695 Bacteria 5030
876 Ga0373927_0048634 3300035695 Bacteria 2743
877 Ga0373927_0319931 3300035695 Bacteria 1021
878 Ga0373933_0003495 3300035724 Bacteria 8748
879 Ga0373933_0008121 3300035724 Bacteria 5725
880 Ga0373933_0019789 3300035724 Bacteria 3809
881 Ga0373933_0060623 3300035724 Bacteria 2281
882 Ga0373933_0604107 3300035724 Bacteria 720
883 Ga0373933_0800663 3300035724 Bacteria 620
884 Ga0373947_0001131 3300035725 Bacteria 16382
885 Ga0373947_0032649 3300035725 Bacteria 3069
886 Ga0373947_0513603 3300035725 Bacteria 814
887 Ga0373947_1229268 3300035725 Bacteria 510
888 Ga0373937_0009064 3300036401 Bacteria 8636
889 Ga0373937_0010912 3300036401 Bacteria 7954
890 Ga0373937_0014216 3300036401 Bacteria 7024
891 Ga0373937_0017271 3300036401 Bacteria 6424
892 Ga0373937_0030955 3300036401 Bacteria 4845
893 Ga0373937_0107375 3300036401 Bacteria 2595
894 Ga0373937_0615691 3300036401 Bacteria 1030
895 Ga0373925_0005021 3300037068 Bacteria 9928
896 Ga0373925_0005303 3300037068 Bacteria 9625
897 Ga0373925_0027500 3300037068 Bacteria 4162
898 Ga0373925_0757389 3300037068 Bacteria 800
899 Ga0373925_1251052 3300037068 Bacteria 609
900 Ga0395899_0002845 3300037312 Bacteria 13930
901 Ga0395899_0080610 3300037312 Bacteria 2369
902 Ga0395900_0003630 3300037418 Bacteria 16592
903 Ga0395900_0010878 3300037418 Bacteria 9305
904 Ga0395900_0328325 3300037418 Bacteria 1508
905 Ga0395900_1040984 3300037418 Bacteria 737
906 Ga0395898_0006740 3300037466 Bacteria 12242
907 Ga0395898_0014680 3300037466 Bacteria 8043
908 Ga0395898_0150024 3300037466 Bacteria 2231
909 Ga0436364_0782926 3300037853 Bacteria 549
910 Ga0395901_0020857 3300038443 Bacteria 6710
911 Ga0395901_0170977 3300038443 Bacteria 2280
912 Ga0395901_0297638 3300038443 Bacteria 1673
913 Ga0395901_0916198 3300038443 Bacteria 857
914 Ga0242420_005947 3300038996 Bacteria 1913
915 Ga0436361_0568157 3300039447 Bacteria 2474
916 Ga0439453_0185193 3300041408 Bacteria 510
917 Ga0439453_0192927 3300041408 Bacteria 502
918 Ga0451793_0643023 3300041452 Bacteria 591
919 Ga0451802_0329831 3300041460 Bacteria 698
920 Ga0451804_0516794 3300041463 Bacteria 1221
921 Ga0451807_1208075 3300041486 Bacteria 865
922 Ga0451845_0125542 3300041501 Bacteria 736
923 Ga0439448_0102944 3300042005 Bacteria 972
924 Ga0439448_0333398 3300042005 Unclassified 540
925 Ga0439450_058082 3300042008 Bacteria 931
926 Ga0439456_047188 3300042013 Bacteria 939
927 Ga0439463_040358 3300042016 Bacteria 1186
928 Ga0439458_0084245 3300042157 Bacteria 814
929 Ga0439458_0235193 3300042157 Bacteria 507
930 Ga0439444_0045082 3300042437 Bacteria 879
931 Ga0439464_0051986 3300042439 Bacteria 1186
932 Ga0439460_0040902 3300042461 Bacteria 1360
933 Ga0451577_0416108 3300042876 Bacteria 1220
934 Ga0466963_0232808 3300044694 Bacteria 1291
935 Ga0453684_1352392 3300044712 Unclassified 741
936 Ga0451576_0151880 3300045051 Bacteria 2415
937 Ga0466967_0654065 3300045976 Bacteria 1039
938 Ga0495592_0019497 3300046454 Bacteria 5158
939 Ga0495592_0027776 3300046454 Bacteria 4286
940 Ga0495592_0054230 3300046454 Bacteria 2971
941 Ga0495592_0163822 3300046454 Bacteria 1528
942 Ga0495592_0189339 3300046454 Bacteria 1395
943 Ga0495592_0773830 3300046454 Bacteria 572
944 Ga0495603_0008518 3300046455 Bacteria 6196
945 Ga0495603_0116801 3300046455 Bacteria 1555
946 Ga0495603_0876116 3300046455 Unclassified 511
947 Ga0495590_0213966 3300046457 Bacteria 711
948 Ga0495591_034040 3300046458 Bacteria 1503
949 Ga0495629_0001316 3300046459 Bacteria 19535
950 Ga0495629_0023842 3300046459 Bacteria 4357
951 Ga0495629_0443347 3300046459 Bacteria 880
952 Ga0495641_0064157 3300046461 Bacteria 1655
953 Ga0495641_0101299 3300046461 Unclassified 1285
954 Ga0495641_0275884 3300046461 Bacteria 756
955 Ga0495651_0004833 3300046462 Bacteria 10309
956 Ga0495651_0015103 3300046462 Bacteria 5968
957 Ga0495651_0032128 3300046462 Bacteria 4095
958 Ga0495651_0252104 3300046462 Bacteria 1205
959 Ga0495651_0280736 3300046462 Bacteria 1125
960 Ga0495651_0311912 3300046462 Bacteria 1052
961 Ga0495653_0002640 3300046463 Bacteria 14272
962 Ga0495653_0005895 3300046463 Bacteria 10031
963 Ga0495653_0090080 3300046463 Bacteria 2246
964 Ga0495653_0242775 3300046463 Bacteria 1199
965 Ga0495580_0015463 3300046472 Bacteria 5753
966 Ga0495580_0600318 3300046472 Bacteria 727
967 Ga0495582_0005763 3300046473 Bacteria 6897
968 Ga0495582_0031750 3300046473 Bacteria 2904
969 Ga0495605_0221291 3300046474 Bacteria 818
970 Ga0495639_0004954 3300046475 Bacteria 5708
971 Ga0495662_0001866 3300046476 Bacteria 10560
972 Ga0495662_0037300 3300046476 Bacteria 2347
973 Ga0495662_0231757 3300046476 Bacteria 910
974 Ga0495664_0050283 3300046477 Bacteria 2475
975 Ga0495664_0150710 3300046477 Bacteria 1410
976 Ga0495664_0296401 3300046477 Bacteria 976
977 Ga0495584_0061606 3300046491 Bacteria 1886
978 Ga0495584_0501780 3300046491 Bacteria 618
979 Ga0495585_0001729 3300046492 Bacteria 16618
980 Ga0495594_0009236 3300046499 Bacteria 5090
981 Ga0495594_0024363 3300046499 Bacteria 3250
982 Ga0495594_0121684 3300046499 Bacteria 1475
983 Ga0495608_0007989 3300046511 Bacteria 7437
984 Ga0495608_0058681 3300046511 Bacteria 2537
985 Ga0495608_0074704 3300046511 Bacteria 2209
986 Ga0495608_0942665 3300046511 Bacteria 504
987 Ga0495616_0035425 3300046513 Bacteria 2583
988 Ga0495618_0047174 3300046514 Bacteria 2719
989 Ga0495618_0132385 3300046514 Bacteria 1595
990 Ga0495618_0361354 3300046514 Bacteria 893
991 Ga0495618_0686226 3300046514 Bacteria 603
992 Ga0495628_0011219 3300046516 Bacteria 7582
993 Ga0495628_0135599 3300046516 Bacteria 1881
994 Ga0495628_0193849 3300046516 Bacteria 1533
995 Ga0495628_0193851 3300046516 Bacteria 1533
996 Ga0495628_0953824 3300046516 Bacteria 592
997 Ga0495628_1190218 3300046516 Bacteria 517
998 Ga0495630_0015862 3300046517 Bacteria 5505
999 Ga0495630_0255351 3300046517 Bacteria 1339
1000 Ga0495630_0571960 3300046517 Bacteria 866
1001 Ga0495637_0214234 3300046520 Bacteria 703
1002 Ga0495644_0055943 3300046523 Bacteria 1482
1003 Ga0495663_0055416 3300046525 Bacteria 1236
1004 Ga0495666_0090430 3300046526 Bacteria 1444
1005 Ga0495652_0027253 3300046529 Bacteria 5036
1006 Ga0495652_0038405 3300046529 Bacteria 4148
1007 Ga0495652_0159752 3300046529 Bacteria 1751
1008 Ga0495652_0339058 3300046529 Bacteria 1080
1009 Ga0495665_0070818 3300046531 Bacteria 1837
1010 Ga0495665_0079937 3300046531 Bacteria 1720
1011 Ga0495640_0015679 3300046533 Bacteria 5692
1012 Ga0495640_0087913 3300046533 Bacteria 2054
1013 Ga0495640_0164206 3300046533 Bacteria 1421
1014 Ga0495640_0228663 3300046533 Bacteria 1171
1015 Ga0495640_0731086 3300046533 Bacteria 592
1016 Ga0495586_0011823 3300046535 Bacteria 4640
1017 Ga0495587_0011963 3300046536 Bacteria 5485
1018 Ga0495587_0026702 3300046536 Bacteria 3519
1019 Ga0495587_0079695 3300046536 Bacteria 1898
1020 Ga0495587_0098505 3300046536 Bacteria 1685
1021 Ga0495587_0187350 3300046536 Bacteria 1172
1022 Ga0495598_0135865 3300046537 Bacteria 847
1023 Ga0495645_0018999 3300046543 Bacteria 4945
1024 Ga0495645_0070977 3300046543 Bacteria 2512
1025 Ga0495645_0378945 3300046543 Bacteria 905
1026 Ga0495622_0035567 3300046557 Bacteria 2322
1027 Ga0495622_0070129 3300046557 Bacteria 1618
1028 Ga0495633_0005006 3300046558 Bacteria 8264
1029 Ga0495667_0013026 3300046559 Bacteria 5633
1030 Ga0495667_0017124 3300046559 Bacteria 4894
1031 Ga0495667_0017232 3300046559 Bacteria 4879
1032 Ga0495667_0051253 3300046559 Bacteria 2723
1033 Ga0495667_0318405 3300046559 Bacteria 984
1034 Ga0495667_0845881 3300046559 Bacteria 563
1035 Ga0495656_0003577 3300046615 Bacteria 5263
1036 Ga0495634_0279340 3300046642 Bacteria 1014
1037 Ga0495634_0292081 3300046642 Bacteria 987
1038 Ga0495634_0527038 3300046642 Bacteria 690
1039 Ga0495611_0213732 3300046648 Bacteria 898
1040 Ga0495635_0006791 3300046663 Bacteria 7999
1041 Ga0495635_0064410 3300046663 Bacteria 2516
1042 Ga0495659_0001405 3300046664 Bacteria 8198
1043 Ga0495661_0019380 3300046665 Bacteria 4458
1044 Ga0495588_0058537 3300046674 Bacteria 1992
1045 Ga0495588_0097486 3300046674 Unclassified 1543
1046 Ga0495588_0661499 3300046674 Bacteria 546
1047 Ga0495657_0024510 3300046675 Bacteria 4296
1048 Ga0495657_0045368 3300046675 Bacteria 2983
1049 Ga0495657_0054497 3300046675 Bacteria 2671
1050 Ga0495657_0242325 3300046675 Bacteria 1088
1051 Ga0495599_0011174 3300046678 Bacteria 5512
1052 Ga0495599_0067846 3300046678 Bacteria 2227
1053 Ga0495599_0077683 3300046678 Bacteria 2072
1054 Ga0495623_0006971 3300046679 Bacteria 7344
1055 Ga0495623_0029805 3300046679 Bacteria 3511
1056 Ga0495623_0487814 3300046679 Bacteria 652
1057 Ga0495646_0007298 3300046680 Bacteria 7022
1058 Ga0495646_0017374 3300046680 Bacteria 4563
1059 Ga0495646_0101317 3300046680 Bacteria 1651
1060 Ga0495646_0130269 3300046680 Bacteria 1416
1061 Ga0495647_0006124 3300046681 Bacteria 3966
1062 Ga0495647_0170830 3300046681 Bacteria 941
1063 Ga0495647_0445906 3300046681 Bacteria 598
1064 Ga0495658_0004362 3300046683 Bacteria 6965
1065 Ga0495658_0006637 3300046683 Bacteria 5687
1066 Ga0495658_0471380 3300046683 Bacteria 802
1067 Ga0495658_1044498 3300046683 Bacteria 521
1068 Ga0495669_0258820 3300046684 Bacteria 836
1069 Ga0495613_0001421 3300046689 Bacteria 18261
1070 Ga0495624_0078164 3300046690 Bacteria 2052
1071 Ga0495670_0000579 3300046691 Bacteria 17498
1072 Ga0495589_0126138 3300046794 Bacteria 1231
1073 Ga0495600_0005626 3300046809 Bacteria 7568
1074 Ga0495600_0013325 3300046809 Bacteria 5163
1075 Ga0495600_0075167 3300046809 Bacteria 2206
1076 Ga0495600_0134908 3300046809 Bacteria 1604
1077 Ga0495600_0177451 3300046809 Bacteria 1373
1078 Ga0495581_0030170 3300047315 Bacteria 3143
1079 Ga0495581_0036393 3300047315 Bacteria 2848
1080 Ga0495581_0057219 3300047315 Bacteria 2250
1081 Ga0495604_0013922 3300047317 Bacteria 6416
1082 Ga0495604_0041061 3300047317 Bacteria 3630
1083 Ga0495604_0140785 3300047317 Bacteria 1723
1084 Ga0495674_0036977 3300047319 Bacteria 4388
1085 Ga0495674_0048019 3300047319 Bacteria 3780
1086 Ga0495674_0056005 3300047319 Bacteria 3456
1087 Ga0495674_1357126 3300047319 Bacteria 531
1088 Ga0495676_0146085 3300047321 Bacteria 1689
1089 Ga0495676_0175042 3300047321 Bacteria 1507
1090 Ga0495676_0191878 3300047321 Bacteria 1424
1091 Ga0495680_0040361 3300047322 Bacteria 3720
1092 Ga0495680_0042659 3300047322 Bacteria 3598
1093 Ga0495680_0048604 3300047322 Bacteria 3330
1094 Ga0495680_0094466 3300047322 Bacteria 2237
1095 Ga0495680_0239396 3300047322 Bacteria 1289
1096 Ga0495680_0925659 3300047322 Unclassified 561
1097 Ga0495675_0003995 3300047444 Bacteria 8937
1098 Ga0495675_0007873 3300047444 Bacteria 6585
1099 Ga0495675_0198415 3300047444 Bacteria 1222
1100 Ga0495675_0478999 3300047444 Bacteria 717
1101 Ga0495675_0820944 3300047444 Bacteria 513
1102 Ga0495679_038861 3300047446 Bacteria 1488
1103 Ga0495684_0000281 3300047471 Bacteria 41079
1104 Ga0495684_0058854 3300047471 Bacteria 2926
1105 Ga0495684_0136135 3300047471 Bacteria 1843
1106 Ga0495593_0001313 3300047673 Bacteria 14566
1107 Ga0495593_0045482 3300047673 Bacteria 2342
1108 Ga0495593_0132677 3300047673 Unclassified 1264
1109 Ga0495593_0170894 3300047673 Bacteria 1096
1110 Ga0495602_0010155 3300048088 Bacteria 9775
1111 Ga0495602_0167764 3300048088 Bacteria 1707
1112 Ga0495602_0222154 3300048088 Bacteria 1425
1113 Ga0495602_0280567 3300048088 Bacteria 1227
1114 Ga0495602_0317411 3300048088 Bacteria 1135
1115 Ga0495614_0009362 3300048089 Bacteria 4332
1116 Ga0495614_0281677 3300048089 Unclassified 765
1117 Ga0495614_0499980 3300048089 Bacteria 578
1118 Ga0496100_0010589 3300048903 Bacteria 5223
1119 Ga0496100_0033704 3300048903 Bacteria 3206
1120 Ga0496101_0031405 3300048904 Bacteria 3733
1121 Ga0496101_0126413 3300048904 Bacteria 1937
1122 Ga0496101_0130906 3300048904 Bacteria 1905
1123 Ga0496101_0942249 3300048904 Bacteria 679
1124 Ga0496102_0146497 3300048905 Bacteria 2216
1125 Ga0496102_0309115 3300048905 Bacteria 1490
1126 Ga0496102_0850487 3300048905 Bacteria 834
1127 Ga0496103_0054280 3300048906 Bacteria 2483
1128 Ga0496103_0181320 3300048906 Bacteria 1353
1129 Ga0496104_0000140 3300048907 Bacteria 67259
1130 Ga0496104_0012874 3300048907 Bacteria 7533
1131 Ga0496104_0085385 3300048907 Bacteria 3013
1132 Ga0496104_0251348 3300048907 Bacteria 1680
1133 Ga0496104_0287181 3300048907 Bacteria 1557
1134 Ga0496104_0822785 3300048907 Bacteria 834
1135 Ga0496105_0000576 3300048908 Bacteria 24313
1136 Ga0496105_0070598 3300048908 Bacteria 2887
1137 Ga0496105_0108795 3300048908 Bacteria 2288
1138 Ga0496105_0284122 3300048908 Bacteria 1333
1139 Ga0496105_0442483 3300048908 Bacteria 1027
1140 Ga0496105_1361051 3300048908 Bacteria 516
1141 Ga0496106_0024928 3300048909 Bacteria 4448
1142 Ga0496106_0029544 3300048909 Bacteria 4085
1143 Ga0496106_0046226 3300048909 Bacteria 3271
1144 Ga0496106_1336315 3300048909 Bacteria 555
1145 Ga0496107_0010578 3300048910 Bacteria 6415
1146 Ga0496107_0061801 3300048910 Bacteria 2712
1147 Ga0496107_0164228 3300048910 Bacteria 1646
1148 Ga0496107_0337463 3300048910 Bacteria 1121
1149 Ga0496108_0000639 3300048911 Bacteria 27304
1150 Ga0496108_0016770 3300048911 Bacteria 5983
1151 Ga0496108_0035329 3300048911 Bacteria 4154
1152 Ga0496108_0068074 3300048911 Bacteria 3003
1153 Ga0496108_0246307 3300048911 Bacteria 1555
1154 Ga0496108_0461891 3300048911 Bacteria 1109
1155 Ga0496109_0000619 3300048912 Bacteria 29616
1156 Ga0496109_0031729 3300048912 Bacteria 4744
1157 Ga0496109_0134593 3300048912 Bacteria 2308
1158 Ga0496109_0221900 3300048912 Bacteria 1777
1159 Ga0496109_0280340 3300048912 Bacteria 1571
1160 Ga0496110_0046770 3300048913 Bacteria 3786
1161 Ga0496110_0199125 3300048913 Bacteria 1819
1162 Ga0496110_0230461 3300048913 Bacteria 1684
1163 Ga0496111_0010913 3300048914 Bacteria 6111
1164 Ga0496111_0214910 3300048914 Bacteria 1428
1165 Ga0496111_0319668 3300048914 Unclassified 1150
1166 Ga0496112_0002285 3300048915 Bacteria 15329
1167 Ga0496112_0006392 3300048915 Bacteria 10343
1168 Ga0496112_0908958 3300048915 Unclassified 802
1169 Ga0496113_0006622 3300048916 Bacteria 7368
1170 Ga0496113_0188187 3300048916 Bacteria 1638
1171 Ga0496113_0921350 3300048916 Bacteria 690
1172 Ga0496113_0979835 3300048916 Bacteria 666
1173 Ga0496114_0011636 3300048917 Bacteria 7036
1174 Ga0496114_0016617 3300048917 Bacteria 5933
1175 Ga0496114_0095862 3300048917 Bacteria 2525
1176 Ga0496114_0396394 3300048917 Bacteria 1222
1177 Ga0496115_0015149 3300048918 Bacteria 5843
1178 Ga0496115_0020630 3300048918 Bacteria 5084
1179 Ga0496115_0250423 3300048918 Bacteria 1458
1180 Ga0496115_0563329 3300048918 Bacteria 909
1181 Ga0495682_0372670 3300049460 Bacteria 503
1182 Ga0501031_0019351 3300049568 Bacteria 4435
1183 Ga0501032_0995383 3300049569 Bacteria 527
1184 Ga0501033_0001099 3300049570 Bacteria 24511
1185 Ga0501034_0083711 3300049571 Bacteria 3192
1186 Ga0501034_0137379 3300049571 Bacteria 2425
1187 Ga0501034_0153944 3300049571 Bacteria 2274
1188 Ga0501036_0060843 3300049572 Bacteria 3198
1189 Ga0501036_0612301 3300049572 Bacteria 903
1190 Ga0501036_0801392 3300049572 Bacteria 776
1191 Ga0501037_0002613 3300049573 Bacteria 13003
1192 Ga0501038_0044217 3300049574 Bacteria 3871
1193 Ga0501038_1072737 3300049574 Bacteria 589
1194 Ga0501039_0149882 3300049575 Bacteria 1832
1195 Ga0501039_0155277 3300049575 Bacteria 1798
1196 Ga0501039_0832229 3300049575 Bacteria 720
1197 Ga0501040_0052628 3300049576 Bacteria 2788
1198 Ga0501040_1042857 3300049576 Bacteria 593
1199 Ga0501041_0246800 3300049577 Bacteria 1122
1200 Ga0501042_0067708 3300049578 Bacteria 2553
1201 Ga0501042_0124564 3300049578 Bacteria 1855
1202 Ga0501043_0117522 3300049579 Bacteria 2086
1203 Ga0501046_0036477 3300049580 Bacteria 3955
1204 Ga0501046_0051536 3300049580 Bacteria 3247
1205 Ga0501046_0562196 3300049580 Bacteria 812
1206 Ga0501047_0008549 3300049581 Bacteria 9658
1207 Ga0501047_0046207 3300049581 Bacteria 4208
1208 Ga0501047_1042770 3300049581 Bacteria 631
1209 Ga0501047_1311621 3300049581 Bacteria 538
1210 Ga0501048_0354681 3300049582 Bacteria 1046
1211 Ga0501067_0002227 3300049583 Bacteria 10726
1212 Ga0501067_0068672 3300049583 Bacteria 1962
1213 Ga0501068_0035230 3300049584 Bacteria 2987
1214 Ga0501068_0124689 3300049584 Bacteria 1608
1215 Ga0501069_0050135 3300049585 Bacteria 2321
1216 Ga0501069_0223836 3300049585 Bacteria 1094
1217 Ga0501069_0398242 3300049585 Bacteria 814
1218 Ga0501070_0027855 3300049586 Bacteria 4739
1219 Ga0501070_0160980 3300049586 Bacteria 1850
1220 Ga0501070_0397775 3300049586 Bacteria 1114
1221 Ga0501070_0609232 3300049586 Bacteria 870
1222 Ga0501070_1263559 3300049586 Bacteria 565
1223 Ga0501070_1464559 3300049586 Unclassified 517
1224 Ga0501071_0081885 3300049587 Bacteria 2363
1225 Ga0501071_0197190 3300049587 Bacteria 1511
1226 Ga0501072_0019663 3300049588 Bacteria 5224
1227 Ga0501072_0020222 3300049588 Bacteria 5155
1228 Ga0501072_1516789 3300049588 Bacteria 517
1229 Ga0501073_0098368 3300049589 Bacteria 2032
1230 Ga0501073_0203077 3300049589 Bacteria 1370
1231 Ga0501073_0228447 3300049589 Bacteria 1286
1232 Ga0501073_0304403 3300049589 Bacteria 1100
1233 Ga0501073_0488134 3300049589 Bacteria 852
1234 Ga0501073_0510677 3300049589 Bacteria 831
1235 Ga0501074_0096432 3300049590 Bacteria 2117
1236 Ga0501074_0236637 3300049590 Bacteria 1299
1237 Ga0501075_0448004 3300049591 Bacteria 984
1238 Ga0501075_0635741 3300049591 Bacteria 814
1239 Ga0501076_0012137 3300049592 Bacteria 6441
1240 Ga0501076_0065020 3300049592 Bacteria 2908
1241 Ga0501076_0653337 3300049592 Bacteria 868
1242 Ga0501076_0704391 3300049592 Bacteria 833
1243 Ga0501076_0770996 3300049592 Bacteria 794
1244 Ga0501077_0024392 3300049593 Bacteria 3841
1245 Ga0501077_0097791 3300049593 Bacteria 1860
1246 Ga0501077_0109851 3300049593 Bacteria 1747
1247 Ga0501079_0127033 3300049741 Bacteria 1983
1248 Ga0501079_0988107 3300049741 Bacteria 663
1249 Ga0501080_0073023 3300049742 Bacteria 3191
1250 Ga0501080_0160437 3300049742 Bacteria 2077
1251 Ga0501080_0711444 3300049742 Bacteria 885
1252 Ga0501081_0013430 3300049743 Bacteria 5386
1253 Ga0501083_0023594 3300049744 Bacteria 4265
1254 Ga0501083_0153262 3300049744 Bacteria 1509
1255 Ga0501083_0208457 3300049744 Bacteria 1274
1256 Ga0501083_0211946 3300049744 Bacteria 1263
1257 Ga0501083_0240119 3300049744 Bacteria 1179
1258 Ga0501083_0342841 3300049744 Bacteria 971
1259 Ga0501083_0415413 3300049744 Bacteria 875
1260 Ga0501035_0003995 3300049822 Bacteria 14069
1261 Ga0501035_0023875 3300049822 Bacteria 5611
1262 Ga0501035_0440570 3300049822 Bacteria 1079
1263 Ga0501044_0036955 3300049823 Bacteria 5106
1264 Ga0501044_0102282 3300049823 Bacteria 2881
1265 Ga0501044_0115111 3300049823 Bacteria 2694
1266 Ga0501044_0369420 3300049823 Bacteria 1351
1267 Ga0501044_1031010 3300049823 Bacteria 694
1268 Ga0501045_0090524 3300049824 Bacteria 2261
1269 nmdc:mga03683_147799_c1 3300050489 Bacteria 1059
1270 nmdc:mga03n38_362536_c1 3300050490 Bacteria 791
1271 nmdc:mga00v17_294139_c1 3300050491 Bacteria 1054
1272 nmdc:mga06z11_661061_c1 3300050494 Bacteria 636
1273 nmdc:mga05p37_44027_c1 3300050507 Bacteria 5492
1274 nmdc:mga05p37_51_c1 3300050507 Bacteria 103396
1275 nmdc:mga05p37_819_c2 3300050507 Bacteria 27529
1276 nmdc:mga09592_1078_c1 3300050508 Bacteria 19140
1277 nmdc:mga09592_1891_c1 3300050508 Bacteria 16858
1278 nmdc:mga0qj67_1161078_c1 3300050509 Bacteria 602
1279 nmdc:mga0qj67_23665_c1 3300050509 Bacteria 4726
1280 nmdc:mga0qj67_6890_c1 3300050509 Bacteria 8361
1281 nmdc:mga06r32_153407_c1 3300050510 Bacteria 2283
1282 nmdc:mga06r32_16_c1 3300050510 Bacteria 101899
1283 nmdc:mga06r32_578710_c1 3300050510 Bacteria 1095
1284 nmdc:mga06r32_677396_c1 3300050510 Bacteria 998
1285 nmdc:mga08y16_2600_c1 3300050511 Bacteria 18544
1286 nmdc:mga08y16_697_c1 3300050511 Bacteria 31905
1287 nmdc:mga08y16_794739_c1 3300050511 Bacteria 939
1288 nmdc:mga08y16_79_c2 3300050511 Bacteria 54400
1289 nmdc:mga0n895_1465712_c1 3300050512 Bacteria 650
1290 nmdc:mga0n895_250277_c1 3300050512 Bacteria 1798
1291 nmdc:mga0n895_258404_c1 3300050512 Bacteria 1768
1292 nmdc:mga0n895_609_c1 3300050512 Bacteria 24818
1293 nmdc:mga0rr50_1280098_c1 3300050513 Bacteria 622
1294 nmdc:mga0rr50_417377_c1 3300050513 Bacteria 1135
1295 nmdc:mga0rr50_4488_c1 3300050513 Bacteria 8220
1296 nmdc:mga0rr50_48326_c1 3300050513 Bacteria 3144
1297 nmdc:mga0rr50_56833_c1 3300050513 Bacteria 2925
1298 nmdc:mga08x19_442365_c1 3300050514 Bacteria 914
1299 nmdc:mga08x19_67630_c1 3300050514 Bacteria 2324
1300 nmdc:mga08x19_699687_c1 3300050514 Bacteria 719
1301 nmdc:mga0a205_967_c1 3300050515 Bacteria 23723
1302 Ga0495601_0008343 3300053077 Bacteria 6119
1303 Ga0495601_0011417 3300053077 Bacteria 5311
1304 Ga0495601_0014707 3300053077 Bacteria 4720
1305 Ga0495601_0017667 3300053077 Bacteria 4332
1306 Ga0495601_0024406 3300053077 Bacteria 3723
1307 Ga0495601_0039920 3300053077 Bacteria 2939
1308 Ga0495601_0109933 3300053077 Bacteria 1785
1309 Ga0495612_0001680 3300053078 Bacteria 9110
1310 Ga0495612_0003005 3300053078 Bacteria 7000
1311 Ga0495612_0122302 3300053078 Bacteria 1120
1312 Ga0495612_0168648 3300053078 Bacteria 958
1313 Ga0495612_0271646 3300053078 Bacteria 756
1314 Ga0495612_0532802 3300053078 Bacteria 540
1315 Ga0495595_0004028 3300053084 Bacteria 5879
1316 Ga0495595_0004570 3300053084 Bacteria 5567
1317 Ga0495595_0007466 3300053084 Bacteria 4477
1318 Ga0495595_0012972 3300053084 Bacteria 3515
1319 Ga0495595_0063818 3300053084 Bacteria 1730
1320 Ga0495595_0065786 3300053084 Bacteria 1705
1321 Ga0495595_0582004 3300053084 Bacteria 572
1322 Ga0495619_0001224 3300053085 Bacteria 16809
1323 Ga0495619_0003768 3300053085 Bacteria 9751
1324 Ga0495619_0003841 3300053085 Bacteria 9670
1325 Ga0495619_0004658 3300053085 Bacteria 8739
1326 Ga0495619_0008730 3300053085 Bacteria 6408
1327 Ga0495619_0022348 3300053085 Bacteria 4046
1328 Ga0495619_0056937 3300053085 Bacteria 2593
1329 Ga0500566_0153479 3300053094 Unclassified 1208
1330 Ga0500559_0017732 3300053136 Bacteria 3009
1331 Ga0500568_0051813 3300053139 Bacteria 1613
1332 Ga0500603_059207 3300053150 Bacteria 1067
1333 Ga0500636_0221998 3300053177 Bacteria 984
1334 Ga0500636_0506793 3300053177 Bacteria 532
1335 Ga0501084_0027428 3300054114 Bacteria 4759
1336 Ga0501084_0081748 3300054114 Bacteria 2710
1337 Ga0501084_0081902 3300054114 Bacteria 2707
1338 Ga0501084_0086177 3300054114 Bacteria 2637
1339 Ga0501084_0104404 3300054114 Bacteria 2380
1340 Ga0501084_0317179 3300054114 Bacteria 1317
1341 Ga0501084_1119160 3300054114 Bacteria 661
1342 Ga0501084_1349359 3300054114 Bacteria 597
1343 Ga0501084_1868594 3300054114 Bacteria 501
1344 Ga0501082_0072147 3300060353 Bacteria 2974
1345 Ga0501082_0132410 3300060353 Bacteria 2163
1346 Ga0501082_0134001 3300060353 Bacteria 2149
1347 Ga0501082_0466796 3300060353 Bacteria 1103
1348 Ga0501082_1085089 3300060353 Bacteria 700
1349 Ga0501082_1782244 3300060353 Bacteria 537
1350 Ga0466962_0168550 3300061719 Unclassified 1066
1351 Ga0530510_0082610 3300061734 Bacteria 2339
1352 Ga0068868_100164763
1353 2214736895
1354 ARcpr5oldR_c000311
1355 ARcpr5oldR_c000840
1356 ARSoilYngRDRAFT_c00517
1357 ARcpr5yngRDRAFT_c000610
1358 ARSoilOldRDRAFT_c000709
1359 ARCol0oldRDRAFT_c00116
1360 ARCol0yngRDRAFT_1000064
1361 JGI24032J14994_100183
1362 JGI24736J21556_1014667
1363 JGI24741J21665_1037267
1364 JGI24752J21851_1026145
1365 JGI24746J21847_1001338
1366 JGI24747J21853_1007734
1367 JGI24739J22299_10006224
1368 JGI24737J22298_10004778
1369 JGI24737J22298_10009245
1370 JGI24743J22301_10032837
1371 JGI24750J21931_1000306
1372 JGI24745J21846_1001741
1373 JGI24745J21846_1016728
1374 JGI24738J21930_10000348
1375 JGI24749J21850_1006472
1376 JGI24749J21850_1011879
1377 JGI24744J21845_10008338
1378 JGI24035J26624_1002077
1379 JGI24033J26618_1011225
1380 JGI24034J26672_10001042
1381 JGI24034J26672_10034750
1382 JGI24742J22300_10007045
1383 JGI24742J22300_10084154
1384 Ga0055524_1007164
1385 JGI25405J52794_10007697
1386 JGI25405J52794_10009033
1387 Ga0065717_1004561
1388 Ga0065716_1000386
1389 Ga0065714_10358745
1390 Ga0065704_10102914
1391 Ga0065712_10001837
1392 Ga0065712_10210982
1393 Ga0065712_10826253
1394 Ga0065715_10002792
1395 Ga0065715_10011595
1396 Ga0065707_10116186
1397 Ga0065707_10187256
1398 Ga0070658_10022098
1399 Ga0070676_10000374
1400 Ga0070676_10135789
1401 Ga0070676_10405950
1402 Ga0070683_100003823
1403 Ga0070683_100314271
1404 Ga0070683_100695158
1405 Ga0070683_100700523
1406 Ga0070683_101331083
1407 Ga0070690_100133199
1408 Ga0070690_100228846
1409 Ga0070670_100055679
1410 Ga0070677_10000461
1411 Ga0068869_100001399
1412 Ga0070666_10014716
1413 Ga0070666_10041967
1414 Ga0070666_11047110
1415 Ga0070680_100012044
1416 Ga0070680_100202372
1417 Ga0070680_100296175
1418 Ga0070680_100593257
1419 Ga0070680_100897397
1420 Ga0070682_100001646
1421 Ga0070682_100073361
1422 Ga0070682_100909994
1423 Ga0070682_101633390
1424 Ga0068868_100000857
1425 Ga0070660_100002034
1426 Ga0070660_100025298
1427 Ga0070660_100445567
1428 Ga0070660_101235811
1429 Ga0070660_101322388
1430 Ga0070689_100040860
1431 Ga0070689_100077743
1432 Ga0070691_10039715
1433 Ga0070691_10056343
1434 Ga0070687_100146638
1435 Ga0070687_100421442
1436 Ga0070661_100002763
1437 Ga0070661_100063093
1438 Ga0070661_100329926
1439 Ga0070661_100919728
1440 Ga0070661_101112003
1441 Ga0070692_10013586
1442 Ga0070692_10175784
1443 Ga0070692_10340229
1444 Ga0070668_100240164
1445 Ga0070668_100287276
1446 Ga0070668_100399690
1447 Ga0070669_100022340
1448 Ga0070675_100055352
1449 Ga0070675_100132287
1450 Ga0070675_100627970
1451 Ga0070671_100000944
1452 Ga0070671_100024654
1453 Ga0070671_100142954
1454 Ga0070674_100042093
1455 Ga0070674_100053296
1456 Ga0070674_100061289
1457 Ga0070674_100621797
1458 Ga0070673_100000633
1459 Ga0070673_100021643
1460 Ga0070673_100317111
1461 Ga0070688_100006703
1462 Ga0070688_100020601
1463 Ga0070659_100185474
1464 Ga0070659_100246600
1465 Ga0070659_100772188
1466 Ga0070659_101959422
1467 Ga0070667_100001396
1468 Ga0070667_100045449
1469 Ga0070667_100078400
1470 Ga0070667_101321862
1471 Ga0070703_10206707
1472 Ga0070709_10005668
1473 Ga0070709_10006339
1474 Ga0070709_10277063
1475 Ga0070709_10788793
1476 Ga0070709_11722090
1477 Ga0070714_100024472
1478 Ga0070714_100091275
1479 Ga0070714_100125523
1480 Ga0070714_100192333
1481 Ga0070714_101226898
1482 Ga0070714_101321270
1483 Ga0070713_100011762
1484 Ga0070713_100018486
1485 Ga0070713_100027651
1486 Ga0070713_100216831
1487 Ga0070713_100482492
1488 Ga0070713_100831263
1489 Ga0070710_10003944
1490 Ga0070710_10025481
1491 Ga0070710_10030724
1492 Ga0070710_11009764
1493 Ga0070710_11355693
1494 Ga0070710_11456976
1495 Ga0070701_10002950
1496 Ga0070711_100128434
1497 Ga0070711_100140581
1498 Ga0070711_100188181
1499 Ga0070711_100290711
1500 Ga0070705_100001427
1501 Ga0070705_100041318
1502 Ga0070705_100223386
1503 Ga0070705_100965285
1504 Ga0070700_100001316
1505 Ga0070700_100321790
1506 Ga0070694_100121265
1507 Ga0070694_101867724
1508 Ga0070708_100212038
1509 Ga0070708_101930509
1510 Ga0070663_100041246
1511 Ga0070663_100274035
1512 Ga0070663_100384697
1513 Ga0070663_100546701
1514 Ga0070663_101641066
1515 Ga0070678_100001338
1516 Ga0070678_100253145
1517 Ga0070662_100020664
1518 Ga0070662_100197745
1519 Ga0070662_100283385
1520 Ga0070681_10013616
1521 Ga0070681_10020378
1522 Ga0070681_10076377
1523 Ga0070681_10263620
1524 Ga0070681_10416319
1525 Ga0070681_10666300
1526 Ga0070681_10754447
1527 Ga0070681_10789896
1528 Ga0070681_10804884
1529 Ga0068867_100003745
1530 Ga0070685_10010368
1531 Ga0070685_10019913
1532 Ga0070707_100256385
1533 Ga0070707_100259696
1534 Ga0070698_101374633
1535 Ga0074259_10443300
1536 Ga0070699_100376173
1537 Ga0070679_100014385
1538 Ga0070679_100024499
1539 Ga0070679_100118277
1540 Ga0070679_100134690
1541 Ga0070679_100202648
1542 Ga0070684_100138386
1543 Ga0070684_100151175
1544 Ga0070684_100596753
1545 Ga0070684_101726885
1546 Ga0070684_101819163
1547 Ga0070684_102073700
1548 Ga0070697_100925803
1549 Ga0070697_101152522
1550 Ga0070697_101434970
1551 Ga0068853_100002812
1552 Ga0068853_100220561
1553 Ga0068853_100784076
1554 Ga0068853_100851263
1555 Ga0068853_101414888
1556 Ga0068853_101634942
1557 Ga0068853_101961692
1558 Ga0070672_100003770
1559 Ga0070686_100011271
1560 Ga0070686_100033789
1561 Ga0070695_100024486
1562 Ga0070695_101013966
1563 Ga0070696_100021036
1564 Ga0070696_100021091
1565 Ga0070693_100062750
1566 Ga0070693_100068331
1567 Ga0070693_100168804
1568 Ga0070693_100468195
1569 Ga0070693_101237549
1570 Ga0070665_100017655
1571 Ga0070665_100354537
1572 Ga0070665_100788104
1573 Ga0070704_100002635
1574 Ga0070704_100040518
1575 Ga0070704_100276867
1576 Ga0068855_100081515
1577 Ga0068855_100095442
1578 Ga0068855_100329615
1579 Ga0068855_100473873
1580 Ga0068855_101339383
1581 Ga0070664_100003713
1582 Ga0070664_100232890
1583 Ga0070664_100400858
1584 Ga0070664_100754209
1585 Ga0070664_101087941
1586 Ga0070664_102150789
1587 Ga0068857_100018167
1588 Ga0068854_100064999
1589 Ga0068854_101419759
1590 Ga0068856_100069292
1591 Ga0068856_100095206
1592 Ga0068856_100165792
1593 Ga0068856_100843706
1594 Ga0068856_101668170
1595 Ga0068856_102162476
1596 Ga0070702_100068724
1597 Ga0070702_100173249
1598 Ga0070702_100781219
1599 Ga0068852_100009996
1600 Ga0068852_100153045
1601 Ga0068852_100626123
1602 Ga0068852_102674836
1603 Ga0068859_100050266
1604 Ga0068859_101023240
1605 Ga0068859_101419395
1606 Ga0068859_102407032
1607 Ga0068864_100004113
1608 Ga0068866_10001778
1609 Ga0068866_10050206
1610 Ga0068861_100090462
1611 Ga0068870_10000630
1612 Ga0068863_100001487
1613 Ga0068863_100133784
1614 Ga0068863_100444244
1615 Ga0068858_100079144
1616 Ga0068858_100137231
1617 Ga0068858_100252503
1618 Ga0068858_100877164
1619 Ga0068860_100000338
1620 Ga0068860_100001886
1621 Ga0068860_100076172
1622 Ga0068860_100322267
1623 Ga0068862_100187335
1624 Ga0068862_100562208
1625 Ga0081455_10000313
1626 Ga0081455_10001856
1627 Ga0081455_10029804
1628 Ga0081455_10067125
1629 Ga0081455_10250521
1630 Ga0081455_10277828
1631 Ga0081540_1070887
1632 Ga0070717_10000430
1633 Ga0070717_10017570
1634 Ga0070717_10737502
1635 Ga0070717_10883178
1636 Ga0075363_100146151
1637 Ga0075364_10343519
1638 Ga0075432_10001349
1639 Ga0075432_10050289
1640 Ga0075432_10535433
1641 Ga0070715_10079654
1642 Ga0070715_10126263
1643 Ga0070715_10147717
1644 Ga0070716_100000617
1645 Ga0070716_100031514
1646 Ga0070716_100217740
1647 Ga0070712_100095843
1648 Ga0070712_100139244
1649 Ga0070712_100297247
1650 Ga0075367_10127942
1651 Ga0075427_10003324
1652 Ga0097621_100008449
1653 Ga0097621_100009717
1654 Ga0097621_100078355
1655 Ga0075370_10765251
1656 Ga0068871_100001209
1657 Ga0068871_100011630
1658 Ga0068871_100026251
1659 Ga0075428_100004387
1660 Ga0075428_100205605
1661 Ga0075428_100329777
1662 Ga0075428_100768253
1663 Ga0075430_100047563
1664 Ga0075430_100062773
1665 Ga0075430_100234177
1666 Ga0075431_100000305
1667 Ga0075431_100511793
1668 Ga0075433_10000618
1669 Ga0075433_10162525
1670 Ga0075433_10260292
1671 Ga0075434_100004516
1672 Ga0075434_100004895
1673 Ga0075434_100202084
1674 Ga0075434_100325968
1675 Ga0075434_100449212
1676 Ga0075434_102349406
1677 Ga0075429_100001751
1678 Ga0075429_100002026
1679 Ga0075429_100416782
1680 Ga0068865_100018285
1681 Ga0075436_100043548
1682 Ga0075436_100441390
1683 Ga0075436_100452601
1684 Ga0097620_100050263
1685 Ga0097620_101023256
1686 Ga0097620_101419275
1687 Ga0097620_102406494
1688 Ga0075435_100004466
1689 Ga0075435_100068391
1690 Ga0075435_100069834
1691 Ga0075435_100108968
1692 Ga0075435_100385819
1693 Ga0105251_10009665
1694 Ga0105251_10256321
1695 Ga0105244_10254702
1696 Ga0105250_10033642
1697 Ga0105250_10293962
1698 Ga0105240_10329808
1699 Ga0105240_10373606
1700 Ga0105240_10544883
1701 Ga0105240_11173567
1702 Ga0105240_11370540
1703 Ga0111539_10000072
1704 Ga0111539_10001208
1705 Ga0111539_10002538
1706 Ga0111539_10024753
1707 Ga0111539_10068136
1708 Ga0111539_11367495
1709 Ga0105245_10001702
1710 Ga0105245_10010259
1711 Ga0105245_10130671
1712 Ga0105245_10407028
1713 Ga0105245_10445267
1714 Ga0105245_10863389
1715 Ga0105245_11636724
1716 Ga0105245_13010652
1717 Ga0105247_10060167
1718 Ga0114129_10009025
1719 Ga0114129_10322990
1720 Ga0105243_10010792
1721 Ga0105243_10172488
1722 Ga0105243_10250766
1723 Ga0105243_10636278
1724 Ga0105241_10008089
1725 Ga0105241_10022718
1726 Ga0105241_10377015
1727 Ga0105241_11754421
1728 Ga0105241_12521352
1729 Ga0105242_10002547
1730 Ga0105242_10003812
1731 Ga0105242_10224540
1732 Ga0105242_11400837
1733 Ga0105242_12605580
1734 Ga0105248_10030754
1735 Ga0105248_10082675
1736 Ga0105248_10144963
1737 Ga0105248_13057615
1738 Ga0105237_10041676
1739 Ga0105237_10393473
1740 Ga0105237_10835667
1741 Ga0105237_12226476
1742 Ga0105238_10174906
1743 Ga0105238_10240578
1744 Ga0105238_10244817
1745 Ga0105238_10581366
1746 Ga0105249_10002932
1747 Ga0105249_10077851
1748 Ga0105249_10284120
1749 Ga0105239_10007571
1750 Ga0105239_10359706
1751 Ga0105239_10599296
1752 Ga0105239_12258715
1753 Ga0105239_12917551
1754 Ga0105246_10000456
1755 Ga0105246_10034993
1756 Ga0157340_1017516
1757 Ga0157340_1020878
1758 Ga0157344_1002446
1759 Ga0157346_1005461
1760 Ga0157337_1000995
1761 Ga0157337_1006072
1762 Ga0157321_1003314
1763 Ga0157341_1011855
1764 Ga0157345_1006853
1765 Ga0157314_1050750
1766 Ga0157324_1000599
1767 Ga0157342_1000152
1768 Ga0157315_1000752
1769 Ga0157326_1023539
1770 Ga0157338_1003303
1771 Ga0157338_1077607
1772 Ga0157373_10094553
1773 Ga0157373_10196560
1774 Ga0157373_10449334
1775 Ga0157373_10491813
1776 Ga0157373_11292724
1777 Ga0157371_10015233
1778 Ga0157371_10235851
1779 Ga0157371_10752618
1780 Ga0157370_10208527
1781 Ga0157370_10509836
1782 Ga0157370_10639589
1783 Ga0157370_10763642
1784 Ga0157370_11280962
1785 Ga0157369_10196586
1786 Ga0157369_10334097
1787 Ga0157369_10693294
1788 Ga0157369_10783991
1789 Ga0157369_12585143
1790 Ga0157374_10027781
1791 Ga0157374_10067109
1792 Ga0157374_10377062
1793 Ga0157374_11146552
1794 Ga0157378_10002239
1795 Ga0157378_10694458
1796 Ga0157378_10719018
1797 Ga0163162_10005232
1798 Ga0163162_10085379
1799 Ga0163162_10413997
1800 Ga0157372_10097909
1801 Ga0157372_10144628
1802 Ga0157372_10207302
1803 Ga0157372_10523761
1804 Ga0157375_10001714
1805 Ga0157375_10030610
1806 Ga0157375_10190111
1807 Ga0157375_10225001
1808 Ga0157375_11047133
1809 Ga0163163_10001518
1810 Ga0163163_10174616
1811 Ga0163163_10366798
1812 Ga0163163_12794896
1813 Ga0157380_10012889
1814 Ga0157380_10607127
1815 Ga0182008_10201423
1816 Ga0182008_10647328
1817 Ga0182008_10823049
1818 Ga0157377_10002411
1819 Ga0157377_10038150
1820 Ga0157379_10003150
1821 Ga0157379_10021868
1822 Ga0157379_10049294
1823 Ga0157379_11336340
1824 Ga0157376_10001552
1825 Ga0157376_10066923
1826 Ga0157376_10148440
1827 Ga0182007_10263505
1828 Ga0163161_10002536
1829 Ga0163161_10100265
1830 Ga0163161_10180229
1831 Ga0206353_11323643
1832 Ga0213872_10352069
1833 Ga0207666_1000186
1834 Ga0207673_1000346
1835 Ga0207673_1018184
1836 Ga0209256_1000181
1837 Ga0207697_10010849
1838 Ga0207697_10016334
1839 Ga0207656_10276535
1840 Ga0207696_1092354
1841 Ga0207696_1194706
1842 Ga0207653_10002509
1843 Ga0207653_10008464
1844 Ga0207682_10000143
1845 Ga0207692_10010101
1846 Ga0207692_10039931
1847 Ga0207692_10079530
1848 Ga0207692_11195911
1849 Ga0207642_10003670
1850 Ga0207642_10090387
1851 Ga0207642_10442171
1852 Ga0207710_10002851
1853 Ga0207710_10028478
1854 Ga0207710_10478767
1855 Ga0207688_10004837
1856 Ga0207688_10087339
1857 Ga0207680_10059922
1858 Ga0207680_10291351
1859 Ga0207647_10009610
1860 Ga0207647_10165777
1861 Ga0207647_10344191
1862 Ga0207685_10214002
1863 Ga0207685_10265698
1864 Ga0207699_10002837
1865 Ga0207699_10008626
1866 Ga0207699_10303724
1867 Ga0207699_11181720
1868 Ga0207645_10003855
1869 Ga0207645_10062093
1870 Ga0207645_10334183
1871 Ga0207645_10342871
1872 Ga0207643_10000336
1873 Ga0207705_10053004
1874 Ga0207705_10059508
1875 Ga0207654_10007173
1876 Ga0207654_10030175
1877 Ga0207654_10084852
1878 Ga0207707_10004481
1879 Ga0207707_10032305
1880 Ga0207707_10126505
1881 Ga0207707_10253668
1882 Ga0207707_10419007
1883 Ga0207707_10555626
1884 Ga0207707_10595474
1885 Ga0207695_10072031
1886 Ga0207671_10017926
1887 Ga0207671_10140224
1888 Ga0207671_11003462
1889 Ga0207693_10047659
1890 Ga0207693_10059188
1891 Ga0207693_10068794
1892 Ga0207663_10033186
1893 Ga0207663_10113738
1894 Ga0207663_10293326
1895 Ga0207663_10498782
1896 Ga0207663_10503645
1897 Ga0207660_10002805
1898 Ga0207660_10067774
1899 Ga0207660_10247453
1900 Ga0207660_10329211
1901 Ga0207660_10816366
1902 Ga0207662_10017545
1903 Ga0207662_10833726
1904 Ga0207657_10025170
1905 Ga0207657_10041931
1906 Ga0207657_10059076
1907 Ga0207657_10080849
1908 Ga0207657_10089041
1909 Ga0207657_10143785
1910 Ga0207649_10000889
1911 Ga0207649_10049100
1912 Ga0207649_10107454
1913 Ga0207652_10028916
1914 Ga0207652_10061170
1915 Ga0207652_10138240
1916 Ga0207652_10139171
1917 Ga0207652_10766391
1918 Ga0207652_10840669
1919 Ga0207681_10000782
1920 Ga0207681_10108107
1921 Ga0207694_10111928
1922 Ga0207694_10129294
1923 Ga0207694_10586500
1924 Ga0207694_10747598
1925 Ga0207650_10021612
1926 Ga0207650_10216694
1927 Ga0207659_10000676
1928 Ga0207659_10473325
1929 Ga0207687_10001851
1930 Ga0207687_10032859
1931 Ga0207687_10046333
1932 Ga0207687_10862131
1933 Ga0207687_11180836
1934 Ga0207700_10015283
1935 Ga0207700_10106298
1936 Ga0207700_10373740
1937 Ga0207664_10115796
1938 Ga0207664_10229696
1939 Ga0207664_10306494
1940 Ga0207644_10001040
1941 Ga0207644_10007133
1942 Ga0207644_10399308
1943 Ga0207644_10861080
1944 Ga0207690_10001491
1945 Ga0207690_10295245
1946 Ga0207690_10715083
1947 Ga0207690_10944347
1948 Ga0207706_10040546
1949 Ga0207706_10040651
1950 Ga0207706_10269359
1951 Ga0207686_10019478
1952 Ga0207686_10023879
1953 Ga0207686_10113589
1954 Ga0207686_10278058
1955 Ga0207686_11244466
1956 Ga0207709_10017465
1957 Ga0207709_10066231
1958 Ga0207709_10258987
1959 Ga0207670_10002314
1960 Ga0207670_10036052
1961 Ga0207670_10118356
1962 Ga0207669_10001302
1963 Ga0207669_10039633
1964 Ga0207669_11481830
1965 Ga0207704_10000410
1966 Ga0207704_10168583
1967 Ga0207704_10231464
1968 Ga0207704_11564573
1969 Ga0207665_10000756
1970 Ga0207665_10027820
1971 Ga0207665_10050785
1972 Ga0207691_10045057
1973 Ga0207691_10209033
1974 Ga0207711_10024421
1975 Ga0207711_10053552
1976 Ga0207711_10127240
1977 Ga0207689_10049253
1978 Ga0207689_10832223
1979 Ga0207689_11128806
1980 Ga0207661_10001346
1981 Ga0207661_10477821
1982 Ga0207661_10581480
1983 Ga0207661_11545714
1984 Ga0207661_12182123
1985 Ga0207679_10000504
1986 Ga0207679_10326065
1987 Ga0207679_10983296
1988 Ga0207667_10017518
1989 Ga0207667_10095367
1990 Ga0207667_10146645
1991 Ga0207667_10199974
1992 Ga0207651_10013105
1993 Ga0207651_10512810
1994 Ga0207712_10032107
1995 Ga0207712_10044100
1996 Ga0207712_10121122
1997 Ga0207712_11022459
1998 Ga0207668_10000762
1999 Ga0207668_10122190
2000 Ga0207668_10633179
2001 Ga0207640_10002084
2002 Ga0207640_10653391
2003 Ga0207658_10039358
2004 Ga0207658_10051921
2005 Ga0207658_10089822
2006 Ga0207658_10948196
2007 Ga0207677_10008747
2008 Ga0207677_10184215
2009 Ga0207677_10827341
2010 Ga0207703_10021501
2011 Ga0207703_10115249
2012 Ga0207703_10165509
2013 Ga0207703_11098093
2014 Ga0207639_10004202
2015 Ga0207639_10181271
2016 Ga0207639_10544362
2017 Ga0207639_10573459
2018 Ga0207639_10787967
2019 Ga0207678_10017045
2020 Ga0207678_10038786
2021 Ga0207678_11628000
2022 Ga0207708_10031096
2023 Ga0207708_10040693
2024 Ga0207702_10212244
2025 Ga0207702_10217561
2026 Ga0207702_10432110
2027 Ga0207702_10648464
2028 Ga0207641_10003596
2029 Ga0207641_10414729
2030 Ga0207641_10533901
2031 Ga0207648_10054561
2032 Ga0207648_10087497
2033 Ga0207648_10732642
2034 Ga0207676_10059220
2035 Ga0207676_10259371
2036 Ga0207676_10691415
2037 Ga0207676_10821517
2038 Ga0207676_11890773
2039 Ga0207674_10002908
2040 Ga0207674_10569242
2041 Ga0207674_10922287
2042 Ga0207674_12012035
2043 Ga0207675_100034535
2044 Ga0207675_100131311
2045 Ga0207675_100626138
2046 Ga0207683_10001206
2047 Ga0207683_10007086
2048 Ga0207683_10018925
2049 Ga0207683_12165302
2050 Ga0207698_10023084
2051 Ga0207698_10173913
2052 Ga0207698_11142829
2053 Ga0207698_11289798
2054 Ga0209973_1012915
2055 Ga0209969_1004998
2056 Ga0209967_1002814
2057 Ga0209981_1030986
2058 Ga0209996_1010995
2059 Ga0209984_1009301
2060 Ga0209995_1067414
2061 Ga0209968_1005637
2062 Ga0209999_1063730
2063 Ga0209982_1020055
2064 Ga0209970_1001595
2065 Ga0209983_1028051
2066 Ga0209971_1010559
2067 Ga0209966_1037455
2068 Ga0209998_10003991
2069 Ga0209998_10020408
2070 Ga0209998_10180906
2071 Ga0209813_10060298
2072 Ga0209974_10018508
2073 Ga0209974_10121909
2074 Ga0209974_10320666
2075 Ga0209974_10472103
2076 Ga0207428_10000141
2077 Ga0207428_10001593
2078 Ga0207428_10003355
2079 Ga0207428_10061609
2080 Ga0207428_10069072
2081 Ga0268266_10023949
2082 Ga0268266_10175755
2083 Ga0268266_10255707
2084 Ga0268265_10001135
2085 Ga0268265_10164860
2086 Ga0268264_10000051
2087 Ga0268264_10005920
2088 Ga0268264_10227206
2089 Ga0268264_10297826
2090 Ga0268264_10383694
2091 Ga0265337_1002114
2092 Ga0265338_10124983
2093 Ga0265338_10327807
2094 Ga0265338_10513659
2095 Ga0265330_10029759
2096 Ga0265330_10288311
2097 Ga0265332_10152147
2098 Ga0265332_10486998
2099 Ga0265328_10327145
2100 Ga0265325_10000119
2101 Ga0265325_10018270
2102 Ga0265325_10411912
2103 Ga0265340_10015371
2104 Ga0265340_10106826
2105 Ga0265340_10201257
2106 Ga0265339_10003215
2107 Ga0265339_10027041
2108 Ga0265339_10102480
2109 Ga0265331_10454368
2110 Ga0265316_10038880
2111 Ga0265316_10136750
2112 Ga0265316_10149537
2113 Ga0265316_10149594
2114 Ga0265313_10032008
2115 Ga0265313_10037161
2116 Ga0265313_10042722
2117 Ga0265313_10142865
2118 Ga0265314_10014050
2119 Ga0265314_10190638
2120 Ga0265342_10000967
2121 Ga0265342_10019923
2122 Ga0307405_11224173
2123 Ga0307406_10469671
2124 Ga0307406_11688402
2125 Ga0316583_10004499
2126 Ga0373930_0000546
2127 Ga0373930_0074486
2128 Ga0373948_0006814
2129 Ga0373958_0000316
2130 Ga0373958_0028289
2131 Ga0373959_0006377
2132 Ga0373938_0000677
2133 Ga0373938_0015610
2134 Ga0373938_0053049
2135 Ga0373926_0002819
2136 Ga0373926_0027341
2137 Ga0373926_0093576
2138 Ga0373928_0001944
2139 Ga0373928_0014038
2140 Ga0373929_0007130
2141 Ga0373934_0135065
2142 Ga0373934_0231347
2143 Ga0373940_0000058
2144 Ga0373940_0041177
2145 Ga0373944_0002373
2146 Ga0373944_0034117
2147 Ga0373944_0051532
2148 Ga0373949_0001169
2149 Ga0373949_0017218
2150 Ga0373949_0040573
2151 Ga0373951_0000698
2152 Ga0373951_0009696
2153 Ga0373952_0000245
2154 Ga0373952_0130653
2155 Ga0373952_0142329
2156 Ga0373952_0268291
2157 Ga0373923_0063383
2158 Ga0373923_0272341
2159 Ga0373923_0662906
2160 Ga0373932_0000784
2161 Ga0373932_0170147
2162 Ga0373932_0365478
2163 Ga0373936_0000491
2164 Ga0373936_0076787
2165 Ga0373936_0360123
2166 Ga0373939_0000350
2167 Ga0373939_0007984
2168 Ga0373939_0008981
2169 Ga0373941_0005512
2170 Ga0373941_0045377
2171 Ga0373945_0010389
2172 Ga0373945_0054339
2173 Ga0373945_0308162
2174 Ga0373953_0006085
2175 Ga0373953_0040573
2176 Ga0373953_0150057
2177 Ga0373953_0274062
2178 Ga0373954_0022723
2179 Ga0373954_0064678
2180 Ga0373954_0273000
2181 Ga0373954_0578010
2182 Ga0373954_0596722
2183 Ga0373956_0002568
2184 Ga0373956_0045063
2185 Ga0373956_0443472
2186 Ga0373957_0036369
2187 Ga0373957_0312763
2188 Ga0373957_0473598
2189 Ga0373960_0225966
2190 Ga0373960_0232409
2191 Ga0373960_0242952
2192 Ga0373943_0005755
2193 Ga0373943_0153622
2194 Ga0373946_0001418
2195 Ga0373946_0018824
2196 Ga0373946_0171061
2197 Ga0373946_0356096
2198 Ga0373955_0006235
2199 Ga0373955_0032016
2200 Ga0373955_0068387
2201 Ga0373955_0130239
2202 Ga0373955_0196101
2203 Ga0373955_0630103
2204 Ga0373942_0000056
2205 Ga0373942_0055759
2206 Ga0373961_0000471
2207 Ga0373961_0022597
2208 Ga0373961_0292490
2209 Ga0373962_0000608
2210 Ga0373962_0003921
2211 Ga0373924_0120621
2212 Ga0373924_0133528
2213 Ga0373924_0220078
2214 Ga0373924_0293080
2215 Ga0373931_0083993
2216 Ga0373931_0086755
2217 Ga0373931_0087850
2218 Ga0373931_0137841
2219 Ga0373931_1271461
2220 Ga0373935_0004417
2221 Ga0373935_0007391
2222 Ga0373935_0072609
2223 Ga0373935_0719669
2224 Ga0373935_0797601
2225 Ga0373935_1507295
2226 Ga0373927_0015530
2227 Ga0373927_0048634
2228 Ga0373927_0319931
2229 Ga0373933_0003495
2230 Ga0373933_0008121
2231 Ga0373933_0019789
2232 Ga0373933_0060623
2233 Ga0373933_0604107
2234 Ga0373933_0800663
2235 Ga0373947_0001131
2236 Ga0373947_0032649
2237 Ga0373947_0513603
2238 Ga0373947_1229268
2239 Ga0373937_0009064
2240 Ga0373937_0010912
2241 Ga0373937_0014216
2242 Ga0373937_0017271
2243 Ga0373937_0030955
2244 Ga0373937_0107375
2245 Ga0373937_0615691
2246 Ga0373925_0005021
2247 Ga0373925_0005303
2248 Ga0373925_0027500
2249 Ga0373925_0757389
2250 Ga0373925_1251052
2251 Ga0395899_0002845
2252 Ga0395899_0080610
2253 Ga0395900_0003630
2254 Ga0395900_0010878
2255 Ga0395900_0328325
2256 Ga0395900_1040984
2257 Ga0395898_0006740
2258 Ga0395898_0014680
2259 Ga0395898_0150024
2260 Ga0436364_0782926
2261 Ga0395901_0020857
2262 Ga0395901_0170977
2263 Ga0395901_0297638
2264 Ga0395901_0916198
2265 Ga0242420_005947
2266 Ga0436361_0568157
2267 Ga0439453_0185193
2268 Ga0439453_0192927
2269 Ga0451793_0643023
2270 Ga0451802_0329831
2271 Ga0451804_0516794
2272 Ga0451807_1208075
2273 Ga0451845_0125542
2274 Ga0439448_0102944
2275 Ga0439448_0333398
2276 Ga0439450_058082
2277 Ga0439456_047188
2278 Ga0439463_040358
2279 Ga0439458_0084245
2280 Ga0439458_0235193
2281 Ga0439444_0045082
2282 Ga0439464_0051986
2283 Ga0439460_0040902
2284 Ga0451577_0416108
2285 Ga0466963_0232808
2286 Ga0453684_1352392
2287 Ga0451576_0151880
2288 Ga0466967_0654065
2289 Ga0495592_0019497
2290 Ga0495592_0027776
2291 Ga0495592_0054230
2292 Ga0495592_0163822
2293 Ga0495592_0189339
2294 Ga0495592_0773830
2295 Ga0495603_0008518
2296 Ga0495603_0116801
2297 Ga0495603_0876116
2298 Ga0495590_0213966
2299 Ga0495591_034040
2300 Ga0495629_0001316
2301 Ga0495629_0023842
2302 Ga0495629_0443347
2303 Ga0495641_0064157
2304 Ga0495641_0101299
2305 Ga0495641_0275884
2306 Ga0495651_0004833
2307 Ga0495651_0015103
2308 Ga0495651_0032128
2309 Ga0495651_0252104
2310 Ga0495651_0280736
2311 Ga0495651_0311912
2312 Ga0495653_0002640
2313 Ga0495653_0005895
2314 Ga0495653_0090080
2315 Ga0495653_0242775
2316 Ga0495580_0015463
2317 Ga0495580_0600318
2318 Ga0495582_0005763
2319 Ga0495582_0031750
2320 Ga0495605_0221291
2321 Ga0495639_0004954
2322 Ga0495662_0001866
2323 Ga0495662_0037300
2324 Ga0495662_0231757
2325 Ga0495664_0050283
2326 Ga0495664_0150710
2327 Ga0495664_0296401
2328 Ga0495584_0061606
2329 Ga0495584_0501780
2330 Ga0495585_0001729
2331 Ga0495594_0009236
2332 Ga0495594_0024363
2333 Ga0495594_0121684
2334 Ga0495608_0007989
2335 Ga0495608_0058681
2336 Ga0495608_0074704
2337 Ga0495608_0942665
2338 Ga0495616_0035425
2339 Ga0495618_0047174
2340 Ga0495618_0132385
2341 Ga0495618_0361354
2342 Ga0495618_0686226
2343 Ga0495628_0011219
2344 Ga0495628_0135599
2345 Ga0495628_0193849
2346 Ga0495628_0193851
2347 Ga0495628_0953824
2348 Ga0495628_1190218
2349 Ga0495630_0015862
2350 Ga0495630_0255351
2351 Ga0495630_0571960
2352 Ga0495637_0214234
2353 Ga0495644_0055943
2354 Ga0495663_0055416
2355 Ga0495666_0090430
2356 Ga0495652_0027253
2357 Ga0495652_0038405
2358 Ga0495652_0159752
2359 Ga0495652_0339058
2360 Ga0495665_0070818
2361 Ga0495665_0079937
2362 Ga0495640_0015679
2363 Ga0495640_0087913
2364 Ga0495640_0164206
2365 Ga0495640_0228663
2366 Ga0495640_0731086
2367 Ga0495586_0011823
2368 Ga0495587_0011963
2369 Ga0495587_0026702
2370 Ga0495587_0079695
2371 Ga0495587_0098505
2372 Ga0495587_0187350
2373 Ga0495598_0135865
2374 Ga0495645_0018999
2375 Ga0495645_0070977
2376 Ga0495645_0378945
2377 Ga0495622_0035567
2378 Ga0495622_0070129
2379 Ga0495633_0005006
2380 Ga0495667_0013026
2381 Ga0495667_0017124
2382 Ga0495667_0017232
2383 Ga0495667_0051253
2384 Ga0495667_0318405
2385 Ga0495667_0845881
2386 Ga0495656_0003577
2387 Ga0495634_0279340
2388 Ga0495634_0292081
2389 Ga0495634_0527038
2390 Ga0495611_0213732
2391 Ga0495635_0006791
2392 Ga0495635_0064410
2393 Ga0495659_0001405
2394 Ga0495661_0019380
2395 Ga0495588_0058537
2396 Ga0495588_0097486
2397 Ga0495588_0661499
2398 Ga0495657_0024510
2399 Ga0495657_0045368
2400 Ga0495657_0054497
2401 Ga0495657_0242325
2402 Ga0495599_0011174
2403 Ga0495599_0067846
2404 Ga0495599_0077683
2405 Ga0495623_0006971
2406 Ga0495623_0029805
2407 Ga0495623_0487814
2408 Ga0495646_0007298
2409 Ga0495646_0017374
2410 Ga0495646_0101317
2411 Ga0495646_0130269
2412 Ga0495647_0006124
2413 Ga0495647_0170830
2414 Ga0495647_0445906
2415 Ga0495658_0004362
2416 Ga0495658_0006637
2417 Ga0495658_0471380
2418 Ga0495658_1044498
2419 Ga0495669_0258820
2420 Ga0495613_0001421
2421 Ga0495624_0078164
2422 Ga0495670_0000579
2423 Ga0495589_0126138
2424 Ga0495600_0005626
2425 Ga0495600_0013325
2426 Ga0495600_0075167
2427 Ga0495600_0134908
2428 Ga0495600_0177451
2429 Ga0495581_0030170
2430 Ga0495581_0036393
2431 Ga0495581_0057219
2432 Ga0495604_0013922
2433 Ga0495604_0041061
2434 Ga0495604_0140785
2435 Ga0495674_0036977
2436 Ga0495674_0048019
2437 Ga0495674_0056005
2438 Ga0495674_1357126
2439 Ga0495676_0146085
2440 Ga0495676_0175042
2441 Ga0495676_0191878
2442 Ga0495680_0040361
2443 Ga0495680_0042659
2444 Ga0495680_0048604
2445 Ga0495680_0094466
2446 Ga0495680_0239396
2447 Ga0495680_0925659
2448 Ga0495675_0003995
2449 Ga0495675_0007873
2450 Ga0495675_0198415
2451 Ga0495675_0478999
2452 Ga0495675_0820944
2453 Ga0495679_038861
2454 Ga0495684_0000281
2455 Ga0495684_0058854
2456 Ga0495684_0136135
2457 Ga0495593_0001313
2458 Ga0495593_0045482
2459 Ga0495593_0132677
2460 Ga0495593_0170894
2461 Ga0495602_0010155
2462 Ga0495602_0167764
2463 Ga0495602_0222154
2464 Ga0495602_0280567
2465 Ga0495602_0317411
2466 Ga0495614_0009362
2467 Ga0495614_0281677
2468 Ga0495614_0499980
2469 Ga0496100_0010589
2470 Ga0496100_0033704
2471 Ga0496101_0031405
2472 Ga0496101_0126413
2473 Ga0496101_0130906
2474 Ga0496101_0942249
2475 Ga0496102_0146497
2476 Ga0496102_0309115
2477 Ga0496102_0850487
2478 Ga0496103_0054280
2479 Ga0496103_0181320
2480 Ga0496104_0000140
2481 Ga0496104_0012874
2482 Ga0496104_0085385
2483 Ga0496104_0251348
2484 Ga0496104_0287181
2485 Ga0496104_0822785
2486 Ga0496105_0000576
2487 Ga0496105_0070598
2488 Ga0496105_0108795
2489 Ga0496105_0284122
2490 Ga0496105_0442483
2491 Ga0496105_1361051
2492 Ga0496106_0024928
2493 Ga0496106_0029544
2494 Ga0496106_0046226
2495 Ga0496106_1336315
2496 Ga0496107_0010578
2497 Ga0496107_0061801
2498 Ga0496107_0164228
2499 Ga0496107_0337463
2500 Ga0496108_0000639
2501 Ga0496108_0016770
2502 Ga0496108_0035329
2503 Ga0496108_0068074
2504 Ga0496108_0246307
2505 Ga0496108_0461891
2506 Ga0496109_0000619
2507 Ga0496109_0031729
2508 Ga0496109_0134593
2509 Ga0496109_0221900
2510 Ga0496109_0280340
2511 Ga0496110_0046770
2512 Ga0496110_0199125
2513 Ga0496110_0230461
2514 Ga0496111_0010913
2515 Ga0496111_0214910
2516 Ga0496111_0319668
2517 Ga0496112_0002285
2518 Ga0496112_0006392
2519 Ga0496112_0908958
2520 Ga0496113_0006622
2521 Ga0496113_0188187
2522 Ga0496113_0921350
2523 Ga0496113_0979835
2524 Ga0496114_0011636
2525 Ga0496114_0016617
2526 Ga0496114_0095862
2527 Ga0496114_0396394
2528 Ga0496115_0015149
2529 Ga0496115_0020630
2530 Ga0496115_0250423
2531 Ga0496115_0563329
2532 Ga0495682_0372670
2533 Ga0501031_0019351
2534 Ga0501032_0995383
2535 Ga0501033_0001099
2536 Ga0501034_0083711
2537 Ga0501034_0137379
2538 Ga0501034_0153944
2539 Ga0501036_0060843
2540 Ga0501036_0612301
2541 Ga0501036_0801392
2542 Ga0501037_0002613
2543 Ga0501038_0044217
2544 Ga0501038_1072737
2545 Ga0501039_0149882
2546 Ga0501039_0155277
2547 Ga0501039_0832229
2548 Ga0501040_0052628
2549 Ga0501040_1042857
2550 Ga0501041_0246800
2551 Ga0501042_0067708
2552 Ga0501042_0124564
2553 Ga0501043_0117522
2554 Ga0501046_0036477
2555 Ga0501046_0051536
2556 Ga0501046_0562196
2557 Ga0501047_0008549
2558 Ga0501047_0046207
2559 Ga0501047_1042770
2560 Ga0501047_1311621
2561 Ga0501048_0354681
2562 Ga0501067_0002227
2563 Ga0501067_0068672
2564 Ga0501068_0035230
2565 Ga0501068_0124689
2566 Ga0501069_0050135
2567 Ga0501069_0223836
2568 Ga0501069_0398242
2569 Ga0501070_0027855
2570 Ga0501070_0160980
2571 Ga0501070_0397775
2572 Ga0501070_0609232
2573 Ga0501070_1263559
2574 Ga0501070_1464559
2575 Ga0501071_0081885
2576 Ga0501071_0197190
2577 Ga0501072_0019663
2578 Ga0501072_0020222
2579 Ga0501072_1516789
2580 Ga0501073_0098368
2581 Ga0501073_0203077
2582 Ga0501073_0228447
2583 Ga0501073_0304403
2584 Ga0501073_0488134
2585 Ga0501073_0510677
2586 Ga0501074_0096432
2587 Ga0501074_0236637
2588 Ga0501075_0448004
2589 Ga0501075_0635741
2590 Ga0501076_0012137
2591 Ga0501076_0065020
2592 Ga0501076_0653337
2593 Ga0501076_0704391
2594 Ga0501076_0770996
2595 Ga0501077_0024392
2596 Ga0501077_0097791
2597 Ga0501077_0109851
2598 Ga0501079_0127033
2599 Ga0501079_0988107
2600 Ga0501080_0073023
2601 Ga0501080_0160437
2602 Ga0501080_0711444
2603 Ga0501081_0013430
2604 Ga0501083_0023594
2605 Ga0501083_0153262
2606 Ga0501083_0208457
2607 Ga0501083_0211946
2608 Ga0501083_0240119
2609 Ga0501083_0342841
2610 Ga0501083_0415413
2611 Ga0501035_0003995
2612 Ga0501035_0023875
2613 Ga0501035_0440570
2614 Ga0501044_0036955
2615 Ga0501044_0102282
2616 Ga0501044_0115111
2617 Ga0501044_0369420
2618 Ga0501044_1031010
2619 Ga0501045_0090524
2620 nmdc:mga03683_147799_c1
2621 nmdc:mga03n38_362536_c1
2622 nmdc:mga00v17_294139_c1
2623 nmdc:mga06z11_661061_c1
2624 nmdc:mga05p37_44027_c1
2625 nmdc:mga05p37_51_c1
2626 nmdc:mga05p37_819_c2
2627 nmdc:mga09592_1078_c1
2628 nmdc:mga09592_1891_c1
2629 nmdc:mga0qj67_1161078_c1
2630 nmdc:mga0qj67_23665_c1
2631 nmdc:mga0qj67_6890_c1
2632 nmdc:mga06r32_153407_c1
2633 nmdc:mga06r32_16_c1
2634 nmdc:mga06r32_578710_c1
2635 nmdc:mga06r32_677396_c1
2636 nmdc:mga08y16_2600_c1
2637 nmdc:mga08y16_697_c1
2638 nmdc:mga08y16_794739_c1
2639 nmdc:mga08y16_79_c2
2640 nmdc:mga0n895_1465712_c1
2641 nmdc:mga0n895_250277_c1
2642 nmdc:mga0n895_258404_c1
2643 nmdc:mga0n895_609_c1
2644 nmdc:mga0rr50_1280098_c1
2645 nmdc:mga0rr50_417377_c1
2646 nmdc:mga0rr50_4488_c1
2647 nmdc:mga0rr50_48326_c1
2648 nmdc:mga0rr50_56833_c1
2649 nmdc:mga08x19_442365_c1
2650 nmdc:mga08x19_67630_c1
2651 nmdc:mga08x19_699687_c1
2652 nmdc:mga0a205_967_c1
2653 Ga0495601_0008343
2654 Ga0495601_0011417
2655 Ga0495601_0014707
2656 Ga0495601_0017667
2657 Ga0495601_0024406
2658 Ga0495601_0039920
2659 Ga0495601_0109933
2660 Ga0495612_0001680
2661 Ga0495612_0003005
2662 Ga0495612_0122302
2663 Ga0495612_0168648
2664 Ga0495612_0271646
2665 Ga0495612_0532802
2666 Ga0495595_0004028
2667 Ga0495595_0004570
2668 Ga0495595_0007466
2669 Ga0495595_0012972
2670 Ga0495595_0063818
2671 Ga0495595_0065786
2672 Ga0495595_0582004
2673 Ga0495619_0001224
2674 Ga0495619_0003768
2675 Ga0495619_0003841
2676 Ga0495619_0004658
2677 Ga0495619_0008730
2678 Ga0495619_0022348
2679 Ga0495619_0056937
2680 Ga0500566_0153479
2681 Ga0500559_0017732
2682 Ga0500568_0051813
2683 Ga0500603_059207
2684 Ga0500636_0221998
2685 Ga0500636_0506793
2686 Ga0501084_0027428
2687 Ga0501084_0081748
2688 Ga0501084_0081902
2689 Ga0501084_0086177
2690 Ga0501084_0104404
2691 Ga0501084_0317179
2692 Ga0501084_1119160
2693 Ga0501084_1349359
2694 Ga0501084_1868594
2695 Ga0501082_0072147
2696 Ga0501082_0132410
2697 Ga0501082_0134001
2698 Ga0501082_0466796
2699 Ga0501082_1085089
2700 Ga0501082_1782244
2701 Ga0466962_0168550
2702 Ga0530510_0082610

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04588

HIG_1_N

Hypoxia induced protein conserved region

17

69

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6inr-assembly2.cif.gz_B the crystal structure of phytoplasmal effector causing phyllody symptoms 1 (phyl1) 0.6927 10 60
4jlr-assembly1.cif.gz_S crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab 0.658 3 60
3aai-assembly1.cif.gz_A x-ray crystal structure of csor from thermus thermophilus hb8 0.6534 10 63
7rh5-assembly1.cif.gz_P mycobacterial ciii2civ2 supercomplex, inhibitor free 0.6389 10 63
3aai-assembly1.cif.gz_C x-ray crystal structure of csor from thermus thermophilus hb8 0.6381 10 60
ID Description Score Start End Superfamily
4jq5E00 Special;Helix non-globular;Helix Hairpins; 0.8544 1 63 6.10.140.1350
4jq5E00 Special;Helix non-globular;Helix Hairpins; 0.8308 1 63 6.10.140.1350
af_I1JPC6_537_798_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.7809 11 60 1.20.58.220
af_A0A2R8QM07_546_651_1.25.40.610 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.7484 10 61 1.25.40.610
af_X1WGA9_335_617_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7076 2 60 1.20.58.60
ID Description Score Start End GO Terms
AF-A0A067KA67-F1-model_v4 RPW8 domain-containing protein 0.9095 2 61
AF-A0A482X526-F1-model_v4 Protein DGCR6 0.895 3 63
AF-A0A533VQR5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8506 1 59 GO:0000155
GO:0000156
GO:0007234
GO:0016020
GO:0030295
AF-A0A482X526-F1-model_v4 Protein DGCR6 0.8456 3 63
AF-A0A067KA67-F1-model_v4 RPW8 domain-containing protein 0.8447 2 61

Map