F493207

General Info

Members Datasets Scaffolds Average Seq Length
1347 426 1304 302

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10275917|Ga0163162_102759172
Length 349
Sequence VRENLPVAGDERGGGFVAGGFDAENDHHRVLSCQPALVEALPFLHGTRMTRFRLGTRGSPLALTQAGMVRDALCAAHGWSPDAVEIVVIRTTGDRVQDRALAEIGGKALWTKGLDRALHDGDIDCAVHSMKDVETIRPATLSIAAMLPRADVRDRLIGAETLSDLRQGAVVGTSSPRRRAQMLRLRPDLEIVLIRGNVDTRLGRVASGEMDATLLAAAGLDRLGRDDGHAIPTDVMLPAPAQGAVGIEVLARSAAGGIVAAIDHRDTSLCVLTERALLARLGADCHSPVAALASLAGETLTLRAELIAEDGACDVAGSIEGTVDDDLGTALAEDLLARAPASVRRLFSA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
6 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
7 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
13 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
14 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
15 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
16 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
17 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
18 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
19 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
20 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
21 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
22 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
23 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
24 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
25 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
26 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
27 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
28 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
29 2902330777 Methylobacterium sp. 2A Isolate Unclassified
30 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
31 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
32 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
33 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
34 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
35 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
36 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
37 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
38 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
39 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
40 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
41 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
42 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
43 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
44 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
45 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
46 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
47 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
48 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
49 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
50 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
51 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
52 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
82 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
104 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
105 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
106 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
107 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
114 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
117 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
167 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
170 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
171 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
174 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
175 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
178 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
251 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
278 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
279 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
280 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
281 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
282 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
283 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
286 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
287 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
290 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
291 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
292 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
293 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
294 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
305 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
308 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
318 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
355 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
356 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
357 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
366 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
375 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
376 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
377 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
378 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
379 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
380 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
381 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
382 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
383 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
384 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
387 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
396 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
397 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
398 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
399 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
400 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
401 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
402 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
403 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
404 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
405 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
406 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
407 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
408 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
409 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
413 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
414 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
415 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
416 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
417 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
418 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
419 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
420 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
421 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 641522639 Methylobacterium sp. 4-46 Isolate Nodule
425 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
426 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.51
Metatranscriptomes 0.3
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 9.5
Nodule 0.22
Rhizoplane 2.97
Rhizosphere 79.29
Stem 0
Stem Tuber 0
Unclassified 7.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2018180 2162886007 Bacteria 8382
2 JGI24736J21556_1000218 3300001904 Bacteria 10349
3 JGI24741J21665_1000920 3300001915 Bacteria 8897
4 JGI24741J21665_1001053 3300001915 Bacteria 8267
5 JGI24741J21665_1006080 3300001915 Bacteria 2460
6 JGI24752J21851_1000572 3300001976 Bacteria 4888
7 JGI24752J21851_1002495 3300001976 Bacteria 2450
8 JGI24740J21852_10001935 3300001979 Bacteria 9482
9 JGI24740J21852_10038182 3300001979 Bacteria 1476
10 JGI24739J22299_10033524 3300001989 Bacteria 1756
11 JGI24739J22299_10054056 3300001989 Bacteria 1287
12 JGI24737J22298_10012515 3300001990 Bacteria 2767
13 JGI24737J22298_10013082 3300001990 Bacteria 2704
14 JGI24737J22298_10026054 3300001990 Bacteria 1847
15 JGI24735J21928_10001399 3300002067 Bacteria 8529
16 JGI24735J21928_10003192 3300002067 Bacteria 5604
17 JGI24735J21928_10012661 3300002067 Bacteria 2664
18 JGI24735J21928_10017883 3300002067 Bacteria 2190
19 JGI24735J21928_10025640 3300002067 Bacteria 1778
20 JGI24738J21930_10001121 3300002075 Bacteria 7568
21 JGI24738J21930_10015417 3300002075 Bacteria 1626
22 JGI24749J21850_1000242 3300002076 Bacteria 8540
23 JGI24751J29686_10000195 3300002459 Bacteria 26688
24 JGI25150J39212_1000189 3300002774 Bacteria 34828
25 JGI25165J46597_1000023 3300003214 Bacteria 338873
26 JGI25153J46596_10000045 3300003215 Bacteria 149347
27 JGI25153J46596_10000125 3300003215 Bacteria 86065
28 rootL2_10207868 3300003322 Bacteria 2066
29 Ga0055525_1000119 3300003759 Bacteria 120272
30 Ga0055542_1000142 3300003762 Bacteria 89813
31 Ga0055542_1006997 3300003762 Bacteria 2342
32 Ga0055529_1000167 3300003763 Bacteria 90966
33 Ga0055526_1008886 3300003771 Bacteria 4932
34 Ga0055537_1000787 3300003773 Bacteria 15930
35 Ga0055537_1002802 3300003773 Bacteria 5605
36 Ga0055537_1011990 3300003773 Bacteria 1717
37 Ga0055524_1000221 3300003775 Bacteria 60461
38 Ga0055524_1000387 3300003775 Bacteria 37906
39 Ga0055536_1038756 3300003781 Bacteria 1152
40 Ga0055530_10000269 3300003791 Bacteria 47045
41 Ga0055530_10011428 3300003791 Bacteria 3188
42 Ga0055530_10020041 3300003791 Bacteria 2010
43 Ga0055540_1004110 3300003792 Bacteria 6737
44 Ga0055531_10000318 3300003794 Bacteria 47203
45 Ga0055531_10011173 3300003794 Bacteria 4367
46 Ga0055543_1009876 3300004625 Bacteria 2028
47 Ga0065165_1001532 3300005262 Bacteria 24175
48 Ga0065165_1002366 3300005262 Bacteria 16298
49 Ga0065165_1004263 3300005262 Bacteria 9033
50 Ga0065165_1037780 3300005262 Bacteria 1461
51 Ga0065165_1038879 3300005262 Bacteria 1430
52 Ga0065704_10073584 3300005289 Bacteria 6988
53 Ga0065704_10096430 3300005289 Bacteria 2442
54 Ga0065715_10213345 3300005293 Bacteria 1304
55 Ga0065707_10082561 3300005295 Bacteria 13721
56 Ga0065707_10133594 3300005295 Bacteria 1879
57 Ga0070658_10000143 3300005327 Bacteria 63183
58 Ga0070658_10009867 3300005327 Bacteria 7672
59 Ga0070658_10010686 3300005327 Bacteria 7354
60 Ga0070658_10015184 3300005327 Bacteria 6161
61 Ga0070658_10036159 3300005327 Bacteria 3980
62 Ga0070658_10114371 3300005327 Bacteria 2237
63 Ga0070658_10117779 3300005327 Bacteria 2205
64 Ga0070658_10135797 3300005327 Bacteria 2052
65 Ga0070676_10000104 3300005328 Bacteria 30258
66 Ga0070676_10017471 3300005328 Bacteria 3970
67 Ga0070676_10067142 3300005328 Bacteria 2144
68 Ga0070676_10082353 3300005328 Bacteria 1955
69 Ga0070683_100018140 3300005329 Bacteria 6229
70 Ga0070683_100025921 3300005329 Bacteria 5272
71 Ga0070670_100000033 3300005331 Bacteria 158509
72 Ga0070670_100001972 3300005331 Bacteria 16797
73 Ga0070670_100013480 3300005331 Bacteria 7002
74 Ga0070670_100022250 3300005331 Bacteria 5456
75 Ga0070670_100035125 3300005331 Bacteria 4315
76 Ga0070670_100048591 3300005331 Bacteria 3651
77 Ga0070670_100386006 3300005331 Bacteria 1234
78 Ga0070670_100532687 3300005331 Bacteria 1047
79 Ga0068869_100002907 3300005334 Bacteria 10406
80 Ga0068869_100016838 3300005334 Bacteria 4940
81 Ga0068869_100066878 3300005334 Bacteria 2649
82 Ga0068869_100148069 3300005334 Bacteria 1819
83 Ga0068869_100164656 3300005334 Bacteria 1728
84 Ga0070666_10000286 3300005335 Bacteria 33235
85 Ga0070666_10074837 3300005335 Bacteria 2309
86 Ga0070666_10173768 3300005335 Bacteria 1510
87 Ga0070680_100003296 3300005336 Bacteria 12049
88 Ga0070680_100038230 3300005336 Bacteria 3881
89 Ga0070680_100047487 3300005336 Bacteria 3496
90 Ga0070680_100147180 3300005336 Bacteria 1976
91 Ga0070682_100033480 3300005337 Bacteria 3122
92 Ga0070682_100049566 3300005337 Bacteria 2618
93 Ga0068868_100000032 3300005338 Bacteria 75803
94 Ga0068868_100000073 3300005338 Bacteria 58910
95 Ga0068868_100033767 3300005338 Bacteria 3946
96 Ga0070660_100000200 3300005339 Bacteria 39931
97 Ga0070660_100002030 3300005339 Bacteria 13961
98 Ga0070660_100011462 3300005339 Bacteria 6301
99 Ga0070660_100015446 3300005339 Bacteria 5514
100 Ga0070660_100044942 3300005339 Bacteria 3379
101 Ga0070660_100064600 3300005339 Bacteria 2847
102 Ga0070660_100069844 3300005339 Bacteria 2740
103 Ga0070660_100115988 3300005339 Bacteria 2135
104 Ga0070660_100151670 3300005339 Bacteria 1864
105 Ga0070660_100224655 3300005339 Bacteria 1527
106 Ga0070689_100241634 3300005340 Bacteria 1487
107 Ga0070689_100269916 3300005340 Bacteria 1408
108 Ga0070691_10001770 3300005341 Bacteria 9393
109 Ga0070661_100021883 3300005344 Bacteria 4573
110 Ga0070661_100029595 3300005344 Bacteria 3954
111 Ga0070661_100102198 3300005344 Bacteria 2133
112 Ga0070661_100187233 3300005344 Bacteria 1577
113 Ga0070668_100000003 3300005347 Bacteria 195738
114 Ga0070668_100000011 3300005347 Bacteria 123099
115 Ga0070668_100005153 3300005347 Bacteria 9692
116 Ga0070668_100016688 3300005347 Bacteria 5488
117 Ga0070668_100017250 3300005347 Bacteria 5405
118 Ga0070668_100022525 3300005347 Bacteria 4763
119 Ga0070668_100027223 3300005347 Bacteria 4340
120 Ga0070668_100029946 3300005347 Bacteria 4136
121 Ga0070668_100044453 3300005347 Bacteria 3407
122 Ga0070668_100064361 3300005347 Bacteria 2843
123 Ga0070668_100130510 3300005347 Bacteria 2017
124 Ga0070669_100000004 3300005353 Bacteria 314707
125 Ga0070669_100000005 3300005353 Bacteria 309134
126 Ga0070669_100000080 3300005353 Bacteria 92960
127 Ga0070669_100006816 3300005353 Bacteria 8219
128 Ga0070669_100029782 3300005353 Bacteria 3938
129 Ga0070669_100033355 3300005353 Bacteria 3724
130 Ga0070669_100058340 3300005353 Bacteria 2832
131 Ga0070669_100067227 3300005353 Bacteria 2643
132 Ga0070669_100143822 3300005353 Bacteria 1841
133 Ga0070669_100501224 3300005353 Bacteria 1007
134 Ga0070675_100015090 3300005354 Bacteria 6101
135 Ga0070675_100027624 3300005354 Bacteria 4561
136 Ga0070675_100028394 3300005354 Bacteria 4503
137 Ga0070675_100152732 3300005354 Bacteria 1980
138 Ga0070671_100000004 3300005355 Bacteria 262155
139 Ga0070671_100000061 3300005355 Bacteria 73646
140 Ga0070671_100000707 3300005355 Bacteria 23997
141 Ga0070671_100002229 3300005355 Bacteria 14965
142 Ga0070671_100014989 3300005355 Bacteria 6260
143 Ga0070671_100016884 3300005355 Bacteria 5906
144 Ga0070671_100041223 3300005355 Bacteria 3837
145 Ga0070671_100114964 3300005355 Bacteria 2262
146 Ga0070674_100003200 3300005356 Bacteria 9130
147 Ga0070674_100003367 3300005356 Bacteria 8959
148 Ga0070674_100051126 3300005356 Bacteria 2847
149 Ga0070673_100000047 3300005364 Bacteria 50070
150 Ga0070673_100006160 3300005364 Bacteria 7772
151 Ga0070673_100018722 3300005364 Bacteria 4956
152 Ga0070673_100035764 3300005364 Bacteria 3769
153 Ga0070673_100178991 3300005364 Bacteria 1814
154 Ga0070673_100436710 3300005364 Bacteria 1176
155 Ga0070659_100000005 3300005366 Bacteria 259902
156 Ga0070659_100004006 3300005366 Bacteria 10482
157 Ga0070659_100007944 3300005366 Bacteria 7729
158 Ga0070659_100019152 3300005366 Bacteria 5179
159 Ga0070659_100027682 3300005366 Bacteria 4369
160 Ga0070659_100068801 3300005366 Bacteria 2809
161 Ga0070659_100115301 3300005366 Bacteria 2171
162 Ga0070659_100117057 3300005366 Bacteria 2155
163 Ga0070659_100120593 3300005366 Bacteria 2124
164 Ga0070659_100125475 3300005366 Bacteria 2082
165 Ga0070667_100000035 3300005367 Bacteria 173461
166 Ga0070667_100000089 3300005367 Bacteria 113661
167 Ga0070667_100005092 3300005367 Bacteria 11004
168 Ga0070667_100012916 3300005367 Bacteria 6902
169 Ga0070667_100014340 3300005367 Bacteria 6550
170 Ga0070667_100022265 3300005367 Bacteria 5258
171 Ga0070667_100023510 3300005367 Bacteria 5114
172 Ga0070667_100029928 3300005367 Bacteria 4540
173 Ga0070667_100039833 3300005367 Bacteria 3939
174 Ga0070667_100079713 3300005367 Bacteria 2800
175 Ga0070705_100003446 3300005440 Bacteria 7759
176 Ga0070694_100034881 3300005444 Bacteria 3321
177 Ga0070663_100005176 3300005455 Bacteria 7723
178 Ga0070663_100017609 3300005455 Bacteria 4667
179 Ga0070663_100122022 3300005455 Bacteria 1969
180 Ga0070663_100249401 3300005455 Bacteria 1404
181 Ga0070678_100000636 3300005456 Bacteria 17176
182 Ga0070678_100052058 3300005456 Bacteria 2971
183 Ga0070662_100115782 3300005457 Bacteria 2048
184 Ga0070681_10030827 3300005458 Bacteria 5382
185 Ga0070681_10053958 3300005458 Bacteria 4005
186 Ga0070681_10076524 3300005458 Bacteria 3304
187 Ga0070681_10280189 3300005458 Bacteria 1578
188 Ga0068867_100000119 3300005459 Bacteria 50149
189 Ga0068867_100078814 3300005459 Bacteria 2478
190 Ga0070679_100120739 3300005530 Bacteria 2606
191 Ga0070679_100125251 3300005530 Bacteria 2552
192 Ga0070679_100196527 3300005530 Bacteria 1984
193 Ga0070679_100404038 3300005530 Bacteria 1312
194 Ga0070684_100001970 3300005535 Bacteria 15086
195 Ga0068853_100000181 3300005539 Bacteria 44176
196 Ga0068853_100009279 3300005539 Bacteria 7933
197 Ga0068853_100013443 3300005539 Bacteria 6682
198 Ga0068853_100023982 3300005539 Bacteria 5114
199 Ga0068853_100030853 3300005539 Bacteria 4529
200 Ga0068853_100033970 3300005539 Bacteria 4327
201 Ga0068853_100076818 3300005539 Bacteria 2917
202 Ga0068853_100091868 3300005539 Bacteria 2670
203 Ga0068853_100247384 3300005539 Bacteria 1635
204 Ga0070672_100024461 3300005543 Bacteria 4465
205 Ga0070686_100000884 3300005544 Bacteria 17414
206 Ga0070695_100015510 3300005545 Bacteria 4602
207 Ga0070696_100000325 3300005546 Bacteria 28995
208 Ga0070696_100025395 3300005546 Bacteria 4028
209 Ga0070693_100054683 3300005547 Bacteria 2297
210 Ga0070665_100000067 3300005548 Bacteria 204787
211 Ga0070665_100000148 3300005548 Bacteria 128573
212 Ga0070665_100008797 3300005548 Bacteria 10219
213 Ga0070665_100010552 3300005548 Bacteria 9349
214 Ga0070665_100039812 3300005548 Bacteria 4725
215 Ga0070665_100039844 3300005548 Bacteria 4723
216 Ga0070665_100041106 3300005548 Bacteria 4646
217 Ga0070665_100071179 3300005548 Bacteria 3484
218 Ga0070665_100074754 3300005548 Bacteria 3394
219 Ga0070665_100103312 3300005548 Bacteria 2853
220 Ga0070665_100353004 3300005548 Bacteria 1476
221 Ga0068855_100000207 3300005563 Bacteria 75310
222 Ga0068855_100000468 3300005563 Bacteria 49550
223 Ga0068855_100128226 3300005563 Bacteria 2899
224 Ga0068855_100150706 3300005563 Bacteria 2645
225 Ga0068855_100199379 3300005563 Bacteria 2254
226 Ga0068855_100218568 3300005563 Bacteria 2138
227 Ga0068855_100283884 3300005563 Bacteria 1837
228 Ga0068855_100305039 3300005563 Bacteria 1763
229 Ga0068855_100336688 3300005563 Bacteria 1665
230 Ga0068855_100634770 3300005563 Bacteria 1149
231 Ga0070664_100005465 3300005564 Bacteria 10201
232 Ga0070664_100011359 3300005564 Bacteria 7225
233 Ga0070664_100011682 3300005564 Bacteria 7126
234 Ga0070664_100071906 3300005564 Bacteria 2965
235 Ga0070664_100074109 3300005564 Bacteria 2921
236 Ga0070664_100101369 3300005564 Bacteria 2504
237 Ga0070664_100180736 3300005564 Bacteria 1875
238 Ga0070664_100279813 3300005564 Bacteria 1504
239 Ga0068857_100016562 3300005577 Bacteria 6458
240 Ga0068857_100052526 3300005577 Bacteria 3616
241 Ga0068857_100102730 3300005577 Bacteria 2566
242 Ga0068857_100216769 3300005577 Bacteria 1747
243 Ga0068857_100239755 3300005577 Bacteria 1660
244 Ga0068854_100000874 3300005578 Bacteria 18073
245 Ga0068854_100001419 3300005578 Bacteria 14478
246 Ga0068854_100002336 3300005578 Bacteria 11699
247 Ga0068854_100010980 3300005578 Bacteria 5877
248 Ga0068854_100016007 3300005578 Bacteria 4987
249 Ga0068854_100053156 3300005578 Bacteria 2907
250 Ga0068854_100087547 3300005578 Bacteria 2311
251 Ga0068854_100143193 3300005578 Bacteria 1836
252 Ga0068854_100385002 3300005578 Bacteria 1157
253 Ga0068856_100004000 3300005614 Bacteria 14763
254 Ga0068856_100022632 3300005614 Bacteria 6110
255 Ga0068856_100165255 3300005614 Bacteria 2224
256 Ga0068856_100206084 3300005614 Bacteria 1981
257 Ga0068856_100262852 3300005614 Bacteria 1741
258 Ga0068852_100005304 3300005616 Bacteria 9200
259 Ga0068852_100005418 3300005616 Bacteria 9127
260 Ga0068852_100094326 3300005616 Bacteria 2684
261 Ga0068852_100154739 3300005616 Bacteria 2135
262 Ga0068852_100729260 3300005616 Bacteria 1002
263 Ga0068859_100000104 3300005617 Bacteria 78653
264 Ga0068859_100000286 3300005617 Bacteria 50373
265 Ga0068859_100002190 3300005617 Bacteria 19848
266 Ga0068859_100002837 3300005617 Bacteria 17580
267 Ga0068859_100009889 3300005617 Bacteria 9633
268 Ga0068859_100013205 3300005617 Bacteria 8291
269 Ga0068859_100019147 3300005617 Bacteria 6875
270 Ga0068859_100024626 3300005617 Bacteria 6039
271 Ga0068859_100064186 3300005617 Bacteria 3704
272 Ga0068859_100076580 3300005617 Bacteria 3386
273 Ga0068859_100120161 3300005617 Bacteria 2694
274 Ga0068864_100000042 3300005618 Bacteria 162930
275 Ga0068864_100000118 3300005618 Bacteria 77800
276 Ga0068864_100002169 3300005618 Bacteria 16205
277 Ga0068864_100003096 3300005618 Bacteria 13743
278 Ga0068864_100003259 3300005618 Bacteria 13416
279 Ga0068864_100008581 3300005618 Bacteria 8435
280 Ga0068864_100017649 3300005618 Bacteria 5951
281 Ga0068864_100018007 3300005618 Bacteria 5895
282 Ga0068864_100141363 3300005618 Bacteria 2171
283 Ga0068866_10063726 3300005718 Bacteria 1922
284 Ga0068866_10156508 3300005718 Bacteria 1325
285 Ga0068861_100000109 3300005719 Bacteria 41453
286 Ga0068861_100007704 3300005719 Bacteria 7393
287 Ga0068861_100105187 3300005719 Bacteria 2253
288 Ga0068861_100167586 3300005719 Bacteria 1818
289 Ga0068861_100298103 3300005719 Bacteria 1395
290 Ga0068851_10020234 3300005834 Bacteria 3220
291 Ga0068863_100000152 3300005841 Bacteria 72823
292 Ga0068863_100000186 3300005841 Bacteria 65963
293 Ga0068863_100001950 3300005841 Bacteria 20502
294 Ga0068863_100003849 3300005841 Bacteria 14841
295 Ga0068863_100004680 3300005841 Bacteria 13485
296 Ga0068863_100015933 3300005841 Bacteria 7210
297 Ga0068863_100019579 3300005841 Bacteria 6473
298 Ga0068863_100020111 3300005841 Bacteria 6386
299 Ga0068863_100040042 3300005841 Bacteria 4456
300 Ga0068863_100066623 3300005841 Bacteria 3406
301 Ga0068863_100066670 3300005841 Bacteria 3405
302 Ga0068858_100000274 3300005842 Bacteria 55319
303 Ga0068858_100000561 3300005842 Bacteria 38777
304 Ga0068858_100000723 3300005842 Bacteria 34436
305 Ga0068858_100012034 3300005842 Bacteria 8155
306 Ga0068858_100014401 3300005842 Bacteria 7457
307 Ga0068858_100025676 3300005842 Bacteria 5481
308 Ga0068860_100000106 3300005843 Bacteria 133556
309 Ga0068860_100000148 3300005843 Bacteria 113661
310 Ga0068860_100003623 3300005843 Bacteria 15881
311 Ga0068860_100004806 3300005843 Bacteria 13753
312 Ga0068860_100007728 3300005843 Bacteria 10747
313 Ga0068860_100009573 3300005843 Bacteria 9627
314 Ga0068860_100072001 3300005843 Bacteria 3284
315 Ga0068862_100000005 3300005844 Bacteria 350713
316 Ga0068862_100000014 3300005844 Bacteria 251552
317 Ga0068862_100000714 3300005844 Bacteria 33769
318 Ga0068862_100001201 3300005844 Bacteria 24437
319 Ga0068862_100002361 3300005844 Bacteria 16806
320 Ga0068862_100002421 3300005844 Bacteria 16567
321 Ga0068862_100014819 3300005844 Bacteria 6475
322 Ga0068862_100026085 3300005844 Bacteria 4912
323 Ga0068862_100028111 3300005844 Bacteria 4736
324 Ga0068862_100090943 3300005844 Bacteria 2657
325 Ga0068862_100139938 3300005844 Bacteria 2147
326 Ga0081539_10046059 3300005985 Bacteria 2502
327 Ga0075363_100037474 3300006048 Bacteria 2547
328 Ga0075364_10196977 3300006051 Bacteria 1365
329 Ga0075367_10012146 3300006178 Bacteria 4581
330 Ga0075366_10063278 3300006195 Bacteria 2199
331 Ga0075366_10100927 3300006195 Bacteria 1732
332 Ga0097621_100051110 3300006237 Bacteria 3363
333 Ga0097621_100082125 3300006237 Bacteria 2683
334 Ga0097621_100273498 3300006237 Bacteria 1485
335 Ga0075370_10050943 3300006353 Bacteria 2349
336 Ga0075370_10054405 3300006353 Bacteria 2273
337 Ga0068871_100012676 3300006358 Bacteria 6227
338 Ga0068871_100051342 3300006358 Bacteria 3338
339 Ga0068871_100500398 3300006358 Bacteria 1095
340 Ga0075428_100442091 3300006844 Bacteria 1393
341 Ga0075434_100166593 3300006871 Bacteria 2224
342 Ga0068865_100000005 3300006881 Bacteria 213248
343 Ga0068865_100171660 3300006881 Bacteria 1663
344 Ga0097620_100000104 3300006931 Bacteria 78653
345 Ga0097620_100000286 3300006931 Bacteria 50373
346 Ga0097620_100002190 3300006931 Bacteria 19848
347 Ga0097620_100002837 3300006931 Bacteria 17580
348 Ga0097620_100009888 3300006931 Bacteria 9633
349 Ga0097620_100013205 3300006931 Bacteria 8291
350 Ga0097620_100019145 3300006931 Bacteria 6875
351 Ga0097620_100024626 3300006931 Bacteria 6039
352 Ga0097620_100064190 3300006931 Bacteria 3704
353 Ga0097620_100076580 3300006931 Bacteria 3386
354 Ga0097620_100120158 3300006931 Bacteria 2694
355 Ga0105251_10033964 3300009011 Bacteria 2528
356 Ga0105250_10026890 3300009092 Bacteria 2318
357 Ga0105240_10001296 3300009093 Bacteria 43229
358 Ga0105240_10127643 3300009093 Bacteria 3054
359 Ga0105240_10251832 3300009093 Bacteria 2042
360 Ga0105240_10262200 3300009093 Bacteria 1993
361 Ga0105240_10273647 3300009093 Bacteria 1943
362 Ga0111539_10096650 3300009094 Bacteria 3469
363 Ga0105245_10000281 3300009098 Bacteria 48386
364 Ga0105245_10001668 3300009098 Bacteria 20218
365 Ga0105245_10030282 3300009098 Bacteria 4785
366 Ga0105247_10000465 3300009101 Bacteria 34000
367 Ga0105247_10000830 3300009101 Bacteria 23517
368 Ga0114129_10380427 3300009147 Bacteria 1864
369 Ga0105243_10000411 3300009148 Bacteria 44928
370 Ga0105243_10003479 3300009148 Bacteria 12715
371 Ga0105243_10013311 3300009148 Bacteria 6221
372 Ga0105243_10102179 3300009148 Bacteria 2382
373 Ga0105241_10003317 3300009174 Bacteria 11976
374 Ga0105241_10164866 3300009174 Bacteria 1825
375 Ga0105241_10209566 3300009174 Bacteria 1632
376 Ga0105241_10213212 3300009174 Bacteria 1619
377 Ga0105242_10001969 3300009176 Bacteria 16156
378 Ga0105242_10063280 3300009176 Bacteria 3047
379 Ga0105248_10000171 3300009177 Bacteria 75565
380 Ga0105248_10000295 3300009177 Bacteria 59247
381 Ga0105248_10000626 3300009177 Bacteria 40130
382 Ga0105248_10013669 3300009177 Bacteria 8936
383 Ga0105248_10045875 3300009177 Bacteria 4899
384 Ga0105248_10058317 3300009177 Bacteria 4335
385 Ga0105248_10105335 3300009177 Bacteria 3180
386 Ga0105248_10502025 3300009177 Bacteria 1368
387 Ga0105248_10547821 3300009177 Bacteria 1305
388 Ga0105237_10004686 3300009545 Bacteria 15740
389 Ga0105237_10022015 3300009545 Bacteria 6542
390 Ga0105237_10036941 3300009545 Bacteria 4939
391 Ga0105237_10066353 3300009545 Bacteria 3604
392 Ga0105237_10068401 3300009545 Bacteria 3545
393 Ga0105238_10002027 3300009551 Bacteria 20446
394 Ga0105238_10096439 3300009551 Bacteria 2943
395 Ga0105238_10098405 3300009551 Bacteria 2909
396 Ga0105238_10134776 3300009551 Bacteria 2447
397 Ga0105238_10505608 3300009551 Bacteria 1210
398 Ga0105238_10520312 3300009551 Bacteria 1192
399 Ga0105249_10000002 3300009553 Bacteria 376207
400 Ga0105249_10003111 3300009553 Bacteria 14339
401 Ga0105249_10006352 3300009553 Bacteria 10274
402 Ga0105249_10009826 3300009553 Bacteria 8385
403 Ga0105249_10033704 3300009553 Bacteria 4637
404 Ga0105249_10051833 3300009553 Bacteria 3745
405 Ga0105249_10077586 3300009553 Bacteria 3081
406 Ga0105249_10116167 3300009553 Bacteria 2536
407 Ga0105148_100047 3300009978 Bacteria 18470
408 Ga0105239_10000266 3300010375 Bacteria 77602
409 Ga0105239_10085122 3300010375 Bacteria 3484
410 Ga0105239_10110126 3300010375 Bacteria 3052
411 Ga0105246_10002967 3300011119 Bacteria 10282
412 Ga0105246_10039643 3300011119 Bacteria 3175
413 Ga0157326_1000559 3300012513 Bacteria 4412
414 Ga0157373_10009957 3300013100 Bacteria 7005
415 Ga0157373_10010481 3300013100 Bacteria 6819
416 Ga0157373_10013343 3300013100 Bacteria 6027
417 Ga0157373_10022838 3300013100 Bacteria 4536
418 Ga0157373_10092834 3300013100 Bacteria 2126
419 Ga0157373_10162908 3300013100 Bacteria 1569
420 Ga0157373_10165562 3300013100 Bacteria 1556
421 Ga0157371_10000062 3300013102 Bacteria 169669
422 Ga0157371_10040988 3300013102 Bacteria 3306
423 Ga0157371_10087118 3300013102 Bacteria 2211
424 Ga0157371_10160058 3300013102 Bacteria 1608
425 Ga0157371_10174668 3300013102 Bacteria 1536
426 Ga0157370_10000611 3300013104 Bacteria 44454
427 Ga0157370_10056321 3300013104 Bacteria 3742
428 Ga0157370_10069540 3300013104 Bacteria 3325
429 Ga0157370_10069936 3300013104 Bacteria 3315
430 Ga0157370_10237542 3300013104 Bacteria 1686
431 Ga0157369_10004697 3300013105 Bacteria 16061
432 Ga0157369_10034579 3300013105 Bacteria 5545
433 Ga0157369_10362366 3300013105 Bacteria 1505
434 Ga0157374_10001017 3300013296 Bacteria 24339
435 Ga0157374_10127707 3300013296 Bacteria 2458
436 Ga0157378_10001127 3300013297 Bacteria 24339
437 Ga0157378_10005257 3300013297 Bacteria 11373
438 Ga0163162_10014044 3300013306 Bacteria 7827
439 Ga0163162_10045213 3300013306 Bacteria 4411
440 Ga0163162_10128767 3300013306 Bacteria 2639
441 Ga0163162_10275917 3300013306 Bacteria 1813
442 Ga0163162_10365752 3300013306 Bacteria 1575
443 Ga0163162_10629872 3300013306 Bacteria 1197
444 Ga0157372_10023486 3300013307 Bacteria 6685
445 Ga0157372_10024302 3300013307 Bacteria 6580
446 Ga0157372_10049722 3300013307 Bacteria 4663
447 Ga0157372_10406939 3300013307 Bacteria 1585
448 Ga0157372_10427514 3300013307 Bacteria 1544
449 Ga0157372_10509123 3300013307 Bacteria 1404
450 Ga0157372_10580103 3300013307 Bacteria 1307
451 Ga0157372_10611976 3300013307 Bacteria 1270
452 Ga0157375_10002160 3300013308 Bacteria 17001
453 Ga0157375_10448862 3300013308 Bacteria 1455
454 Ga0157375_10625967 3300013308 Bacteria 1234
455 Ga0163163_10000882 3300014325 Bacteria 25516
456 Ga0163163_10027458 3300014325 Bacteria 5453
457 Ga0163163_10048402 3300014325 Bacteria 4180
458 Ga0163163_10269882 3300014325 Bacteria 1753
459 Ga0157380_10000030 3300014326 Bacteria 91258
460 Ga0157380_10000365 3300014326 Bacteria 27217
461 Ga0157380_10004840 3300014326 Bacteria 9382
462 Ga0157380_10074108 3300014326 Bacteria 2762
463 Ga0157380_10079645 3300014326 Bacteria 2676
464 Ga0157380_10098239 3300014326 Bacteria 2432
465 Ga0157380_10108341 3300014326 Bacteria 2329
466 Ga0157379_10003869 3300014968 Bacteria 12761
467 Ga0157379_10004680 3300014968 Bacteria 11746
468 Ga0157379_10025399 3300014968 Bacteria 5263
469 Ga0157376_10001892 3300014969 Bacteria 13979
470 Ga0183363_1003 3300015690 Bacteria 421263
471 Ga0206356_10373769 3300020070 Bacteria 1626
472 Ga0206356_10882194 3300020070 Bacteria 2156
473 Ga0206353_10996392 3300020082 Bacteria 1879
474 Ga0206353_12001773 3300020082 Bacteria 2559
475 Ga0213876_10007008 3300021384 Bacteria 6147
476 Ga0213875_10000636 3300021388 Bacteria 28040
477 Ga0209563_100024 3300025230 Bacteria 601155
478 Ga0207427_101779 3300025231 Bacteria 6987
479 Ga0209437_104987 3300025233 Bacteria 2293
480 Ga0207425_1000005 3300025245 Bacteria 900502
481 Ga0209026_1002697 3300025250 Bacteria 6409
482 Ga0209148_1000008 3300025254 Bacteria 1504371
483 Ga0209148_1000301 3300025254 Bacteria 71452
484 Ga0209148_1001740 3300025254 Bacteria 9482
485 Ga0209129_1000345 3300025258 Bacteria 39677
486 Ga0209233_1000003 3300025261 Bacteria 1607366
487 Ga0209233_1000044 3300025261 Bacteria 489783
488 Ga0209565_1000010 3300025263 Bacteria 687724
489 Ga0209565_1000029 3300025263 Bacteria 340335
490 Ga0209565_1000052 3300025263 Bacteria 212056
491 Ga0209565_1009556 3300025263 Bacteria 2454
492 Ga0209455_1000002 3300025272 Bacteria 1505459
493 Ga0209455_1000467 3300025272 Bacteria 30363
494 Ga0209455_1004431 3300025272 Bacteria 4602
495 Ga0209673_1002171 3300025273 Bacteria 14487
496 Ga0209673_1002668 3300025273 Bacteria 11894
497 Ga0209676_1005902 3300025292 Bacteria 6217
498 Ga0209025_1000855 3300025294 Bacteria 48253
499 Ga0209564_1000866 3300025295 Bacteria 40332
500 Ga0209564_1012788 3300025295 Bacteria 3627
501 Ga0209758_1000002 3300025297 Bacteria 1400310
502 Ga0209758_1000007 3300025297 Bacteria 1270410
503 Ga0209758_1025935 3300025297 Bacteria 2556
504 Ga0209050_1000001 3300025298 Bacteria 3563507
505 Ga0209050_1000167 3300025298 Bacteria 151608
506 Ga0209050_1007940 3300025298 Bacteria 5812
507 Ga0209256_1000008 3300025299 Bacteria 975723
508 Ga0209256_1000012 3300025299 Bacteria 790371
509 Ga0209051_1000297 3300025303 Bacteria 79062
510 Ga0209257_1000028 3300025304 Bacteria 699493
511 Ga0209257_1002251 3300025304 Bacteria 19776
512 Ga0209257_1002675 3300025304 Bacteria 17088
513 Ga0209257_1002709 3300025304 Bacteria 16888
514 Ga0209257_1024069 3300025304 Bacteria 2119
515 Ga0207697_10000105 3300025315 Bacteria 38611
516 Ga0207697_10042941 3300025315 Bacteria 1858
517 Ga0207656_10031488 3300025321 Bacteria 2198
518 Ga0207656_10115232 3300025321 Bacteria 1246
519 Ga0207713_1027124 3300025735 Bacteria 2608
520 Ga0207682_10000970 3300025893 Bacteria 13250
521 Ga0207710_10010965 3300025900 Bacteria 3818
522 Ga0207710_10023316 3300025900 Bacteria 2659
523 Ga0207688_10066523 3300025901 Bacteria 2039
524 Ga0207688_10087546 3300025901 Bacteria 1786
525 Ga0207688_10088204 3300025901 Bacteria 1779
526 Ga0207680_10000299 3300025903 Bacteria 23555
527 Ga0207680_10056507 3300025903 Bacteria 2370
528 Ga0207647_10000643 3300025904 Bacteria 27280
529 Ga0207647_10002316 3300025904 Bacteria 14493
530 Ga0207647_10002797 3300025904 Bacteria 13162
531 Ga0207647_10003935 3300025904 Bacteria 11093
532 Ga0207647_10014925 3300025904 Bacteria 5338
533 Ga0207647_10041875 3300025904 Bacteria 2877
534 Ga0207647_10091413 3300025904 Bacteria 1815
535 Ga0207645_10002875 3300025907 Bacteria 13324
536 Ga0207645_10015633 3300025907 Bacteria 5035
537 Ga0207645_10093955 3300025907 Bacteria 1930
538 Ga0207645_10174161 3300025907 Bacteria 1411
539 Ga0207705_10000046 3300025909 Bacteria 177574
540 Ga0207705_10000181 3300025909 Bacteria 66244
541 Ga0207705_10000299 3300025909 Bacteria 46209
542 Ga0207705_10002601 3300025909 Bacteria 13872
543 Ga0207705_10006485 3300025909 Bacteria 8669
544 Ga0207705_10026336 3300025909 Bacteria 4147
545 Ga0207705_10034863 3300025909 Bacteria 3599
546 Ga0207705_10036465 3300025909 Bacteria 3519
547 Ga0207705_10083029 3300025909 Bacteria 2337
548 Ga0207705_10188398 3300025909 Bacteria 1559
549 Ga0207705_10204979 3300025909 Bacteria 1495
550 Ga0207654_10000741 3300025911 Bacteria 18127
551 Ga0207707_10053752 3300025912 Bacteria 3506
552 Ga0207707_10172064 3300025912 Bacteria 1893
553 Ga0207707_10274134 3300025912 Bacteria 1462
554 Ga0207707_10282574 3300025912 Bacteria 1437
555 Ga0207695_10000516 3300025913 Bacteria 81914
556 Ga0207695_10007459 3300025913 Bacteria 13900
557 Ga0207695_10012484 3300025913 Bacteria 10195
558 Ga0207695_10022835 3300025913 Bacteria 7087
559 Ga0207695_10141239 3300025913 Bacteria 2356
560 Ga0207695_10247953 3300025913 Bacteria 1681
561 Ga0207671_10019676 3300025914 Bacteria 5157
562 Ga0207671_10020388 3300025914 Bacteria 5045
563 Ga0207671_10031862 3300025914 Bacteria 3925
564 Ga0207660_10002059 3300025917 Bacteria 13360
565 Ga0207660_10016210 3300025917 Bacteria 4930
566 Ga0207660_10030179 3300025917 Bacteria 3725
567 Ga0207660_10201067 3300025917 Bacteria 1556
568 Ga0207660_10292345 3300025917 Bacteria 1296
569 Ga0207657_10001108 3300025919 Bacteria 28597
570 Ga0207657_10002117 3300025919 Bacteria 21474
571 Ga0207657_10003558 3300025919 Bacteria 16624
572 Ga0207657_10004994 3300025919 Bacteria 13945
573 Ga0207657_10005570 3300025919 Bacteria 13151
574 Ga0207657_10007755 3300025919 Bacteria 10963
575 Ga0207657_10038901 3300025919 Bacteria 4229
576 Ga0207657_10046247 3300025919 Bacteria 3813
577 Ga0207657_10049022 3300025919 Bacteria 3684
578 Ga0207657_10109844 3300025919 Bacteria 2278
579 Ga0207657_10126224 3300025919 Bacteria 2101
580 Ga0207657_10167370 3300025919 Bacteria 1782
581 Ga0207649_10020563 3300025920 Bacteria 3786
582 Ga0207649_10034748 3300025920 Bacteria 3023
583 Ga0207649_10061294 3300025920 Bacteria 2367
584 Ga0207649_10120262 3300025920 Bacteria 1770
585 Ga0207652_10082118 3300025921 Bacteria 2820
586 Ga0207652_10093551 3300025921 Bacteria 2645
587 Ga0207652_10126857 3300025921 Bacteria 2273
588 Ga0207652_10130312 3300025921 Bacteria 2243
589 Ga0207652_10150879 3300025921 Bacteria 2081
590 Ga0207652_10171552 3300025921 Bacteria 1947
591 Ga0207652_10398027 3300025921 Bacteria 1243
592 Ga0207652_10428955 3300025921 Bacteria 1192
593 Ga0207652_10523714 3300025921 Bacteria 1066
594 Ga0207681_10000003 3300025923 Bacteria 713245
595 Ga0207681_10000010 3300025923 Bacteria 403379
596 Ga0207681_10000049 3300025923 Bacteria 120296
597 Ga0207681_10029445 3300025923 Bacteria 3567
598 Ga0207681_10061664 3300025923 Bacteria 2579
599 Ga0207681_10287104 3300025923 Bacteria 1297
600 Ga0207681_10444687 3300025923 Bacteria 1054
601 Ga0207681_10447058 3300025923 Bacteria 1051
602 Ga0207694_10066128 3300025924 Bacteria 2820
603 Ga0207694_10082193 3300025924 Bacteria 2532
604 Ga0207694_10367958 3300025924 Bacteria 1192
605 Ga0207650_10000012 3300025925 Bacteria 437889
606 Ga0207650_10012956 3300025925 Bacteria 5765
607 Ga0207650_10035436 3300025925 Bacteria 3624
608 Ga0207650_10038261 3300025925 Bacteria 3502
609 Ga0207650_10038930 3300025925 Bacteria 3474
610 Ga0207650_10075913 3300025925 Bacteria 2538
611 Ga0207650_10077064 3300025925 Bacteria 2520
612 Ga0207650_10105107 3300025925 Bacteria 2179
613 Ga0207650_10195318 3300025925 Bacteria 1619
614 Ga0207650_10214693 3300025925 Bacteria 1546
615 Ga0207659_10013860 3300025926 Bacteria 5181
616 Ga0207659_10019949 3300025926 Bacteria 4423
617 Ga0207659_10066375 3300025926 Bacteria 2618
618 Ga0207659_10071154 3300025926 Bacteria 2539
619 Ga0207659_10260604 3300025926 Bacteria 1410
620 Ga0207687_10010131 3300025927 Bacteria 6163
621 Ga0207687_10049796 3300025927 Bacteria 2914
622 Ga0207700_10138279 3300025928 Bacteria 1998
623 Ga0207644_10000007 3300025931 Bacteria 381778
624 Ga0207644_10000032 3300025931 Bacteria 133759
625 Ga0207644_10000052 3300025931 Bacteria 91473
626 Ga0207644_10000069 3300025931 Bacteria 75201
627 Ga0207644_10066824 3300025931 Bacteria 2619
628 Ga0207644_10112012 3300025931 Bacteria 2065
629 Ga0207644_10223483 3300025931 Bacteria 1493
630 Ga0207690_10000020 3300025932 Bacteria 218439
631 Ga0207690_10001383 3300025932 Bacteria 15243
632 Ga0207690_10016682 3300025932 Bacteria 4473
633 Ga0207690_10076960 3300025932 Bacteria 2318
634 Ga0207690_10107485 3300025932 Bacteria 2004
635 Ga0207690_10162215 3300025932 Bacteria 1667
636 Ga0207690_10170013 3300025932 Bacteria 1632
637 Ga0207690_10328257 3300025932 Bacteria 1204
638 Ga0207706_10003116 3300025933 Bacteria 15944
639 Ga0207706_10021858 3300025933 Bacteria 5742
640 Ga0207706_10026051 3300025933 Bacteria 5236
641 Ga0207706_10041512 3300025933 Bacteria 4078
642 Ga0207706_10041713 3300025933 Bacteria 4068
643 Ga0207706_10052489 3300025933 Bacteria 3599
644 Ga0207706_10066126 3300025933 Bacteria 3182
645 Ga0207706_10292387 3300025933 Bacteria 1420
646 Ga0207686_10005035 3300025934 Bacteria 7110
647 Ga0207709_10000005 3300025935 Bacteria 806813
648 Ga0207709_10000051 3300025935 Bacteria 227968
649 Ga0207709_10017408 3300025935 Bacteria 4011
650 Ga0207670_10145285 3300025936 Bacteria 1753
651 Ga0207669_10000742 3300025937 Bacteria 14150
652 Ga0207669_10001774 3300025937 Bacteria 9151
653 Ga0207669_10028122 3300025937 Bacteria 3089
654 Ga0207669_10057581 3300025937 Bacteria 2367
655 Ga0207704_10000001 3300025938 Bacteria 716296
656 Ga0207691_10011367 3300025940 Bacteria 8544
657 Ga0207691_10036585 3300025940 Bacteria 4549
658 Ga0207691_10040846 3300025940 Bacteria 4285
659 Ga0207691_10087562 3300025940 Bacteria 2794
660 Ga0207691_10088679 3300025940 Bacteria 2774
661 Ga0207691_10379635 3300025940 Bacteria 1207
662 Ga0207711_10000153 3300025941 Bacteria 73814
663 Ga0207711_10001371 3300025941 Bacteria 22952
664 Ga0207711_10011668 3300025941 Bacteria 7300
665 Ga0207711_10055660 3300025941 Bacteria 3396
666 Ga0207711_10089499 3300025941 Bacteria 2705
667 Ga0207711_10165514 3300025941 Bacteria 2004
668 Ga0207711_10172504 3300025941 Bacteria 1963
669 Ga0207711_10327237 3300025941 Bacteria 1417
670 Ga0207711_10459114 3300025941 Bacteria 1186
671 Ga0207689_10005027 3300025942 Bacteria 11917
672 Ga0207689_10093499 3300025942 Bacteria 2470
673 Ga0207689_10105177 3300025942 Bacteria 2319
674 Ga0207661_10016501 3300025944 Bacteria 5450
675 Ga0207661_10089152 3300025944 Bacteria 2565
676 Ga0207661_10303553 3300025944 Bacteria 1432
677 Ga0207679_10170520 3300025945 Bacteria 1791
678 Ga0207679_10202423 3300025945 Bacteria 1659
679 Ga0207679_10214166 3300025945 Bacteria 1617
680 Ga0207679_10235480 3300025945 Bacteria 1548
681 Ga0207667_10000024 3300025949 Bacteria 355874
682 Ga0207667_10000852 3300025949 Bacteria 39321
683 Ga0207667_10002816 3300025949 Bacteria 21561
684 Ga0207667_10220220 3300025949 Bacteria 1944
685 Ga0207667_10272166 3300025949 Bacteria 1731
686 Ga0207651_10000006 3300025960 Bacteria 227893
687 Ga0207651_10050762 3300025960 Bacteria 2819
688 Ga0207651_10073534 3300025960 Bacteria 2431
689 Ga0207651_10131110 3300025960 Bacteria 1919
690 Ga0207651_10223588 3300025960 Bacteria 1523
691 Ga0207712_10000002 3300025961 Bacteria 706628
692 Ga0207712_10002585 3300025961 Bacteria 11625
693 Ga0207712_10010885 3300025961 Bacteria 5789
694 Ga0207712_10030000 3300025961 Bacteria 3654
695 Ga0207712_10237933 3300025961 Bacteria 1465
696 Ga0207712_10322510 3300025961 Bacteria 1275
697 Ga0207668_10000006 3300025972 Bacteria 191468
698 Ga0207668_10000034 3300025972 Bacteria 119274
699 Ga0207668_10000321 3300025972 Bacteria 31112
700 Ga0207668_10002255 3300025972 Bacteria 11242
701 Ga0207668_10006614 3300025972 Bacteria 6855
702 Ga0207668_10008868 3300025972 Bacteria 6014
703 Ga0207668_10010065 3300025972 Bacteria 5695
704 Ga0207668_10022336 3300025972 Bacteria 4049
705 Ga0207668_10070992 3300025972 Bacteria 2486
706 Ga0207668_10075528 3300025972 Bacteria 2423
707 Ga0207640_10000109 3300025981 Bacteria 62407
708 Ga0207640_10006284 3300025981 Bacteria 6515
709 Ga0207640_10009825 3300025981 Bacteria 5367
710 Ga0207640_10012181 3300025981 Bacteria 4892
711 Ga0207640_10013565 3300025981 Bacteria 4676
712 Ga0207640_10020357 3300025981 Bacteria 3938
713 Ga0207640_10028939 3300025981 Bacteria 3394
714 Ga0207640_10118678 3300025981 Bacteria 1890
715 Ga0207640_10124510 3300025981 Bacteria 1853
716 Ga0207658_10000026 3300025986 Bacteria 178292
717 Ga0207658_10000069 3300025986 Bacteria 113687
718 Ga0207658_10003813 3300025986 Bacteria 10610
719 Ga0207658_10004121 3300025986 Bacteria 10137
720 Ga0207658_10016310 3300025986 Bacteria 5109
721 Ga0207658_10020099 3300025986 Bacteria 4623
722 Ga0207658_10020601 3300025986 Bacteria 4566
723 Ga0207658_10034220 3300025986 Bacteria 3629
724 Ga0207658_10102527 3300025986 Bacteria 2244
725 Ga0207658_10162940 3300025986 Bacteria 1829
726 Ga0207677_10000156 3300026023 Bacteria 54081
727 Ga0207677_10012718 3300026023 Bacteria 4852
728 Ga0207703_10001033 3300026035 Bacteria 26717
729 Ga0207703_10002370 3300026035 Bacteria 16383
730 Ga0207703_10003077 3300026035 Bacteria 14107
731 Ga0207703_10004091 3300026035 Bacteria 12030
732 Ga0207703_10004901 3300026035 Bacteria 10880
733 Ga0207703_10087222 3300026035 Bacteria 2616
734 Ga0207639_10001528 3300026041 Bacteria 15547
735 Ga0207639_10004179 3300026041 Bacteria 9724
736 Ga0207639_10004479 3300026041 Bacteria 9429
737 Ga0207639_10032831 3300026041 Bacteria 3825
738 Ga0207639_10050815 3300026041 Bacteria 3150
739 Ga0207639_10060713 3300026041 Bacteria 2917
740 Ga0207639_10091673 3300026041 Bacteria 2433
741 Ga0207639_10093055 3300026041 Bacteria 2417
742 Ga0207639_10192547 3300026041 Bacteria 1743
743 Ga0207678_10000080 3300026067 Bacteria 78553
744 Ga0207678_10000680 3300026067 Bacteria 31116
745 Ga0207678_10003120 3300026067 Bacteria 15000
746 Ga0207678_10003478 3300026067 Bacteria 14176
747 Ga0207678_10004958 3300026067 Bacteria 11947
748 Ga0207678_10023620 3300026067 Bacteria 5376
749 Ga0207678_10059541 3300026067 Bacteria 3286
750 Ga0207678_10119066 3300026067 Bacteria 2253
751 Ga0207678_10228415 3300026067 Bacteria 1593
752 Ga0207702_10001603 3300026078 Bacteria 22370
753 Ga0207702_10003537 3300026078 Bacteria 14222
754 Ga0207702_10005016 3300026078 Bacteria 11632
755 Ga0207702_10009720 3300026078 Bacteria 8078
756 Ga0207702_10021712 3300026078 Bacteria 5315
757 Ga0207702_10154436 3300026078 Bacteria 2091
758 Ga0207702_10285661 3300026078 Bacteria 1561
759 Ga0207702_10536686 3300026078 Bacteria 1143
760 Ga0207641_10000031 3300026088 Bacteria 224320
761 Ga0207641_10000205 3300026088 Bacteria 78692
762 Ga0207641_10000617 3300026088 Bacteria 38890
763 Ga0207641_10001438 3300026088 Bacteria 23396
764 Ga0207641_10003069 3300026088 Bacteria 15060
765 Ga0207641_10004589 3300026088 Bacteria 11931
766 Ga0207641_10006151 3300026088 Bacteria 10157
767 Ga0207641_10012621 3300026088 Bacteria 6928
768 Ga0207641_10018768 3300026088 Bacteria 5671
769 Ga0207641_10037164 3300026088 Bacteria 4066
770 Ga0207641_10090902 3300026088 Bacteria 2670
771 Ga0207641_10099749 3300026088 Bacteria 2556
772 Ga0207648_10000363 3300026089 Bacteria 50049
773 Ga0207648_10004614 3300026089 Bacteria 14126
774 Ga0207648_10073095 3300026089 Bacteria 2988
775 Ga0207676_10000009 3300026095 Bacteria 545256
776 Ga0207676_10001710 3300026095 Bacteria 16181
777 Ga0207676_10001834 3300026095 Bacteria 15561
778 Ga0207676_10004450 3300026095 Bacteria 9910
779 Ga0207676_10006981 3300026095 Bacteria 8003
780 Ga0207676_10012120 3300026095 Bacteria 6171
781 Ga0207676_10060246 3300026095 Bacteria 3002
782 Ga0207676_10061808 3300026095 Bacteria 2967
783 Ga0207674_10000284 3300026116 Bacteria 64099
784 Ga0207674_10002418 3300026116 Bacteria 23581
785 Ga0207674_10004022 3300026116 Bacteria 17851
786 Ga0207674_10004819 3300026116 Bacteria 16164
787 Ga0207674_10012727 3300026116 Bacteria 9402
788 Ga0207674_10016332 3300026116 Bacteria 8132
789 Ga0207674_10019804 3300026116 Bacteria 7282
790 Ga0207674_10028832 3300026116 Bacteria 5852
791 Ga0207674_10031068 3300026116 Bacteria 5612
792 Ga0207674_10065001 3300026116 Bacteria 3679
793 Ga0207674_10172960 3300026116 Bacteria 2113
794 Ga0207675_100000053 3300026118 Bacteria 82907
795 Ga0207675_100000255 3300026118 Bacteria 50880
796 Ga0207675_100001380 3300026118 Bacteria 24344
797 Ga0207675_100071737 3300026118 Bacteria 3238
798 Ga0207675_100376066 3300026118 Bacteria 1396
799 Ga0207683_10002674 3300026121 Bacteria 15579
800 Ga0207683_10003233 3300026121 Bacteria 14216
801 Ga0207698_10000964 3300026142 Bacteria 16725
802 Ga0207698_10002279 3300026142 Bacteria 11359
803 Ga0207698_10003975 3300026142 Bacteria 8963
804 Ga0207698_10026953 3300026142 Bacteria 4072
805 Ga0207698_10507191 3300026142 Bacteria 1175
806 Ga0209813_10000014 3300027866 Bacteria 87712
807 Ga0209974_10021647 3300027876 Bacteria 2130
808 Ga0209974_10029267 3300027876 Bacteria 1824
809 Ga0268266_10000002 3300028379 Bacteria 3059047
810 Ga0268266_10000626 3300028379 Bacteria 48011
811 Ga0268266_10008582 3300028379 Bacteria 9076
812 Ga0268266_10010736 3300028379 Bacteria 7981
813 Ga0268266_10012663 3300028379 Bacteria 7290
814 Ga0268266_10016041 3300028379 Bacteria 6406
815 Ga0268266_10017080 3300028379 Bacteria 6197
816 Ga0268266_10143703 3300028379 Bacteria 2143
817 Ga0268266_10273355 3300028379 Bacteria 1569
818 Ga0268266_10300108 3300028379 Bacteria 1498
819 Ga0268266_10377681 3300028379 Bacteria 1336
820 Ga0268265_10000001 3300028380 Bacteria 1230727
821 Ga0268265_10000048 3300028380 Bacteria 178523
822 Ga0268265_10000972 3300028380 Bacteria 26208
823 Ga0268265_10001068 3300028380 Bacteria 24459
824 Ga0268265_10001877 3300028380 Bacteria 16711
825 Ga0268265_10005131 3300028380 Bacteria 8967
826 Ga0268265_10008778 3300028380 Bacteria 6828
827 Ga0268265_10010546 3300028380 Bacteria 6239
828 Ga0268265_10025582 3300028380 Bacteria 4192
829 Ga0268265_10130476 3300028380 Bacteria 2087
830 Ga0268265_10149800 3300028380 Bacteria 1966
831 Ga0268265_10251546 3300028380 Bacteria 1565
832 Ga0268264_10000076 3300028381 Bacteria 255518
833 Ga0268264_10000106 3300028381 Bacteria 210031
834 Ga0268264_10000217 3300028381 Bacteria 113674
835 Ga0268264_10000439 3300028381 Bacteria 57339
836 Ga0268264_10000645 3300028381 Bacteria 41090
837 Ga0268264_10003344 3300028381 Bacteria 13863
838 Ga0268264_10046997 3300028381 Bacteria 3587
839 Ga0268264_10131719 3300028381 Bacteria 2218
840 Ga0268264_10172584 3300028381 Bacteria 1957
841 Ga0307517_10001703 3300028786 Bacteria 36321
842 Ga0307515_10288239 3300028794 Bacteria 1341
843 Ga0307513_10021142 3300031456 Bacteria 7688
844 Ga0307513_10078148 3300031456 Bacteria 3424
845 Ga0307513_10343196 3300031456 Bacteria 1243
846 Ga0307509_10225888 3300031507 Bacteria 1680
847 Ga0307408_100021735 3300031548 Bacteria 4346
848 Ga0307408_100029774 3300031548 Bacteria 3786
849 Ga0307408_100038304 3300031548 Bacteria 3382
850 Ga0307408_100045920 3300031548 Bacteria 3122
851 Ga0307408_100053685 3300031548 Bacteria 2911
852 Ga0307408_100125754 3300031548 Bacteria 1993
853 Ga0307408_100414950 3300031548 Bacteria 1159
854 Ga0307405_10014730 3300031731 Bacteria 4214
855 Ga0307405_10067652 3300031731 Bacteria 2283
856 Ga0307405_10096911 3300031731 Bacteria 1968
857 Ga0307405_10104681 3300031731 Bacteria 1904
858 Ga0307405_10122976 3300031731 Bacteria 1779
859 Ga0307405_10201270 3300031731 Bacteria 1446
860 Ga0307405_10219015 3300031731 Bacteria 1395
861 Ga0307413_10008683 3300031824 Bacteria 4813
862 Ga0307413_10081449 3300031824 Bacteria 2075
863 Ga0307413_10108764 3300031824 Bacteria 1851
864 Ga0307413_10111929 3300031824 Bacteria 1829
865 Ga0307413_10115938 3300031824 Bacteria 1803
866 Ga0307413_10138495 3300031824 Bacteria 1678
867 Ga0307410_10001691 3300031852 Bacteria 10153
868 Ga0307410_10015931 3300031852 Bacteria 4469
869 Ga0307410_10024939 3300031852 Bacteria 3743
870 Ga0307410_10057510 3300031852 Bacteria 2648
871 Ga0307410_10064707 3300031852 Bacteria 2513
872 Ga0307410_10071379 3300031852 Bacteria 2408
873 Ga0307410_10081235 3300031852 Bacteria 2277
874 Ga0307410_10082071 3300031852 Bacteria 2267
875 Ga0307410_10104263 3300031852 Bacteria 2038
876 Ga0307410_10252591 3300031852 Bacteria 1371
877 Ga0307406_10010818 3300031901 Bacteria 5156
878 Ga0307406_10014221 3300031901 Bacteria 4574
879 Ga0307406_10030679 3300031901 Bacteria 3266
880 Ga0307406_10253402 3300031901 Bacteria 1327
881 Ga0307407_10043436 3300031903 Bacteria 2527
882 Ga0307407_10052426 3300031903 Bacteria 2343
883 Ga0307407_10076751 3300031903 Bacteria 2007
884 Ga0307407_10300882 3300031903 Bacteria 1118
885 Ga0307412_10001006 3300031911 Bacteria 16124
886 Ga0307412_10010753 3300031911 Bacteria 5279
887 Ga0307412_10015861 3300031911 Bacteria 4475
888 Ga0307412_10026558 3300031911 Bacteria 3600
889 Ga0307412_10090404 3300031911 Bacteria 2140
890 Ga0307412_10131208 3300031911 Bacteria 1820
891 Ga0307412_10258661 3300031911 Bacteria 1356
892 Ga0307409_100003480 3300031995 Bacteria 8560
893 Ga0307409_100008340 3300031995 Bacteria 6282
894 Ga0307409_100014339 3300031995 Bacteria 5150
895 Ga0307409_100019207 3300031995 Bacteria 4621
896 Ga0307409_100051476 3300031995 Bacteria 3152
897 Ga0307409_100090909 3300031995 Bacteria 2500
898 Ga0307409_100162794 3300031995 Bacteria 1953
899 Ga0307409_100167198 3300031995 Bacteria 1931
900 Ga0307409_100176297 3300031995 Bacteria 1887
901 Ga0307409_100178903 3300031995 Bacteria 1875
902 Ga0307409_100196260 3300031995 Bacteria 1802
903 Ga0307409_100197829 3300031995 Bacteria 1795
904 Ga0307409_100597173 3300031995 Bacteria 1090
905 Ga0307416_100008527 3300032002 Bacteria 6624
906 Ga0307416_100009876 3300032002 Bacteria 6276
907 Ga0307416_100032224 3300032002 Bacteria 3957
908 Ga0307416_100041334 3300032002 Bacteria 3590
909 Ga0307416_100041956 3300032002 Bacteria 3568
910 Ga0307416_100120714 3300032002 Bacteria 2335
911 Ga0307416_100206387 3300032002 Bacteria 1869
912 Ga0307416_100256220 3300032002 Bacteria 1707
913 Ga0307416_100263142 3300032002 Bacteria 1687
914 Ga0307416_100377439 3300032002 Bacteria 1446
915 Ga0307416_100490352 3300032002 Bacteria 1291
916 Ga0307416_100756164 3300032002 Bacteria 1065
917 Ga0307414_10000463 3300032004 Bacteria 21300
918 Ga0307414_10013269 3300032004 Bacteria 4902
919 Ga0307414_10018046 3300032004 Bacteria 4332
920 Ga0307414_10022267 3300032004 Bacteria 3993
921 Ga0307414_10032046 3300032004 Bacteria 3456
922 Ga0307414_10038232 3300032004 Bacteria 3221
923 Ga0307414_10040883 3300032004 Bacteria 3135
924 Ga0307414_10050706 3300032004 Bacteria 2876
925 Ga0307414_10080498 3300032004 Bacteria 2382
926 Ga0307414_10089233 3300032004 Bacteria 2284
927 Ga0307414_10095902 3300032004 Bacteria 2218
928 Ga0307414_10100857 3300032004 Bacteria 2172
929 Ga0307414_10364778 3300032004 Bacteria 1244
930 Ga0307414_10584610 3300032004 Bacteria 999
931 Ga0307411_10004366 3300032005 Bacteria 6762
932 Ga0307411_10007971 3300032005 Bacteria 5448
933 Ga0307411_10011224 3300032005 Bacteria 4822
934 Ga0307411_10013119 3300032005 Bacteria 4556
935 Ga0307411_10028624 3300032005 Bacteria 3391
936 Ga0307411_10125648 3300032005 Bacteria 1865
937 Ga0307411_10180873 3300032005 Bacteria 1600
938 Ga0307411_10234088 3300032005 Bacteria 1434
939 Ga0307411_10239316 3300032005 Bacteria 1420
940 Ga0307411_10283227 3300032005 Bacteria 1320
941 Ga0307415_100015317 3300032126 Bacteria 4536
942 Ga0307415_100029178 3300032126 Bacteria 3522
943 Ga0307415_100112216 3300032126 Bacteria 2025
944 Ga0307415_100129515 3300032126 Bacteria 1907
945 Ga0307415_100162034 3300032126 Bacteria 1735
946 Ga0307415_100163138 3300032126 Bacteria 1729
947 Ga0307415_100403440 3300032126 Bacteria 1168
948 Ga0307415_100469859 3300032126 Bacteria 1092
949 Ga0307510_10000248 3300033180 Bacteria 48764
950 Ga0307510_10040635 3300033180 Bacteria 5103
951 Ga0307510_10182106 3300033180 Bacteria 1662
952 Ga0373927_0071656 3300035695 Bacteria 2243
953 Ga0395899_0004754 3300037312 Bacteria 10587
954 Ga0395899_0077243 3300037312 Bacteria 2429
955 Ga0395899_0130846 3300037312 Bacteria 1792
956 Ga0395900_0006155 3300037418 Bacteria 12526
957 Ga0395900_0010551 3300037418 Bacteria 9450
958 Ga0395900_0018554 3300037418 Bacteria 7094
959 Ga0395900_0053239 3300037418 Bacteria 4165
960 Ga0395900_0090942 3300037418 Bacteria 3136
961 Ga0395900_0120339 3300037418 Bacteria 2694
962 Ga0395900_0187899 3300037418 Bacteria 2097
963 Ga0395900_0279352 3300037418 Bacteria 1662
964 Ga0395900_0358415 3300037418 Bacteria 1430
965 Ga0395898_0032517 3300037466 Bacteria 5207
966 Ga0395898_0223001 3300037466 Bacteria 1798
967 Ga0395898_0292281 3300037466 Bacteria 1554
968 Ga0395898_0363665 3300037466 Bacteria 1380
969 Ga0395898_0697633 3300037466 Bacteria 957
970 Ga0395905_0000232 3300037471 Bacteria 84233
971 Ga0395905_0028518 3300037471 Bacteria 5262
972 Ga0395905_0041496 3300037471 Bacteria 4318
973 Ga0395905_0048257 3300037471 Bacteria 3990
974 Ga0395905_0066004 3300037471 Bacteria 3388
975 Ga0395905_0153646 3300037471 Bacteria 2165
976 Ga0395905_0310815 3300037471 Bacteria 1464
977 Ga0395905_0412896 3300037471 Bacteria 1245
978 Ga0436364_0551790 3300037853 Bacteria 2086
979 Ga0436364_0786820 3300037853 Bacteria 5502
980 Ga0436364_0816160 3300037853 Bacteria 20704
981 Ga0395901_0024797 3300038443 Bacteria 6156
982 Ga0395901_0056296 3300038443 Bacteria 4090
983 Ga0395901_0250660 3300038443 Bacteria 1844
984 Ga0395901_0521418 3300038443 Bacteria 1207
985 Ga0237819_00556 3300038705 Bacteria 12543
986 Ga0436365_1650189 3300039437 Bacteria 5299
987 Ga0439436_0053380 3300041404 Bacteria 1138
988 Ga0439461_0000081 3300041410 Bacteria 12554
989 Ga0439466_0032477 3300041411 Bacteria 1779
990 Ga0439465_0001389 3300041413 Bacteria 7815
991 Ga0439465_0028487 3300041413 Bacteria 1771
992 Ga0451807_2106806 3300041486 Bacteria 1728
993 Ga0439431_0000134 3300041997 Bacteria 13258
994 Ga0439431_0029888 3300041997 Bacteria 1347
995 Ga0439442_003063 3300042002 Bacteria 3306
996 Ga0439445_0000905 3300042004 Bacteria 6298
997 Ga0439432_000152 3300042006 Bacteria 23430
998 Ga0439432_016068 3300042006 Bacteria 2522
999 Ga0439449_0008461 3300042007 Bacteria 3911
1000 Ga0439449_0021174 3300042007 Bacteria 2435
1001 Ga0439452_014099 3300042010 Bacteria 2227
1002 Ga0439452_025818 3300042010 Bacteria 1487
1003 Ga0439455_0000107 3300042012 Bacteria 8291
1004 Ga0439462_0000151 3300042015 Bacteria 11324
1005 Ga0439462_0004098 3300042015 Bacteria 3538
1006 Ga0450919_004896 3300042121 Bacteria 1622
1007 Ga0450920_009964 3300042122 Bacteria 1757
1008 Ga0450891_004362 3300042129 Bacteria 1328
1009 Ga0450889_000118 3300042144 Bacteria 7702
1010 Ga0439446_0038448 3300042156 Bacteria 1403
1011 Ga0439458_0000371 3300042157 Bacteria 11321
1012 Ga0439458_0004674 3300042157 Bacteria 3125
1013 Ga0439434_0000213 3300042435 Bacteria 16069
1014 Ga0451577_0339336 3300042876 Bacteria 1363
1015 Ga0466966_0316951 3300044684 Bacteria 937
1016 Ga0466961_0067645 3300044693 Bacteria 2269
1017 Ga0466963_0004135 3300044694 Bacteria 8393
1018 Ga0466963_0212209 3300044694 Bacteria 1355
1019 Ga0466963_0337181 3300044694 Bacteria 1061
1020 Ga0466964_0016202 3300044706 Bacteria 2842
1021 Ga0466971_0003306 3300044719 Bacteria 6887
1022 Ga0466971_0074812 3300044719 Bacteria 1540
1023 Ga0466968_0054218 3300044735 Bacteria 1718
1024 Ga0466957_0021802 3300044842 Bacteria 3776
1025 Ga0466960_0044375 3300044901 Bacteria 2119
1026 Ga0466959_0292751 3300045049 Bacteria 1116
1027 Ga0466959_0304717 3300045049 Bacteria 1091
1028 Ga0466958_0069813 3300045836 Bacteria 2149
1029 Ga0466958_0191725 3300045836 Bacteria 1299
1030 Ga0466967_0012308 3300045976 Bacteria 6536
1031 Ga0466967_0019763 3300045976 Bacteria 5425
1032 Ga0466967_0478654 3300045976 Bacteria 1220
1033 Ga0495627_006112 3300046453 Bacteria 4752
1034 Ga0495638_0001117 3300046460 Bacteria 26096
1035 Ga0495638_0007198 3300046460 Bacteria 8006
1036 Ga0495638_0024614 3300046460 Bacteria 3923
1037 Ga0495638_0054138 3300046460 Bacteria 2495
1038 Ga0495650_0027007 3300046471 Bacteria 2659
1039 Ga0495584_0081542 3300046491 Bacteria 1628
1040 Ga0495585_0000933 3300046492 Bacteria 24663
1041 Ga0495607_0008896 3300046501 Bacteria 6839
1042 Ga0495583_0000358 3300046506 Bacteria 71745
1043 Ga0495583_0006282 3300046506 Bacteria 7809
1044 Ga0495583_0006422 3300046506 Bacteria 7693
1045 Ga0495583_0012582 3300046506 Bacteria 4778
1046 Ga0495583_0014543 3300046506 Bacteria 4337
1047 Ga0495583_0024689 3300046506 Bacteria 3015
1048 Ga0495606_0000457 3300046507 Bacteria 67044
1049 Ga0495606_0033751 3300046507 Bacteria 3524
1050 Ga0495616_0029958 3300046513 Bacteria 2866
1051 Ga0495631_0006313 3300046518 Bacteria 6133
1052 Ga0495637_0009055 3300046520 Bacteria 4864
1053 Ga0495643_0003269 3300046522 Bacteria 11994
1054 Ga0495643_0126952 3300046522 Bacteria 1283
1055 Ga0495643_0139080 3300046522 Bacteria 1212
1056 Ga0495648_0001493 3300046524 Bacteria 22886
1057 Ga0495648_0033863 3300046524 Bacteria 3332
1058 Ga0495648_0036481 3300046524 Bacteria 3171
1059 Ga0495648_0060079 3300046524 Bacteria 2264
1060 Ga0495648_0140727 3300046524 Bacteria 1270
1061 Ga0495663_0000435 3300046525 Bacteria 15274
1062 Ga0495663_0039188 3300046525 Bacteria 1435
1063 Ga0495654_0000338 3300046530 Bacteria 40946
1064 Ga0495597_0031047 3300046542 Bacteria 2433
1065 Ga0495597_0039105 3300046542 Bacteria 2125
1066 Ga0495622_0004163 3300046557 Bacteria 6749
1067 Ga0495622_0004720 3300046557 Bacteria 6315
1068 Ga0495633_0000690 3300046558 Bacteria 30854
1069 Ga0495633_0011005 3300046558 Bacteria 4909
1070 Ga0495633_0157489 3300046558 Bacteria 1048
1071 Ga0495668_0000059 3300046616 Bacteria 194951
1072 Ga0495668_0002301 3300046616 Bacteria 16028
1073 Ga0495668_0005543 3300046616 Bacteria 8505
1074 Ga0495668_0013937 3300046616 Bacteria 4726
1075 Ga0495668_0064687 3300046616 Bacteria 2013
1076 Ga0495668_0113197 3300046616 Bacteria 1484
1077 Ga0495668_0124350 3300046616 Bacteria 1411
1078 Ga0495611_0070043 3300046648 Bacteria 1603
1079 Ga0495625_0000094 3300046660 Bacteria 144517
1080 Ga0495625_0004059 3300046660 Bacteria 13990
1081 Ga0495625_0005946 3300046660 Bacteria 10979
1082 Ga0495625_0012086 3300046660 Bacteria 7005
1083 Ga0495625_0194363 3300046660 Bacteria 1342
1084 Ga0495625_0207866 3300046660 Bacteria 1288
1085 Ga0495623_0215794 3300046679 Bacteria 1096
1086 Ga0495669_0000058 3300046684 Bacteria 76033
1087 Ga0495669_0003419 3300046684 Bacteria 6538
1088 Ga0495669_0017312 3300046684 Bacteria 3092
1089 Ga0495669_0019801 3300046684 Bacteria 2906
1090 Ga0495669_0033342 3300046684 Bacteria 2266
1091 Ga0495670_0000016 3300046691 Bacteria 128045
1092 Ga0495670_0054654 3300046691 Bacteria 2001
1093 Ga0495671_0010759 3300046692 Bacteria 5058
1094 Ga0495671_0082351 3300046692 Bacteria 1577
1095 Ga0495649_0054082 3300046694 Bacteria 2172
1096 Ga0495660_0033946 3300046810 Bacteria 2858
1097 Ga0495660_0087453 3300046810 Bacteria 1625
1098 Ga0495683_0006073 3300047323 Bacteria 6626
1099 Ga0495687_000083 3300047443 Bacteria 145688
1100 Ga0495687_000152 3300047443 Bacteria 105602
1101 Ga0495677_0006604 3300047445 Bacteria 4378
1102 Ga0495677_0015249 3300047445 Bacteria 2793
1103 Ga0495681_0003027 3300047470 Bacteria 11814
1104 Ga0495681_0022129 3300047470 Bacteria 3410
1105 Ga0495681_0026507 3300047470 Bacteria 3014
1106 Ga0495686_0000100 3300047472 Bacteria 180492
1107 Ga0495686_0000209 3300047472 Bacteria 108972
1108 Ga0495686_0000300 3300047472 Bacteria 85146
1109 Ga0495686_0008787 3300047472 Bacteria 7362
1110 Ga0495686_0031244 3300047472 Bacteria 3454
1111 Ga0495686_0048709 3300047472 Bacteria 2670
1112 Ga0495686_0115656 3300047472 Bacteria 1604
1113 Ga0496100_0052989 3300048903 Bacteria 2640
1114 Ga0496100_0408691 3300048903 Bacteria 1035
1115 Ga0496102_0000321 3300048905 Bacteria 60110
1116 Ga0496102_0000372 3300048905 Bacteria 53776
1117 Ga0496102_0013635 3300048905 Bacteria 7045
1118 Ga0496102_0737498 3300048905 Bacteria 908
1119 Ga0496103_0000021 3300048906 Bacteria 229062
1120 Ga0496103_0000199 3300048906 Bacteria 60032
1121 Ga0496103_0020370 3300048906 Bacteria 3983
1122 Ga0496104_0000128 3300048907 Bacteria 70094
1123 Ga0496104_0200548 3300048907 Bacteria 1907
1124 Ga0496105_0000064 3300048908 Bacteria 83935
1125 Ga0496107_0060793 3300048910 Bacteria 2734
1126 Ga0496107_0112532 3300048910 Bacteria 2001
1127 Ga0496107_0209131 3300048910 Bacteria 1451
1128 Ga0496108_0000270 3300048911 Bacteria 44669
1129 Ga0496108_0003272 3300048911 Bacteria 13018
1130 Ga0496108_0013648 3300048911 Bacteria 6632
1131 Ga0496108_0238511 3300048911 Bacteria 1582
1132 Ga0496108_0316635 3300048911 Bacteria 1360
1133 Ga0496109_0012198 3300048912 Bacteria 7413
1134 Ga0496109_0017884 3300048912 Bacteria 6220
1135 Ga0496110_0008670 3300048913 Bacteria 8189
1136 Ga0496110_0018618 3300048913 Bacteria 5825
1137 Ga0496110_0209858 3300048913 Bacteria 1770
1138 Ga0496111_0007263 3300048914 Bacteria 7249
1139 Ga0496111_0073251 3300048914 Bacteria 2494
1140 Ga0496112_0011063 3300048915 Bacteria 8223
1141 Ga0496112_0018560 3300048915 Bacteria 6552
1142 Ga0496112_0024945 3300048915 Bacteria 5736
1143 Ga0496113_0000044 3300048916 Bacteria 51909
1144 Ga0496113_0001779 3300048916 Bacteria 12227
1145 Ga0496113_0010090 3300048916 Bacteria 6229
1146 Ga0496113_0039617 3300048916 Bacteria 3469
1147 Ga0496113_0223916 3300048916 Bacteria 1499
1148 Ga0496114_0188465 3300048917 Bacteria 1804
1149 Ga0496115_0004300 3300048918 Bacteria 10314
1150 Ga0496116_0000648 3300048919 Bacteria 45494
1151 Ga0496116_0060403 3300048919 Bacteria 2459
1152 Ga0496116_0189969 3300048919 Bacteria 1088
1153 Ga0496117_0000584 3300048920 Bacteria 60140
1154 Ga0496117_0001310 3300048920 Bacteria 36602
1155 Ga0496117_0009809 3300048920 Bacteria 8825
1156 Ga0496117_0035784 3300048920 Bacteria 3723
1157 Ga0496118_0000588 3300048921 Bacteria 60153
1158 Ga0496118_0003241 3300048921 Bacteria 20752
1159 Ga0496118_0063764 3300048921 Bacteria 2709
1160 Ga0496118_0069773 3300048921 Bacteria 2543
1161 Ga0496118_0095905 3300048921 Bacteria 2023
1162 Ga0496119_0000077 3300048922 Bacteria 143108
1163 Ga0496119_0024187 3300048922 Bacteria 4279
1164 Ga0496119_0041571 3300048922 Bacteria 2925
1165 Ga0496120_0001955 3300048923 Bacteria 22562
1166 Ga0496120_0016721 3300048923 Bacteria 4785
1167 Ga0496120_0207791 3300048923 Bacteria 943
1168 Ga0496121_0000163 3300048924 Bacteria 145648
1169 Ga0496121_0001865 3300048924 Bacteria 33822
1170 Ga0496121_0002849 3300048924 Bacteria 25522
1171 Ga0496121_0005208 3300048924 Bacteria 16854
1172 Ga0496121_0010109 3300048924 Bacteria 10699
1173 Ga0496121_0043634 3300048924 Bacteria 3880
1174 Ga0496121_0091189 3300048924 Bacteria 2380
1175 Ga0496121_0182928 3300048924 Bacteria 1510
1176 Ga0496122_0001166 3300048925 Bacteria 44916
1177 Ga0496122_0001683 3300048925 Bacteria 34269
1178 Ga0496122_0004055 3300048925 Bacteria 18593
1179 Ga0496122_0009279 3300048925 Bacteria 10403
1180 Ga0496122_0029763 3300048925 Bacteria 4594
1181 Ga0496123_0000542 3300048926 Bacteria 64858
1182 Ga0496123_0001103 3300048926 Bacteria 40498
1183 Ga0496123_0011457 3300048926 Bacteria 7681
1184 Ga0496123_0018448 3300048926 Bacteria 5552
1185 Ga0496123_0018488 3300048926 Bacteria 5542
1186 Ga0496123_0022752 3300048926 Bacteria 4819
1187 Ga0496123_0039900 3300048926 Bacteria 3279
1188 Ga0496123_0061608 3300048926 Bacteria 2409
1189 Ga0496123_0070592 3300048926 Bacteria 2185
1190 Ga0496123_0102011 3300048926 Bacteria 1667
1191 Ga0496123_0113327 3300048926 Bacteria 1544
1192 Ga0496124_0000354 3300048927 Bacteria 83817
1193 Ga0496124_0000387 3300048927 Bacteria 80517
1194 Ga0496124_0001269 3300048927 Bacteria 38422
1195 Ga0496124_0008572 3300048927 Bacteria 10668
1196 Ga0496124_0009752 3300048927 Bacteria 9828
1197 Ga0496124_0027461 3300048927 Bacteria 5108
1198 Ga0496124_0031798 3300048927 Bacteria 4667
1199 Ga0496124_0033453 3300048927 Bacteria 4522
1200 Ga0496124_0109432 3300048927 Bacteria 2227
1201 Ga0496125_0000687 3300048928 Bacteria 56251
1202 Ga0496125_0001135 3300048928 Bacteria 40511
1203 Ga0496125_0010521 3300048928 Bacteria 9354
1204 Ga0496125_0014132 3300048928 Bacteria 7790
1205 Ga0496125_0023090 3300048928 Bacteria 5753
1206 Ga0496125_0039372 3300048928 Bacteria 4072
1207 Ga0496125_0151987 3300048928 Bacteria 1588
1208 Ga0496125_0155808 3300048928 Bacteria 1561
1209 Ga0496126_0000175 3300048929 Bacteria 146389
1210 Ga0496126_0006303 3300048929 Bacteria 13249
1211 Ga0496126_0024925 3300048929 Bacteria 5767
1212 Ga0496126_0037074 3300048929 Bacteria 4553
1213 Ga0496126_0174180 3300048929 Bacteria 1831
1214 Ga0496126_0183686 3300048929 Bacteria 1775
1215 Ga0496126_0184844 3300048929 Bacteria 1768
1216 Ga0501290_001241 3300049513 Bacteria 3558
1217 Ga0501292_000012 3300049515 Bacteria 69398
1218 Ga0501033_0153155 3300049570 Bacteria 1662
1219 Ga0501034_0014162 3300049571 Bacteria 8220
1220 Ga0501043_0027180 3300049579 Bacteria 4492
1221 Ga0501046_0246584 3300049580 Bacteria 1316
1222 Ga0501047_0002016 3300049581 Bacteria 19482
1223 Ga0501047_0138887 3300049581 Bacteria 2309
1224 Ga0501067_0013236 3300049583 Bacteria 4567
1225 Ga0501068_0061284 3300049584 Bacteria 2286
1226 Ga0501209_042906 3300049656 Bacteria 1204
1227 Ga0501223_000111 3300049663 Bacteria 23444
1228 Ga0501223_002079 3300049663 Bacteria 4494
1229 Ga0501224_000024 3300049664 Bacteria 61321
1230 Ga0501224_000250 3300049664 Bacteria 6135
1231 Ga0501257_011461 3300049686 Bacteria 2024
1232 Ga0501259_015058 3300049688 Bacteria 1317
1233 Ga0501225_0000004 3300049705 Bacteria 140738
1234 Ga0501225_0000017 3300049705 Bacteria 61517
1235 Ga0501225_0008251 3300049705 Bacteria 2996
1236 Ga0501241_003853 3300049758 Bacteria 2828
1237 Ga0501279_000012 3300049775 Bacteria 80359
1238 Ga0501280_000052 3300049776 Bacteria 33642
1239 Ga0501282_000586 3300049778 Bacteria 4250
1240 Ga0501283_006592 3300049779 Bacteria 1630
1241 Ga0501044_0064208 3300049823 Bacteria 3749
1242 Ga0501044_0123466 3300049823 Bacteria 2588
1243 Ga0501226_000072 3300049853 Bacteria 31259
1244 nmdc:mga03683_39951_c1 3300050489 Bacteria 1922
1245 nmdc:mga00v17_54411_c1 3300050491 Bacteria 2441
1246 nmdc:mga0k408_59255_c1 3300050493 Bacteria 2224
1247 nmdc:mga0k408_85431_c1 3300050493 Bacteria 1852
1248 nmdc:mga06z11_47_c1 3300050494 Bacteria 51206
1249 nmdc:mga04h51_182_c1 3300050495 Bacteria 17567
1250 nmdc:mga05p37_458637_c1 3300050507 Bacteria 1473
1251 nmdc:mga08y16_44274_c1 3300050511 Bacteria 4663
1252 nmdc:mga0n895_301325_c1 3300050512 Bacteria 1625
1253 Ga0500610_0000029 3300053079 Bacteria 52531
1254 Ga0500643_000096 3300053087 Bacteria 92125
1255 Ga0500643_000611 3300053087 Bacteria 24350
1256 Ga0500643_001187 3300053087 Bacteria 15537
1257 Ga0500643_001703 3300053087 Bacteria 12216
1258 Ga0500643_002575 3300053087 Bacteria 9232
1259 Ga0500643_003036 3300053087 Bacteria 8284
1260 Ga0500583_0045830 3300053092 Bacteria 2010
1261 Ga0500651_0009427 3300053093 Bacteria 5800
1262 Ga0500641_0008635 3300053096 Bacteria 3642
1263 Ga0500641_0042853 3300053096 Bacteria 1835
1264 Ga0500555_003364 3300053103 Bacteria 4560
1265 Ga0500556_0000053 3300053104 Bacteria 117389
1266 Ga0500556_0006126 3300053104 Bacteria 3411
1267 Ga0500592_013655 3300053116 Bacteria 1302
1268 Ga0500594_0005984 3300053118 Bacteria 2715
1269 Ga0500595_001869 3300053119 Bacteria 10863
1270 Ga0500614_003766 3300053123 Bacteria 3248
1271 Ga0500617_066071 3300053124 Bacteria 1593
1272 Ga0500618_014164 3300053125 Bacteria 2044
1273 Ga0500618_017070 3300053125 Bacteria 1809
1274 Ga0500642_0000001 3300053130 Bacteria 1468402
1275 Ga0500642_0000238 3300053130 Bacteria 21313
1276 Ga0500655_000089 3300053133 Bacteria 24204
1277 Ga0500658_0000147 3300053134 Bacteria 33394
1278 Ga0500658_0007420 3300053134 Bacteria 4053
1279 Ga0500658_0013523 3300053134 Bacteria 3016
1280 Ga0500559_0000456 3300053136 Bacteria 29143
1281 Ga0500559_0021181 3300053136 Bacteria 2753
1282 Ga0500559_0042912 3300053136 Bacteria 1975
1283 Ga0500559_0098424 3300053136 Bacteria 1346
1284 Ga0500573_0000039 3300053140 Bacteria 105413
1285 Ga0500585_080656 3300053144 Bacteria 1176
1286 Ga0500590_001156 3300053148 Bacteria 10422
1287 Ga0500604_0038234 3300053151 Bacteria 1439
1288 Ga0500622_0102362 3300053156 Bacteria 1408
1289 Ga0500622_0109698 3300053156 Bacteria 1350
1290 Ga0500624_000005 3300053157 Bacteria 187122
1291 Ga0500624_000026 3300053157 Bacteria 109681
1292 Ga0500627_0000074 3300053158 Bacteria 40189
1293 Ga0500627_0000248 3300053158 Bacteria 15424
1294 Ga0500627_0167636 3300053158 Bacteria 990
1295 Ga0500639_121099 3300053163 Bacteria 1256
1296 Ga0500636_0002055 3300053177 Bacteria 11101
1297 Ga0500636_0004034 3300053177 Bacteria 8284
1298 Ga0500570_002530 3300053724 Bacteria 9109
1299 Ga0500645_000019 3300053730 Bacteria 135445
1300 Ga0500645_003141 3300053730 Bacteria 6872
1301 Ga0500645_008281 3300053730 Bacteria 3559
1302 Ga0500645_013673 3300053730 Bacteria 2601
1303 Ga0466962_0002921 3300061719 Bacteria 8146
1304 Ga0466962_0112577 3300061719 Bacteria 1311

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0031047 Ga0495597_0031047_706_1563 253
2 3300046660 Ga0495625_0012086 Ga0495625_0012086_3142_3999 253
3 3300042129 Ga0450891_004362 Ga0450891_004362_28_816 258
4 3300013308 Ga0157375_10625967 Ga0157375_106259672 266
5 3300025972 Ga0207668_10006614 Ga0207668_100066144 269
6 3300005367 Ga0070667_100079713 Ga0070667_1000797133 271
7 3300046616 Ga0495668_0124350 Ga0495668_0124350_221_1159 272
8 3300053104 Ga0500556_0000053 Ga0500556_0000053_21077_22015 272
9 3300053124 Ga0500617_066071 Ga0500617_066071_518_1456 272
10 3300053130 Ga0500642_0000001 Ga0500642_0000001_268082_269020 272
11 3300053730 Ga0500645_008281 Ga0500645_008281_493_1431 273
12 3300032002 Ga0307416_100041956 Ga0307416_1000419564 274
13 3300032126 Ga0307415_100469859 Ga0307415_1004698592 274
14 3300001990 JGI24737J22298_10013082 JGI24737J22298_100130822 276
15 3300005344 Ga0070661_100187233 Ga0070661_1001872332 276
16 3300005366 Ga0070659_100068801 Ga0070659_1000688013 276
17 3300005455 Ga0070663_100005176 Ga0070663_1000051765 276
18 3300005564 Ga0070664_100071906 Ga0070664_1000719063 276
19 3300013100 Ga0157373_10092834 Ga0157373_100928342 276
20 3300013307 Ga0157372_10509123 Ga0157372_105091232 276
21 3300025933 Ga0207706_10052489 Ga0207706_100524893 276
22 3300025949 Ga0207667_10272166 Ga0207667_102721662 276
23 3300025981 Ga0207640_10020357 Ga0207640_100203573 276
24 3300001915 JGI24741J21665_1000920 JGI24741J21665_10009209 278
25 3300002067 JGI24735J21928_10001399 JGI24735J21928_100013998 278
26 3300005614 Ga0068856_100004000 Ga0068856_10000400014 278
27 3300009093 Ga0105240_10127643 Ga0105240_101276433 278
28 3300013104 Ga0157370_10056321 Ga0157370_100563212 278
29 3300025904 Ga0207647_10002797 Ga0207647_100027976 278
30 3300025913 Ga0207695_10247953 Ga0207695_102479532 278
31 3300026041 Ga0207639_10001528 Ga0207639_1000152812 278
32 3300026078 Ga0207702_10009720 Ga0207702_100097208 278
33 3300026116 Ga0207674_10016332 Ga0207674_100163325 278
34 3300031852 Ga0307410_10024939 Ga0307410_100249393 278
35 3300031995 Ga0307409_100167198 Ga0307409_1001671983 278
36 3300032004 Ga0307414_10050706 Ga0307414_100507063 278
37 3300046684 Ga0495669_0033342 Ga0495669_0033342_729_1574 278
38 3300005563 Ga0068855_100128226 Ga0068855_1001282262 279
39 3300010375 Ga0105239_10110126 Ga0105239_101101262 279
40 3300046525 Ga0495663_0000435 Ga0495663_0000435_7238_8083 279
41 3300046660 Ga0495625_0000094 Ga0495625_0000094_45324_46169 279
42 3300047470 Ga0495681_0003027 Ga0495681_0003027_9597_10442 279
43 3300053116 Ga0500592_013655 Ga0500592_013655_153_1106 279
44 3300053136 Ga0500559_0098424 Ga0500559_0098424_70_915 279
45 3300053158 Ga0500627_0000074 Ga0500627_0000074_38461_39414 279
46 3300001904 JGI24736J21556_1000218 JGI24736J21556_10002184 280
47 3300003322 rootL2_10207868 rootL2_102078682 280
48 3300005548 Ga0070665_100000148 Ga0070665_100000148140 280
49 3300005578 Ga0068854_100087547 Ga0068854_1000875472 280
50 3300025981 Ga0207640_10012181 Ga0207640_100121812 280
51 3300028379 Ga0268266_10000626 Ga0268266_1000062614 280
52 3300048914 Ga0496111_0073251 Ga0496111_0073251_897_1811 280
53 3300048925 Ga0496122_0001683 Ga0496122_0001683_29959_30873 280
54 3300048926 Ga0496123_0022752 Ga0496123_0022752_655_1569 280
55 3300048926 Ga0496123_0061608 Ga0496123_0061608_29_877 280
56 3300048926 Ga0496123_0113327 Ga0496123_0113327_249_1097 280
57 3300048927 Ga0496124_0008572 Ga0496124_0008572_3681_4529 280
58 3300048927 Ga0496124_0009752 Ga0496124_0009752_8385_9299 280
59 3300006881 Ga0068865_100171660 Ga0068865_1001716602 281
60 3300009093 Ga0105240_10001296 Ga0105240_1000129628 281
61 3300012513 Ga0157326_1000559 Ga0157326_10005594 281
62 3300031824 Ga0307413_10108764 Ga0307413_101087642 281
63 3300032004 Ga0307414_10089233 Ga0307414_100892332 281
64 3300032004 Ga0307414_10364778 Ga0307414_103647782 281
65 3300032126 Ga0307415_100403440 Ga0307415_1004034402 281
66 3300048924 Ga0496121_0091189 Ga0496121_0091189_852_1706 281
67 3300049513 Ga0501290_001241 Ga0501290_001241_21_872 281
68 3300049515 Ga0501292_000012 Ga0501292_000012_65045_65896 281
69 3300049664 Ga0501224_000250 Ga0501224_000250_26_877 281
70 3300049688 Ga0501259_015058 Ga0501259_015058_44_895 281
71 3300049775 Ga0501279_000012 Ga0501279_000012_73585_74436 281
72 3300049776 Ga0501280_000052 Ga0501280_000052_116_967 281
73 3300049778 Ga0501282_000586 Ga0501282_000586_2923_3774 281
74 3300049779 Ga0501283_006592 Ga0501283_006592_227_1078 281
75 3300005338 Ga0068868_100000073 Ga0068868_10000007351 282
76 3300005354 Ga0070675_100015090 Ga0070675_1000150908 282
77 3300005364 Ga0070673_100000047 Ga0070673_10000004710 282
78 3300005459 Ga0068867_100000119 Ga0068867_10000011942 282
79 3300005577 Ga0068857_100052526 Ga0068857_1000525263 282
80 3300005844 Ga0068862_100002421 Ga0068862_1000024217 282
81 3300009098 Ga0105245_10000281 Ga0105245_100002817 282
82 3300009148 Ga0105243_10000411 Ga0105243_1000041134 282
83 3300009176 Ga0105242_10001969 Ga0105242_100019697 282
84 3300009553 Ga0105249_10009826 Ga0105249_100098264 282
85 3300010375 Ga0105239_10085122 Ga0105239_100851222 282
86 3300011119 Ga0105246_10002967 Ga0105246_100029674 282
87 3300013100 Ga0157373_10009957 Ga0157373_100099577 282
88 3300013104 Ga0157370_10000611 Ga0157370_100006119 282
89 3300013104 Ga0157370_10069936 Ga0157370_100699362 282
90 3300013105 Ga0157369_10034579 Ga0157369_100345796 282
91 3300013296 Ga0157374_10001017 Ga0157374_100010174 282
92 3300013297 Ga0157378_10001127 Ga0157378_100011274 282
93 3300013307 Ga0157372_10024302 Ga0157372_100243024 282
94 3300013307 Ga0157372_10049722 Ga0157372_100497226 282
95 3300013307 Ga0157372_10611976 Ga0157372_106119762 282
96 3300013308 Ga0157375_10002160 Ga0157375_1000216011 282
97 3300014969 Ga0157376_10001892 Ga0157376_100018928 282
98 3300025263 Ga0209565_1000010 Ga0209565_100001050 282
99 3300025299 Ga0209256_1000012 Ga0209256_100001297 282
100 3300025304 Ga0209257_1002251 Ga0209257_100225112 282
101 3300026116 Ga0207674_10065001 Ga0207674_100650013 282
102 3300028380 Ga0268265_10010546 Ga0268265_100105466 282
103 3300037312 Ga0395899_0004754 Ga0395899_0004754_7320_8171 282
104 3300037418 Ga0395900_0187899 Ga0395900_0187899_248_1099 282
105 3300037466 Ga0395898_0697633 Ga0395898_0697633_70_921 282
106 3300037471 Ga0395905_0041496 Ga0395905_0041496_841_1692 282
107 3300044684 Ga0466966_0316951 Ga0466966_0316951_12_863 282
108 3300044842 Ga0466957_0021802 Ga0466957_0021802_2874_3725 282
109 3300046460 Ga0495638_0054138 Ga0495638_0054138_592_1449 282
110 3300046506 Ga0495583_0000358 Ga0495583_0000358_66697_67554 282
111 3300047472 Ga0495686_0008787 Ga0495686_0008787_4968_5822 282
112 3300048921 Ga0496118_0063764 Ga0496118_0063764_43_900 282
113 3300048921 Ga0496118_0069773 Ga0496118_0069773_213_1064 282
114 3300048922 Ga0496119_0041571 Ga0496119_0041571_1231_2082 282
115 3300048928 Ga0496125_0014132 Ga0496125_0014132_4821_5672 282
116 3300053103 Ga0500555_003364 Ga0500555_003364_57_914 282
117 3300053119 Ga0500595_001869 Ga0500595_001869_5350_6204 282
118 3300053125 Ga0500618_014164 Ga0500618_014164_149_1006 282
119 3300053134 Ga0500658_0013523 Ga0500658_0013523_421_1275 282
120 3300005328 Ga0070676_10017471 Ga0070676_100174713 283
121 3300005334 Ga0068869_100148069 Ga0068869_1001480692 283
122 3300005338 Ga0068868_100000032 Ga0068868_10000003233 283
123 3300005339 Ga0070660_100000200 Ga0070660_10000020024 283
124 3300005347 Ga0070668_100005153 Ga0070668_1000051535 283
125 3300005354 Ga0070675_100028394 Ga0070675_1000283945 283
126 3300005366 Ga0070659_100000005 Ga0070659_100000005226 283
127 3300005718 Ga0068866_10156508 Ga0068866_101565082 283
128 3300009098 Ga0105245_10001668 Ga0105245_1000166817 283
129 3300009148 Ga0105243_10102179 Ga0105243_101021792 283
130 3300009176 Ga0105242_10063280 Ga0105242_100632803 283
131 3300009177 Ga0105248_10013669 Ga0105248_1001366910 283
132 3300009551 Ga0105238_10505608 Ga0105238_105056081 283
133 3300013296 Ga0157374_10127707 Ga0157374_101277072 283
134 3300025233 Ga0209437_104987 Ga0209437_1049872 283
135 3300025261 Ga0209233_1000044 Ga0209233_1000044345 283
136 3300025900 Ga0207710_10023316 Ga0207710_100233163 283
137 3300025901 Ga0207688_10066523 Ga0207688_100665232 283
138 3300025907 Ga0207645_10015633 Ga0207645_100156334 283
139 3300025919 Ga0207657_10001108 Ga0207657_100011088 283
140 3300025924 Ga0207694_10066128 Ga0207694_100661284 283
141 3300025926 Ga0207659_10019949 Ga0207659_100199492 283
142 3300025932 Ga0207690_10000020 Ga0207690_1000002042 283
143 3300025940 Ga0207691_10040846 Ga0207691_100408462 283
144 3300025941 Ga0207711_10055660 Ga0207711_100556602 283
145 3300025972 Ga0207668_10000321 Ga0207668_1000032125 283
146 3300026089 Ga0207648_10004614 Ga0207648_100046145 283
147 3300028379 Ga0268266_10012663 Ga0268266_100126633 283
148 3300031456 Ga0307513_10078148 Ga0307513_100781483 283
149 3300031731 Ga0307405_10014730 Ga0307405_100147304 283
150 3300031995 Ga0307409_100019207 Ga0307409_1000192072 283
151 3300032004 Ga0307414_10022267 Ga0307414_100222672 283
152 3300032005 Ga0307411_10004366 Ga0307411_100043662 283
153 3300041486 Ga0451807_2106806 Ga0451807_2106806_581_1438 283
154 3300044735 Ga0466968_0054218 Ga0466968_0054218_383_1306 283
155 3300046460 Ga0495638_0024614 Ga0495638_0024614_545_1402 283
156 3300046524 Ga0495648_0140727 Ga0495648_0140727_11_868 283
157 3300046558 Ga0495633_0011005 Ga0495633_0011005_613_1473 283
158 3300046558 Ga0495633_0157489 Ga0495633_0157489_124_981 283
159 3300046679 Ga0495623_0215794 Ga0495623_0215794_54_911 283
160 3300048905 Ga0496102_0737498 Ga0496102_0737498_38_895 283
161 3300048911 Ga0496108_0316635 Ga0496108_0316635_115_972 283
162 3300048913 Ga0496110_0209858 Ga0496110_0209858_25_882 283
163 3300048923 Ga0496120_0207791 Ga0496120_0207791_70_927 283
164 3300048928 Ga0496125_0010521 Ga0496125_0010521_5348_6205 283
165 3300048928 Ga0496125_0155808 Ga0496125_0155808_138_995 283
166 3300049663 Ga0501223_002079 Ga0501223_002079_1942_2799 283
167 3300049705 Ga0501225_0000004 Ga0501225_0000004_67685_68542 283
168 3300053136 Ga0500559_0000456 Ga0500559_0000456_4424_5281 283
169 3300053136 Ga0500559_0021181 Ga0500559_0021181_74_931 283
170 3300053140 Ga0500573_0000039 Ga0500573_0000039_95649_96506 283
171 3300053157 Ga0500624_000005 Ga0500624_000005_55898_56758 283
172 3300053157 Ga0500624_000026 Ga0500624_000026_77644_78501 283
173 3300053177 Ga0500636_0004034 Ga0500636_0004034_3732_4589 283
174 iso_pu_bacteria 2738541281 2738746478 283
175 iso_pu_bacteria 2738543032 2739355708 283
176 3300009092 Ga0105250_10026890 Ga0105250_100268903 284
177 iso_pu_bacteria 2919138771 2919139474 284
178 3300025940 Ga0207691_10379635 Ga0207691_103796351 285
179 3300031548 Ga0307408_100038304 Ga0307408_1000383043 285
180 3300031995 Ga0307409_100051476 Ga0307409_1000514763 285
181 3300032002 Ga0307416_100041334 Ga0307416_1000413343 285
182 3300005539 Ga0068853_100009279 Ga0068853_1000092798 286
183 3300005544 Ga0070686_100000884 Ga0070686_10000088412 286
184 3300006871 Ga0075434_100166593 Ga0075434_1001665932 286
185 3300013297 Ga0157378_10005257 Ga0157378_100052577 286
186 3300013308 Ga0157375_10448862 Ga0157375_104488622 286
187 3300020070 Ga0206356_10882194 Ga0206356_108821942 286
188 3300021384 Ga0213876_10007008 Ga0213876_100070085 286
189 3300025944 Ga0207661_10303553 Ga0207661_103035532 286
190 3300026041 Ga0207639_10060713 Ga0207639_100607133 286
191 3300026088 Ga0207641_10037164 Ga0207641_100371646 286
192 3300039437 Ga0436365_1650189 Ga0436365_1650189_1202_2071 286
193 3300046460 Ga0495638_0001117 Ga0495638_0001117_16545_17411 286
194 3300046530 Ga0495654_0000338 Ga0495654_0000338_7651_8568 286
195 3300046616 Ga0495668_0002301 Ga0495668_0002301_6038_6955 286
196 3300050512 nmdc:mga0n895_301325_c1 nmdc:mga0n895_301325_c1_414_1283 286
197 3300053158 Ga0500627_0000248 Ga0500627_0000248_5450_6367 286
198 3300005616 Ga0068852_100005418 Ga0068852_10000541810 287
199 3300006051 Ga0075364_10196977 Ga0075364_101969772 287
200 3300006195 Ga0075366_10100927 Ga0075366_101009272 287
201 3300006353 Ga0075370_10050943 Ga0075370_100509433 287
202 3300026142 Ga0207698_10000964 Ga0207698_100009649 287
203 3300032002 Ga0307416_100756164 Ga0307416_1007561641 287
204 3300048927 Ga0496124_0031798 Ga0496124_0031798_1349_2224 287
205 3300050491 nmdc:mga00v17_54411_c1 nmdc:mga00v17_54411_c1_1151_2080 287
206 3300050493 nmdc:mga0k408_85431_c1 nmdc:mga0k408_85431_c1_880_1809 287
207 3300005985 Ga0081539_10046059 Ga0081539_100460591 288
208 3300014326 Ga0157380_10079645 Ga0157380_100796452 288
209 3300025928 Ga0207700_10138279 Ga0207700_101382792 288
210 3300009177 Ga0105248_10000626 Ga0105248_1000062610 289
211 3300009551 Ga0105238_10098405 Ga0105238_100984052 289
212 3300013102 Ga0157371_10174668 Ga0157371_101746682 289
213 3300013306 Ga0163162_10629872 Ga0163162_106298722 289
214 3300048911 Ga0496108_0013648 Ga0496108_0013648_462_1337 289
215 3300048912 Ga0496109_0012198 Ga0496109_0012198_536_1411 289
216 3300048913 Ga0496110_0018618 Ga0496110_0018618_3803_4678 289
217 3300048915 Ga0496112_0024945 Ga0496112_0024945_1388_2263 289
218 3300048916 Ga0496113_0001779 Ga0496113_0001779_1387_2262 289
219 3300048925 Ga0496122_0001166 Ga0496122_0001166_39457_40395 289
220 3300048926 Ga0496123_0000542 Ga0496123_0000542_26501_27439 289
221 3300014326 Ga0157380_10108341 Ga0157380_101083412 290
222 3300048924 Ga0496121_0000163 Ga0496121_0000163_2533_3423 290
223 3300005295 Ga0065707_10082561 Ga0065707_100825617 291
224 3300014326 Ga0157380_10000365 Ga0157380_1000036510 291
225 3300048926 Ga0496123_0070592 Ga0496123_0070592_1189_2136 291
226 3300048928 Ga0496125_0039372 Ga0496125_0039372_488_1414 291
227 3300031731 Ga0307405_10122976 Ga0307405_101229762 292
228 3300053730 Ga0500645_013673 Ga0500645_013673_1450_2361 293
229 iso_pu_bacteria 8057101203 8057105113 293
230 3300025919 Ga0207657_10126224 Ga0207657_101262242 294
231 3300046453 Ga0495627_006112 Ga0495627_006112_876_1790 294
232 3300046525 Ga0495663_0039188 Ga0495663_0039188_168_1082 294
233 3300053134 Ga0500658_0007420 Ga0500658_0007420_1063_1977 294
234 3300005844 Ga0068862_100014819 Ga0068862_1000148196 295
235 3300028380 Ga0268265_10008778 Ga0268265_100087784 295
236 iso_pu_bacteria 2599185359 2600226997 295
237 iso_pu_bacteria 2879163058 2879163527 295
238 iso_pu_bacteria 2885429604 2885432234 295
239 iso_pu_bacteria 2928526807 2928529571 295
240 iso_pu_bacteria 2928968154 2928970942 295
241 3300001915 JGI24741J21665_1001053 JGI24741J21665_10010532 296
242 3300001979 JGI24740J21852_10001935 JGI24740J21852_100019359 296
243 3300001990 JGI24737J22298_10026054 JGI24737J22298_100260542 296
244 3300003215 JGI25153J46596_10000045 JGI25153J46596_10000045123 296
245 3300003759 Ga0055525_1000119 Ga0055525_100011958 296
246 3300003762 Ga0055542_1000142 Ga0055542_100014283 296
247 3300003763 Ga0055529_1000167 Ga0055529_100016783 296
248 3300005327 Ga0070658_10010686 Ga0070658_100106869 296
249 3300005331 Ga0070670_100048591 Ga0070670_1000485913 296
250 3300005339 Ga0070660_100151670 Ga0070660_1001516702 296
251 3300005347 Ga0070668_100130510 Ga0070668_1001305102 296
252 3300005353 Ga0070669_100501224 Ga0070669_1005012241 296
253 3300005356 Ga0070674_100003200 Ga0070674_10000320010 296
254 3300005356 Ga0070674_100003367 Ga0070674_1000033672 296
255 3300005364 Ga0070673_100436710 Ga0070673_1004367101 296
256 3300005456 Ga0070678_100000636 Ga0070678_1000006369 296
257 3300005459 Ga0068867_100078814 Ga0068867_1000788143 296
258 3300005548 Ga0070665_100000067 Ga0070665_100000067140 296
259 3300005548 Ga0070665_100353004 Ga0070665_1003530041 296
260 3300005564 Ga0070664_100279813 Ga0070664_1002798132 296
261 3300005719 Ga0068861_100298103 Ga0068861_1002981031 296
262 3300006195 Ga0075366_10063278 Ga0075366_100632782 296
263 3300006358 Ga0068871_100500398 Ga0068871_1005003981 296
264 3300009148 Ga0105243_10003479 Ga0105243_100034792 296
265 3300009174 Ga0105241_10003317 Ga0105241_1000331710 296
266 3300009551 Ga0105238_10134776 Ga0105238_101347762 296
267 3300013102 Ga0157371_10000062 Ga0157371_1000006217 296
268 3300013104 Ga0157370_10237542 Ga0157370_102375422 296
269 3300025230 Ga0209563_100024 Ga0209563_100024487 296
270 3300025254 Ga0209148_1000008 Ga0209148_1000008470 296
271 3300025272 Ga0209455_1000002 Ga0209455_1000002954 296
272 3300025297 Ga0209758_1000007 Ga0209758_1000007975 296
273 3300025901 Ga0207688_10088204 Ga0207688_100882041 296
274 3300025904 Ga0207647_10041875 Ga0207647_100418753 296
275 3300025909 Ga0207705_10000181 Ga0207705_1000018147 296
276 3300025911 Ga0207654_10000741 Ga0207654_100007412 296
277 3300025913 Ga0207695_10007459 Ga0207695_1000745913 296
278 3300025919 Ga0207657_10109844 Ga0207657_101098441 296
279 3300025925 Ga0207650_10077064 Ga0207650_100770642 296
280 3300025926 Ga0207659_10071154 Ga0207659_100711542 296
281 3300025932 Ga0207690_10001383 Ga0207690_1000138314 296
282 3300025933 Ga0207706_10041713 Ga0207706_100417133 296
283 3300025935 Ga0207709_10000005 Ga0207709_10000005641 296
284 3300025937 Ga0207669_10000742 Ga0207669_100007422 296
285 3300025937 Ga0207669_10001774 Ga0207669_100017742 296
286 3300025949 Ga0207667_10000852 Ga0207667_1000085228 296
287 3300025960 Ga0207651_10050762 Ga0207651_100507622 296
288 3300025972 Ga0207668_10075528 Ga0207668_100755282 296
289 3300026041 Ga0207639_10004179 Ga0207639_100041792 296
290 3300026067 Ga0207678_10003478 Ga0207678_1000347814 296
291 3300026078 Ga0207702_10001603 Ga0207702_1000160311 296
292 3300026089 Ga0207648_10073095 Ga0207648_100730952 296
293 3300026116 Ga0207674_10019804 Ga0207674_100198049 296
294 3300026121 Ga0207683_10002674 Ga0207683_1000267417 296
295 3300026142 Ga0207698_10002279 Ga0207698_100022793 296
296 3300028379 Ga0268266_10000002 Ga0268266_10000002213 296
297 3300028379 Ga0268266_10300108 Ga0268266_103001082 296
298 3300028786 Ga0307517_10001703 Ga0307517_1000170317 296
299 3300031456 Ga0307513_10343196 Ga0307513_103431961 296
300 3300031507 Ga0307509_10225888 Ga0307509_102258882 296
301 3300033180 Ga0307510_10040635 Ga0307510_100406354 296
302 3300033180 Ga0307510_10182106 Ga0307510_101821062 296
303 3300046471 Ga0495650_0027007 Ga0495650_0027007_129_1031 296
304 3300046491 Ga0495584_0081542 Ga0495584_0081542_663_1565 296
305 3300046492 Ga0495585_0000933 Ga0495585_0000933_14310_15212 296
306 3300046506 Ga0495583_0006282 Ga0495583_0006282_3427_4329 296
307 3300046506 Ga0495583_0006422 Ga0495583_0006422_1739_2641 296
308 3300046506 Ga0495583_0014543 Ga0495583_0014543_2763_3665 296
309 3300046506 Ga0495583_0024689 Ga0495583_0024689_1201_2103 296
310 3300046507 Ga0495606_0000457 Ga0495606_0000457_59543_60445 296
311 3300046507 Ga0495606_0033751 Ga0495606_0033751_1289_2191 296
312 3300046513 Ga0495616_0029958 Ga0495616_0029958_1732_2634 296
313 3300046518 Ga0495631_0006313 Ga0495631_0006313_4952_5854 296
314 3300046520 Ga0495637_0009055 Ga0495637_0009055_2922_3824 296
315 3300046522 Ga0495643_0003269 Ga0495643_0003269_7759_8661 296
316 3300046522 Ga0495643_0126952 Ga0495643_0126952_295_1197 296
317 3300046522 Ga0495643_0139080 Ga0495643_0139080_87_989 296
318 3300046524 Ga0495648_0001493 Ga0495648_0001493_14900_15802 296
319 3300046524 Ga0495648_0036481 Ga0495648_0036481_1790_2692 296
320 3300046557 Ga0495622_0004720 Ga0495622_0004720_5110_6012 296
321 3300046558 Ga0495633_0000690 Ga0495633_0000690_2782_3684 296
322 3300046616 Ga0495668_0000059 Ga0495668_0000059_86675_87577 296
323 3300046648 Ga0495611_0070043 Ga0495611_0070043_382_1284 296
324 3300046660 Ga0495625_0004059 Ga0495625_0004059_2746_3648 296
325 3300046660 Ga0495625_0005946 Ga0495625_0005946_2693_3595 296
326 3300046660 Ga0495625_0207866 Ga0495625_0207866_144_1046 296
327 3300046684 Ga0495669_0000058 Ga0495669_0000058_43976_44878 296
328 3300046691 Ga0495670_0054654 Ga0495670_0054654_496_1398 296
329 3300046692 Ga0495671_0082351 Ga0495671_0082351_215_1117 296
330 3300046694 Ga0495649_0054082 Ga0495649_0054082_1172_2074 296
331 3300046810 Ga0495660_0033946 Ga0495660_0033946_295_1197 296
332 3300046810 Ga0495660_0087453 Ga0495660_0087453_431_1333 296
333 3300047323 Ga0495683_0006073 Ga0495683_0006073_4090_4992 296
334 3300047443 Ga0495687_000083 Ga0495687_000083_92135_93037 296
335 3300047443 Ga0495687_000152 Ga0495687_000152_31834_32736 296
336 3300047445 Ga0495677_0006604 Ga0495677_0006604_601_1503 296
337 3300047470 Ga0495681_0022129 Ga0495681_0022129_2169_3071 296
338 3300047472 Ga0495686_0000209 Ga0495686_0000209_91773_92675 296
339 3300048916 Ga0496113_0039617 Ga0496113_0039617_2284_3186 296
340 3300048925 Ga0496122_0009279 Ga0496122_0009279_1856_2758 296
341 3300048926 Ga0496123_0011457 Ga0496123_0011457_5035_5937 296
342 3300048928 Ga0496125_0000687 Ga0496125_0000687_24021_24923 296
343 3300050493 nmdc:mga0k408_59255_c1 nmdc:mga0k408_59255_c1_345_1247 296
344 3300053079 Ga0500610_0000029 Ga0500610_0000029_18393_19295 296
345 3300053092 Ga0500583_0045830 Ga0500583_0045830_849_1766 296
346 3300053130 Ga0500642_0000238 Ga0500642_0000238_11613_12515 296
347 3300053144 Ga0500585_080656 Ga0500585_080656_13_915 296
348 3300053177 Ga0500636_0002055 Ga0500636_0002055_7104_8006 296
349 3300053730 Ga0500645_000019 Ga0500645_000019_50884_51786 296
350 iso_pu_bacteria 2599185354 2600203225 296
351 iso_pu_bacteria 2830075706 2830076101 296
352 iso_pu_bacteria 2928027323 2928029405 296
353 iso_pu_bacteria 2984555340 2984556602 296
354 iso_pu_bacteria 2984564862 2984565225 296
355 iso_pu_bacteria 2993356040 2993356301 296
356 3300005262 Ga0065165_1037780 Ga0065165_10377802 297
357 3300005262 Ga0065165_1038879 Ga0065165_10388791 297
358 3300005456 Ga0070678_100052058 Ga0070678_1000520583 297
359 3300005618 Ga0068864_100017649 Ga0068864_1000176494 297
360 3300005842 Ga0068858_100000723 Ga0068858_1000007239 297
361 3300009177 Ga0105248_10547821 Ga0105248_105478212 297
362 3300013306 Ga0163162_10014044 Ga0163162_100140442 297
363 3300013306 Ga0163162_10275917 Ga0163162_102759172 297
364 3300014325 Ga0163163_10269882 Ga0163163_102698822 297
365 3300025304 Ga0209257_1024069 Ga0209257_10240693 297
366 3300025941 Ga0207711_10172504 Ga0207711_101725042 297
367 3300026035 Ga0207703_10004091 Ga0207703_1000409110 297
368 3300026095 Ga0207676_10001834 Ga0207676_1000183411 297
369 3300026116 Ga0207674_10172960 Ga0207674_101729602 297
370 3300031456 Ga0307513_10021142 Ga0307513_100211426 297
371 3300033180 Ga0307510_10000248 Ga0307510_1000024825 297
372 3300046501 Ga0495607_0008896 Ga0495607_0008896_1365_2342 297
373 3300046506 Ga0495583_0012582 Ga0495583_0012582_145_1053 297
374 3300046524 Ga0495648_0060079 Ga0495648_0060079_358_1266 297
375 3300046616 Ga0495668_0013937 Ga0495668_0013937_83_991 297
376 3300046660 Ga0495625_0194363 Ga0495625_0194363_94_1002 297
377 3300046691 Ga0495670_0000016 Ga0495670_0000016_47412_48317 297
378 3300047445 Ga0495677_0015249 Ga0495677_0015249_95_1003 297
379 3300048917 Ga0496114_0188465 Ga0496114_0188465_343_1272 297
380 3300048923 Ga0496120_0016721 Ga0496120_0016721_1872_2777 297
381 3300048926 Ga0496123_0018488 Ga0496123_0018488_2209_3114 297
382 3300048927 Ga0496124_0000354 Ga0496124_0000354_20923_21828 297
383 3300048927 Ga0496124_0027461 Ga0496124_0027461_2619_3524 297
384 3300048927 Ga0496124_0109432 Ga0496124_0109432_634_1539 297
385 3300048929 Ga0496126_0174180 Ga0496126_0174180_795_1724 297
386 3300048929 Ga0496126_0184844 Ga0496126_0184844_567_1472 297
387 3300053087 Ga0500643_001703 Ga0500643_001703_8290_9198 297
388 3300053136 Ga0500559_0042912 Ga0500559_0042912_702_1610 297
389 3300053158 Ga0500627_0167636 Ga0500627_0167636_55_960 297
390 iso_pu_bacteria 2842698319 2842701625 297
391 iso_pu_bacteria 2902330777 2902333399 297
392 iso_pu_bacteria 2990265787 2990267955 297
393 iso_pu_bacteria 2993693658 2993697027 297
394 3300005617 Ga0068859_100002837 Ga0068859_10000283720 298
395 3300005719 Ga0068861_100000109 Ga0068861_10000010934 298
396 3300006931 Ga0097620_100002837 Ga0097620_10000283720 298
397 3300009177 Ga0105248_10502025 Ga0105248_105020252 298
398 3300013102 Ga0157371_10160058 Ga0157371_101600582 298
399 3300025941 Ga0207711_10327237 Ga0207711_103272372 298
400 3300026118 Ga0207675_100000255 Ga0207675_1000002559 298
401 3300046460 Ga0495638_0007198 Ga0495638_0007198_3368_4291 298
402 iso_pu_bacteria 2643221622 2644127456 298
403 3300003773 Ga0055537_1011990 Ga0055537_10119903 299
404 3300003775 Ga0055524_1000221 Ga0055524_100022152 299
405 3300003794 Ga0055531_10011173 Ga0055531_100111731 299
406 3300005339 Ga0070660_100115988 Ga0070660_1001159882 299
407 3300005344 Ga0070661_100102198 Ga0070661_1001021982 299
408 3300005458 Ga0070681_10280189 Ga0070681_102801892 299
409 3300005530 Ga0070679_100125251 Ga0070679_1001252513 299
410 3300005539 Ga0068853_100030853 Ga0068853_1000308534 299
411 3300005563 Ga0068855_100000468 Ga0068855_10000046844 299
412 3300005614 Ga0068856_100206084 Ga0068856_1002060842 299
413 3300009093 Ga0105240_10273647 Ga0105240_102736472 299
414 3300009551 Ga0105238_10520312 Ga0105238_105203121 299
415 3300015690 Ga0183363_1003 Ga0183363_1003250 299
416 3300025273 Ga0209673_1002171 Ga0209673_100217120 299
417 3300025909 Ga0207705_10026336 Ga0207705_100263365 299
418 3300025912 Ga0207707_10274134 Ga0207707_102741341 299
419 3300025913 Ga0207695_10141239 Ga0207695_101412392 299
420 3300025920 Ga0207649_10120262 Ga0207649_101202622 299
421 3300025921 Ga0207652_10130312 Ga0207652_101303122 299
422 3300025921 Ga0207652_10428955 Ga0207652_104289552 299
423 3300025924 Ga0207694_10367958 Ga0207694_103679581 299
424 3300025949 Ga0207667_10002816 Ga0207667_1000281612 299
425 3300026041 Ga0207639_10032831 Ga0207639_100328312 299
426 3300026078 Ga0207702_10154436 Ga0207702_101544362 299
427 3300037853 Ga0436364_0551790 Ga0436364_0551790_701_1615 299
428 3300041404 Ga0439436_0053380 Ga0439436_0053380_120_1028 299
429 3300041410 Ga0439461_0000081 Ga0439461_0000081_431_1339 299
430 3300041411 Ga0439466_0032477 Ga0439466_0032477_547_1455 299
431 3300041413 Ga0439465_0001389 Ga0439465_0001389_216_1124 299
432 3300041997 Ga0439431_0000134 Ga0439431_0000134_10788_11696 299
433 3300042002 Ga0439442_003063 Ga0439442_003063_670_1578 299
434 3300042004 Ga0439445_0000905 Ga0439445_0000905_3915_4823 299
435 3300042006 Ga0439432_000152 Ga0439432_000152_18626_19534 299
436 3300042007 Ga0439449_0021174 Ga0439449_0021174_1289_2197 299
437 3300042010 Ga0439452_025818 Ga0439452_025818_86_994 299
438 3300042015 Ga0439462_0000151 Ga0439462_0000151_7726_8634 299
439 3300042435 Ga0439434_0000213 Ga0439434_0000213_12038_12946 299
440 3300047472 Ga0495686_0031244 Ga0495686_0031244_1201_2112 299
441 3300053104 Ga0500556_0006126 Ga0500556_0006126_1478_2389 299
442 3300053730 Ga0500645_003141 Ga0500645_003141_3432_4343 299
443 iso_pu_bacteria 2545555834 2545677296 299
444 iso_pu_bacteria 3003665799 3003667601 299
445 iso_pu_bacteria 641522639 641640733 299
446 3300001915 JGI24741J21665_1006080 JGI24741J21665_10060803 300
447 3300001976 JGI24752J21851_1002495 JGI24752J21851_10024953 300
448 3300001979 JGI24740J21852_10038182 JGI24740J21852_100381822 300
449 3300001989 JGI24739J22299_10033524 JGI24739J22299_100335242 300
450 3300001989 JGI24739J22299_10054056 JGI24739J22299_100540562 300
451 3300001990 JGI24737J22298_10012515 JGI24737J22298_100125153 300
452 3300002067 JGI24735J21928_10025640 JGI24735J21928_100256402 300
453 3300002075 JGI24738J21930_10015417 JGI24738J21930_100154171 300
454 3300002774 JGI25150J39212_1000189 JGI25150J39212_100018929 300
455 3300003215 JGI25153J46596_10000125 JGI25153J46596_1000012547 300
456 3300003771 Ga0055526_1008886 Ga0055526_10088862 300
457 3300003773 Ga0055537_1000787 Ga0055537_10007876 300
458 3300003773 Ga0055537_1002802 Ga0055537_10028023 300
459 3300003775 Ga0055524_1000387 Ga0055524_100038731 300
460 3300003781 Ga0055536_1038756 Ga0055536_10387561 300
461 3300003791 Ga0055530_10000269 Ga0055530_1000026940 300
462 3300003791 Ga0055530_10011428 Ga0055530_100114283 300
463 3300003791 Ga0055530_10020041 Ga0055530_100200412 300
464 3300003792 Ga0055540_1004110 Ga0055540_10041105 300
465 3300003794 Ga0055531_10000318 Ga0055531_1000031840 300
466 3300004625 Ga0055543_1009876 Ga0055543_10098762 300
467 3300005262 Ga0065165_1001532 Ga0065165_100153210 300
468 3300005262 Ga0065165_1002366 Ga0065165_100236615 300
469 3300005262 Ga0065165_1004263 Ga0065165_10042634 300
470 3300005327 Ga0070658_10009867 Ga0070658_100098677 300
471 3300005327 Ga0070658_10015184 Ga0070658_100151846 300
472 3300005327 Ga0070658_10114371 Ga0070658_101143712 300
473 3300005327 Ga0070658_10117779 Ga0070658_101177792 300
474 3300005328 Ga0070676_10082353 Ga0070676_100823532 300
475 3300005329 Ga0070683_100018140 Ga0070683_1000181406 300
476 3300005329 Ga0070683_100025921 Ga0070683_1000259216 300
477 3300005331 Ga0070670_100022250 Ga0070670_1000222505 300
478 3300005331 Ga0070670_100386006 Ga0070670_1003860061 300
479 3300005334 Ga0068869_100016838 Ga0068869_1000168384 300
480 3300005334 Ga0068869_100066878 Ga0068869_1000668782 300
481 3300005334 Ga0068869_100164656 Ga0068869_1001646562 300
482 3300005335 Ga0070666_10173768 Ga0070666_101737682 300
483 3300005336 Ga0070680_100003296 Ga0070680_1000032967 300
484 3300005336 Ga0070680_100038230 Ga0070680_1000382303 300
485 3300005336 Ga0070680_100047487 Ga0070680_1000474871 300
486 3300005336 Ga0070680_100147180 Ga0070680_1001471802 300
487 3300005337 Ga0070682_100033480 Ga0070682_1000334804 300
488 3300005337 Ga0070682_100049566 Ga0070682_1000495663 300
489 3300005338 Ga0068868_100033767 Ga0068868_1000337674 300
490 3300005339 Ga0070660_100015446 Ga0070660_1000154463 300
491 3300005339 Ga0070660_100064600 Ga0070660_1000646004 300
492 3300005339 Ga0070660_100069844 Ga0070660_1000698443 300
493 3300005340 Ga0070689_100241634 Ga0070689_1002416342 300
494 3300005341 Ga0070691_10001770 Ga0070691_100017705 300
495 3300005344 Ga0070661_100021883 Ga0070661_1000218833 300
496 3300005344 Ga0070661_100029595 Ga0070661_1000295952 300
497 3300005347 Ga0070668_100064361 Ga0070668_1000643612 300
498 3300005353 Ga0070669_100006816 Ga0070669_1000068166 300
499 3300005353 Ga0070669_100143822 Ga0070669_1001438221 300
500 3300005354 Ga0070675_100027624 Ga0070675_1000276243 300
501 3300005354 Ga0070675_100152732 Ga0070675_1001527322 300
502 3300005355 Ga0070671_100002229 Ga0070671_1000022292 300
503 3300005355 Ga0070671_100014989 Ga0070671_1000149898 300
504 3300005355 Ga0070671_100041223 Ga0070671_1000412233 300
505 3300005364 Ga0070673_100006160 Ga0070673_1000061605 300
506 3300005364 Ga0070673_100018722 Ga0070673_1000187225 300
507 3300005364 Ga0070673_100178991 Ga0070673_1001789912 300
508 3300005366 Ga0070659_100004006 Ga0070659_1000040066 300
509 3300005366 Ga0070659_100007944 Ga0070659_1000079442 300
510 3300005366 Ga0070659_100019152 Ga0070659_1000191522 300
511 3300005366 Ga0070659_100027682 Ga0070659_1000276825 300
512 3300005366 Ga0070659_100115301 Ga0070659_1001153012 300
513 3300005366 Ga0070659_100117057 Ga0070659_1001170572 300
514 3300005366 Ga0070659_100120593 Ga0070659_1001205932 300
515 3300005367 Ga0070667_100014340 Ga0070667_1000143405 300
516 3300005367 Ga0070667_100022265 Ga0070667_1000222655 300
517 3300005367 Ga0070667_100023510 Ga0070667_1000235106 300
518 3300005367 Ga0070667_100039833 Ga0070667_1000398333 300
519 3300005444 Ga0070694_100034881 Ga0070694_1000348814 300
520 3300005455 Ga0070663_100017609 Ga0070663_1000176093 300
521 3300005455 Ga0070663_100122022 Ga0070663_1001220222 300
522 3300005455 Ga0070663_100249401 Ga0070663_1002494012 300
523 3300005457 Ga0070662_100115782 Ga0070662_1001157823 300
524 3300005458 Ga0070681_10030827 Ga0070681_100308276 300
525 3300005458 Ga0070681_10053958 Ga0070681_100539582 300
526 3300005530 Ga0070679_100404038 Ga0070679_1004040381 300
527 3300005535 Ga0070684_100001970 Ga0070684_1000019706 300
528 3300005539 Ga0068853_100023982 Ga0068853_1000239825 300
529 3300005539 Ga0068853_100076818 Ga0068853_1000768182 300
530 3300005539 Ga0068853_100247384 Ga0068853_1002473842 300
531 3300005543 Ga0070672_100024461 Ga0070672_1000244613 300
532 3300005545 Ga0070695_100015510 Ga0070695_1000155104 300
533 3300005546 Ga0070696_100000325 Ga0070696_10000032513 300
534 3300005546 Ga0070696_100025395 Ga0070696_1000253955 300
535 3300005547 Ga0070693_100054683 Ga0070693_1000546833 300
536 3300005548 Ga0070665_100008797 Ga0070665_1000087972 300
537 3300005548 Ga0070665_100071179 Ga0070665_1000711792 300
538 3300005548 Ga0070665_100074754 Ga0070665_1000747543 300
539 3300005563 Ga0068855_100150706 Ga0068855_1001507062 300
540 3300005563 Ga0068855_100283884 Ga0068855_1002838842 300
541 3300005563 Ga0068855_100305039 Ga0068855_1003050392 300
542 3300005563 Ga0068855_100336688 Ga0068855_1003366881 300
543 3300005564 Ga0070664_100005465 Ga0070664_1000054652 300
544 3300005564 Ga0070664_100011359 Ga0070664_1000113593 300
545 3300005564 Ga0070664_100011682 Ga0070664_1000116822 300
546 3300005564 Ga0070664_100074109 Ga0070664_1000741093 300
547 3300005564 Ga0070664_100180736 Ga0070664_1001807362 300
548 3300005577 Ga0068857_100016562 Ga0068857_1000165625 300
549 3300005577 Ga0068857_100102730 Ga0068857_1001027302 300
550 3300005577 Ga0068857_100216769 Ga0068857_1002167692 300
551 3300005578 Ga0068854_100002336 Ga0068854_1000023363 300
552 3300005578 Ga0068854_100053156 Ga0068854_1000531563 300
553 3300005578 Ga0068854_100143193 Ga0068854_1001431932 300
554 3300005578 Ga0068854_100385002 Ga0068854_1003850022 300
555 3300005614 Ga0068856_100165255 Ga0068856_1001652552 300
556 3300005614 Ga0068856_100262852 Ga0068856_1002628522 300
557 3300005616 Ga0068852_100005304 Ga0068852_1000053041 300
558 3300005616 Ga0068852_100094326 Ga0068852_1000943262 300
559 3300005616 Ga0068852_100729260 Ga0068852_1007292601 300
560 3300005617 Ga0068859_100000104 Ga0068859_10000010481 300
561 3300005617 Ga0068859_100019147 Ga0068859_1000191472 300
562 3300005617 Ga0068859_100064186 Ga0068859_1000641863 300
563 3300005617 Ga0068859_100076580 Ga0068859_1000765803 300
564 3300005618 Ga0068864_100000118 Ga0068864_10000011861 300
565 3300005618 Ga0068864_100003096 Ga0068864_10000309611 300
566 3300005618 Ga0068864_100003259 Ga0068864_1000032594 300
567 3300005618 Ga0068864_100141363 Ga0068864_1001413631 300
568 3300005719 Ga0068861_100167586 Ga0068861_1001675862 300
569 3300005834 Ga0068851_10020234 Ga0068851_100202343 300
570 3300005841 Ga0068863_100000152 Ga0068863_10000015259 300
571 3300005841 Ga0068863_100015933 Ga0068863_1000159332 300
572 3300005841 Ga0068863_100020111 Ga0068863_1000201114 300
573 3300005841 Ga0068863_100040042 Ga0068863_1000400422 300
574 3300005841 Ga0068863_100066623 Ga0068863_1000666231 300
575 3300005841 Ga0068863_100066670 Ga0068863_1000666703 300
576 3300005842 Ga0068858_100000274 Ga0068858_10000027418 300
577 3300005842 Ga0068858_100000561 Ga0068858_10000056112 300
578 3300005842 Ga0068858_100025676 Ga0068858_1000256766 300
579 3300005843 Ga0068860_100003623 Ga0068860_10000362311 300
580 3300005843 Ga0068860_100004806 Ga0068860_1000048065 300
581 3300005843 Ga0068860_100007728 Ga0068860_1000077282 300
582 3300005843 Ga0068860_100072001 Ga0068860_1000720012 300
583 3300005844 Ga0068862_100001201 Ga0068862_1000012019 300
584 3300005844 Ga0068862_100090943 Ga0068862_1000909432 300
585 3300005844 Ga0068862_100139938 Ga0068862_1001399383 300
586 3300006237 Ga0097621_100051110 Ga0097621_1000511102 300
587 3300006237 Ga0097621_100273498 Ga0097621_1002734982 300
588 3300006358 Ga0068871_100012676 Ga0068871_1000126765 300
589 3300006358 Ga0068871_100051342 Ga0068871_1000513422 300
590 3300006844 Ga0075428_100442091 Ga0075428_1004420912 300
591 3300006931 Ga0097620_100000104 Ga0097620_10000010481 300
592 3300006931 Ga0097620_100019145 Ga0097620_1000191456 300
593 3300006931 Ga0097620_100064190 Ga0097620_1000641903 300
594 3300006931 Ga0097620_100076580 Ga0097620_1000765803 300
595 3300009093 Ga0105240_10251832 Ga0105240_102518322 300
596 3300009093 Ga0105240_10262200 Ga0105240_102622002 300
597 3300009094 Ga0111539_10096650 Ga0111539_100966503 300
598 3300009098 Ga0105245_10030282 Ga0105245_100302824 300
599 3300009147 Ga0114129_10380427 Ga0114129_103804272 300
600 3300009174 Ga0105241_10164866 Ga0105241_101648661 300
601 3300009174 Ga0105241_10209566 Ga0105241_102095662 300
602 3300009174 Ga0105241_10213212 Ga0105241_102132122 300
603 3300009177 Ga0105248_10000295 Ga0105248_1000029556 300
604 3300009177 Ga0105248_10045875 Ga0105248_100458753 300
605 3300009177 Ga0105248_10058317 Ga0105248_100583174 300
606 3300009545 Ga0105237_10022015 Ga0105237_100220156 300
607 3300009545 Ga0105237_10036941 Ga0105237_100369415 300
608 3300009551 Ga0105238_10002027 Ga0105238_100020278 300
609 3300009551 Ga0105238_10096439 Ga0105238_100964392 300
610 3300009553 Ga0105249_10006352 Ga0105249_100063524 300
611 3300009553 Ga0105249_10051833 Ga0105249_100518332 300
612 3300011119 Ga0105246_10039643 Ga0105246_100396432 300
613 3300013100 Ga0157373_10010481 Ga0157373_100104812 300
614 3300013100 Ga0157373_10013343 Ga0157373_100133436 300
615 3300013100 Ga0157373_10022838 Ga0157373_100228383 300
616 3300013100 Ga0157373_10165562 Ga0157373_101655622 300
617 3300013102 Ga0157371_10087118 Ga0157371_100871183 300
618 3300013104 Ga0157370_10069540 Ga0157370_100695402 300
619 3300013105 Ga0157369_10004697 Ga0157369_100046978 300
620 3300013306 Ga0163162_10045213 Ga0163162_100452134 300
621 3300013306 Ga0163162_10365752 Ga0163162_103657522 300
622 3300013307 Ga0157372_10023486 Ga0157372_100234862 300
623 3300013307 Ga0157372_10427514 Ga0157372_104275142 300
624 3300013307 Ga0157372_10580103 Ga0157372_105801032 300
625 3300014325 Ga0163163_10000882 Ga0163163_1000088217 300
626 3300014325 Ga0163163_10027458 Ga0163163_100274583 300
627 3300014968 Ga0157379_10004680 Ga0157379_100046809 300
628 3300014968 Ga0157379_10025399 Ga0157379_100253994 300
629 3300020070 Ga0206356_10373769 Ga0206356_103737692 300
630 3300020082 Ga0206353_10996392 Ga0206353_109963921 300
631 3300020082 Ga0206353_12001773 Ga0206353_120017733 300
632 3300021388 Ga0213875_10000636 Ga0213875_1000063611 300
633 3300025245 Ga0207425_1000005 Ga0207425_1000005866 300
634 3300025258 Ga0209129_1000345 Ga0209129_100034529 300
635 3300025263 Ga0209565_1000029 Ga0209565_1000029235 300
636 3300025263 Ga0209565_1000052 Ga0209565_1000052189 300
637 3300025263 Ga0209565_1009556 Ga0209565_10095563 300
638 3300025272 Ga0209455_1004431 Ga0209455_10044312 300
639 3300025273 Ga0209673_1002668 Ga0209673_100266810 300
640 3300025292 Ga0209676_1005902 Ga0209676_10059027 300
641 3300025294 Ga0209025_1000855 Ga0209025_100085519 300
642 3300025295 Ga0209564_1000866 Ga0209564_100086624 300
643 3300025295 Ga0209564_1012788 Ga0209564_10127883 300
644 3300025297 Ga0209758_1000002 Ga0209758_1000002479 300
645 3300025297 Ga0209758_1025935 Ga0209758_10259352 300
646 3300025298 Ga0209050_1000001 Ga0209050_1000001431 300
647 3300025298 Ga0209050_1000167 Ga0209050_1000167140 300
648 3300025298 Ga0209050_1007940 Ga0209050_10079403 300
649 3300025299 Ga0209256_1000008 Ga0209256_1000008843 300
650 3300025303 Ga0209051_1000297 Ga0209051_10002973 300
651 3300025304 Ga0209257_1000028 Ga0209257_1000028596 300
652 3300025304 Ga0209257_1002675 Ga0209257_10026758 300
653 3300025304 Ga0209257_1002709 Ga0209257_10027098 300
654 3300025315 Ga0207697_10042941 Ga0207697_100429412 300
655 3300025321 Ga0207656_10031488 Ga0207656_100314883 300
656 3300025321 Ga0207656_10115232 Ga0207656_101152322 300
657 3300025901 Ga0207688_10087546 Ga0207688_100875462 300
658 3300025904 Ga0207647_10003935 Ga0207647_100039357 300
659 3300025904 Ga0207647_10091413 Ga0207647_100914132 300
660 3300025907 Ga0207645_10093955 Ga0207645_100939552 300
661 3300025907 Ga0207645_10174161 Ga0207645_101741611 300
662 3300025909 Ga0207705_10006485 Ga0207705_100064859 300
663 3300025909 Ga0207705_10034863 Ga0207705_100348633 300
664 3300025909 Ga0207705_10036465 Ga0207705_100364652 300
665 3300025909 Ga0207705_10188398 Ga0207705_101883982 300
666 3300025909 Ga0207705_10204979 Ga0207705_102049792 300
667 3300025912 Ga0207707_10172064 Ga0207707_101720642 300
668 3300025912 Ga0207707_10282574 Ga0207707_102825742 300
669 3300025913 Ga0207695_10022835 Ga0207695_100228354 300
670 3300025917 Ga0207660_10002059 Ga0207660_1000205910 300
671 3300025917 Ga0207660_10030179 Ga0207660_100301792 300
672 3300025917 Ga0207660_10201067 Ga0207660_102010672 300
673 3300025919 Ga0207657_10002117 Ga0207657_1000211710 300
674 3300025919 Ga0207657_10003558 Ga0207657_100035587 300
675 3300025919 Ga0207657_10005570 Ga0207657_100055706 300
676 3300025919 Ga0207657_10038901 Ga0207657_100389015 300
677 3300025919 Ga0207657_10049022 Ga0207657_100490223 300
678 3300025920 Ga0207649_10020563 Ga0207649_100205634 300
679 3300025920 Ga0207649_10034748 Ga0207649_100347482 300
680 3300025920 Ga0207649_10061294 Ga0207649_100612943 300
681 3300025921 Ga0207652_10082118 Ga0207652_100821182 300
682 3300025921 Ga0207652_10126857 Ga0207652_101268572 300
683 3300025921 Ga0207652_10171552 Ga0207652_101715523 300
684 3300025921 Ga0207652_10398027 Ga0207652_103980272 300
685 3300025921 Ga0207652_10523714 Ga0207652_105237141 300
686 3300025923 Ga0207681_10444687 Ga0207681_104446871 300
687 3300025924 Ga0207694_10082193 Ga0207694_100821933 300
688 3300025925 Ga0207650_10105107 Ga0207650_101051073 300
689 3300025926 Ga0207659_10066375 Ga0207659_100663751 300
690 3300025927 Ga0207687_10049796 Ga0207687_100497963 300
691 3300025931 Ga0207644_10000052 Ga0207644_10000052104 300
692 3300025931 Ga0207644_10112012 Ga0207644_101120122 300
693 3300025931 Ga0207644_10223483 Ga0207644_102234832 300
694 3300025932 Ga0207690_10076960 Ga0207690_100769603 300
695 3300025932 Ga0207690_10107485 Ga0207690_101074852 300
696 3300025932 Ga0207690_10162215 Ga0207690_101622153 300
697 3300025932 Ga0207690_10170013 Ga0207690_101700132 300
698 3300025932 Ga0207690_10328257 Ga0207690_103282572 300
699 3300025933 Ga0207706_10003116 Ga0207706_100031169 300
700 3300025933 Ga0207706_10026051 Ga0207706_100260517 300
701 3300025933 Ga0207706_10066126 Ga0207706_100661261 300
702 3300025933 Ga0207706_10292387 Ga0207706_102923872 300
703 3300025936 Ga0207670_10145285 Ga0207670_101452852 300
704 3300025937 Ga0207669_10028122 Ga0207669_100281221 300
705 3300025940 Ga0207691_10036585 Ga0207691_100365854 300
706 3300025940 Ga0207691_10087562 Ga0207691_100875623 300
707 3300025941 Ga0207711_10000153 Ga0207711_1000015322 300
708 3300025941 Ga0207711_10011668 Ga0207711_100116687 300
709 3300025941 Ga0207711_10089499 Ga0207711_100894992 300
710 3300025941 Ga0207711_10165514 Ga0207711_101655142 300
711 3300025941 Ga0207711_10459114 Ga0207711_104591141 300
712 3300025942 Ga0207689_10093499 Ga0207689_100934992 300
713 3300025942 Ga0207689_10105177 Ga0207689_101051772 300
714 3300025944 Ga0207661_10016501 Ga0207661_100165016 300
715 3300025944 Ga0207661_10089152 Ga0207661_100891522 300
716 3300025945 Ga0207679_10170520 Ga0207679_101705202 300
717 3300025945 Ga0207679_10202423 Ga0207679_102024232 300
718 3300025945 Ga0207679_10214166 Ga0207679_102141662 300
719 3300025945 Ga0207679_10235480 Ga0207679_102354801 300
720 3300025949 Ga0207667_10220220 Ga0207667_102202202 300
721 3300025960 Ga0207651_10131110 Ga0207651_101311102 300
722 3300025960 Ga0207651_10223588 Ga0207651_102235882 300
723 3300025961 Ga0207712_10010885 Ga0207712_100108854 300
724 3300025961 Ga0207712_10030000 Ga0207712_100300002 300
725 3300025972 Ga0207668_10070992 Ga0207668_100709923 300
726 3300025981 Ga0207640_10009825 Ga0207640_100098255 300
727 3300025981 Ga0207640_10118678 Ga0207640_101186782 300
728 3300025981 Ga0207640_10124510 Ga0207640_101245102 300
729 3300025986 Ga0207658_10003813 Ga0207658_100038139 300
730 3300025986 Ga0207658_10020099 Ga0207658_100200996 300
731 3300025986 Ga0207658_10034220 Ga0207658_100342203 300
732 3300025986 Ga0207658_10102527 Ga0207658_101025272 300
733 3300025986 Ga0207658_10162940 Ga0207658_101629402 300
734 3300026023 Ga0207677_10012718 Ga0207677_100127184 300
735 3300026035 Ga0207703_10001033 Ga0207703_1000103318 300
736 3300026035 Ga0207703_10004901 Ga0207703_100049017 300
737 3300026035 Ga0207703_10087222 Ga0207703_100872223 300
738 3300026041 Ga0207639_10050815 Ga0207639_100508153 300
739 3300026041 Ga0207639_10091673 Ga0207639_100916732 300
740 3300026041 Ga0207639_10093055 Ga0207639_100930553 300
741 3300026067 Ga0207678_10000680 Ga0207678_1000068012 300
742 3300026067 Ga0207678_10004958 Ga0207678_100049585 300
743 3300026067 Ga0207678_10023620 Ga0207678_100236203 300
744 3300026067 Ga0207678_10059541 Ga0207678_100595412 300
745 3300026067 Ga0207678_10119066 Ga0207678_101190663 300
746 3300026078 Ga0207702_10003537 Ga0207702_100035377 300
747 3300026078 Ga0207702_10021712 Ga0207702_100217122 300
748 3300026078 Ga0207702_10285661 Ga0207702_102856612 300
749 3300026078 Ga0207702_10536686 Ga0207702_105366862 300
750 3300026088 Ga0207641_10000205 Ga0207641_1000020556 300
751 3300026088 Ga0207641_10004589 Ga0207641_100045893 300
752 3300026088 Ga0207641_10018768 Ga0207641_100187687 300
753 3300026088 Ga0207641_10090902 Ga0207641_100909022 300
754 3300026088 Ga0207641_10099749 Ga0207641_100997492 300
755 3300026095 Ga0207676_10001710 Ga0207676_100017108 300
756 3300026095 Ga0207676_10006981 Ga0207676_100069812 300
757 3300026095 Ga0207676_10012120 Ga0207676_100121206 300
758 3300026095 Ga0207676_10061808 Ga0207676_100618083 300
759 3300026116 Ga0207674_10000284 Ga0207674_100002846 300
760 3300026116 Ga0207674_10004022 Ga0207674_100040226 300
761 3300026116 Ga0207674_10004819 Ga0207674_1000481910 300
762 3300026116 Ga0207674_10012727 Ga0207674_100127276 300
763 3300026118 Ga0207675_100071737 Ga0207675_1000717372 300
764 3300026118 Ga0207675_100376066 Ga0207675_1003760661 300
765 3300026121 Ga0207683_10003233 Ga0207683_1000323310 300
766 3300026142 Ga0207698_10003975 Ga0207698_100039758 300
767 3300026142 Ga0207698_10026953 Ga0207698_100269535 300
768 3300028379 Ga0268266_10008582 Ga0268266_100085822 300
769 3300028379 Ga0268266_10377681 Ga0268266_103776812 300
770 3300028380 Ga0268265_10000972 Ga0268265_100009729 300
771 3300028380 Ga0268265_10025582 Ga0268265_100255822 300
772 3300028380 Ga0268265_10149800 Ga0268265_101498002 300
773 3300028380 Ga0268265_10251546 Ga0268265_102515462 300
774 3300028381 Ga0268264_10000645 Ga0268264_1000064526 300
775 3300028381 Ga0268264_10003344 Ga0268264_100033445 300
776 3300028381 Ga0268264_10046997 Ga0268264_100469972 300
777 3300028381 Ga0268264_10131719 Ga0268264_101317192 300
778 3300028381 Ga0268264_10172584 Ga0268264_101725842 300
779 3300028794 Ga0307515_10288239 Ga0307515_102882392 300
780 3300031548 Ga0307408_100021735 Ga0307408_1000217352 300
781 3300031731 Ga0307405_10219015 Ga0307405_102190152 300
782 3300031824 Ga0307413_10008683 Ga0307413_100086835 300
783 3300031852 Ga0307410_10082071 Ga0307410_100820712 300
784 3300031901 Ga0307406_10010818 Ga0307406_100108186 300
785 3300031903 Ga0307407_10043436 Ga0307407_100434362 300
786 3300031903 Ga0307407_10300882 Ga0307407_103008821 300
787 3300031995 Ga0307409_100176297 Ga0307409_1001762972 300
788 3300031995 Ga0307409_100597173 Ga0307409_1005971731 300
789 3300032002 Ga0307416_100263142 Ga0307416_1002631422 300
790 3300032002 Ga0307416_100490352 Ga0307416_1004903522 300
791 3300032004 Ga0307414_10032046 Ga0307414_100320464 300
792 3300032004 Ga0307414_10080498 Ga0307414_100804982 300
793 3300032004 Ga0307414_10100857 Ga0307414_101008572 300
794 3300032005 Ga0307411_10180873 Ga0307411_101808732 300
795 3300032005 Ga0307411_10234088 Ga0307411_102340881 300
796 3300032126 Ga0307415_100112216 Ga0307415_1001122163 300
797 3300032126 Ga0307415_100162034 Ga0307415_1001620341 300
798 3300037312 Ga0395899_0077243 Ga0395899_0077243_484_1395 300
799 3300037312 Ga0395899_0130846 Ga0395899_0130846_774_1691 300
800 3300037418 Ga0395900_0006155 Ga0395900_0006155_10568_11479 300
801 3300037418 Ga0395900_0010551 Ga0395900_0010551_8398_9312 300
802 3300037418 Ga0395900_0018554 Ga0395900_0018554_4898_5815 300
803 3300037418 Ga0395900_0053239 Ga0395900_0053239_1074_1985 300
804 3300037418 Ga0395900_0090942 Ga0395900_0090942_211_1128 300
805 3300037418 Ga0395900_0120339 Ga0395900_0120339_410_1324 300
806 3300037418 Ga0395900_0279352 Ga0395900_0279352_200_1111 300
807 3300037418 Ga0395900_0358415 Ga0395900_0358415_196_1107 300
808 3300037466 Ga0395898_0032517 Ga0395898_0032517_738_1649 300
809 3300037466 Ga0395898_0223001 Ga0395898_0223001_446_1357 300
810 3300037466 Ga0395898_0292281 Ga0395898_0292281_11_925 300
811 3300037466 Ga0395898_0363665 Ga0395898_0363665_138_1049 300
812 3300037471 Ga0395905_0000232 Ga0395905_0000232_64243_65154 300
813 3300037471 Ga0395905_0028518 Ga0395905_0028518_3558_4472 300
814 3300037471 Ga0395905_0048257 Ga0395905_0048257_2093_3004 300
815 3300037471 Ga0395905_0066004 Ga0395905_0066004_695_1609 300
816 3300037471 Ga0395905_0153646 Ga0395905_0153646_1112_2026 300
817 3300037471 Ga0395905_0310815 Ga0395905_0310815_263_1177 300
818 3300037471 Ga0395905_0412896 Ga0395905_0412896_275_1186 300
819 3300037853 Ga0436364_0786820 Ga0436364_0786820_53_967 300
820 3300037853 Ga0436364_0816160 Ga0436364_0816160_6572_7489 300
821 3300038443 Ga0395901_0024797 Ga0395901_0024797_1737_2648 300
822 3300038443 Ga0395901_0056296 Ga0395901_0056296_1577_2491 300
823 3300038443 Ga0395901_0250660 Ga0395901_0250660_618_1529 300
824 3300038443 Ga0395901_0521418 Ga0395901_0521418_160_1074 300
825 3300041413 Ga0439465_0028487 Ga0439465_0028487_208_1122 300
826 3300041997 Ga0439431_0029888 Ga0439431_0029888_164_1078 300
827 3300042015 Ga0439462_0004098 Ga0439462_0004098_857_1771 300
828 3300042121 Ga0450919_004896 Ga0450919_004896_171_1085 300
829 3300042122 Ga0450920_009964 Ga0450920_009964_413_1327 300
830 3300042144 Ga0450889_000118 Ga0450889_000118_4552_5466 300
831 3300042156 Ga0439446_0038448 Ga0439446_0038448_210_1124 300
832 3300044693 Ga0466961_0067645 Ga0466961_0067645_547_1458 300
833 3300044694 Ga0466963_0212209 Ga0466963_0212209_240_1154 300
834 3300044694 Ga0466963_0337181 Ga0466963_0337181_108_1019 300
835 3300044719 Ga0466971_0074812 Ga0466971_0074812_212_1123 300
836 3300045049 Ga0466959_0292751 Ga0466959_0292751_34_945 300
837 3300045049 Ga0466959_0304717 Ga0466959_0304717_155_1066 300
838 3300045836 Ga0466958_0191725 Ga0466958_0191725_11_922 300
839 3300045976 Ga0466967_0012308 Ga0466967_0012308_2190_3101 300
840 3300045976 Ga0466967_0478654 Ga0466967_0478654_154_1065 300
841 3300046524 Ga0495648_0033863 Ga0495648_0033863_733_1653 300
842 3300046616 Ga0495668_0005543 Ga0495668_0005543_454_1368 300
843 3300046616 Ga0495668_0064687 Ga0495668_0064687_817_1731 300
844 3300046684 Ga0495669_0003419 Ga0495669_0003419_3580_4494 300
845 3300046684 Ga0495669_0017312 Ga0495669_0017312_1244_2158 300
846 3300046684 Ga0495669_0019801 Ga0495669_0019801_1693_2607 300
847 3300047470 Ga0495681_0026507 Ga0495681_0026507_184_1098 300
848 3300047472 Ga0495686_0115656 Ga0495686_0115656_20_946 300
849 3300048903 Ga0496100_0408691 Ga0496100_0408691_51_962 300
850 3300048905 Ga0496102_0013635 Ga0496102_0013635_833_1750 300
851 3300048906 Ga0496103_0020370 Ga0496103_0020370_832_1749 300
852 3300048907 Ga0496104_0200548 Ga0496104_0200548_860_1777 300
853 3300048910 Ga0496107_0060793 Ga0496107_0060793_1034_1951 300
854 3300048910 Ga0496107_0112532 Ga0496107_0112532_566_1480 300
855 3300048910 Ga0496107_0209131 Ga0496107_0209131_436_1353 300
856 3300048911 Ga0496108_0003272 Ga0496108_0003272_4594_5511 300
857 3300048911 Ga0496108_0238511 Ga0496108_0238511_574_1488 300
858 3300048912 Ga0496109_0017884 Ga0496109_0017884_4827_5744 300
859 3300048913 Ga0496110_0008670 Ga0496110_0008670_4539_5456 300
860 3300048914 Ga0496111_0007263 Ga0496111_0007263_1306_2223 300
861 3300048915 Ga0496112_0018560 Ga0496112_0018560_211_1128 300
862 3300048916 Ga0496113_0010090 Ga0496113_0010090_3681_4598 300
863 3300048916 Ga0496113_0223916 Ga0496113_0223916_276_1187 300
864 3300048918 Ga0496115_0004300 Ga0496115_0004300_6352_7266 300
865 3300048924 Ga0496121_0182928 Ga0496121_0182928_138_1058 300
866 3300048926 Ga0496123_0102011 Ga0496123_0102011_656_1576 300
867 3300048928 Ga0496125_0151987 Ga0496125_0151987_57_971 300
868 3300049583 Ga0501067_0013236 Ga0501067_0013236_2810_3724 300
869 3300049584 Ga0501068_0061284 Ga0501068_0061284_369_1283 300
870 3300049758 Ga0501241_003853 Ga0501241_003853_1831_2745 300
871 3300049823 Ga0501044_0123466 Ga0501044_0123466_600_1517 300
872 3300050507 nmdc:mga05p37_458637_c1 nmdc:mga05p37_458637_c1_324_1238 300
873 3300050511 nmdc:mga08y16_44274_c1 nmdc:mga08y16_44274_c1_2703_3617 300
874 3300053134 Ga0500658_0000147 Ga0500658_0000147_19851_20765 300
875 3300053151 Ga0500604_0038234 Ga0500604_0038234_364_1278 300
876 3300061719 Ga0466962_0112577 Ga0466962_0112577_141_1052 300
877 iso_pu_bacteria 2895880812 2895885859 300
878 3300002067 JGI24735J21928_10003192 JGI24735J21928_100031922 301
879 3300002067 JGI24735J21928_10012661 JGI24735J21928_100126613 301
880 3300002067 JGI24735J21928_10017883 JGI24735J21928_100178833 301
881 3300002075 JGI24738J21930_10001121 JGI24738J21930_100011216 301
882 3300003214 JGI25165J46597_1000023 JGI25165J46597_1000023246 301
883 3300003762 Ga0055542_1006997 Ga0055542_10069972 301
884 3300005293 Ga0065715_10213345 Ga0065715_102133451 301
885 3300005327 Ga0070658_10000143 Ga0070658_100001436 301
886 3300005327 Ga0070658_10036159 Ga0070658_100361593 301
887 3300005327 Ga0070658_10135797 Ga0070658_101357973 301
888 3300005328 Ga0070676_10000104 Ga0070676_1000010428 301
889 3300005328 Ga0070676_10067142 Ga0070676_100671422 301
890 3300005331 Ga0070670_100035125 Ga0070670_1000351252 301
891 3300005334 Ga0068869_100002907 Ga0068869_1000029079 301
892 3300005335 Ga0070666_10074837 Ga0070666_100748372 301
893 3300005339 Ga0070660_100002030 Ga0070660_1000020306 301
894 3300005339 Ga0070660_100011462 Ga0070660_1000114626 301
895 3300005339 Ga0070660_100044942 Ga0070660_1000449423 301
896 3300005339 Ga0070660_100224655 Ga0070660_1002246551 301
897 3300005347 Ga0070668_100000011 Ga0070668_1000000118 301
898 3300005347 Ga0070668_100022525 Ga0070668_1000225255 301
899 3300005347 Ga0070668_100044453 Ga0070668_1000444534 301
900 3300005353 Ga0070669_100029782 Ga0070669_1000297824 301
901 3300005353 Ga0070669_100033355 Ga0070669_1000333553 301
902 3300005353 Ga0070669_100058340 Ga0070669_1000583403 301
903 3300005355 Ga0070671_100000707 Ga0070671_10000070712 301
904 3300005355 Ga0070671_100114964 Ga0070671_1001149642 301
905 3300005356 Ga0070674_100051126 Ga0070674_1000511263 301
906 3300005364 Ga0070673_100035764 Ga0070673_1000357643 301
907 3300005366 Ga0070659_100125475 Ga0070659_1001254752 301
908 3300005458 Ga0070681_10076524 Ga0070681_100765243 301
909 3300005530 Ga0070679_100120739 Ga0070679_1001207393 301
910 3300005530 Ga0070679_100196527 Ga0070679_1001965273 301
911 3300005539 Ga0068853_100013443 Ga0068853_1000134434 301
912 3300005539 Ga0068853_100033970 Ga0068853_1000339704 301
913 3300005539 Ga0068853_100091868 Ga0068853_1000918682 301
914 3300005548 Ga0070665_100010552 Ga0070665_1000105529 301
915 3300005548 Ga0070665_100103312 Ga0070665_1001033122 301
916 3300005563 Ga0068855_100000207 Ga0068855_10000020757 301
917 3300005563 Ga0068855_100634770 Ga0068855_1006347701 301
918 3300005564 Ga0070664_100101369 Ga0070664_1001013693 301
919 3300005578 Ga0068854_100000874 Ga0068854_1000008746 301
920 3300005614 Ga0068856_100022632 Ga0068856_1000226325 301
921 3300005718 Ga0068866_10063726 Ga0068866_100637262 301
922 3300005841 Ga0068863_100000186 Ga0068863_1000001869 301
923 3300005844 Ga0068862_100026085 Ga0068862_1000260853 301
924 3300005844 Ga0068862_100028111 Ga0068862_1000281115 301
925 3300006237 Ga0097621_100082125 Ga0097621_1000821252 301
926 3300006881 Ga0068865_100000005 Ga0068865_100000005215 301
927 3300009545 Ga0105237_10066353 Ga0105237_100663532 301
928 3300009553 Ga0105249_10077586 Ga0105249_100775862 301
929 3300013100 Ga0157373_10162908 Ga0157373_101629082 301
930 3300013102 Ga0157371_10040988 Ga0157371_100409882 301
931 3300013105 Ga0157369_10362366 Ga0157369_103623661 301
932 3300013306 Ga0163162_10128767 Ga0163162_101287672 301
933 3300013307 Ga0157372_10406939 Ga0157372_104069391 301
934 3300025231 Ga0207427_101779 Ga0207427_1017793 301
935 3300025250 Ga0209026_1002697 Ga0209026_10026979 301
936 3300025254 Ga0209148_1000301 Ga0209148_100030164 301
937 3300025254 Ga0209148_1001740 Ga0209148_100174010 301
938 3300025261 Ga0209233_1000003 Ga0209233_10000031084 301
939 3300025272 Ga0209455_1000467 Ga0209455_10004678 301
940 3300025893 Ga0207682_10000970 Ga0207682_1000097010 301
941 3300025903 Ga0207680_10056507 Ga0207680_100565073 301
942 3300025904 Ga0207647_10000643 Ga0207647_100006438 301
943 3300025904 Ga0207647_10002316 Ga0207647_1000231613 301
944 3300025904 Ga0207647_10014925 Ga0207647_100149254 301
945 3300025907 Ga0207645_10002875 Ga0207645_100028758 301
946 3300025909 Ga0207705_10000046 Ga0207705_10000046158 301
947 3300025909 Ga0207705_10000299 Ga0207705_100002996 301
948 3300025909 Ga0207705_10002601 Ga0207705_100026013 301
949 3300025909 Ga0207705_10083029 Ga0207705_100830292 301
950 3300025912 Ga0207707_10053752 Ga0207707_100537522 301
951 3300025913 Ga0207695_10012484 Ga0207695_1001248412 301
952 3300025914 Ga0207671_10031862 Ga0207671_100318626 301
953 3300025917 Ga0207660_10016210 Ga0207660_100162102 301
954 3300025917 Ga0207660_10292345 Ga0207660_102923452 301
955 3300025919 Ga0207657_10004994 Ga0207657_1000499411 301
956 3300025919 Ga0207657_10007755 Ga0207657_100077558 301
957 3300025919 Ga0207657_10046247 Ga0207657_100462474 301
958 3300025919 Ga0207657_10167370 Ga0207657_101673702 301
959 3300025921 Ga0207652_10093551 Ga0207652_100935513 301
960 3300025921 Ga0207652_10150879 Ga0207652_101508793 301
961 3300025923 Ga0207681_10029445 Ga0207681_100294453 301
962 3300025923 Ga0207681_10447058 Ga0207681_104470581 301
963 3300025925 Ga0207650_10035436 Ga0207650_100354364 301
964 3300025925 Ga0207650_10038261 Ga0207650_100382612 301
965 3300025925 Ga0207650_10075913 Ga0207650_100759133 301
966 3300025925 Ga0207650_10214693 Ga0207650_102146932 301
967 3300025926 Ga0207659_10013860 Ga0207659_100138604 301
968 3300025926 Ga0207659_10260604 Ga0207659_102606041 301
969 3300025927 Ga0207687_10010131 Ga0207687_100101315 301
970 3300025931 Ga0207644_10000032 Ga0207644_1000003212 301
971 3300025932 Ga0207690_10016682 Ga0207690_100166822 301
972 3300025933 Ga0207706_10021858 Ga0207706_100218586 301
973 3300025933 Ga0207706_10041512 Ga0207706_100415124 301
974 3300025934 Ga0207686_10005035 Ga0207686_100050353 301
975 3300025935 Ga0207709_10000051 Ga0207709_1000005110 301
976 3300025937 Ga0207669_10057581 Ga0207669_100575812 301
977 3300025938 Ga0207704_10000001 Ga0207704_10000001230 301
978 3300025940 Ga0207691_10011367 Ga0207691_100113676 301
979 3300025940 Ga0207691_10088679 Ga0207691_100886792 301
980 3300025942 Ga0207689_10005027 Ga0207689_100050278 301
981 3300025949 Ga0207667_10000024 Ga0207667_10000024210 301
982 3300025960 Ga0207651_10000006 Ga0207651_100000069 301
983 3300025960 Ga0207651_10073534 Ga0207651_100735343 301
984 3300025961 Ga0207712_10002585 Ga0207712_100025858 301
985 3300025961 Ga0207712_10237933 Ga0207712_102379332 301
986 3300025972 Ga0207668_10000034 Ga0207668_100000349 301
987 3300025972 Ga0207668_10022336 Ga0207668_100223364 301
988 3300025981 Ga0207640_10000109 Ga0207640_1000010961 301
989 3300025981 Ga0207640_10013565 Ga0207640_100135652 301
990 3300026023 Ga0207677_10000156 Ga0207677_100001569 301
991 3300026041 Ga0207639_10192547 Ga0207639_101925472 301
992 3300026067 Ga0207678_10003120 Ga0207678_100031202 301
993 3300026067 Ga0207678_10228415 Ga0207678_102284152 301
994 3300026078 Ga0207702_10005016 Ga0207702_100050168 301
995 3300026088 Ga0207641_10000031 Ga0207641_10000031220 301
996 3300026089 Ga0207648_10000363 Ga0207648_1000036342 301
997 3300026095 Ga0207676_10060246 Ga0207676_100602464 301
998 3300026116 Ga0207674_10028832 Ga0207674_100288323 301
999 3300027876 Ga0209974_10021647 Ga0209974_100216472 301
1000 3300027876 Ga0209974_10029267 Ga0209974_100292672 301
1001 3300028379 Ga0268266_10273355 Ga0268266_102733551 301
1002 3300028380 Ga0268265_10130476 Ga0268265_101304763 301
1003 3300031548 Ga0307408_100053685 Ga0307408_1000536853 301
1004 3300031731 Ga0307405_10104681 Ga0307405_101046812 301
1005 3300031824 Ga0307413_10111929 Ga0307413_101119292 301
1006 3300031824 Ga0307413_10115938 Ga0307413_101159382 301
1007 3300031824 Ga0307413_10138495 Ga0307413_101384952 301
1008 3300031852 Ga0307410_10001691 Ga0307410_100016919 301
1009 3300031852 Ga0307410_10015931 Ga0307410_100159313 301
1010 3300031852 Ga0307410_10057510 Ga0307410_100575103 301
1011 3300031852 Ga0307410_10064707 Ga0307410_100647073 301
1012 3300031852 Ga0307410_10071379 Ga0307410_100713792 301
1013 3300031852 Ga0307410_10081235 Ga0307410_100812352 301
1014 3300031852 Ga0307410_10104263 Ga0307410_101042633 301
1015 3300031852 Ga0307410_10252591 Ga0307410_102525912 301
1016 3300031901 Ga0307406_10014221 Ga0307406_100142212 301
1017 3300031901 Ga0307406_10030679 Ga0307406_100306792 301
1018 3300031901 Ga0307406_10253402 Ga0307406_102534021 301
1019 3300031903 Ga0307407_10076751 Ga0307407_100767512 301
1020 3300031911 Ga0307412_10010753 Ga0307412_100107536 301
1021 3300031911 Ga0307412_10015861 Ga0307412_100158615 301
1022 3300031911 Ga0307412_10026558 Ga0307412_100265582 301
1023 3300031911 Ga0307412_10131208 Ga0307412_101312081 301
1024 3300031911 Ga0307412_10258661 Ga0307412_102586612 301
1025 3300031995 Ga0307409_100003480 Ga0307409_1000034808 301
1026 3300031995 Ga0307409_100008340 Ga0307409_1000083403 301
1027 3300031995 Ga0307409_100014339 Ga0307409_1000143395 301
1028 3300031995 Ga0307409_100090909 Ga0307409_1000909091 301
1029 3300031995 Ga0307409_100162794 Ga0307409_1001627942 301
1030 3300031995 Ga0307409_100178903 Ga0307409_1001789031 301
1031 3300031995 Ga0307409_100196260 Ga0307409_1001962602 301
1032 3300032002 Ga0307416_100008527 Ga0307416_1000085273 301
1033 3300032002 Ga0307416_100009876 Ga0307416_1000098766 301
1034 3300032002 Ga0307416_100032224 Ga0307416_1000322242 301
1035 3300032002 Ga0307416_100120714 Ga0307416_1001207142 301
1036 3300032002 Ga0307416_100206387 Ga0307416_1002063872 301
1037 3300032002 Ga0307416_100256220 Ga0307416_1002562202 301
1038 3300032004 Ga0307414_10013269 Ga0307414_100132695 301
1039 3300032004 Ga0307414_10018046 Ga0307414_100180463 301
1040 3300032004 Ga0307414_10038232 Ga0307414_100382322 301
1041 3300032004 Ga0307414_10040883 Ga0307414_100408834 301
1042 3300032004 Ga0307414_10095902 Ga0307414_100959023 301
1043 3300032004 Ga0307414_10584610 Ga0307414_105846101 301
1044 3300032005 Ga0307411_10007971 Ga0307411_100079713 301
1045 3300032005 Ga0307411_10013119 Ga0307411_100131196 301
1046 3300032005 Ga0307411_10028624 Ga0307411_100286242 301
1047 3300032005 Ga0307411_10125648 Ga0307411_101256482 301
1048 3300032005 Ga0307411_10239316 Ga0307411_102393162 301
1049 3300032126 Ga0307415_100015317 Ga0307415_1000153172 301
1050 3300032126 Ga0307415_100029178 Ga0307415_1000291784 301
1051 3300032126 Ga0307415_100163138 Ga0307415_1001631382 301
1052 3300042006 Ga0439432_016068 Ga0439432_016068_1103_2023 301
1053 3300042007 Ga0439449_0008461 Ga0439449_0008461_2599_3519 301
1054 3300042010 Ga0439452_014099 Ga0439452_014099_1133_2053 301
1055 3300042012 Ga0439455_0000107 Ga0439455_0000107_3011_3922 301
1056 3300042157 Ga0439458_0000371 Ga0439458_0000371_4575_5486 301
1057 3300042157 Ga0439458_0004674 Ga0439458_0004674_2195_3106 301
1058 3300042876 Ga0451577_0339336 Ga0451577_0339336_25_945 301
1059 3300044694 Ga0466963_0004135 Ga0466963_0004135_3110_4021 301
1060 3300044706 Ga0466964_0016202 Ga0466964_0016202_45_956 301
1061 3300044719 Ga0466971_0003306 Ga0466971_0003306_3960_4871 301
1062 3300044901 Ga0466960_0044375 Ga0466960_0044375_486_1397 301
1063 3300045836 Ga0466958_0069813 Ga0466958_0069813_746_1657 301
1064 3300045976 Ga0466967_0019763 Ga0466967_0019763_3090_4001 301
1065 3300047472 Ga0495686_0000100 Ga0495686_0000100_87102_88022 301
1066 3300047472 Ga0495686_0000300 Ga0495686_0000300_80547_81464 301
1067 3300048924 Ga0496121_0043634 Ga0496121_0043634_197_1108 301
1068 3300048925 Ga0496122_0029763 Ga0496122_0029763_986_1897 301
1069 3300048926 Ga0496123_0018448 Ga0496123_0018448_127_1038 301
1070 3300049570 Ga0501033_0153155 Ga0501033_0153155_326_1246 301
1071 3300049580 Ga0501046_0246584 Ga0501046_0246584_287_1201 301
1072 3300049581 Ga0501047_0138887 Ga0501047_0138887_1003_1917 301
1073 3300049656 Ga0501209_042906 Ga0501209_042906_44_967 301
1074 3300049823 Ga0501044_0064208 Ga0501044_0064208_239_1159 301
1075 3300053087 Ga0500643_000096 Ga0500643_000096_89825_90739 301
1076 3300053096 Ga0500641_0042853 Ga0500641_0042853_522_1508 301
1077 3300061719 Ga0466962_0002921 Ga0466962_0002921_670_1581 301
1078 iso_pu_bacteria 2643221541 2643728270 301
1079 iso_pu_bacteria 2643221606 2644042781 301
1080 iso_pu_bacteria 2643221671 2644395788 301
1081 iso_pu_bacteria 643348564 643599467 301
1082 3300001976 JGI24752J21851_1000572 JGI24752J21851_10005723 302
1083 3300005289 Ga0065704_10073584 Ga0065704_100735842 302
1084 3300005331 Ga0070670_100013480 Ga0070670_1000134805 302
1085 3300005335 Ga0070666_10000286 Ga0070666_100002862 302
1086 3300005347 Ga0070668_100016688 Ga0070668_1000166882 302
1087 3300005347 Ga0070668_100017250 Ga0070668_1000172503 302
1088 3300005353 Ga0070669_100000004 Ga0070669_100000004164 302
1089 3300005353 Ga0070669_100000080 Ga0070669_1000000809 302
1090 3300005355 Ga0070671_100000004 Ga0070671_100000004227 302
1091 3300005367 Ga0070667_100000089 Ga0070667_100000089109 302
1092 3300005367 Ga0070667_100005092 Ga0070667_1000050927 302
1093 3300005367 Ga0070667_100012916 Ga0070667_1000129165 302
1094 3300005440 Ga0070705_100003446 Ga0070705_1000034469 302
1095 3300005539 Ga0068853_100000181 Ga0068853_10000018126 302
1096 3300005548 Ga0070665_100039812 Ga0070665_1000398123 302
1097 3300005548 Ga0070665_100039844 Ga0070665_1000398443 302
1098 3300005563 Ga0068855_100218568 Ga0068855_1002185682 302
1099 3300005578 Ga0068854_100001419 Ga0068854_1000014198 302
1100 3300005617 Ga0068859_100000286 Ga0068859_1000002869 302
1101 3300005617 Ga0068859_100013205 Ga0068859_1000132053 302
1102 3300005617 Ga0068859_100120161 Ga0068859_1001201612 302
1103 3300005618 Ga0068864_100002169 Ga0068864_1000021699 302
1104 3300005719 Ga0068861_100007704 Ga0068861_1000077045 302
1105 3300005841 Ga0068863_100003849 Ga0068863_1000038497 302
1106 3300005841 Ga0068863_100004680 Ga0068863_1000046806 302
1107 3300005842 Ga0068858_100012034 Ga0068858_1000120344 302
1108 3300005843 Ga0068860_100000148 Ga0068860_10000014821 302
1109 3300005843 Ga0068860_100009573 Ga0068860_1000095737 302
1110 3300005844 Ga0068862_100000714 Ga0068862_10000071423 302
1111 3300006931 Ga0097620_100000286 Ga0097620_1000002869 302
1112 3300006931 Ga0097620_100013205 Ga0097620_1000132053 302
1113 3300006931 Ga0097620_100120158 Ga0097620_1001201582 302
1114 3300009011 Ga0105251_10033964 Ga0105251_100339642 302
1115 3300009101 Ga0105247_10000465 Ga0105247_1000046517 302
1116 3300009177 Ga0105248_10105335 Ga0105248_101053352 302
1117 3300009553 Ga0105249_10003111 Ga0105249_1000311112 302
1118 3300009553 Ga0105249_10116167 Ga0105249_101161672 302
1119 3300014325 Ga0163163_10048402 Ga0163163_100484024 302
1120 3300014326 Ga0157380_10074108 Ga0157380_100741083 302
1121 3300014968 Ga0157379_10003869 Ga0157379_100038695 302
1122 3300025315 Ga0207697_10000105 Ga0207697_1000010516 302
1123 3300025735 Ga0207713_1027124 Ga0207713_10271243 302
1124 3300025900 Ga0207710_10010965 Ga0207710_100109652 302
1125 3300025903 Ga0207680_10000299 Ga0207680_100002994 302
1126 3300025923 Ga0207681_10000010 Ga0207681_10000010243 302
1127 3300025923 Ga0207681_10000049 Ga0207681_1000004929 302
1128 3300025925 Ga0207650_10012956 Ga0207650_100129563 302
1129 3300025931 Ga0207644_10000007 Ga0207644_10000007231 302
1130 3300025972 Ga0207668_10002255 Ga0207668_100022555 302
1131 3300025972 Ga0207668_10010065 Ga0207668_100100652 302
1132 3300025986 Ga0207658_10000069 Ga0207658_1000006920 302
1133 3300025986 Ga0207658_10004121 Ga0207658_100041216 302
1134 3300025986 Ga0207658_10016310 Ga0207658_100163103 302
1135 3300026035 Ga0207703_10002370 Ga0207703_1000237015 302
1136 3300026041 Ga0207639_10004479 Ga0207639_100044797 302
1137 3300026088 Ga0207641_10006151 Ga0207641_100061518 302
1138 3300026088 Ga0207641_10012621 Ga0207641_100126217 302
1139 3300026095 Ga0207676_10004450 Ga0207676_100044504 302
1140 3300026116 Ga0207674_10002418 Ga0207674_1000241810 302
1141 3300026118 Ga0207675_100001380 Ga0207675_1000013804 302
1142 3300028379 Ga0268266_10016041 Ga0268266_100160415 302
1143 3300028379 Ga0268266_10017080 Ga0268266_100170805 302
1144 3300028379 Ga0268266_10143703 Ga0268266_101437033 302
1145 3300028380 Ga0268265_10001068 Ga0268265_100010682 302
1146 3300028380 Ga0268265_10005131 Ga0268265_100051313 302
1147 3300028381 Ga0268264_10000106 Ga0268264_1000010662 302
1148 3300028381 Ga0268264_10000217 Ga0268264_1000021720 302
1149 3300031548 Ga0307408_100045920 Ga0307408_1000459202 302
1150 3300031548 Ga0307408_100125754 Ga0307408_1001257542 302
1151 3300031731 Ga0307405_10096911 Ga0307405_100969112 302
1152 3300031824 Ga0307413_10081449 Ga0307413_100814493 302
1153 3300031903 Ga0307407_10052426 Ga0307407_100524262 302
1154 3300031995 Ga0307409_100197829 Ga0307409_1001978293 302
1155 3300032002 Ga0307416_100377439 Ga0307416_1003774392 302
1156 3300032005 Ga0307411_10011224 Ga0307411_100112244 302
1157 3300032126 Ga0307415_100129515 Ga0307415_1001295152 302
1158 3300046557 Ga0495622_0004163 Ga0495622_0004163_5655_6593 302
1159 3300046692 Ga0495671_0010759 Ga0495671_0010759_1047_1985 302
1160 3300047472 Ga0495686_0048709 Ga0495686_0048709_1621_2535 302
1161 3300048903 Ga0496100_0052989 Ga0496100_0052989_1192_2133 302
1162 3300048905 Ga0496102_0000372 Ga0496102_0000372_30266_31207 302
1163 3300048906 Ga0496103_0000021 Ga0496103_0000021_192193_193134 302
1164 3300048907 Ga0496104_0000128 Ga0496104_0000128_5667_6608 302
1165 3300048908 Ga0496105_0000064 Ga0496105_0000064_62436_63377 302
1166 3300048915 Ga0496112_0011063 Ga0496112_0011063_2366_3307 302
1167 3300048916 Ga0496113_0000044 Ga0496113_0000044_6334_7275 302
1168 3300048920 Ga0496117_0001310 Ga0496117_0001310_23780_24721 302
1169 3300048921 Ga0496118_0003241 Ga0496118_0003241_9788_10729 302
1170 3300048922 Ga0496119_0000077 Ga0496119_0000077_69045_69986 302
1171 3300048923 Ga0496120_0001955 Ga0496120_0001955_12063_13004 302
1172 3300048924 Ga0496121_0010109 Ga0496121_0010109_9456_10397 302
1173 3300048925 Ga0496122_0004055 Ga0496122_0004055_9001_9942 302
1174 3300048926 Ga0496123_0001103 Ga0496123_0001103_3471_4412 302
1175 3300048927 Ga0496124_0001269 Ga0496124_0001269_20457_21398 302
1176 3300048928 Ga0496125_0001135 Ga0496125_0001135_4683_5624 302
1177 3300048929 Ga0496126_0000175 Ga0496126_0000175_35980_36921 302
1178 3300048929 Ga0496126_0037074 Ga0496126_0037074_1704_2642 302
1179 3300048929 Ga0496126_0183686 Ga0496126_0183686_547_1479 302
1180 3300049686 Ga0501257_011461 Ga0501257_011461_844_1761 302
1181 3300050489 nmdc:mga03683_39951_c1 nmdc:mga03683_39951_c1_399_1337 302
1182 3300053087 Ga0500643_000611 Ga0500643_000611_19385_20323 302
1183 3300053087 Ga0500643_002575 Ga0500643_002575_1600_2517 302
1184 3300053087 Ga0500643_003036 Ga0500643_003036_1263_2180 302
1185 3300053118 Ga0500594_0005984 Ga0500594_0005984_242_1180 302
1186 3300053156 Ga0500622_0109698 Ga0500622_0109698_321_1247 302
1187 iso_pu_bacteria 2512564014 2512645141 302
1188 iso_pu_bacteria 2643221605 2644040523 302
1189 iso_pu_bacteria 2738541275 2738711044 302
1190 iso_pu_bacteria 2738541301 2738849469 302
1191 iso_pu_bacteria 2738541304 2738865198 302
1192 iso_pu_bacteria 2738543022 2739297716 302
1193 iso_pu_bacteria 2738543033 2739359394 302
1194 iso_pu_bacteria 2775507255 2778125838 302
1195 iso_pu_bacteria 2808606401 2809063354 302
1196 iso_pu_bacteria 2808606404 2809079210 302
1197 iso_pu_bacteria 2808606405 2809083416 302
1198 iso_pu_bacteria 2880518877 2880520624 302
1199 iso_pu_bacteria 2928100450 2928103657 302
1200 iso_pu_bacteria 2928959182 2928961330 302
1201 3300005563 Ga0068855_100199379 Ga0068855_1001993792 303
1202 3300005578 Ga0068854_100016007 Ga0068854_1000160073 303
1203 3300009148 Ga0105243_10013311 Ga0105243_100133117 303
1204 3300009545 Ga0105237_10004686 Ga0105237_100046863 303
1205 3300010375 Ga0105239_10000266 Ga0105239_1000026631 303
1206 3300025913 Ga0207695_10000516 Ga0207695_1000051643 303
1207 3300025914 Ga0207671_10019676 Ga0207671_100196763 303
1208 3300025935 Ga0207709_10017408 Ga0207709_100174083 303
1209 3300025961 Ga0207712_10322510 Ga0207712_103225102 303
1210 3300025981 Ga0207640_10006284 Ga0207640_100062842 303
1211 3300048920 Ga0496117_0035784 Ga0496117_0035784_438_1358 303
1212 3300048924 Ga0496121_0001865 Ga0496121_0001865_25566_26486 303
1213 3300048924 Ga0496121_0005208 Ga0496121_0005208_2126_3046 303
1214 3300048929 Ga0496126_0006303 Ga0496126_0006303_4490_5410 303
1215 3300049579 Ga0501043_0027180 Ga0501043_0027180_3105_4031 303
1216 3300049581 Ga0501047_0002016 Ga0501047_0002016_13888_14814 303
1217 3300002076 JGI24749J21850_1000242 JGI24749J21850_10002422 304
1218 3300002459 JGI24751J29686_10000195 JGI24751J29686_100001952 304
1219 3300005295 Ga0065707_10133594 Ga0065707_101335942 304
1220 3300005331 Ga0070670_100000033 Ga0070670_10000003341 304
1221 3300005331 Ga0070670_100001972 Ga0070670_1000019729 304
1222 3300005347 Ga0070668_100000003 Ga0070668_10000000371 304
1223 3300005347 Ga0070668_100027223 Ga0070668_1000272231 304
1224 3300005353 Ga0070669_100000005 Ga0070669_10000000586 304
1225 3300005355 Ga0070671_100000061 Ga0070671_10000006143 304
1226 3300005367 Ga0070667_100000035 Ga0070667_10000003589 304
1227 3300005367 Ga0070667_100029928 Ga0070667_1000299283 304
1228 3300005577 Ga0068857_100239755 Ga0068857_1002397552 304
1229 3300005578 Ga0068854_100010980 Ga0068854_1000109802 304
1230 3300005616 Ga0068852_100154739 Ga0068852_1001547392 304
1231 3300005617 Ga0068859_100002190 Ga0068859_1000021903 304
1232 3300005617 Ga0068859_100024626 Ga0068859_1000246262 304
1233 3300005618 Ga0068864_100000042 Ga0068864_10000004241 304
1234 3300005618 Ga0068864_100008581 Ga0068864_1000085813 304
1235 3300005719 Ga0068861_100105187 Ga0068861_1001051872 304
1236 3300005841 Ga0068863_100001950 Ga0068863_1000019509 304
1237 3300005841 Ga0068863_100019579 Ga0068863_1000195796 304
1238 3300005842 Ga0068858_100014401 Ga0068858_1000144015 304
1239 3300005843 Ga0068860_100000106 Ga0068860_10000010648 304
1240 3300005844 Ga0068862_100000005 Ga0068862_10000000594 304
1241 3300005844 Ga0068862_100002361 Ga0068862_1000023618 304
1242 3300006931 Ga0097620_100002190 Ga0097620_10000219021 304
1243 3300006931 Ga0097620_100024626 Ga0097620_1000246262 304
1244 3300009177 Ga0105248_10000171 Ga0105248_1000017134 304
1245 3300009553 Ga0105249_10033704 Ga0105249_100337045 304
1246 3300014326 Ga0157380_10000030 Ga0157380_1000003078 304
1247 3300025923 Ga0207681_10000003 Ga0207681_10000003226 304
1248 3300025923 Ga0207681_10061664 Ga0207681_100616642 304
1249 3300025925 Ga0207650_10000012 Ga0207650_10000012234 304
1250 3300025925 Ga0207650_10038930 Ga0207650_100389302 304
1251 3300025931 Ga0207644_10000069 Ga0207644_1000006935 304
1252 3300025941 Ga0207711_10001371 Ga0207711_1000137112 304
1253 3300025972 Ga0207668_10000006 Ga0207668_1000000666 304
1254 3300025981 Ga0207640_10028939 Ga0207640_100289394 304
1255 3300025986 Ga0207658_10000026 Ga0207658_1000002613 304
1256 3300025986 Ga0207658_10020601 Ga0207658_100206013 304
1257 3300026035 Ga0207703_10003077 Ga0207703_100030775 304
1258 3300026088 Ga0207641_10000617 Ga0207641_1000061739 304
1259 3300026088 Ga0207641_10001438 Ga0207641_100014384 304
1260 3300026095 Ga0207676_10000009 Ga0207676_10000009223 304
1261 3300026116 Ga0207674_10031068 Ga0207674_100310684 304
1262 3300026118 Ga0207675_100000053 Ga0207675_10000005376 304
1263 3300026142 Ga0207698_10507191 Ga0207698_105071911 304
1264 3300028380 Ga0268265_10000001 Ga0268265_10000001186 304
1265 3300028380 Ga0268265_10001877 Ga0268265_100018778 304
1266 3300028381 Ga0268264_10000076 Ga0268264_10000076174 304
1267 3300031548 Ga0307408_100414950 Ga0307408_1004149502 304
1268 3300031731 Ga0307405_10201270 Ga0307405_102012701 304
1269 3300031911 Ga0307412_10090404 Ga0307412_100904042 304
1270 3300038705 Ga0237819_00556 Ga0237819_00556_7683_8609 304
1271 2162886007 SwRhRL2b_contig_2018180 SwRhRL2b_0172.00000190 306
1272 3300005289 Ga0065704_10096430 Ga0065704_100964303 306
1273 3300005331 Ga0070670_100532687 Ga0070670_1005326871 306
1274 3300005340 Ga0070689_100269916 Ga0070689_1002699161 306
1275 3300005347 Ga0070668_100029946 Ga0070668_1000299464 306
1276 3300005353 Ga0070669_100067227 Ga0070669_1000672273 306
1277 3300005355 Ga0070671_100016884 Ga0070671_1000168842 306
1278 3300005548 Ga0070665_100041106 Ga0070665_1000411064 306
1279 3300005617 Ga0068859_100009889 Ga0068859_1000098897 306
1280 3300005618 Ga0068864_100018007 Ga0068864_1000180075 306
1281 3300005844 Ga0068862_100000014 Ga0068862_100000014163 306
1282 3300006048 Ga0075363_100037474 Ga0075363_1000374743 306
1283 3300006178 Ga0075367_10012146 Ga0075367_100121464 306
1284 3300006353 Ga0075370_10054405 Ga0075370_100544053 306
1285 3300006931 Ga0097620_100009888 Ga0097620_1000098887 306
1286 3300009101 Ga0105247_10000830 Ga0105247_100008302 306
1287 3300009545 Ga0105237_10068401 Ga0105237_100684012 306
1288 3300009553 Ga0105249_10000002 Ga0105249_10000002234 306
1289 3300009978 Ga0105148_100047 Ga0105148_10004710 306
1290 3300014326 Ga0157380_10004840 Ga0157380_100048406 306
1291 3300014326 Ga0157380_10098239 Ga0157380_100982393 306
1292 3300025914 Ga0207671_10020388 Ga0207671_100203883 306
1293 3300025923 Ga0207681_10287104 Ga0207681_102871041 306
1294 3300025925 Ga0207650_10195318 Ga0207650_101953182 306
1295 3300025931 Ga0207644_10066824 Ga0207644_100668242 306
1296 3300025961 Ga0207712_10000002 Ga0207712_10000002606 306
1297 3300025972 Ga0207668_10008868 Ga0207668_100088684 306
1298 3300026067 Ga0207678_10000080 Ga0207678_100000804 306
1299 3300026088 Ga0207641_10003069 Ga0207641_1000306910 306
1300 3300027866 Ga0209813_10000014 Ga0209813_1000001431 306
1301 3300028379 Ga0268266_10010736 Ga0268266_100107363 306
1302 3300028380 Ga0268265_10000048 Ga0268265_1000004832 306
1303 3300028381 Ga0268264_10000439 Ga0268264_1000043922 306
1304 3300031548 Ga0307408_100029774 Ga0307408_1000297743 306
1305 3300031731 Ga0307405_10067652 Ga0307405_100676522 306
1306 3300031911 Ga0307412_10001006 Ga0307412_100010068 306
1307 3300032004 Ga0307414_10000463 Ga0307414_1000046314 306
1308 3300032005 Ga0307411_10283227 Ga0307411_102832272 306
1309 3300035695 Ga0373927_0071656 Ga0373927_0071656_499_1443 306
1310 3300046542 Ga0495597_0039105 Ga0495597_0039105_1063_2076 306
1311 3300046616 Ga0495668_0113197 Ga0495668_0113197_25_969 306
1312 3300048905 Ga0496102_0000321 Ga0496102_0000321_30631_31560 306
1313 3300048906 Ga0496103_0000199 Ga0496103_0000199_30553_31482 306
1314 3300048911 Ga0496108_0000270 Ga0496108_0000270_30308_31228 306
1315 3300048919 Ga0496116_0000648 Ga0496116_0000648_14130_15059 306
1316 3300048919 Ga0496116_0060403 Ga0496116_0060403_941_1861 306
1317 3300048919 Ga0496116_0189969 Ga0496116_0189969_62_988 306
1318 3300048920 Ga0496117_0000584 Ga0496117_0000584_28551_29480 306
1319 3300048920 Ga0496117_0009809 Ga0496117_0009809_1287_2213 306
1320 3300048921 Ga0496118_0000588 Ga0496118_0000588_28551_29480 306
1321 3300048921 Ga0496118_0095905 Ga0496118_0095905_344_1270 306
1322 3300048922 Ga0496119_0024187 Ga0496119_0024187_3203_4132 306
1323 3300048924 Ga0496121_0002849 Ga0496121_0002849_22100_23020 306
1324 3300048926 Ga0496123_0039900 Ga0496123_0039900_1863_2783 306
1325 3300048927 Ga0496124_0000387 Ga0496124_0000387_51374_52303 306
1326 3300048927 Ga0496124_0033453 Ga0496124_0033453_562_1482 306
1327 3300048928 Ga0496125_0023090 Ga0496125_0023090_943_1902 306
1328 3300048929 Ga0496126_0024925 Ga0496126_0024925_942_1862 306
1329 3300049571 Ga0501034_0014162 Ga0501034_0014162_6501_7442 306
1330 3300049663 Ga0501223_000111 Ga0501223_000111_16381_17322 306
1331 3300049664 Ga0501224_000024 Ga0501224_000024_6163_7104 306
1332 3300049705 Ga0501225_0000017 Ga0501225_0000017_6430_7371 306
1333 3300049705 Ga0501225_0008251 Ga0501225_0008251_314_1252 306
1334 3300049853 Ga0501226_000072 Ga0501226_000072_6471_7412 306
1335 3300050494 nmdc:mga06z11_47_c1 nmdc:mga06z11_47_c1_34285_35211 306
1336 3300050495 nmdc:mga04h51_182_c1 nmdc:mga04h51_182_c1_367_1293 306
1337 3300053087 Ga0500643_001187 Ga0500643_001187_13069_14013 306
1338 3300053093 Ga0500651_0009427 Ga0500651_0009427_809_1753 306
1339 3300053096 Ga0500641_0008635 Ga0500641_0008635_1814_2758 306
1340 3300053123 Ga0500614_003766 Ga0500614_003766_686_1699 306
1341 3300053125 Ga0500618_017070 Ga0500618_017070_214_1158 306
1342 3300053133 Ga0500655_000089 Ga0500655_000089_1661_2605 306
1343 3300053148 Ga0500590_001156 Ga0500590_001156_2305_3249 306
1344 3300053156 Ga0500622_0102362 Ga0500622_0102362_209_1153 306
1345 3300053163 Ga0500639_121099 Ga0500639_121099_68_1081 306
1346 3300053724 Ga0500570_002530 Ga0500570_002530_5366_6310 306
1347 iso_pu_bacteria 2582581305 2585264219 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01379

Porphobil_deam

Porphobilinogen deaminase, dipyromethane cofactor binding domain

52

255

0.93

PF03900

Porphobil_deamC

Porphobilinogen deaminase, C-terminal domain

268

337

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htg-assembly1.cif.gz_A porphobilinogen deaminase from arabidopsis thaliana 0.9493 5 293
1ah5-assembly1.cif.gz_A reduced form selenomethionine-labelled hydroxymethylbilane synthase determined by mad 0.9386 8 302
1pda-assembly1.cif.gz_A structure of porphobilinogen deaminase reveals a flexible multidomain polymerase with a single catalytic site 0.937 5 296
2ypn-assembly1.cif.gz_A hydroxymethylbilane synthase 0.9358 5 294
5h6o-assembly1.cif.gz_A porphobilinogen deaminase from vibrio cholerae 0.9356 7 295
ID Description Score Start End Superfamily
4htgA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9605 104 198 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9581 104 198 3.40.190.10
4htgA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9334 220 293 3.30.160.40
5h6oA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9241 220 295 3.30.160.40
af_C6TEP8_269_355_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9193 220 300 3.30.160.40
ID Description Score Start End GO Terms
AF-A0A350KUL8-F1-model_v4 deleted 0.981 125 306
AF-A0A377TL07-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.9717 101 232 GO:0004418
GO:0005737
GO:0006782
AF-A0A849FDB6-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.9704 91 300 GO:0004418
GO:0005737
GO:0006782
AF-A0A377LQF5-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.9695 101 294 GO:0004418
GO:0005737
GO:0006782
AF-A0A3B0RAH1-F1-model_v4 hydroxymethylbilane synthase (EC 2.5.1.61) 0.9656 6 249 GO:0004418
GO:0005737
GO:0006783

Feature Viewer

pLDDT pTM Quality
93.43 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map