F493103
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1334 | 630 | 1185 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300031507|Ga0307509_10065921|Ga0307509_100659213 |
| Length | 208 |
| Sequence | MDKPASTPSTAAAPPISRFSIPDLATLPDDVRARIQEVQDKAGFVPNVFLVLARRPDEFRAFFAYHDALMAKDGGGLSKGEREMIVVATSAANQCHYCVIAHGAILRIYEKRPLLADQVAVNYRKADLTPRQRAMLEFAIKVALRSPEIEDGDFARLREHGFSDEDAWDIAAIAAFFAMSNRLANATAMRPNDEFYLMGRLPKQPAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 16 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 17 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 18 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 19 | 2791355199 | |||
| 20 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 26 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 27 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 28 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 29 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 30 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 31 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 32 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 33 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 34 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 35 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 36 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 37 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 38 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 39 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 40 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 41 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 42 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 43 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 44 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 45 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 46 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 47 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 48 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 49 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 50 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 51 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 52 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 53 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 54 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 55 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 56 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 57 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 58 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 59 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 60 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 61 | 2922368715 | |||
| 62 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 63 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 64 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 65 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 66 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 67 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 68 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 69 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 70 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 71 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 72 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 73 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 74 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 75 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 76 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 77 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 78 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 79 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 80 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 81 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 82 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 83 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 84 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 85 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 86 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 87 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 88 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 89 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 90 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 91 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 92 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 93 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 94 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 95 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 96 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 97 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 98 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 99 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 100 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 101 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 102 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 103 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 104 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 105 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 106 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 107 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 108 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 109 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 110 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 111 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 112 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 113 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 114 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 115 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 116 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 117 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 118 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 119 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 120 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 121 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 122 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 123 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 124 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 125 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 126 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 128 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 129 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 130 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 131 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 132 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 133 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 137 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 140 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 142 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 143 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 144 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 146 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 161 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 165 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 166 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 167 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 169 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 171 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 174 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 181 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 183 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 184 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 185 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 187 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 188 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 189 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 190 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 191 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 192 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 193 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 194 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 195 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 196 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 197 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 198 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 199 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 200 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 202 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 203 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 204 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 205 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 209 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 210 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 211 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 212 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 214 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 215 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 216 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 217 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 218 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 219 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 221 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 222 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 223 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 224 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 225 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 239 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 252 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 256 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 258 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 259 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 260 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 261 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 262 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 263 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 273 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 275 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 341 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 342 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 343 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 345 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 346 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 350 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 351 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 352 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 353 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 354 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 355 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 356 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 357 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 358 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 359 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 360 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 361 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 362 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 363 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 364 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 365 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 366 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 367 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 368 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 369 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 370 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 371 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 372 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 373 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 374 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 375 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 376 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 377 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 378 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 379 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 380 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 381 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 382 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 383 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 384 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 385 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 386 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 387 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 388 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 389 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 390 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 391 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 392 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 393 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 394 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 395 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 396 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 397 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 398 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 399 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 400 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 401 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 402 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 403 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 404 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 405 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 406 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 407 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 408 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 409 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 410 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 411 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 412 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 492 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 494 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 495 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 496 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 497 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 498 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 499 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 500 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 501 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 502 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 503 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 504 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 505 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 506 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 507 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 508 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 509 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 510 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 511 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 512 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 513 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 514 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 515 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 544 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 545 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 546 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 547 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 548 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 554 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 556 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 558 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 559 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 560 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 561 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 562 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 563 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 564 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 565 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 566 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 567 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 568 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 569 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 570 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 571 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 572 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 573 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 574 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 575 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 576 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 577 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 578 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 579 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 580 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 581 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 582 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 583 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 584 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 585 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 586 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 587 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 588 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 589 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 590 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 591 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 592 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 593 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 594 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 595 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 596 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 597 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 598 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 600 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 601 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 602 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 603 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 604 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 605 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 606 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 607 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 608 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 609 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 610 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 611 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 612 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 613 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 614 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 615 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 616 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 617 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 618 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 619 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 620 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 621 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 622 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 623 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 624 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 625 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 626 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 627 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 628 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 629 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 630 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.96 |
| Metatranscriptomes | 0 |
| Isolates | 11.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.02 |
| Nodule | 9.22 |
| Rhizoplane | 5.85 |
| Rhizosphere | 67.77 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 6.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1005748 | 3300000549 | Bacteria | 1562 |
| 2 | JGI24739J22299_10004675 | 3300001989 | Bacteria | 5233 |
| 3 | JGI24737J22298_10003599 | 3300001990 | Bacteria | 5463 |
| 4 | JGI24737J22298_10010858 | 3300001990 | Bacteria | 2994 |
| 5 | JGI24735J21928_10003477 | 3300002067 | Bacteria | 5365 |
| 6 | JGI24750J21931_1026045 | 3300002070 | Bacteria | 840 |
| 7 | JGI25406J46586_10006716 | 3300003203 | Bacteria | 5288 |
| 8 | JGI25153J46596_10004034 | 3300003215 | Bacteria | 8006 |
| 9 | JGI25153J46596_10063189 | 3300003215 | Bacteria | 994 |
| 10 | JGI25160J50197_1000921 | 3300003354 | Bacteria | 15453 |
| 11 | JGI25160J50197_1009395 | 3300003354 | Bacteria | 3630 |
| 12 | JGI25404J52841_10026147 | 3300003659 | Bacteria | 1256 |
| 13 | JGI25404J52841_10042784 | 3300003659 | Bacteria | 958 |
| 14 | Ga0055538_1000019 | 3300003751 | Bacteria | 282365 |
| 15 | Ga0055539_1000024 | 3300003752 | Bacteria | 282365 |
| 16 | Ga0055533_1000032 | 3300003756 | Bacteria | 282365 |
| 17 | Ga0055525_1000041 | 3300003759 | Bacteria | 282365 |
| 18 | Ga0055541_1000018 | 3300003841 | Bacteria | 282365 |
| 19 | Ga0065165_1007079 | 3300005262 | Bacteria | 5634 |
| 20 | Ga0065165_1008084 | 3300005262 | Bacteria | 5017 |
| 21 | Ga0070658_10326807 | 3300005327 | Bacteria | 1310 |
| 22 | Ga0070676_10040507 | 3300005328 | Bacteria | 2697 |
| 23 | Ga0070676_10046538 | 3300005328 | Bacteria | 2530 |
| 24 | Ga0070676_10061229 | 3300005328 | Unclassified | 2237 |
| 25 | Ga0070683_100020596 | 3300005329 | Bacteria | 5870 |
| 26 | Ga0070683_100045726 | 3300005329 | Bacteria | 4041 |
| 27 | Ga0070683_100164968 | 3300005329 | Bacteria | 2102 |
| 28 | Ga0070690_100002084 | 3300005330 | Bacteria | 10682 |
| 29 | Ga0070690_100123477 | 3300005330 | Bacteria | 1741 |
| 30 | Ga0070690_100199738 | 3300005330 | Bacteria | 1391 |
| 31 | Ga0070690_100603217 | 3300005330 | Bacteria | 834 |
| 32 | Ga0070670_100064364 | 3300005331 | Bacteria | 3146 |
| 33 | Ga0070670_100117136 | 3300005331 | Bacteria | 2297 |
| 34 | Ga0070670_100168447 | 3300005331 | Bacteria | 1900 |
| 35 | Ga0070670_100186060 | 3300005331 | Bacteria | 1803 |
| 36 | Ga0070677_10079041 | 3300005333 | Bacteria | 1403 |
| 37 | Ga0068869_100047651 | 3300005334 | Bacteria | 3096 |
| 38 | Ga0068869_100064006 | 3300005334 | Bacteria | 2704 |
| 39 | Ga0068869_100182199 | 3300005334 | Bacteria | 1647 |
| 40 | Ga0070666_10054453 | 3300005335 | Unclassified | 2699 |
| 41 | Ga0070666_10055893 | 3300005335 | Bacteria | 2665 |
| 42 | Ga0070666_10671631 | 3300005335 | Bacteria | 759 |
| 43 | Ga0070680_100118878 | 3300005336 | Bacteria | 2205 |
| 44 | Ga0070682_100202331 | 3300005337 | Bacteria | 1401 |
| 45 | Ga0070682_101038063 | 3300005337 | Bacteria | 683 |
| 46 | Ga0068868_100002211 | 3300005338 | Bacteria | 13438 |
| 47 | Ga0068868_100086295 | 3300005338 | Bacteria | 2523 |
| 48 | Ga0068868_100233532 | 3300005338 | Bacteria | 1543 |
| 49 | Ga0068868_100315573 | 3300005338 | Bacteria | 1330 |
| 50 | Ga0068868_100384892 | 3300005338 | Bacteria | 1207 |
| 51 | Ga0070660_100001944 | 3300005339 | Bacteria | 14250 |
| 52 | Ga0070689_100785405 | 3300005340 | Bacteria | 836 |
| 53 | Ga0070661_100009779 | 3300005344 | Bacteria | 6652 |
| 54 | Ga0070661_100309883 | 3300005344 | Bacteria | 1231 |
| 55 | Ga0070661_100844656 | 3300005344 | Bacteria | 753 |
| 56 | Ga0070668_100290149 | 3300005347 | Bacteria | 1369 |
| 57 | Ga0070669_100456600 | 3300005353 | Bacteria | 1054 |
| 58 | Ga0070675_100006484 | 3300005354 | Bacteria | 8986 |
| 59 | Ga0070675_100156919 | 3300005354 | Bacteria | 1954 |
| 60 | Ga0070671_100004974 | 3300005355 | Bacteria | 10582 |
| 61 | Ga0070671_100049969 | 3300005355 | Bacteria | 3478 |
| 62 | Ga0070671_100057073 | 3300005355 | Bacteria | 3248 |
| 63 | Ga0070671_100101291 | 3300005355 | Bacteria | 2416 |
| 64 | Ga0070671_100198119 | 3300005355 | Bacteria | 1703 |
| 65 | Ga0070671_100243917 | 3300005355 | Bacteria | 1525 |
| 66 | Ga0070674_100039953 | 3300005356 | Bacteria | 3171 |
| 67 | Ga0070674_100056697 | 3300005356 | Bacteria | 2717 |
| 68 | Ga0070674_100167957 | 3300005356 | Bacteria | 1670 |
| 69 | Ga0070673_100010231 | 3300005364 | Bacteria | 6340 |
| 70 | Ga0070673_100439798 | 3300005364 | Bacteria | 1172 |
| 71 | Ga0070659_100338807 | 3300005366 | Bacteria | 1259 |
| 72 | Ga0070667_100032334 | 3300005367 | Bacteria | 4363 |
| 73 | Ga0070667_100104314 | 3300005367 | Bacteria | 2452 |
| 74 | Ga0070667_100157499 | 3300005367 | Bacteria | 1998 |
| 75 | Ga0070667_100175540 | 3300005367 | Bacteria | 1893 |
| 76 | Ga0070667_100216809 | 3300005367 | Bacteria | 1702 |
| 77 | Ga0070667_100229731 | 3300005367 | Bacteria | 1654 |
| 78 | Ga0070667_100304493 | 3300005367 | Bacteria | 1435 |
| 79 | Ga0070667_100561173 | 3300005367 | Bacteria | 1050 |
| 80 | Ga0070667_100691833 | 3300005367 | Bacteria | 943 |
| 81 | Ga0070709_10000751 | 3300005434 | Bacteria | 18320 |
| 82 | Ga0070709_10098062 | 3300005434 | Bacteria | 1947 |
| 83 | Ga0070709_10320075 | 3300005434 | Bacteria | 1138 |
| 84 | Ga0070714_100001123 | 3300005435 | Bacteria | 19235 |
| 85 | Ga0070713_100000647 | 3300005436 | Bacteria | 22255 |
| 86 | Ga0070713_101135603 | 3300005436 | Bacteria | 756 |
| 87 | Ga0070713_101299207 | 3300005436 | Bacteria | 705 |
| 88 | Ga0070711_100045601 | 3300005439 | Bacteria | 2983 |
| 89 | Ga0070711_100082879 | 3300005439 | Bacteria | 2290 |
| 90 | Ga0070711_100129075 | 3300005439 | Bacteria | 1880 |
| 91 | Ga0070705_100413347 | 3300005440 | Bacteria | 1002 |
| 92 | Ga0070705_100716380 | 3300005440 | Bacteria | 788 |
| 93 | Ga0070700_100057018 | 3300005441 | Bacteria | 2450 |
| 94 | Ga0070700_100201951 | 3300005441 | Bacteria | 1397 |
| 95 | Ga0070700_100575485 | 3300005441 | Bacteria | 879 |
| 96 | Ga0070663_100039596 | 3300005455 | Bacteria | 3294 |
| 97 | Ga0070663_100042935 | 3300005455 | Bacteria | 3179 |
| 98 | Ga0070663_100051561 | 3300005455 | Bacteria | 2932 |
| 99 | Ga0070663_100125891 | 3300005455 | Bacteria | 1941 |
| 100 | Ga0070663_100221772 | 3300005455 | Bacteria | 1485 |
| 101 | Ga0070663_100243363 | 3300005455 | Bacteria | 1421 |
| 102 | Ga0070663_100298089 | 3300005455 | Bacteria | 1289 |
| 103 | Ga0070678_100006561 | 3300005456 | Bacteria | 6838 |
| 104 | Ga0070678_100083683 | 3300005456 | Bacteria | 2426 |
| 105 | Ga0070678_100257631 | 3300005456 | Bacteria | 1465 |
| 106 | Ga0070678_100574519 | 3300005456 | Bacteria | 1003 |
| 107 | Ga0070678_100580568 | 3300005456 | Bacteria | 998 |
| 108 | Ga0070678_100974863 | 3300005456 | Bacteria | 778 |
| 109 | Ga0070662_100195379 | 3300005457 | Bacteria | 1602 |
| 110 | Ga0070662_100447894 | 3300005457 | Bacteria | 1071 |
| 111 | Ga0070681_10009117 | 3300005458 | Bacteria | 9750 |
| 112 | Ga0070681_10059381 | 3300005458 | Bacteria | 3804 |
| 113 | Ga0068867_100010469 | 3300005459 | Bacteria | 6544 |
| 114 | Ga0068867_100014371 | 3300005459 | Bacteria | 5609 |
| 115 | Ga0068867_100103825 | 3300005459 | Bacteria | 2174 |
| 116 | Ga0068867_100116656 | 3300005459 | Bacteria | 2058 |
| 117 | Ga0068867_100422297 | 3300005459 | Bacteria | 1130 |
| 118 | Ga0068867_100490206 | 3300005459 | Bacteria | 1054 |
| 119 | Ga0070685_10051976 | 3300005466 | Bacteria | 2370 |
| 120 | Ga0070685_10084375 | 3300005466 | Bacteria | 1911 |
| 121 | Ga0070707_100184068 | 3300005468 | Bacteria | 2037 |
| 122 | Ga0070698_100258430 | 3300005471 | Bacteria | 1674 |
| 123 | Ga0070699_100121433 | 3300005518 | Bacteria | 2298 |
| 124 | Ga0070699_100186336 | 3300005518 | Bacteria | 1843 |
| 125 | Ga0070679_100477395 | 3300005530 | Bacteria | 1191 |
| 126 | Ga0070684_100048525 | 3300005535 | Bacteria | 3683 |
| 127 | Ga0070684_100236066 | 3300005535 | Bacteria | 1670 |
| 128 | Ga0070697_100058137 | 3300005536 | Bacteria | 3146 |
| 129 | Ga0068853_100008723 | 3300005539 | Bacteria | 8155 |
| 130 | Ga0068853_100022298 | 3300005539 | Bacteria | 5288 |
| 131 | Ga0068853_100035826 | 3300005539 | Bacteria | 4217 |
| 132 | Ga0068853_100263706 | 3300005539 | Bacteria | 1584 |
| 133 | Ga0068853_100278905 | 3300005539 | Bacteria | 1540 |
| 134 | Ga0068853_100874851 | 3300005539 | Bacteria | 862 |
| 135 | Ga0070672_100004623 | 3300005543 | Bacteria | 9014 |
| 136 | Ga0070672_100103124 | 3300005543 | Bacteria | 2316 |
| 137 | Ga0070672_100126053 | 3300005543 | Bacteria | 2100 |
| 138 | Ga0070672_100196724 | 3300005543 | Bacteria | 1684 |
| 139 | Ga0070672_100552692 | 3300005543 | Bacteria | 1000 |
| 140 | Ga0070686_100020725 | 3300005544 | Bacteria | 3894 |
| 141 | Ga0070686_100146194 | 3300005544 | Bacteria | 1651 |
| 142 | Ga0070686_100271719 | 3300005544 | Bacteria | 1247 |
| 143 | Ga0070695_100409731 | 3300005545 | Bacteria | 1030 |
| 144 | Ga0070696_100844130 | 3300005546 | Bacteria | 757 |
| 145 | Ga0070693_100001570 | 3300005547 | Bacteria | 10307 |
| 146 | Ga0070693_100230210 | 3300005547 | Bacteria | 1219 |
| 147 | Ga0070693_100311342 | 3300005547 | Bacteria | 1065 |
| 148 | Ga0070693_100318695 | 3300005547 | Bacteria | 1054 |
| 149 | Ga0070665_100037219 | 3300005548 | Bacteria | 4895 |
| 150 | Ga0070665_100055378 | 3300005548 | Bacteria | 3978 |
| 151 | Ga0070665_100194472 | 3300005548 | Bacteria | 2029 |
| 152 | Ga0070665_100227881 | 3300005548 | Bacteria | 1863 |
| 153 | Ga0070665_100319271 | 3300005548 | Bacteria | 1557 |
| 154 | Ga0068855_100017322 | 3300005563 | Bacteria | 8668 |
| 155 | Ga0068855_100018996 | 3300005563 | Bacteria | 8264 |
| 156 | Ga0068855_100046858 | 3300005563 | Bacteria | 5109 |
| 157 | Ga0068855_100083668 | 3300005563 | Bacteria | 3696 |
| 158 | Ga0068855_100135272 | 3300005563 | Bacteria | 2812 |
| 159 | Ga0068855_100154198 | 3300005563 | Bacteria | 2611 |
| 160 | Ga0068855_100275018 | 3300005563 | Bacteria | 1872 |
| 161 | Ga0068855_100768736 | 3300005563 | Bacteria | 1026 |
| 162 | Ga0068855_101168479 | 3300005563 | Bacteria | 801 |
| 163 | Ga0070664_100023846 | 3300005564 | Bacteria | 5054 |
| 164 | Ga0070664_100257820 | 3300005564 | Bacteria | 1568 |
| 165 | Ga0068857_100013666 | 3300005577 | Bacteria | 7074 |
| 166 | Ga0068857_100016794 | 3300005577 | Bacteria | 6412 |
| 167 | Ga0068857_100025993 | 3300005577 | Bacteria | 5156 |
| 168 | Ga0068857_100090271 | 3300005577 | Bacteria | 2742 |
| 169 | Ga0068857_100178756 | 3300005577 | Bacteria | 1931 |
| 170 | Ga0068857_100377876 | 3300005577 | Bacteria | 1315 |
| 171 | Ga0068857_100866258 | 3300005577 | Bacteria | 865 |
| 172 | Ga0068854_100002059 | 3300005578 | Bacteria | 12329 |
| 173 | Ga0068854_100006321 | 3300005578 | Bacteria | 7533 |
| 174 | Ga0068854_100016295 | 3300005578 | Bacteria | 4951 |
| 175 | Ga0068854_100086460 | 3300005578 | Bacteria | 2324 |
| 176 | Ga0068854_100134775 | 3300005578 | Bacteria | 1890 |
| 177 | Ga0068854_100199620 | 3300005578 | Bacteria | 1572 |
| 178 | Ga0068856_100001874 | 3300005614 | Bacteria | 21950 |
| 179 | Ga0068856_100029048 | 3300005614 | Bacteria | 5402 |
| 180 | Ga0068856_100054733 | 3300005614 | Bacteria | 3937 |
| 181 | Ga0068856_100096583 | 3300005614 | Bacteria | 2943 |
| 182 | Ga0068856_100107099 | 3300005614 | Bacteria | 2790 |
| 183 | Ga0068856_100257601 | 3300005614 | Bacteria | 1760 |
| 184 | Ga0068856_100718182 | 3300005614 | Bacteria | 1019 |
| 185 | Ga0070702_100006992 | 3300005615 | Bacteria | 5377 |
| 186 | Ga0070702_100018208 | 3300005615 | Bacteria | 3639 |
| 187 | Ga0070702_100639692 | 3300005615 | Bacteria | 803 |
| 188 | Ga0068852_100011069 | 3300005616 | Bacteria | 6772 |
| 189 | Ga0068852_100040373 | 3300005616 | Bacteria | 3936 |
| 190 | Ga0068852_100055734 | 3300005616 | Bacteria | 3413 |
| 191 | Ga0068852_100104537 | 3300005616 | Bacteria | 2563 |
| 192 | Ga0068852_100128249 | 3300005616 | Bacteria | 2332 |
| 193 | Ga0068852_100233518 | 3300005616 | Bacteria | 1754 |
| 194 | Ga0068852_100312894 | 3300005616 | Bacteria | 1523 |
| 195 | Ga0068852_100455909 | 3300005616 | Bacteria | 1267 |
| 196 | Ga0068852_100991840 | 3300005616 | Bacteria | 858 |
| 197 | Ga0068859_100147451 | 3300005617 | Bacteria | 2428 |
| 198 | Ga0068859_100295503 | 3300005617 | Bacteria | 1713 |
| 199 | Ga0068859_100645413 | 3300005617 | Bacteria | 1151 |
| 200 | Ga0068864_100020059 | 3300005618 | Bacteria | 5590 |
| 201 | Ga0068864_100064105 | 3300005618 | Bacteria | 3186 |
| 202 | Ga0068864_100365958 | 3300005618 | Bacteria | 1363 |
| 203 | Ga0068866_10002289 | 3300005718 | Bacteria | 7928 |
| 204 | Ga0068866_10020376 | 3300005718 | Bacteria | 3038 |
| 205 | Ga0068861_100006429 | 3300005719 | Bacteria | 8006 |
| 206 | Ga0068861_100059899 | 3300005719 | Bacteria | 2917 |
| 207 | Ga0068861_100230752 | 3300005719 | Bacteria | 1569 |
| 208 | Ga0068861_101559912 | 3300005719 | Bacteria | 650 |
| 209 | Ga0068851_10000665 | 3300005834 | Bacteria | 14682 |
| 210 | Ga0068851_10001506 | 3300005834 | Bacteria | 10221 |
| 211 | Ga0068851_10006993 | 3300005834 | Bacteria | 5174 |
| 212 | Ga0068851_10142701 | 3300005834 | Bacteria | 1303 |
| 213 | Ga0068870_10112519 | 3300005840 | Bacteria | 1556 |
| 214 | Ga0068863_100081005 | 3300005841 | Bacteria | 3075 |
| 215 | Ga0068863_100086511 | 3300005841 | Bacteria | 2970 |
| 216 | Ga0068863_100282064 | 3300005841 | Bacteria | 1609 |
| 217 | Ga0068863_100498042 | 3300005841 | Bacteria | 1199 |
| 218 | Ga0068863_100589644 | 3300005841 | Bacteria | 1099 |
| 219 | Ga0068858_100095139 | 3300005842 | Bacteria | 2775 |
| 220 | Ga0068858_100335879 | 3300005842 | Bacteria | 1445 |
| 221 | Ga0068858_100337981 | 3300005842 | Bacteria | 1441 |
| 222 | Ga0068860_100000213 | 3300005843 | Bacteria | 91105 |
| 223 | Ga0068860_100023118 | 3300005843 | Bacteria | 6011 |
| 224 | Ga0068860_100291645 | 3300005843 | Bacteria | 1597 |
| 225 | Ga0068860_100389135 | 3300005843 | Bacteria | 1377 |
| 226 | Ga0068860_100539684 | 3300005843 | Bacteria | 1167 |
| 227 | Ga0068860_100727792 | 3300005843 | Bacteria | 1003 |
| 228 | Ga0068862_100014954 | 3300005844 | Bacteria | 6445 |
| 229 | Ga0068862_100168868 | 3300005844 | Bacteria | 1957 |
| 230 | Ga0068862_100196454 | 3300005844 | Bacteria | 1817 |
| 231 | Ga0081455_10007959 | 3300005937 | Bacteria | 11084 |
| 232 | Ga0081455_10033401 | 3300005937 | Bacteria | 4624 |
| 233 | Ga0081540_1002690 | 3300005983 | Bacteria | 14454 |
| 234 | Ga0081540_1003654 | 3300005983 | Bacteria | 12058 |
| 235 | Ga0081540_1005056 | 3300005983 | Bacteria | 9896 |
| 236 | Ga0081540_1009757 | 3300005983 | Bacteria | 6578 |
| 237 | Ga0081540_1010774 | 3300005983 | Bacteria | 6148 |
| 238 | Ga0081540_1025433 | 3300005983 | Bacteria | 3406 |
| 239 | Ga0081540_1071432 | 3300005983 | Bacteria | 1604 |
| 240 | Ga0081539_10000148 | 3300005985 | Bacteria | 163442 |
| 241 | Ga0081539_10016757 | 3300005985 | Bacteria | 5203 |
| 242 | Ga0070717_11168232 | 3300006028 | Bacteria | 701 |
| 243 | Ga0075365_10003838 | 3300006038 | Bacteria | 7843 |
| 244 | Ga0075365_10032195 | 3300006038 | Bacteria | 3369 |
| 245 | Ga0075365_10067397 | 3300006038 | Bacteria | 2403 |
| 246 | Ga0075365_10149909 | 3300006038 | Bacteria | 1622 |
| 247 | Ga0075365_10287590 | 3300006038 | Bacteria | 1157 |
| 248 | Ga0075368_10002426 | 3300006042 | Bacteria | 6083 |
| 249 | Ga0075368_10009350 | 3300006042 | Bacteria | 3524 |
| 250 | Ga0075368_10050268 | 3300006042 | Bacteria | 1655 |
| 251 | Ga0075363_100001327 | 3300006048 | Bacteria | 9262 |
| 252 | Ga0075363_100020674 | 3300006048 | Bacteria | 3304 |
| 253 | Ga0075363_100053024 | 3300006048 | Bacteria | 2166 |
| 254 | Ga0075363_100094818 | 3300006048 | Bacteria | 1645 |
| 255 | Ga0075364_10065283 | 3300006051 | Bacteria | 2389 |
| 256 | Ga0075364_10238924 | 3300006051 | Bacteria | 1234 |
| 257 | Ga0070715_10013591 | 3300006163 | Bacteria | 2994 |
| 258 | Ga0070716_100003547 | 3300006173 | Bacteria | 7364 |
| 259 | Ga0070716_100576521 | 3300006173 | Bacteria | 843 |
| 260 | Ga0070716_100649533 | 3300006173 | Bacteria | 800 |
| 261 | Ga0070712_100021012 | 3300006175 | Bacteria | 4280 |
| 262 | Ga0070712_100152940 | 3300006175 | Bacteria | 1773 |
| 263 | Ga0070712_100363904 | 3300006175 | Bacteria | 1187 |
| 264 | Ga0070712_100605234 | 3300006175 | Bacteria | 928 |
| 265 | Ga0075362_10054241 | 3300006177 | Bacteria | 1801 |
| 266 | Ga0075362_10140258 | 3300006177 | Bacteria | 1155 |
| 267 | Ga0075367_10002297 | 3300006178 | Bacteria | 8676 |
| 268 | Ga0075367_10009600 | 3300006178 | Bacteria | 5064 |
| 269 | Ga0075367_10060115 | 3300006178 | Bacteria | 2264 |
| 270 | Ga0075367_10126478 | 3300006178 | Bacteria | 1577 |
| 271 | Ga0075367_10185516 | 3300006178 | Bacteria | 1297 |
| 272 | Ga0075367_10286818 | 3300006178 | Bacteria | 1035 |
| 273 | Ga0075369_10088176 | 3300006186 | Bacteria | 1382 |
| 274 | Ga0075369_10169745 | 3300006186 | Bacteria | 1001 |
| 275 | Ga0075366_10007498 | 3300006195 | Bacteria | 6029 |
| 276 | Ga0075366_10019086 | 3300006195 | Bacteria | 3962 |
| 277 | Ga0097621_100011478 | 3300006237 | Bacteria | 6525 |
| 278 | Ga0097621_100042158 | 3300006237 | Bacteria | 3675 |
| 279 | Ga0097621_100078820 | 3300006237 | Bacteria | 2737 |
| 280 | Ga0097621_100116282 | 3300006237 | Bacteria | 2265 |
| 281 | Ga0097621_100136235 | 3300006237 | Bacteria | 2094 |
| 282 | Ga0097621_100389056 | 3300006237 | Bacteria | 1247 |
| 283 | Ga0075370_10035136 | 3300006353 | Bacteria | 2812 |
| 284 | Ga0075370_10079108 | 3300006353 | Bacteria | 1888 |
| 285 | Ga0068871_100019286 | 3300006358 | Bacteria | 5206 |
| 286 | Ga0068871_100027614 | 3300006358 | Bacteria | 4440 |
| 287 | Ga0068871_100031162 | 3300006358 | Bacteria | 4203 |
| 288 | Ga0068871_100223209 | 3300006358 | Bacteria | 1633 |
| 289 | Ga0068871_100411868 | 3300006358 | Bacteria | 1205 |
| 290 | Ga0075428_100071694 | 3300006844 | Bacteria | 3786 |
| 291 | Ga0075434_100017694 | 3300006871 | Bacteria | 6870 |
| 292 | Ga0075434_100393898 | 3300006871 | Bacteria | 1406 |
| 293 | Ga0075434_100665107 | 3300006871 | Bacteria | 1060 |
| 294 | Ga0075429_100158532 | 3300006880 | Bacteria | 1982 |
| 295 | Ga0068865_100003720 | 3300006881 | Bacteria | 9156 |
| 296 | Ga0068865_100131111 | 3300006881 | Bacteria | 1878 |
| 297 | Ga0068865_100254427 | 3300006881 | Bacteria | 1387 |
| 298 | Ga0068865_100321204 | 3300006881 | Bacteria | 1245 |
| 299 | Ga0097620_100147448 | 3300006931 | Bacteria | 2428 |
| 300 | Ga0097620_100295498 | 3300006931 | Bacteria | 1713 |
| 301 | Ga0097620_100645431 | 3300006931 | Bacteria | 1151 |
| 302 | Ga0099824_1010553 | 3300006942 | Bacteria | 10831 |
| 303 | Ga0099822_1067191 | 3300006943 | Bacteria | 1061 |
| 304 | Ga0075435_100022344 | 3300007076 | Bacteria | 4881 |
| 305 | Ga0099794_10119692 | 3300007265 | Bacteria | 1324 |
| 306 | Ga0099795_10068565 | 3300007788 | Bacteria | 1333 |
| 307 | Ga0099795_10112602 | 3300007788 | Bacteria | 1080 |
| 308 | Ga0105244_10256859 | 3300009036 | Bacteria | 814 |
| 309 | Ga0105250_10090462 | 3300009092 | Bacteria | 1244 |
| 310 | Ga0105240_10012206 | 3300009093 | Bacteria | 11879 |
| 311 | Ga0105240_10015453 | 3300009093 | Bacteria | 10380 |
| 312 | Ga0105240_10019644 | 3300009093 | Bacteria | 9023 |
| 313 | Ga0105240_10204805 | 3300009093 | Bacteria | 2310 |
| 314 | Ga0105240_10235380 | 3300009093 | Bacteria | 2126 |
| 315 | Ga0105240_10553482 | 3300009093 | Bacteria | 1272 |
| 316 | Ga0105240_10584371 | 3300009093 | Bacteria | 1232 |
| 317 | Ga0105240_11011289 | 3300009093 | Bacteria | 888 |
| 318 | Ga0105240_11612825 | 3300009093 | Bacteria | 679 |
| 319 | Ga0111539_10207315 | 3300009094 | Bacteria | 2284 |
| 320 | Ga0111539_10371335 | 3300009094 | Bacteria | 1665 |
| 321 | Ga0105245_10035254 | 3300009098 | Bacteria | 4440 |
| 322 | Ga0105245_10111250 | 3300009098 | Bacteria | 2547 |
| 323 | Ga0105245_10172862 | 3300009098 | Bacteria | 2058 |
| 324 | Ga0105245_10194798 | 3300009098 | Bacteria | 1943 |
| 325 | Ga0105245_10214003 | 3300009098 | Bacteria | 1856 |
| 326 | Ga0105247_10074437 | 3300009101 | Bacteria | 2130 |
| 327 | Ga0105247_10431046 | 3300009101 | Bacteria | 946 |
| 328 | Ga0105247_10676183 | 3300009101 | Bacteria | 774 |
| 329 | Ga0105243_10048411 | 3300009148 | Bacteria | 3351 |
| 330 | Ga0105243_10195973 | 3300009148 | Bacteria | 1768 |
| 331 | Ga0105241_10001128 | 3300009174 | Bacteria | 20332 |
| 332 | Ga0105241_10010710 | 3300009174 | Bacteria | 6729 |
| 333 | Ga0105241_10038244 | 3300009174 | Bacteria | 3616 |
| 334 | Ga0105241_10051559 | 3300009174 | Bacteria | 3138 |
| 335 | Ga0105241_10277950 | 3300009174 | Bacteria | 1429 |
| 336 | Ga0105242_10034685 | 3300009176 | Bacteria | 4045 |
| 337 | Ga0105242_10039027 | 3300009176 | Bacteria | 3821 |
| 338 | Ga0105242_10229076 | 3300009176 | Bacteria | 1664 |
| 339 | Ga0105248_10032462 | 3300009177 | Bacteria | 5836 |
| 340 | Ga0105248_10039667 | 3300009177 | Bacteria | 5277 |
| 341 | Ga0105248_10394372 | 3300009177 | Bacteria | 1559 |
| 342 | Ga0105248_11050293 | 3300009177 | Bacteria | 920 |
| 343 | Ga0105237_10016711 | 3300009545 | Bacteria | 7618 |
| 344 | Ga0105237_10039759 | 3300009545 | Bacteria | 4746 |
| 345 | Ga0105237_10087117 | 3300009545 | Bacteria | 3112 |
| 346 | Ga0105237_10097240 | 3300009545 | Bacteria | 2934 |
| 347 | Ga0105237_10117017 | 3300009545 | Bacteria | 2659 |
| 348 | Ga0105237_10125974 | 3300009545 | Bacteria | 2556 |
| 349 | Ga0105237_10165645 | 3300009545 | Bacteria | 2209 |
| 350 | Ga0105238_10000006 | 3300009551 | Bacteria | 346249 |
| 351 | Ga0105238_10005356 | 3300009551 | Bacteria | 12677 |
| 352 | Ga0105238_10033734 | 3300009551 | Bacteria | 5208 |
| 353 | Ga0105238_10538707 | 3300009551 | Bacteria | 1171 |
| 354 | Ga0105238_10727802 | 3300009551 | Bacteria | 1005 |
| 355 | Ga0105249_10219612 | 3300009553 | Bacteria | 1870 |
| 356 | Ga0105249_10246467 | 3300009553 | Bacteria | 1769 |
| 357 | Ga0099796_10000987 | 3300010159 | Bacteria | 5345 |
| 358 | Ga0105239_10003581 | 3300010375 | Bacteria | 18987 |
| 359 | Ga0105239_10010252 | 3300010375 | Bacteria | 10494 |
| 360 | Ga0105239_10013525 | 3300010375 | Bacteria | 9059 |
| 361 | Ga0105239_10038755 | 3300010375 | Bacteria | 5221 |
| 362 | Ga0105239_10076483 | 3300010375 | Bacteria | 3682 |
| 363 | Ga0105239_10151195 | 3300010375 | Bacteria | 2591 |
| 364 | Ga0105239_10350184 | 3300010375 | Bacteria | 1667 |
| 365 | Ga0105239_10523367 | 3300010375 | Bacteria | 1349 |
| 366 | Ga0105246_10071979 | 3300011119 | Bacteria | 2436 |
| 367 | Ga0105246_10107900 | 3300011119 | Bacteria | 2040 |
| 368 | Ga0105246_10680542 | 3300011119 | Bacteria | 899 |
| 369 | Ga0157371_10030779 | 3300013102 | Bacteria | 3869 |
| 370 | Ga0157371_10361194 | 3300013102 | Bacteria | 1058 |
| 371 | Ga0157370_10040329 | 3300013104 | Bacteria | 4508 |
| 372 | Ga0157370_10054676 | 3300013104 | Bacteria | 3805 |
| 373 | Ga0157369_10066689 | 3300013105 | Bacteria | 3871 |
| 374 | Ga0157369_10551805 | 3300013105 | Bacteria | 1191 |
| 375 | Ga0157374_10037138 | 3300013296 | Bacteria | 4468 |
| 376 | Ga0157374_10157085 | 3300013296 | Bacteria | 2214 |
| 377 | Ga0157374_10758943 | 3300013296 | Bacteria | 985 |
| 378 | Ga0157378_10007281 | 3300013297 | Bacteria | 9663 |
| 379 | Ga0157378_10013278 | 3300013297 | Bacteria | 7202 |
| 380 | Ga0157378_10026219 | 3300013297 | Bacteria | 5138 |
| 381 | Ga0157378_10154957 | 3300013297 | Bacteria | 2137 |
| 382 | Ga0157378_10168161 | 3300013297 | Bacteria | 2055 |
| 383 | Ga0157378_11187248 | 3300013297 | Bacteria | 802 |
| 384 | Ga0163162_10011527 | 3300013306 | Bacteria | 8622 |
| 385 | Ga0163162_10035074 | 3300013306 | Bacteria | 4995 |
| 386 | Ga0163162_10039978 | 3300013306 | Bacteria | 4688 |
| 387 | Ga0163162_10041818 | 3300013306 | Bacteria | 4586 |
| 388 | Ga0163162_10200071 | 3300013306 | Bacteria | 2126 |
| 389 | Ga0163162_10225184 | 3300013306 | Bacteria | 2005 |
| 390 | Ga0163162_10319734 | 3300013306 | Bacteria | 1684 |
| 391 | Ga0163162_10618287 | 3300013306 | Bacteria | 1209 |
| 392 | Ga0157372_10055636 | 3300013307 | Bacteria | 4419 |
| 393 | Ga0157375_10048580 | 3300013308 | Bacteria | 4152 |
| 394 | Ga0157375_10057722 | 3300013308 | Bacteria | 3837 |
| 395 | Ga0157375_10251804 | 3300013308 | Bacteria | 1927 |
| 396 | Ga0157375_10298662 | 3300013308 | Bacteria | 1774 |
| 397 | Ga0157375_10479684 | 3300013308 | Bacteria | 1409 |
| 398 | Ga0157375_10682786 | 3300013308 | Bacteria | 1181 |
| 399 | Ga0157375_10730970 | 3300013308 | Bacteria | 1142 |
| 400 | Ga0163163_10051487 | 3300014325 | Bacteria | 4060 |
| 401 | Ga0163163_10300177 | 3300014325 | Bacteria | 1659 |
| 402 | Ga0163163_10467958 | 3300014325 | Bacteria | 1321 |
| 403 | Ga0157380_10010841 | 3300014326 | Bacteria | 6571 |
| 404 | Ga0157380_10133887 | 3300014326 | Bacteria | 2118 |
| 405 | Ga0157380_10403654 | 3300014326 | Bacteria | 1297 |
| 406 | Ga0157380_10880432 | 3300014326 | Bacteria | 920 |
| 407 | Ga0182008_10206915 | 3300014497 | Bacteria | 1000 |
| 408 | Ga0182008_10282620 | 3300014497 | Bacteria | 864 |
| 409 | Ga0157377_10197850 | 3300014745 | Bacteria | 1274 |
| 410 | Ga0157379_10033015 | 3300014968 | Bacteria | 4616 |
| 411 | Ga0157379_10688565 | 3300014968 | Bacteria | 959 |
| 412 | Ga0157376_10204895 | 3300014969 | Bacteria | 1817 |
| 413 | Ga0157376_10299006 | 3300014969 | Bacteria | 1523 |
| 414 | Ga0157376_10365929 | 3300014969 | Bacteria | 1384 |
| 415 | Ga0157376_10440153 | 3300014969 | Bacteria | 1269 |
| 416 | Ga0157376_10649097 | 3300014969 | Bacteria | 1055 |
| 417 | Ga0157376_10831970 | 3300014969 | Bacteria | 937 |
| 418 | Ga0182006_1008158 | 3300015261 | Bacteria | 4752 |
| 419 | Ga0163161_10094489 | 3300017792 | Bacteria | 2217 |
| 420 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 421 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 422 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 423 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 424 | Ga0213872_10007408 | 3300021361 | Bacteria | 5402 |
| 425 | Ga0213876_10151807 | 3300021384 | Bacteria | 1232 |
| 426 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 427 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 428 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 429 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 430 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 431 | Ga0209148_1000500 | 3300025254 | Bacteria | 39994 |
| 432 | Ga0209233_1001622 | 3300025261 | Bacteria | 8756 |
| 433 | Ga0209233_1002635 | 3300025261 | Bacteria | 6509 |
| 434 | Ga0209233_1008753 | 3300025261 | Bacteria | 3110 |
| 435 | Ga0209233_1010397 | 3300025261 | Bacteria | 2790 |
| 436 | Ga0207666_1032107 | 3300025271 | Bacteria | 806 |
| 437 | Ga0209455_1001381 | 3300025272 | Bacteria | 11081 |
| 438 | Ga0209455_1001411 | 3300025272 | Bacteria | 10891 |
| 439 | Ga0209455_1014791 | 3300025272 | Bacteria | 1747 |
| 440 | Ga0209564_1031964 | 3300025295 | Bacteria | 1595 |
| 441 | Ga0209758_1002091 | 3300025297 | Bacteria | 21224 |
| 442 | Ga0209758_1002990 | 3300025297 | Bacteria | 16204 |
| 443 | Ga0209758_1006039 | 3300025297 | Bacteria | 8935 |
| 444 | Ga0209758_1028088 | 3300025297 | Bacteria | 2388 |
| 445 | Ga0209758_1071513 | 3300025297 | Bacteria | 1089 |
| 446 | Ga0209256_1069700 | 3300025299 | Bacteria | 794 |
| 447 | Ga0207426_1000238 | 3300025302 | Bacteria | 124393 |
| 448 | Ga0207426_1000726 | 3300025302 | Bacteria | 37826 |
| 449 | Ga0207426_1010515 | 3300025302 | Bacteria | 3587 |
| 450 | Ga0207426_1018462 | 3300025302 | Bacteria | 2456 |
| 451 | Ga0209257_1016377 | 3300025304 | Bacteria | 3003 |
| 452 | Ga0209257_1029697 | 3300025304 | Bacteria | 1777 |
| 453 | Ga0207697_10032045 | 3300025315 | Bacteria | 2151 |
| 454 | Ga0207656_10020655 | 3300025321 | Bacteria | 2620 |
| 455 | Ga0207656_10023820 | 3300025321 | Bacteria | 2469 |
| 456 | Ga0207653_10020940 | 3300025885 | Bacteria | 2072 |
| 457 | Ga0207692_10005452 | 3300025898 | Bacteria | 5098 |
| 458 | Ga0207642_10001698 | 3300025899 | Bacteria | 6811 |
| 459 | Ga0207642_10024183 | 3300025899 | Bacteria | 2439 |
| 460 | Ga0207642_10058877 | 3300025899 | Bacteria | 1774 |
| 461 | Ga0207642_10120908 | 3300025899 | Bacteria | 1350 |
| 462 | Ga0207710_10040185 | 3300025900 | Bacteria | 2072 |
| 463 | Ga0207710_10352615 | 3300025900 | Bacteria | 750 |
| 464 | Ga0207688_10014787 | 3300025901 | Bacteria | 4235 |
| 465 | Ga0207688_10022654 | 3300025901 | Bacteria | 3438 |
| 466 | Ga0207688_10718549 | 3300025901 | Bacteria | 632 |
| 467 | Ga0207680_10011092 | 3300025903 | Bacteria | 4539 |
| 468 | Ga0207680_10080583 | 3300025903 | Bacteria | 2044 |
| 469 | Ga0207680_10210837 | 3300025903 | Bacteria | 1328 |
| 470 | Ga0207680_10425906 | 3300025903 | Bacteria | 940 |
| 471 | Ga0207680_10507445 | 3300025903 | Bacteria | 859 |
| 472 | Ga0207647_10001739 | 3300025904 | Bacteria | 16681 |
| 473 | Ga0207647_10004412 | 3300025904 | Bacteria | 10434 |
| 474 | Ga0207685_10280953 | 3300025905 | Bacteria | 817 |
| 475 | Ga0207699_10031838 | 3300025906 | Bacteria | 2965 |
| 476 | Ga0207645_10002659 | 3300025907 | Bacteria | 13907 |
| 477 | Ga0207645_10076504 | 3300025907 | Bacteria | 2144 |
| 478 | Ga0207645_10104653 | 3300025907 | Bacteria | 1828 |
| 479 | Ga0207645_10141766 | 3300025907 | Bacteria | 1566 |
| 480 | Ga0207643_10009703 | 3300025908 | Bacteria | 5166 |
| 481 | Ga0207705_10054017 | 3300025909 | Bacteria | 2895 |
| 482 | Ga0207684_10147447 | 3300025910 | Bacteria | 2024 |
| 483 | Ga0207654_10000232 | 3300025911 | Bacteria | 34089 |
| 484 | Ga0207654_10007223 | 3300025911 | Bacteria | 5597 |
| 485 | Ga0207654_10008189 | 3300025911 | Bacteria | 5272 |
| 486 | Ga0207654_10018133 | 3300025911 | Bacteria | 3690 |
| 487 | Ga0207654_10217514 | 3300025911 | Bacteria | 1265 |
| 488 | Ga0207707_10004626 | 3300025912 | Bacteria | 12087 |
| 489 | Ga0207707_10153907 | 3300025912 | Bacteria | 2010 |
| 490 | Ga0207695_10001547 | 3300025913 | Bacteria | 37828 |
| 491 | Ga0207695_10018027 | 3300025913 | Bacteria | 8174 |
| 492 | Ga0207695_10021133 | 3300025913 | Bacteria | 7435 |
| 493 | Ga0207695_10029145 | 3300025913 | Bacteria | 6107 |
| 494 | Ga0207695_10211998 | 3300025913 | Bacteria | 1847 |
| 495 | Ga0207695_10225135 | 3300025913 | Bacteria | 1782 |
| 496 | Ga0207695_10272263 | 3300025913 | Bacteria | 1589 |
| 497 | Ga0207671_10044857 | 3300025914 | Bacteria | 3269 |
| 498 | Ga0207671_10061493 | 3300025914 | Bacteria | 2786 |
| 499 | Ga0207671_10106153 | 3300025914 | Bacteria | 2132 |
| 500 | Ga0207671_10361026 | 3300025914 | Bacteria | 1153 |
| 501 | Ga0207671_10596836 | 3300025914 | Bacteria | 880 |
| 502 | Ga0207671_10730982 | 3300025914 | Bacteria | 787 |
| 503 | Ga0207693_10004043 | 3300025915 | Bacteria | 12466 |
| 504 | Ga0207693_10096048 | 3300025915 | Bacteria | 2323 |
| 505 | Ga0207693_10218848 | 3300025915 | Bacteria | 1496 |
| 506 | Ga0207693_10468550 | 3300025915 | Bacteria | 984 |
| 507 | Ga0207663_10000098 | 3300025916 | Bacteria | 41171 |
| 508 | Ga0207663_10077320 | 3300025916 | Bacteria | 2166 |
| 509 | Ga0207660_10002564 | 3300025917 | Bacteria | 11938 |
| 510 | Ga0207660_10049575 | 3300025917 | Bacteria | 2978 |
| 511 | Ga0207662_10021702 | 3300025918 | Bacteria | 3674 |
| 512 | Ga0207657_10000658 | 3300025919 | Bacteria | 36762 |
| 513 | Ga0207657_10169532 | 3300025919 | Bacteria | 1769 |
| 514 | Ga0207649_10031218 | 3300025920 | Bacteria | 3165 |
| 515 | Ga0207649_10531499 | 3300025920 | Bacteria | 898 |
| 516 | Ga0207652_10003470 | 3300025921 | Bacteria | 12999 |
| 517 | Ga0207652_10104025 | 3300025921 | Bacteria | 2511 |
| 518 | Ga0207652_10673781 | 3300025921 | Bacteria | 924 |
| 519 | Ga0207646_10063050 | 3300025922 | Bacteria | 3309 |
| 520 | Ga0207681_10208519 | 3300025923 | Bacteria | 1505 |
| 521 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 522 | Ga0207694_10000129 | 3300025924 | Bacteria | 77922 |
| 523 | Ga0207694_10017085 | 3300025924 | Bacteria | 5481 |
| 524 | Ga0207694_10063725 | 3300025924 | Bacteria | 2872 |
| 525 | Ga0207694_10154466 | 3300025924 | Bacteria | 1850 |
| 526 | Ga0207650_10070842 | 3300025925 | Bacteria | 2621 |
| 527 | Ga0207650_10215193 | 3300025925 | Unclassified | 1544 |
| 528 | Ga0207659_10003508 | 3300025926 | Bacteria | 9425 |
| 529 | Ga0207659_10044448 | 3300025926 | Bacteria | 3125 |
| 530 | Ga0207659_10380865 | 3300025926 | Bacteria | 1176 |
| 531 | Ga0207687_10006047 | 3300025927 | Bacteria | 8006 |
| 532 | Ga0207687_10190002 | 3300025927 | Bacteria | 1598 |
| 533 | Ga0207687_10478189 | 3300025927 | Bacteria | 1037 |
| 534 | Ga0207687_10509630 | 3300025927 | Bacteria | 1005 |
| 535 | Ga0207664_10017228 | 3300025929 | Bacteria | 5291 |
| 536 | Ga0207664_10810461 | 3300025929 | Bacteria | 842 |
| 537 | Ga0207644_10002628 | 3300025931 | Bacteria | 11568 |
| 538 | Ga0207644_10083186 | 3300025931 | Bacteria | 2369 |
| 539 | Ga0207644_10157177 | 3300025931 | Bacteria | 1764 |
| 540 | Ga0207644_10325732 | 3300025931 | Bacteria | 1243 |
| 541 | Ga0207706_10042483 | 3300025933 | Bacteria | 4029 |
| 542 | Ga0207706_10122664 | 3300025933 | Bacteria | 2286 |
| 543 | Ga0207706_10175601 | 3300025933 | Bacteria | 1882 |
| 544 | Ga0207706_10210667 | 3300025933 | Bacteria | 1704 |
| 545 | Ga0207706_10308903 | 3300025933 | Bacteria | 1377 |
| 546 | Ga0207686_10000485 | 3300025934 | Bacteria | 26204 |
| 547 | Ga0207709_10028770 | 3300025935 | Bacteria | 3216 |
| 548 | Ga0207709_10174249 | 3300025935 | Bacteria | 1513 |
| 549 | Ga0207709_10410928 | 3300025935 | Bacteria | 1037 |
| 550 | Ga0207709_10442205 | 3300025935 | Bacteria | 1003 |
| 551 | Ga0207670_10098558 | 3300025936 | Bacteria | 2083 |
| 552 | Ga0207670_10422402 | 3300025936 | Bacteria | 1070 |
| 553 | Ga0207670_10658863 | 3300025936 | Bacteria | 864 |
| 554 | Ga0207669_10020565 | 3300025937 | Bacteria | 3465 |
| 555 | Ga0207704_10035220 | 3300025938 | Bacteria | 2866 |
| 556 | Ga0207704_10060292 | 3300025938 | Bacteria | 2347 |
| 557 | Ga0207704_10121951 | 3300025938 | Bacteria | 1786 |
| 558 | Ga0207704_10174673 | 3300025938 | Bacteria | 1545 |
| 559 | Ga0207704_10517648 | 3300025938 | Bacteria | 964 |
| 560 | Ga0207665_10000355 | 3300025939 | Bacteria | 31763 |
| 561 | Ga0207665_10316251 | 3300025939 | Bacteria | 1170 |
| 562 | Ga0207665_10730464 | 3300025939 | Bacteria | 780 |
| 563 | Ga0207665_10794906 | 3300025939 | Bacteria | 747 |
| 564 | Ga0207691_10000734 | 3300025940 | Bacteria | 32373 |
| 565 | Ga0207691_10043338 | 3300025940 | Bacteria | 4147 |
| 566 | Ga0207691_10305385 | 3300025940 | Bacteria | 1366 |
| 567 | Ga0207691_10328974 | 3300025940 | Bacteria | 1309 |
| 568 | Ga0207711_10078422 | 3300025941 | Bacteria | 2881 |
| 569 | Ga0207711_10821497 | 3300025941 | Bacteria | 865 |
| 570 | Ga0207689_10015745 | 3300025942 | Bacteria | 6404 |
| 571 | Ga0207689_10018993 | 3300025942 | Bacteria | 5797 |
| 572 | Ga0207689_10031264 | 3300025942 | Bacteria | 4433 |
| 573 | Ga0207689_10124415 | 3300025942 | Bacteria | 2121 |
| 574 | Ga0207689_10184590 | 3300025942 | Bacteria | 1720 |
| 575 | Ga0207661_10022075 | 3300025944 | Bacteria | 4785 |
| 576 | Ga0207661_10291060 | 3300025944 | Bacteria | 1462 |
| 577 | Ga0207661_10446571 | 3300025944 | Bacteria | 1177 |
| 578 | Ga0207679_10024963 | 3300025945 | Bacteria | 4104 |
| 579 | Ga0207679_10400752 | 3300025945 | Bacteria | 1207 |
| 580 | Ga0207679_10556362 | 3300025945 | Bacteria | 1030 |
| 581 | Ga0207667_10014083 | 3300025949 | Bacteria | 9131 |
| 582 | Ga0207667_10015706 | 3300025949 | Bacteria | 8586 |
| 583 | Ga0207667_10018609 | 3300025949 | Bacteria | 7784 |
| 584 | Ga0207667_10043266 | 3300025949 | Bacteria | 4780 |
| 585 | Ga0207667_10097440 | 3300025949 | Bacteria | 3035 |
| 586 | Ga0207667_10236835 | 3300025949 | Bacteria | 1868 |
| 587 | Ga0207667_10285835 | 3300025949 | Bacteria | 1685 |
| 588 | Ga0207651_10215578 | 3300025960 | Bacteria | 1548 |
| 589 | Ga0207651_10360982 | 3300025960 | Bacteria | 1226 |
| 590 | Ga0207668_10292329 | 3300025972 | Bacteria | 1341 |
| 591 | Ga0207668_10321278 | 3300025972 | Bacteria | 1284 |
| 592 | Ga0207640_10016085 | 3300025981 | Bacteria | 4344 |
| 593 | Ga0207640_10043908 | 3300025981 | Bacteria | 2860 |
| 594 | Ga0207640_10052613 | 3300025981 | Bacteria | 2653 |
| 595 | Ga0207640_10079187 | 3300025981 | Unclassified | 2239 |
| 596 | Ga0207640_10119092 | 3300025981 | Bacteria | 1887 |
| 597 | Ga0207640_10258346 | 3300025981 | Bacteria | 1356 |
| 598 | Ga0207640_10285402 | 3300025981 | Bacteria | 1299 |
| 599 | Ga0207677_10004777 | 3300026023 | Bacteria | 7311 |
| 600 | Ga0207677_10125605 | 3300026023 | Bacteria | 1938 |
| 601 | Ga0207703_10140794 | 3300026035 | Bacteria | 2093 |
| 602 | Ga0207639_10021331 | 3300026041 | Bacteria | 4651 |
| 603 | Ga0207639_10478909 | 3300026041 | Bacteria | 1134 |
| 604 | Ga0207639_10910586 | 3300026041 | Bacteria | 822 |
| 605 | Ga0207639_11089091 | 3300026041 | Bacteria | 749 |
| 606 | Ga0207678_10008230 | 3300026067 | Bacteria | 9189 |
| 607 | Ga0207678_10008831 | 3300026067 | Bacteria | 8871 |
| 608 | Ga0207678_10029682 | 3300026067 | Bacteria | 4774 |
| 609 | Ga0207678_10065077 | 3300026067 | Bacteria | 3131 |
| 610 | Ga0207678_10150609 | 3300026067 | Bacteria | 1986 |
| 611 | Ga0207678_10310698 | 3300026067 | Bacteria | 1355 |
| 612 | Ga0207678_10354152 | 3300026067 | Bacteria | 1266 |
| 613 | Ga0207678_10429827 | 3300026067 | Bacteria | 1146 |
| 614 | Ga0207708_10028723 | 3300026075 | Bacteria | 4211 |
| 615 | Ga0207708_10067333 | 3300026075 | Bacteria | 2739 |
| 616 | Ga0207708_10611095 | 3300026075 | Bacteria | 924 |
| 617 | Ga0207708_10773519 | 3300026075 | Bacteria | 825 |
| 618 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 619 | Ga0207702_10010350 | 3300026078 | Bacteria | 7813 |
| 620 | Ga0207702_10051226 | 3300026078 | Bacteria | 3488 |
| 621 | Ga0207702_10079035 | 3300026078 | Bacteria | 2850 |
| 622 | Ga0207702_10080745 | 3300026078 | Bacteria | 2822 |
| 623 | Ga0207702_10097487 | 3300026078 | Bacteria | 2588 |
| 624 | Ga0207702_10205406 | 3300026078 | Bacteria | 1829 |
| 625 | Ga0207702_10269781 | 3300026078 | Bacteria | 1605 |
| 626 | Ga0207641_10229824 | 3300026088 | Bacteria | 1723 |
| 627 | Ga0207641_10313119 | 3300026088 | Bacteria | 1486 |
| 628 | Ga0207641_10636814 | 3300026088 | Bacteria | 1046 |
| 629 | Ga0207641_11090006 | 3300026088 | Bacteria | 797 |
| 630 | Ga0207648_10002498 | 3300026089 | Bacteria | 19740 |
| 631 | Ga0207648_10012844 | 3300026089 | Bacteria | 7821 |
| 632 | Ga0207648_10018957 | 3300026089 | Bacteria | 6214 |
| 633 | Ga0207648_10044357 | 3300026089 | Bacteria | 3901 |
| 634 | Ga0207648_10049980 | 3300026089 | Bacteria | 3657 |
| 635 | Ga0207648_10055009 | 3300026089 | Bacteria | 3475 |
| 636 | Ga0207648_10502058 | 3300026089 | Bacteria | 1110 |
| 637 | Ga0207648_10870686 | 3300026089 | Bacteria | 841 |
| 638 | Ga0207676_10089834 | 3300026095 | Bacteria | 2519 |
| 639 | Ga0207676_10215181 | 3300026095 | Bacteria | 1708 |
| 640 | Ga0207676_10258444 | 3300026095 | Bacteria | 1571 |
| 641 | Ga0207676_10287859 | 3300026095 | Bacteria | 1494 |
| 642 | Ga0207676_10866087 | 3300026095 | Bacteria | 884 |
| 643 | Ga0207674_10010794 | 3300026116 | Bacteria | 10301 |
| 644 | Ga0207674_10012018 | 3300026116 | Bacteria | 9700 |
| 645 | Ga0207674_10014258 | 3300026116 | Bacteria | 8783 |
| 646 | Ga0207674_10097514 | 3300026116 | Bacteria | 2923 |
| 647 | Ga0207675_100003157 | 3300026118 | Bacteria | 16167 |
| 648 | Ga0207675_100042005 | 3300026118 | Bacteria | 4269 |
| 649 | Ga0207675_100162819 | 3300026118 | Bacteria | 2129 |
| 650 | Ga0207675_100193834 | 3300026118 | Bacteria | 1950 |
| 651 | Ga0207675_100232070 | 3300026118 | Bacteria | 1781 |
| 652 | Ga0207675_100441456 | 3300026118 | Bacteria | 1288 |
| 653 | Ga0207683_10001672 | 3300026121 | Bacteria | 19869 |
| 654 | Ga0207683_10002522 | 3300026121 | Bacteria | 15987 |
| 655 | Ga0207683_10061259 | 3300026121 | Bacteria | 3311 |
| 656 | Ga0207683_10104462 | 3300026121 | Bacteria | 2532 |
| 657 | Ga0207683_10343648 | 3300026121 | Bacteria | 1369 |
| 658 | Ga0207683_10440052 | 3300026121 | Bacteria | 1201 |
| 659 | Ga0207683_10467756 | 3300026121 | Bacteria | 1163 |
| 660 | Ga0207698_10003755 | 3300026142 | Bacteria | 9180 |
| 661 | Ga0207698_10027502 | 3300026142 | Bacteria | 4039 |
| 662 | Ga0207698_10030725 | 3300026142 | Bacteria | 3868 |
| 663 | Ga0207698_10183800 | 3300026142 | Bacteria | 1855 |
| 664 | Ga0207698_10681066 | 3300026142 | Bacteria | 1021 |
| 665 | Ga0207698_11127917 | 3300026142 | Bacteria | 797 |
| 666 | Ga0207698_11217242 | 3300026142 | Bacteria | 767 |
| 667 | Ga0209389_1005934 | 3300027296 | Bacteria | 10512 |
| 668 | Ga0209589_1000092 | 3300027357 | Bacteria | 89530 |
| 669 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 670 | Ga0209588_1025913 | 3300027671 | Bacteria | 1859 |
| 671 | Ga0209813_10014735 | 3300027866 | Bacteria | 2109 |
| 672 | Ga0209813_10132505 | 3300027866 | Bacteria | 878 |
| 673 | Ga0207428_10097532 | 3300027907 | Bacteria | 2275 |
| 674 | Ga0207428_10119691 | 3300027907 | Bacteria | 2020 |
| 675 | Ga0268266_10008395 | 3300028379 | Bacteria | 9183 |
| 676 | Ga0268266_10046593 | 3300028379 | Bacteria | 3712 |
| 677 | Ga0268266_10062176 | 3300028379 | Bacteria | 3221 |
| 678 | Ga0268266_10914601 | 3300028379 | Bacteria | 848 |
| 679 | Ga0268266_11083511 | 3300028379 | Bacteria | 775 |
| 680 | Ga0268265_10019499 | 3300028380 | Bacteria | 4716 |
| 681 | Ga0268265_10190091 | 3300028380 | Bacteria | 1772 |
| 682 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 683 | Ga0268264_10006431 | 3300028381 | Bacteria | 9893 |
| 684 | Ga0268264_10551098 | 3300028381 | Bacteria | 1131 |
| 685 | Ga0307515_10074714 | 3300028794 | Bacteria | 4528 |
| 686 | Ga0265328_10034595 | 3300031239 | Bacteria | 1871 |
| 687 | Ga0265325_10013395 | 3300031241 | Bacteria | 4669 |
| 688 | Ga0265339_10063987 | 3300031249 | Bacteria | 1974 |
| 689 | Ga0265339_10071466 | 3300031249 | Bacteria | 1849 |
| 690 | Ga0265339_10101543 | 3300031249 | Bacteria | 1496 |
| 691 | Ga0307513_10302368 | 3300031456 | Bacteria | 1366 |
| 692 | Ga0307509_10065921 | 3300031507 | Bacteria | 3800 |
| 693 | Ga0307509_10596543 | 3300031507 | Bacteria | 777 |
| 694 | Ga0265313_10067731 | 3300031595 | Bacteria | 1651 |
| 695 | Ga0265314_10005784 | 3300031711 | Bacteria | 11093 |
| 696 | Ga0265314_10075664 | 3300031711 | Bacteria | 2239 |
| 697 | Ga0265314_10098506 | 3300031711 | Bacteria | 1886 |
| 698 | Ga0265342_10029779 | 3300031712 | Bacteria | 3387 |
| 699 | Ga0265342_10077859 | 3300031712 | Bacteria | 1919 |
| 700 | Ga0307516_10004992 | 3300031730 | Bacteria | 16102 |
| 701 | Ga0307405_10139955 | 3300031731 | Bacteria | 1686 |
| 702 | Ga0307406_10090379 | 3300031901 | Bacteria | 2060 |
| 703 | Ga0307406_10820446 | 3300031901 | Bacteria | 786 |
| 704 | Ga0307416_100054674 | 3300032002 | Bacteria | 3210 |
| 705 | Ga0307411_10931942 | 3300032005 | Bacteria | 773 |
| 706 | Ga0307415_100881300 | 3300032126 | Bacteria | 823 |
| 707 | Ga0307510_10016959 | 3300033180 | Bacteria | 8590 |
| 708 | Ga0307510_10060670 | 3300033180 | Bacteria | 3889 |
| 709 | Ga0307510_10200324 | 3300033180 | Bacteria | 1532 |
| 710 | Ga0373930_0006141 | 3300034816 | Bacteria | 2020 |
| 711 | Ga0373928_0055920 | 3300035084 | Bacteria | 943 |
| 712 | Ga0373944_0157513 | 3300035089 | Bacteria | 804 |
| 713 | Ga0373951_0032943 | 3300035091 | Bacteria | 1227 |
| 714 | Ga0373923_0104184 | 3300035111 | Bacteria | 1254 |
| 715 | Ga0373941_0026182 | 3300035115 | Bacteria | 1692 |
| 716 | Ga0373953_0024360 | 3300035117 | Bacteria | 2300 |
| 717 | Ga0373954_0003560 | 3300035118 | Bacteria | 6618 |
| 718 | Ga0373956_0056972 | 3300035119 | Bacteria | 1765 |
| 719 | Ga0373957_0012158 | 3300035120 | Bacteria | 2891 |
| 720 | Ga0373943_0004723 | 3300035170 | Bacteria | 6161 |
| 721 | Ga0373946_0010067 | 3300035171 | Bacteria | 3496 |
| 722 | Ga0373955_0092505 | 3300035172 | Bacteria | 1725 |
| 723 | Ga0373955_0264978 | 3300035172 | Bacteria | 1032 |
| 724 | Ga0373924_0026828 | 3300035410 | Bacteria | 2287 |
| 725 | Ga0373931_0038508 | 3300035691 | Bacteria | 2501 |
| 726 | Ga0373931_0144646 | 3300035691 | Bacteria | 1381 |
| 727 | Ga0373935_0022640 | 3300035692 | Bacteria | 3855 |
| 728 | Ga0373935_0229179 | 3300035692 | Bacteria | 1293 |
| 729 | Ga0373935_0412377 | 3300035692 | Bacteria | 971 |
| 730 | Ga0373927_0024231 | 3300035695 | Bacteria | 3970 |
| 731 | Ga0373927_0036402 | 3300035695 | Bacteria | 3201 |
| 732 | Ga0373927_0046989 | 3300035695 | Bacteria | 2792 |
| 733 | Ga0373927_0267854 | 3300035695 | Bacteria | 1123 |
| 734 | Ga0373927_0324252 | 3300035695 | Bacteria | 1014 |
| 735 | Ga0373927_0391148 | 3300035695 | Bacteria | 917 |
| 736 | Ga0373933_0014758 | 3300035724 | Bacteria | 4348 |
| 737 | Ga0373933_0017008 | 3300035724 | Bacteria | 4077 |
| 738 | Ga0373933_0133256 | 3300035724 | Bacteria | 1564 |
| 739 | Ga0373947_0023699 | 3300035725 | Bacteria | 3573 |
| 740 | Ga0373947_0053850 | 3300035725 | Bacteria | 2427 |
| 741 | Ga0373937_0012233 | 3300036401 | Bacteria | 7538 |
| 742 | Ga0373937_0074306 | 3300036401 | Bacteria | 3136 |
| 743 | Ga0373937_0251215 | 3300036401 | Bacteria | 1667 |
| 744 | Ga0373937_0750281 | 3300036401 | Bacteria | 923 |
| 745 | Ga0373925_0006190 | 3300037068 | Bacteria | 8839 |
| 746 | Ga0373925_0010015 | 3300037068 | Bacteria | 6884 |
| 747 | Ga0373925_0147237 | 3300037068 | Bacteria | 1846 |
| 748 | Ga0373925_0357268 | 3300037068 | Bacteria | 1187 |
| 749 | Ga0373925_0465515 | 3300037068 | Bacteria | 1036 |
| 750 | Ga0395899_0268825 | 3300037312 | Bacteria | 1163 |
| 751 | Ga0395899_0494693 | 3300037312 | Bacteria | 794 |
| 752 | Ga0395900_0153330 | 3300037418 | Bacteria | 2354 |
| 753 | Ga0395900_0233750 | 3300037418 | Bacteria | 1847 |
| 754 | Ga0395898_0229371 | 3300037466 | Bacteria | 1771 |
| 755 | Ga0395898_0243167 | 3300037466 | Bacteria | 1716 |
| 756 | Ga0395905_0069832 | 3300037471 | Bacteria | 3290 |
| 757 | Ga0395905_0092718 | 3300037471 | Bacteria | 2833 |
| 758 | Ga0395905_0182186 | 3300037471 | Bacteria | 1972 |
| 759 | Ga0395901_0380552 | 3300038443 | Bacteria | 1453 |
| 760 | Ga0395901_0392858 | 3300038443 | Bacteria | 1426 |
| 761 | Ga0395901_0432768 | 3300038443 | Bacteria | 1348 |
| 762 | Ga0395901_0674514 | 3300038443 | Bacteria | 1034 |
| 763 | Ga0436365_0905497 | 3300039437 | Bacteria | 2390 |
| 764 | Ga0436365_1149165 | 3300039437 | Bacteria | 2335 |
| 765 | Ga0436361_0011286 | 3300039447 | Bacteria | 11058 |
| 766 | Ga0436363_1425212 | 3300039450 | Bacteria | 2794 |
| 767 | Ga0451793_0066431 | 3300041452 | Bacteria | 951 |
| 768 | Ga0451837_1034308 | 3300041494 | Bacteria | 1301 |
| 769 | Ga0439457_107661 | 3300042014 | Bacteria | 653 |
| 770 | Ga0439458_0009294 | 3300042157 | Bacteria | 2189 |
| 771 | Ga0451577_0028784 | 3300042876 | Bacteria | 5024 |
| 772 | Ga0451577_0084183 | 3300042876 | Bacteria | 2838 |
| 773 | Ga0466969_0078556 | 3300044656 | Bacteria | 1578 |
| 774 | Ga0466972_0054950 | 3300044658 | Bacteria | 1915 |
| 775 | Ga0466966_0000334 | 3300044684 | Bacteria | 30532 |
| 776 | Ga0466966_0524082 | 3300044684 | Bacteria | 713 |
| 777 | Ga0466961_0000038 | 3300044693 | Bacteria | 80721 |
| 778 | Ga0466963_0005517 | 3300044694 | Bacteria | 7404 |
| 779 | Ga0466964_0116996 | 3300044706 | Bacteria | 1196 |
| 780 | Ga0453684_0049348 | 3300044712 | Bacteria | 5552 |
| 781 | Ga0466968_0015575 | 3300044735 | Bacteria | 3015 |
| 782 | Ga0466968_0193226 | 3300044735 | Bacteria | 951 |
| 783 | Ga0466957_0171612 | 3300044842 | Bacteria | 1413 |
| 784 | Ga0466960_0122745 | 3300044901 | Bacteria | 1362 |
| 785 | Ga0466959_0092862 | 3300045049 | Bacteria | 2166 |
| 786 | Ga0466959_0556464 | 3300045049 | Bacteria | 773 |
| 787 | Ga0451576_0520459 | 3300045051 | Bacteria | 1250 |
| 788 | Ga0466967_0108493 | 3300045976 | Bacteria | 2547 |
| 789 | Ga0466967_0358013 | 3300045976 | Bacteria | 1413 |
| 790 | Ga0495617_032547 | 3300046452 | Bacteria | 1750 |
| 791 | Ga0495592_0060008 | 3300046454 | Bacteria | 2798 |
| 792 | Ga0495603_0014382 | 3300046455 | Bacteria | 4786 |
| 793 | Ga0495603_0036781 | 3300046455 | Bacteria | 2939 |
| 794 | Ga0495603_0225587 | 3300046455 | Bacteria | 1080 |
| 795 | Ga0495590_0064242 | 3300046457 | Bacteria | 1284 |
| 796 | Ga0495590_0150170 | 3300046457 | Bacteria | 844 |
| 797 | Ga0495629_0003217 | 3300046459 | Bacteria | 12360 |
| 798 | Ga0495629_0080045 | 3300046459 | Bacteria | 2281 |
| 799 | Ga0495629_0122411 | 3300046459 | Bacteria | 1812 |
| 800 | Ga0495638_0006201 | 3300046460 | Bacteria | 8735 |
| 801 | Ga0495638_0145928 | 3300046460 | Bacteria | 1376 |
| 802 | Ga0495651_0070309 | 3300046462 | Bacteria | 2663 |
| 803 | Ga0495651_0220773 | 3300046462 | Bacteria | 1312 |
| 804 | Ga0495653_0012009 | 3300046463 | Bacteria | 7070 |
| 805 | Ga0495650_0055372 | 3300046471 | Bacteria | 1614 |
| 806 | Ga0495580_0264567 | 3300046472 | Bacteria | 1176 |
| 807 | Ga0495582_0036696 | 3300046473 | Bacteria | 2696 |
| 808 | Ga0495582_0520540 | 3300046473 | Bacteria | 688 |
| 809 | Ga0495605_0129610 | 3300046474 | Bacteria | 1138 |
| 810 | Ga0495639_0078334 | 3300046475 | Bacteria | 1536 |
| 811 | Ga0495639_0381587 | 3300046475 | Bacteria | 710 |
| 812 | Ga0495662_0077741 | 3300046476 | Bacteria | 1612 |
| 813 | Ga0495662_0249246 | 3300046476 | Bacteria | 875 |
| 814 | Ga0495664_0418600 | 3300046477 | Bacteria | 804 |
| 815 | Ga0495584_0042216 | 3300046491 | Bacteria | 2302 |
| 816 | Ga0495585_0173204 | 3300046492 | Bacteria | 1113 |
| 817 | Ga0495585_0175924 | 3300046492 | Bacteria | 1103 |
| 818 | Ga0495594_0012205 | 3300046499 | Bacteria | 4474 |
| 819 | Ga0495594_0085371 | 3300046499 | Bacteria | 1766 |
| 820 | Ga0495594_0089078 | 3300046499 | Bacteria | 1728 |
| 821 | Ga0495594_0126312 | 3300046499 | Bacteria | 1447 |
| 822 | Ga0495606_0046966 | 3300046507 | Bacteria | 2850 |
| 823 | Ga0495606_0332008 | 3300046507 | Bacteria | 813 |
| 824 | Ga0495608_0242533 | 3300046511 | Bacteria | 1125 |
| 825 | Ga0495610_0044603 | 3300046512 | Bacteria | 2200 |
| 826 | Ga0495616_0009944 | 3300046513 | Bacteria | 5528 |
| 827 | Ga0495616_0034535 | 3300046513 | Bacteria | 2626 |
| 828 | Ga0495616_0049017 | 3300046513 | Bacteria | 2119 |
| 829 | Ga0495618_0003822 | 3300046514 | Bacteria | 9319 |
| 830 | Ga0495620_0132633 | 3300046515 | Bacteria | 977 |
| 831 | Ga0495628_0070333 | 3300046516 | Bacteria | 2728 |
| 832 | Ga0495630_0170225 | 3300046517 | Bacteria | 1659 |
| 833 | Ga0495630_0573235 | 3300046517 | Bacteria | 865 |
| 834 | Ga0495631_0053605 | 3300046518 | Bacteria | 1760 |
| 835 | Ga0495631_0273399 | 3300046518 | Bacteria | 719 |
| 836 | Ga0495632_0124516 | 3300046519 | Bacteria | 1202 |
| 837 | Ga0495632_0134778 | 3300046519 | Bacteria | 1148 |
| 838 | Ga0495644_0032007 | 3300046523 | Bacteria | 1988 |
| 839 | Ga0495648_0004153 | 3300046524 | Bacteria | 12451 |
| 840 | Ga0495648_0061772 | 3300046524 | Bacteria | 2223 |
| 841 | Ga0495648_0099316 | 3300046524 | Bacteria | 1611 |
| 842 | Ga0495663_0143268 | 3300046525 | Bacteria | 812 |
| 843 | Ga0495642_0309020 | 3300046528 | Bacteria | 693 |
| 844 | Ga0495652_0035676 | 3300046529 | Bacteria | 4327 |
| 845 | Ga0495652_0100750 | 3300046529 | Bacteria | 2342 |
| 846 | Ga0495665_0277532 | 3300046531 | Bacteria | 860 |
| 847 | Ga0495640_0025473 | 3300046533 | Bacteria | 4290 |
| 848 | Ga0495640_0206206 | 3300046533 | Bacteria | 1244 |
| 849 | Ga0495586_0179880 | 3300046535 | Bacteria | 1196 |
| 850 | Ga0495587_0032723 | 3300046536 | Bacteria | 3141 |
| 851 | Ga0495609_0069177 | 3300046538 | Bacteria | 1552 |
| 852 | Ga0495621_0032826 | 3300046539 | Bacteria | 1787 |
| 853 | Ga0495621_0038579 | 3300046539 | Bacteria | 1667 |
| 854 | Ga0495621_0107673 | 3300046539 | Bacteria | 1066 |
| 855 | Ga0495645_0009636 | 3300046543 | Bacteria | 6753 |
| 856 | Ga0495622_0030649 | 3300046557 | Bacteria | 2513 |
| 857 | Ga0495633_0054492 | 3300046558 | Bacteria | 1881 |
| 858 | Ga0495633_0328782 | 3300046558 | Bacteria | 693 |
| 859 | Ga0495667_0056479 | 3300046559 | Bacteria | 2581 |
| 860 | Ga0495656_0012617 | 3300046615 | Bacteria | 3123 |
| 861 | Ga0495656_0095704 | 3300046615 | Bacteria | 1365 |
| 862 | Ga0495656_0271051 | 3300046615 | Bacteria | 862 |
| 863 | Ga0495668_0022682 | 3300046616 | Bacteria | 3586 |
| 864 | Ga0495634_0078269 | 3300046642 | Bacteria | 2166 |
| 865 | Ga0495611_0032629 | 3300046648 | Bacteria | 2296 |
| 866 | Ga0495625_0363691 | 3300046660 | Bacteria | 911 |
| 867 | Ga0495635_0032410 | 3300046663 | Bacteria | 3625 |
| 868 | Ga0495659_0039206 | 3300046664 | Bacteria | 1684 |
| 869 | Ga0495659_0133284 | 3300046664 | Bacteria | 986 |
| 870 | Ga0495657_0033593 | 3300046675 | Bacteria | 3570 |
| 871 | Ga0495599_0009127 | 3300046678 | Bacteria | 6048 |
| 872 | Ga0495623_0058918 | 3300046679 | Bacteria | 2413 |
| 873 | Ga0495623_0286858 | 3300046679 | Bacteria | 914 |
| 874 | Ga0495646_0026126 | 3300046680 | Bacteria | 3668 |
| 875 | Ga0495647_0002647 | 3300046681 | Bacteria | 5681 |
| 876 | Ga0495647_0044199 | 3300046681 | Bacteria | 1708 |
| 877 | Ga0495658_0004054 | 3300046683 | Bacteria | 7217 |
| 878 | Ga0495669_0107138 | 3300046684 | Bacteria | 1302 |
| 879 | Ga0495613_0344836 | 3300046689 | Bacteria | 1024 |
| 880 | Ga0495624_0215782 | 3300046690 | Bacteria | 1164 |
| 881 | Ga0495624_0271506 | 3300046690 | Bacteria | 1024 |
| 882 | Ga0495670_0116972 | 3300046691 | Bacteria | 1383 |
| 883 | Ga0495671_0039889 | 3300046692 | Bacteria | 2369 |
| 884 | Ga0495671_0071158 | 3300046692 | Bacteria | 1709 |
| 885 | Ga0495671_0123247 | 3300046692 | Bacteria | 1264 |
| 886 | Ga0495649_0201124 | 3300046694 | Bacteria | 1034 |
| 887 | Ga0495589_0059202 | 3300046794 | Bacteria | 1883 |
| 888 | Ga0495600_0033714 | 3300046809 | Bacteria | 3323 |
| 889 | Ga0495600_0174090 | 3300046809 | Bacteria | 1388 |
| 890 | Ga0495600_0174770 | 3300046809 | Bacteria | 1385 |
| 891 | Ga0495660_0201389 | 3300046810 | Bacteria | 950 |
| 892 | Ga0495581_0004461 | 3300047315 | Bacteria | 8093 |
| 893 | Ga0495581_0194874 | 3300047315 | Bacteria | 1185 |
| 894 | Ga0495581_0194930 | 3300047315 | Bacteria | 1185 |
| 895 | Ga0495581_0342323 | 3300047315 | Bacteria | 873 |
| 896 | Ga0495604_0013959 | 3300047317 | Bacteria | 6406 |
| 897 | Ga0495604_0016857 | 3300047317 | Bacteria | 5841 |
| 898 | Ga0495674_0024247 | 3300047319 | Bacteria | 5577 |
| 899 | Ga0495674_0063302 | 3300047319 | Bacteria | 3218 |
| 900 | Ga0495680_0071472 | 3300047322 | Bacteria | 2642 |
| 901 | Ga0495683_0094403 | 3300047323 | Bacteria | 1445 |
| 902 | Ga0495687_173467 | 3300047443 | Bacteria | 711 |
| 903 | Ga0495675_0014638 | 3300047444 | Bacteria | 4955 |
| 904 | Ga0495677_0125732 | 3300047445 | Bacteria | 979 |
| 905 | Ga0495679_065519 | 3300047446 | Bacteria | 1057 |
| 906 | Ga0495673_0120654 | 3300047469 | Bacteria | 1039 |
| 907 | Ga0495684_0087827 | 3300047471 | Bacteria | 2356 |
| 908 | Ga0495684_0095441 | 3300047471 | Bacteria | 2251 |
| 909 | Ga0495686_0071106 | 3300047472 | Bacteria | 2143 |
| 910 | Ga0495686_0256771 | 3300047472 | Bacteria | 980 |
| 911 | Ga0495686_0259194 | 3300047472 | Bacteria | 974 |
| 912 | Ga0495602_0096785 | 3300048088 | Bacteria | 2433 |
| 913 | Ga0495626_0067254 | 3300048091 | Bacteria | 1619 |
| 914 | Ga0496100_0007662 | 3300048903 | Bacteria | 5973 |
| 915 | Ga0496100_0086541 | 3300048903 | Bacteria | 2129 |
| 916 | Ga0496100_0233105 | 3300048903 | Bacteria | 1355 |
| 917 | Ga0496100_0693935 | 3300048903 | Bacteria | 794 |
| 918 | Ga0496100_0891295 | 3300048903 | Bacteria | 698 |
| 919 | Ga0496101_0249292 | 3300048904 | Bacteria | 1383 |
| 920 | Ga0496101_0406347 | 3300048904 | Bacteria | 1073 |
| 921 | Ga0496102_0003526 | 3300048905 | Bacteria | 13263 |
| 922 | Ga0496102_0006768 | 3300048905 | Bacteria | 9781 |
| 923 | Ga0496102_0027968 | 3300048905 | Bacteria | 5038 |
| 924 | Ga0496102_0028322 | 3300048905 | Bacteria | 5003 |
| 925 | Ga0496102_0098561 | 3300048905 | Bacteria | 2712 |
| 926 | Ga0496102_0171580 | 3300048905 | Bacteria | 2042 |
| 927 | Ga0496102_0239702 | 3300048905 | Bacteria | 1710 |
| 928 | Ga0496102_0586218 | 3300048905 | Bacteria | 1038 |
| 929 | Ga0496102_0703959 | 3300048905 | Bacteria | 933 |
| 930 | Ga0496103_0036969 | 3300048906 | Bacteria | 2991 |
| 931 | Ga0496103_0307970 | 3300048906 | Bacteria | 1019 |
| 932 | Ga0496104_0006629 | 3300048907 | Bacteria | 10188 |
| 933 | Ga0496104_0008661 | 3300048907 | Bacteria | 9052 |
| 934 | Ga0496104_0046639 | 3300048907 | Bacteria | 4081 |
| 935 | Ga0496104_0055336 | 3300048907 | Bacteria | 3751 |
| 936 | Ga0496104_0104315 | 3300048907 | Bacteria | 2716 |
| 937 | Ga0496104_0125604 | 3300048907 | Bacteria | 2463 |
| 938 | Ga0496104_0301067 | 3300048907 | Bacteria | 1516 |
| 939 | Ga0496105_0014118 | 3300048908 | Bacteria | 6355 |
| 940 | Ga0496105_0025056 | 3300048908 | Bacteria | 4851 |
| 941 | Ga0496105_0025338 | 3300048908 | Bacteria | 4828 |
| 942 | Ga0496105_0060696 | 3300048908 | Bacteria | 3120 |
| 943 | Ga0496105_0254629 | 3300048908 | Bacteria | 1421 |
| 944 | Ga0496105_0265153 | 3300048908 | Bacteria | 1388 |
| 945 | Ga0496106_0027981 | 3300048909 | Bacteria | 4197 |
| 946 | Ga0496106_0044425 | 3300048909 | Bacteria | 3335 |
| 947 | Ga0496106_0164563 | 3300048909 | Bacteria | 1755 |
| 948 | Ga0496107_0089106 | 3300048910 | Bacteria | 2253 |
| 949 | Ga0496107_0179865 | 3300048910 | Bacteria | 1570 |
| 950 | Ga0496107_0305294 | 3300048910 | Bacteria | 1184 |
| 951 | Ga0496108_0004162 | 3300048911 | Bacteria | 11640 |
| 952 | Ga0496108_0050833 | 3300048911 | Bacteria | 3471 |
| 953 | Ga0496108_0059885 | 3300048911 | Bacteria | 3202 |
| 954 | Ga0496108_0187419 | 3300048911 | Bacteria | 1792 |
| 955 | Ga0496108_0634814 | 3300048911 | Bacteria | 929 |
| 956 | Ga0496109_0181886 | 3300048912 | Bacteria | 1975 |
| 957 | Ga0496109_0252924 | 3300048912 | Bacteria | 1659 |
| 958 | Ga0496109_0280158 | 3300048912 | Bacteria | 1571 |
| 959 | Ga0496110_0005115 | 3300048913 | Bacteria | 10244 |
| 960 | Ga0496110_0024513 | 3300048913 | Bacteria | 5141 |
| 961 | Ga0496110_0032862 | 3300048913 | Bacteria | 4485 |
| 962 | Ga0496110_0311556 | 3300048913 | Bacteria | 1433 |
| 963 | Ga0496110_0544127 | 3300048913 | Bacteria | 1055 |
| 964 | Ga0496111_0039965 | 3300048914 | Bacteria | 3365 |
| 965 | Ga0496111_0052523 | 3300048914 | Bacteria | 2943 |
| 966 | Ga0496111_0189177 | 3300048914 | Bacteria | 1530 |
| 967 | Ga0496112_0107232 | 3300048915 | Bacteria | 2763 |
| 968 | Ga0496112_0154174 | 3300048915 | Bacteria | 2264 |
| 969 | Ga0496112_0173687 | 3300048915 | Bacteria | 2120 |
| 970 | Ga0496112_0173955 | 3300048915 | Bacteria | 2118 |
| 971 | Ga0496112_0254038 | 3300048915 | Bacteria | 1708 |
| 972 | Ga0496112_0950647 | 3300048915 | Bacteria | 780 |
| 973 | Ga0496113_0039679 | 3300048916 | Bacteria | 3467 |
| 974 | Ga0496113_0052398 | 3300048916 | Bacteria | 3047 |
| 975 | Ga0496113_0053908 | 3300048916 | Bacteria | 3008 |
| 976 | Ga0496113_0071006 | 3300048916 | Bacteria | 2648 |
| 977 | Ga0496113_0087561 | 3300048916 | Bacteria | 2395 |
| 978 | Ga0496113_0119470 | 3300048916 | Bacteria | 2059 |
| 979 | Ga0496114_0053872 | 3300048917 | Bacteria | 3353 |
| 980 | Ga0496114_0079601 | 3300048917 | Bacteria | 2766 |
| 981 | Ga0496114_0269417 | 3300048917 | Bacteria | 1500 |
| 982 | Ga0496114_0280522 | 3300048917 | Bacteria | 1469 |
| 983 | Ga0496114_0287607 | 3300048917 | Bacteria | 1450 |
| 984 | Ga0496115_0011990 | 3300048918 | Bacteria | 6514 |
| 985 | Ga0496115_0034188 | 3300048918 | Bacteria | 4017 |
| 986 | Ga0496115_0055461 | 3300048918 | Bacteria | 3183 |
| 987 | Ga0496115_0064825 | 3300048918 | Bacteria | 2950 |
| 988 | Ga0496115_0072699 | 3300048918 | Bacteria | 2790 |
| 989 | Ga0496115_0121595 | 3300048918 | Bacteria | 2149 |
| 990 | Ga0496115_0440391 | 3300048918 | Bacteria | 1054 |
| 991 | Ga0496116_0007877 | 3300048919 | Bacteria | 9349 |
| 992 | Ga0496116_0063979 | 3300048919 | Bacteria | 2366 |
| 993 | Ga0496116_0183766 | 3300048919 | Bacteria | 1116 |
| 994 | Ga0496117_0109010 | 3300048920 | Bacteria | 1730 |
| 995 | Ga0496118_0024256 | 3300048921 | Bacteria | 5243 |
| 996 | Ga0496118_0083713 | 3300048921 | Bacteria | 2229 |
| 997 | Ga0496118_0105697 | 3300048921 | Bacteria | 1886 |
| 998 | Ga0496118_0327868 | 3300048921 | Bacteria | 827 |
| 999 | Ga0496118_0373546 | 3300048921 | Bacteria | 751 |
| 1000 | Ga0496119_0055595 | 3300048922 | Bacteria | 2403 |
| 1001 | Ga0496119_0076439 | 3300048922 | Bacteria | 1943 |
| 1002 | Ga0496119_0196340 | 3300048922 | Bacteria | 1048 |
| 1003 | Ga0496119_0208447 | 3300048922 | Bacteria | 1007 |
| 1004 | Ga0496120_0008444 | 3300048923 | Bacteria | 7475 |
| 1005 | Ga0496120_0030923 | 3300048923 | Bacteria | 3248 |
| 1006 | Ga0496121_0000594 | 3300048924 | Bacteria | 67953 |
| 1007 | Ga0496121_0002279 | 3300048924 | Bacteria | 29850 |
| 1008 | Ga0496121_0016133 | 3300048924 | Bacteria | 7740 |
| 1009 | Ga0496121_0032438 | 3300048924 | Bacteria | 4746 |
| 1010 | Ga0496121_0038456 | 3300048924 | Bacteria | 4237 |
| 1011 | Ga0496121_0099176 | 3300048924 | Bacteria | 2252 |
| 1012 | Ga0496121_0208639 | 3300048924 | Bacteria | 1386 |
| 1013 | Ga0496121_0227288 | 3300048924 | Bacteria | 1309 |
| 1014 | Ga0496121_0372853 | 3300048924 | Bacteria | 944 |
| 1015 | Ga0496121_0563375 | 3300048924 | Bacteria | 710 |
| 1016 | Ga0496124_0136426 | 3300048927 | Bacteria | 1942 |
| 1017 | Ga0496126_0004957 | 3300048929 | Bacteria | 15524 |
| 1018 | Ga0496126_0052922 | 3300048929 | Bacteria | 3686 |
| 1019 | Ga0496126_0106575 | 3300048929 | Bacteria | 2446 |
| 1020 | Ga0496126_0109051 | 3300048929 | Bacteria | 2413 |
| 1021 | Ga0496126_0137333 | 3300048929 | Bacteria | 2107 |
| 1022 | Ga0496126_0192896 | 3300048929 | Bacteria | 1724 |
| 1023 | Ga0496126_0193712 | 3300048929 | Bacteria | 1720 |
| 1024 | Ga0496126_0247466 | 3300048929 | Bacteria | 1487 |
| 1025 | Ga0496126_0365535 | 3300048929 | Bacteria | 1177 |
| 1026 | Ga0496126_0492859 | 3300048929 | Bacteria | 980 |
| 1027 | Ga0496126_0557927 | 3300048929 | Bacteria | 908 |
| 1028 | Ga0496126_0613170 | 3300048929 | Bacteria | 856 |
| 1029 | Ga0495682_0125547 | 3300049460 | Bacteria | 918 |
| 1030 | Ga0501031_0000268 | 3300049568 | Bacteria | 29430 |
| 1031 | Ga0501032_0000765 | 3300049569 | Bacteria | 26091 |
| 1032 | Ga0501032_0324914 | 3300049569 | Bacteria | 992 |
| 1033 | Ga0501033_0000095 | 3300049570 | Bacteria | 84522 |
| 1034 | Ga0501033_0000344 | 3300049570 | Bacteria | 44238 |
| 1035 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 1036 | Ga0501034_0002052 | 3300049571 | Bacteria | 25285 |
| 1037 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 1038 | Ga0501036_0000228 | 3300049572 | Bacteria | 37800 |
| 1039 | Ga0501037_0000109 | 3300049573 | Bacteria | 77490 |
| 1040 | Ga0501037_0002522 | 3300049573 | Bacteria | 13227 |
| 1041 | Ga0501038_0000028 | 3300049574 | Bacteria | 144481 |
| 1042 | Ga0501038_0000350 | 3300049574 | Bacteria | 39547 |
| 1043 | Ga0501038_0259222 | 3300049574 | Bacteria | 1375 |
| 1044 | Ga0501038_0275878 | 3300049574 | Bacteria | 1324 |
| 1045 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 1046 | Ga0501039_0092091 | 3300049575 | Bacteria | 2362 |
| 1047 | Ga0501039_0330699 | 3300049575 | Bacteria | 1197 |
| 1048 | Ga0501040_0386338 | 3300049576 | Bacteria | 1004 |
| 1049 | Ga0501042_0158164 | 3300049578 | Bacteria | 1634 |
| 1050 | Ga0501042_0379922 | 3300049578 | Bacteria | 1023 |
| 1051 | Ga0501043_0000085 | 3300049579 | Bacteria | 83544 |
| 1052 | Ga0501043_0000122 | 3300049579 | Bacteria | 71952 |
| 1053 | Ga0501046_0000032 | 3300049580 | Bacteria | 180265 |
| 1054 | Ga0501046_0000426 | 3300049580 | Bacteria | 42186 |
| 1055 | Ga0501047_0000077 | 3300049581 | Bacteria | 123480 |
| 1056 | Ga0501047_0000493 | 3300049581 | Bacteria | 42827 |
| 1057 | Ga0501048_0000233 | 3300049582 | Bacteria | 36758 |
| 1058 | Ga0501048_0004655 | 3300049582 | Bacteria | 10441 |
| 1059 | Ga0501048_0524613 | 3300049582 | Bacteria | 849 |
| 1060 | Ga0501067_0000384 | 3300049583 | Bacteria | 24036 |
| 1061 | Ga0501067_0009253 | 3300049583 | Bacteria | 5456 |
| 1062 | Ga0501068_0003858 | 3300049584 | Bacteria | 8138 |
| 1063 | Ga0501068_0090889 | 3300049584 | Bacteria | 1883 |
| 1064 | Ga0501069_0006612 | 3300049585 | Bacteria | 6064 |
| 1065 | Ga0501069_0032838 | 3300049585 | Bacteria | 2857 |
| 1066 | Ga0501069_0485801 | 3300049585 | Bacteria | 736 |
| 1067 | Ga0501070_0000152 | 3300049586 | Bacteria | 63679 |
| 1068 | Ga0501070_0001419 | 3300049586 | Bacteria | 21462 |
| 1069 | Ga0501072_0001233 | 3300049588 | Bacteria | 19088 |
| 1070 | Ga0501072_0028477 | 3300049588 | Bacteria | 4362 |
| 1071 | Ga0501073_0001343 | 3300049589 | Bacteria | 18116 |
| 1072 | Ga0501073_0041571 | 3300049589 | Bacteria | 3248 |
| 1073 | Ga0501074_0000094 | 3300049590 | Bacteria | 42565 |
| 1074 | Ga0501074_0009987 | 3300049590 | Bacteria | 6893 |
| 1075 | Ga0501079_0002879 | 3300049741 | Bacteria | 12559 |
| 1076 | Ga0501079_0072469 | 3300049741 | Bacteria | 2662 |
| 1077 | Ga0501079_0556759 | 3300049741 | Bacteria | 902 |
| 1078 | Ga0501080_0006214 | 3300049742 | Bacteria | 10717 |
| 1079 | Ga0501080_0258797 | 3300049742 | Bacteria | 1586 |
| 1080 | Ga0501083_0046583 | 3300049744 | Bacteria | 2931 |
| 1081 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 1082 | Ga0501035_0000496 | 3300049822 | Bacteria | 44296 |
| 1083 | Ga0501035_0099379 | 3300049822 | Bacteria | 2554 |
| 1084 | Ga0501035_0403006 | 3300049822 | Bacteria | 1138 |
| 1085 | Ga0501044_0000970 | 3300049823 | Bacteria | 34530 |
| 1086 | Ga0501044_0002765 | 3300049823 | Bacteria | 19972 |
| 1087 | Ga0501044_0469149 | 3300049823 | Bacteria | 1163 |
| 1088 | Ga0501045_0027447 | 3300049824 | Bacteria | 4103 |
| 1089 | nmdc:mga03n38_196479_c1 | 3300050490 | Bacteria | 1042 |
| 1090 | nmdc:mga03n38_22431_c1 | 3300050490 | Bacteria | 2555 |
| 1091 | nmdc:mga03n38_4949_c1 | 3300050490 | Bacteria | 3307 |
| 1092 | nmdc:mga0yw44_234994_c1 | 3300050492 | Bacteria | 1217 |
| 1093 | nmdc:mga0yw44_31057_c1 | 3300050492 | Bacteria | 3103 |
| 1094 | nmdc:mga0yw44_41674_c1 | 3300050492 | Bacteria | 2734 |
| 1095 | nmdc:mga0yw44_7001_c1 | 3300050492 | Bacteria | 5513 |
| 1096 | nmdc:mga0k408_119055_c1 | 3300050493 | Bacteria | 1563 |
| 1097 | nmdc:mga06z11_149473_c1 | 3300050494 | Bacteria | 1327 |
| 1098 | nmdc:mga06z11_338738_c1 | 3300050494 | Bacteria | 899 |
| 1099 | nmdc:mga07m45_128707_c1 | 3300050496 | Bacteria | 1465 |
| 1100 | nmdc:mga07m45_142599_c1 | 3300050496 | Bacteria | 1388 |
| 1101 | nmdc:mga07m45_194617_c1 | 3300050496 | Bacteria | 1179 |
| 1102 | nmdc:mga07m45_44437_c1 | 3300050496 | Bacteria | 2493 |
| 1103 | nmdc:mga05p37_252921_c1 | 3300050507 | Bacteria | 2112 |
| 1104 | nmdc:mga09592_645214_c1 | 3300050508 | Bacteria | 904 |
| 1105 | nmdc:mga08y16_153990_c1 | 3300050511 | Bacteria | 2389 |
| 1106 | nmdc:mga08y16_289648_c1 | 3300050511 | Bacteria | 1688 |
| 1107 | nmdc:mga0n895_409200_c1 | 3300050512 | Bacteria | 1372 |
| 1108 | nmdc:mga0n895_419144_c1 | 3300050512 | Bacteria | 1353 |
| 1109 | nmdc:mga0n895_95087_c1 | 3300050512 | Bacteria | 2984 |
| 1110 | nmdc:mga0rr50_526043_c1 | 3300050513 | Bacteria | 1006 |
| 1111 | nmdc:mga0rr50_779384_c1 | 3300050513 | Bacteria | 816 |
| 1112 | nmdc:mga0rr50_8902_c1 | 3300050513 | Bacteria | 6271 |
| 1113 | nmdc:mga0sz30_111097_c1 | 3300050516 | Bacteria | 1201 |
| 1114 | nmdc:mga0sz30_154243_c1 | 3300050516 | Bacteria | 1017 |
| 1115 | nmdc:mga0sz30_303075_c1 | 3300050516 | Bacteria | 712 |
| 1116 | nmdc:mga0sz30_49431_c1 | 3300050516 | Bacteria | 1781 |
| 1117 | nmdc:mga0sz30_89818_c1 | 3300050516 | Bacteria | 1336 |
| 1118 | nmdc:mga0sz30_93217_c1 | 3300050516 | Bacteria | 1312 |
| 1119 | Ga0495612_0017319 | 3300053078 | Bacteria | 2886 |
| 1120 | Ga0495612_0126493 | 3300053078 | Bacteria | 1102 |
| 1121 | Ga0495612_0171249 | 3300053078 | Bacteria | 951 |
| 1122 | Ga0500635_0227427 | 3300053080 | Bacteria | 729 |
| 1123 | Ga0495619_0066317 | 3300053085 | Bacteria | 2409 |
| 1124 | Ga0495619_0395754 | 3300053085 | Bacteria | 954 |
| 1125 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 1126 | Ga0500646_0033663 | 3300053090 | Bacteria | 1419 |
| 1127 | Ga0500647_0010677 | 3300053091 | Bacteria | 4072 |
| 1128 | Ga0500651_0007614 | 3300053093 | Bacteria | 6333 |
| 1129 | Ga0500566_0000732 | 3300053094 | Bacteria | 18439 |
| 1130 | Ga0500566_0008320 | 3300053094 | Bacteria | 6135 |
| 1131 | Ga0500640_102910 | 3300053095 | Bacteria | 1177 |
| 1132 | Ga0500641_0059206 | 3300053096 | Bacteria | 1592 |
| 1133 | Ga0500641_0088154 | 3300053096 | Bacteria | 1323 |
| 1134 | Ga0500650_0040373 | 3300053098 | Bacteria | 2153 |
| 1135 | Ga0500650_0238861 | 3300053098 | Bacteria | 818 |
| 1136 | Ga0500554_063818 | 3300053102 | Bacteria | 1187 |
| 1137 | Ga0500555_001232 | 3300053103 | Bacteria | 8233 |
| 1138 | Ga0500555_018189 | 3300053103 | Bacteria | 2026 |
| 1139 | Ga0500562_004298 | 3300053108 | Bacteria | 3605 |
| 1140 | Ga0500562_015137 | 3300053108 | Bacteria | 1978 |
| 1141 | Ga0500592_031538 | 3300053116 | Bacteria | 855 |
| 1142 | Ga0500594_0003422 | 3300053118 | Bacteria | 3482 |
| 1143 | Ga0500595_000932 | 3300053119 | Bacteria | 16564 |
| 1144 | Ga0500595_002620 | 3300053119 | Bacteria | 8759 |
| 1145 | Ga0500595_004781 | 3300053119 | Bacteria | 6001 |
| 1146 | Ga0500595_007598 | 3300053119 | Bacteria | 4488 |
| 1147 | Ga0500595_008465 | 3300053119 | Bacteria | 4198 |
| 1148 | Ga0500595_032345 | 3300053119 | Bacteria | 1747 |
| 1149 | Ga0500597_128310 | 3300053120 | Bacteria | 1097 |
| 1150 | Ga0500608_051069 | 3300053122 | Bacteria | 1986 |
| 1151 | Ga0500614_082112 | 3300053123 | Bacteria | 904 |
| 1152 | Ga0500617_075353 | 3300053124 | Bacteria | 1471 |
| 1153 | Ga0500642_0031165 | 3300053130 | Bacteria | 2226 |
| 1154 | Ga0500652_001387 | 3300053131 | Bacteria | 7555 |
| 1155 | Ga0500658_0067985 | 3300053134 | Bacteria | 1497 |
| 1156 | Ga0500559_0000066 | 3300053136 | Bacteria | 84664 |
| 1157 | Ga0500559_0218023 | 3300053136 | Bacteria | 900 |
| 1158 | Ga0500568_0004322 | 3300053139 | Bacteria | 7622 |
| 1159 | Ga0500568_0010375 | 3300053139 | Bacteria | 4367 |
| 1160 | Ga0500568_0014447 | 3300053139 | Bacteria | 3565 |
| 1161 | Ga0500577_0000062 | 3300053142 | Bacteria | 24421 |
| 1162 | Ga0500589_022305 | 3300053147 | Bacteria | 2911 |
| 1163 | Ga0500590_210597 | 3300053148 | Bacteria | 812 |
| 1164 | Ga0500603_005970 | 3300053150 | Bacteria | 2637 |
| 1165 | Ga0500604_0019850 | 3300053151 | Bacteria | 1886 |
| 1166 | Ga0500616_0068866 | 3300053153 | Bacteria | 1811 |
| 1167 | Ga0500622_0216135 | 3300053156 | Bacteria | 862 |
| 1168 | Ga0500627_0148666 | 3300053158 | Bacteria | 1058 |
| 1169 | Ga0500634_0074912 | 3300053161 | Bacteria | 1761 |
| 1170 | Ga0500634_0080054 | 3300053161 | Bacteria | 1686 |
| 1171 | Ga0500638_014840 | 3300053162 | Bacteria | 3561 |
| 1172 | Ga0500638_238907 | 3300053162 | Bacteria | 740 |
| 1173 | Ga0500639_080010 | 3300053163 | Bacteria | 1648 |
| 1174 | Ga0500636_0002347 | 3300053177 | Bacteria | 10501 |
| 1175 | Ga0500636_0028744 | 3300053177 | Bacteria | 3283 |
| 1176 | Ga0500636_0119412 | 3300053177 | Bacteria | 1480 |
| 1177 | Ga0500637_0000132 | 3300053178 | Bacteria | 27236 |
| 1178 | Ga0500637_0010848 | 3300053178 | Bacteria | 4686 |
| 1179 | Ga0500637_0074211 | 3300053178 | Bacteria | 1959 |
| 1180 | Ga0500625_003709 | 3300053729 | Bacteria | 6095 |
| 1181 | Ga0500552_005220 | 3300053733 | Bacteria | 1406 |
| 1182 | Ga0500599_000415 | 3300053736 | Bacteria | 4359 |
| 1183 | Ga0501084_0241325 | 3300054114 | Bacteria | 1525 |
| 1184 | Ga0500661_000757 | 3300055283 | Bacteria | 6057 |
| 1185 | Ga0501082_0000452 | 3300060353 | Bacteria | 36318 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046524 | Ga0495648_0099316 | Ga0495648_0099316_393_980 | 174 |
| 2 | 3300046459 | Ga0495629_0003217 | Ga0495629_0003217_10126_10695 | 177 |
| 3 | 3300005843 | Ga0068860_100727792 | Ga0068860_1007277921 | 181 |
| 4 | 3300009148 | Ga0105243_10195973 | Ga0105243_101959732 | 182 |
| 5 | 3300013297 | Ga0157378_10026219 | Ga0157378_100262192 | 182 |
| 6 | 3300013306 | Ga0163162_10035074 | Ga0163162_100350742 | 182 |
| 7 | 3300013308 | Ga0157375_10730970 | Ga0157375_107309702 | 182 |
| 8 | 3300014326 | Ga0157380_10010841 | Ga0157380_100108412 | 182 |
| 9 | 3300014968 | Ga0157379_10033015 | Ga0157379_100330154 | 182 |
| 10 | 3300035695 | Ga0373927_0267854 | Ga0373927_0267854_69_632 | 182 |
| 11 | 3300037068 | Ga0373925_0006190 | Ga0373925_0006190_2425_2988 | 182 |
| 12 | iso_pu_bacteria | 8057132660 | 8057134976 | 184 |
| 13 | iso_pu_bacteria | 2524023205 | 2524437741 | 186 |
| 14 | iso_pu_bacteria | 2744054633 | 2745074851 | 186 |
| 15 | iso_pu_bacteria | 2876761206 | 2876764963 | 186 |
| 16 | 3300037471 | Ga0395905_0092718 | Ga0395905_0092718_1021_1596 | 187 |
| 17 | 3300046499 | Ga0495594_0085371 | Ga0495594_0085371_244_807 | 187 |
| 18 | iso_pu_bacteria | 2507262055 | 2507508216 | 187 |
| 19 | iso_pu_bacteria | 2508501042 | 2508691953 | 187 |
| 20 | iso_pu_bacteria | 2513237094 | 2513640522 | 187 |
| 21 | iso_pu_bacteria | 2513237141 | 2513890024 | 187 |
| 22 | iso_pu_bacteria | 2515154112 | 2515627278 | 187 |
| 23 | iso_pu_bacteria | 2721755755 | 2723846532 | 187 |
| 24 | iso_pu_bacteria | 2824696289 | 2824697119 | 187 |
| 25 | iso_pu_bacteria | 2844315083 | 2844319413 | 187 |
| 26 | iso_pu_bacteria | 2847939898 | 2847946933 | 187 |
| 27 | iso_pu_bacteria | 2849076700 | 2849078956 | 187 |
| 28 | iso_pu_bacteria | 2855020534 | 2855022684 | 187 |
| 29 | iso_pu_bacteria | 2874590934 | 2874598414 | 187 |
| 30 | iso_pu_bacteria | 2874645413 | 2874652531 | 187 |
| 31 | iso_pu_bacteria | 2876771140 | 2876778108 | 187 |
| 32 | iso_pu_bacteria | 2876818435 | 2876826023 | 187 |
| 33 | iso_pu_bacteria | 2879074833 | 2879081902 | 187 |
| 34 | iso_pu_bacteria | 2879127579 | 2879135024 | 187 |
| 35 | iso_pu_bacteria | 2879142872 | 2879149709 | 187 |
| 36 | iso_pu_bacteria | 2885409591 | 2885413309 | 187 |
| 37 | iso_pu_bacteria | 2891633521 | 2891635224 | 187 |
| 38 | iso_pu_bacteria | 2903727486 | 2903734355 | 187 |
| 39 | iso_pu_bacteria | 2906602504 | 2906605599 | 187 |
| 40 | iso_pu_bacteria | 2932794094 | 2932797990 | 187 |
| 41 | iso_pu_bacteria | 2932801729 | 2932807168 | 187 |
| 42 | iso_pu_bacteria | 2935883170 | 2935886717 | 187 |
| 43 | iso_pu_bacteria | 2935908558 | 2935908733 | 187 |
| 44 | iso_pu_bacteria | 2935916978 | 2935917878 | 187 |
| 45 | iso_pu_bacteria | 2935926038 | 2935926693 | 187 |
| 46 | iso_pu_bacteria | 2935934488 | 2935935143 | 187 |
| 47 | iso_pu_bacteria | 2935942939 | 2935943593 | 187 |
| 48 | iso_pu_bacteria | 2935951376 | 2935952031 | 187 |
| 49 | iso_pu_bacteria | 2935967501 | 2935968156 | 187 |
| 50 | iso_pu_bacteria | 2935975950 | 2935978772 | 187 |
| 51 | iso_pu_bacteria | 2941531003 | 2941533185 | 187 |
| 52 | iso_pu_bacteria | 3005594810 | 3005599614 | 187 |
| 53 | iso_pu_bacteria | 3005710791 | 3005715271 | 187 |
| 54 | iso_pu_bacteria | 3005718088 | 3005722652 | 187 |
| 55 | iso_pu_bacteria | 8019619141 | 8019628581 | 187 |
| 56 | iso_pu_bacteria | 8019629233 | 8019634055 | 187 |
| 57 | iso_pu_bacteria | 8019638758 | 8019645674 | 187 |
| 58 | iso_pu_bacteria | 8019648815 | 8019658937 | 187 |
| 59 | iso_pu_bacteria | 8019659431 | 8019661935 | 187 |
| 60 | iso_pu_bacteria | 8019668869 | 8019671457 | 187 |
| 61 | iso_pu_bacteria | 8019678201 | 8019684647 | 187 |
| 62 | iso_pu_bacteria | 8019687851 | 8019690469 | 187 |
| 63 | iso_pu_bacteria | 8056967851 | 8056968405 | 187 |
| 64 | 3300005330 | Ga0070690_100002084 | Ga0070690_1000020844 | 188 |
| 65 | 3300005335 | Ga0070666_10055893 | Ga0070666_100558932 | 188 |
| 66 | 3300005544 | Ga0070686_100020725 | Ga0070686_1000207252 | 188 |
| 67 | 3300005547 | Ga0070693_100318695 | Ga0070693_1003186952 | 188 |
| 68 | 3300005578 | Ga0068854_100134775 | Ga0068854_1001347751 | 188 |
| 69 | 3300005615 | Ga0070702_100639692 | Ga0070702_1006396921 | 188 |
| 70 | 3300005719 | Ga0068861_100059899 | Ga0068861_1000598992 | 188 |
| 71 | 3300006871 | Ga0075434_100393898 | Ga0075434_1003938981 | 188 |
| 72 | 3300007076 | Ga0075435_100022344 | Ga0075435_1000223444 | 188 |
| 73 | 3300009174 | Ga0105241_10277950 | Ga0105241_102779502 | 188 |
| 74 | 3300025903 | Ga0207680_10011092 | Ga0207680_100110924 | 188 |
| 75 | 3300025911 | Ga0207654_10217514 | Ga0207654_102175142 | 188 |
| 76 | 3300026075 | Ga0207708_10773519 | Ga0207708_107735191 | 188 |
| 77 | 3300048907 | Ga0496104_0046639 | Ga0496104_0046639_2882_3457 | 188 |
| 78 | 3300048909 | Ga0496106_0044425 | Ga0496106_0044425_383_949 | 188 |
| 79 | 3300049576 | Ga0501040_0386338 | Ga0501040_0386338_381_953 | 188 |
| 80 | 3300049578 | Ga0501042_0158164 | Ga0501042_0158164_540_1112 | 188 |
| 81 | 3300050512 | nmdc:mga0n895_95087_c1 | nmdc:mga0n895_95087_c1_1737_2303 | 188 |
| 82 | 3300050513 | nmdc:mga0rr50_8902_c1 | nmdc:mga0rr50_8902_c1_3960_4526 | 188 |
| 83 | iso_pu_bacteria | 2511231028 | 2511397528 | 188 |
| 84 | iso_pu_bacteria | 2513237092 | 2513622345 | 188 |
| 85 | iso_pu_bacteria | 2513237095 | 2513645440 | 188 |
| 86 | iso_pu_bacteria | 2513237098 | 2513676595 | 188 |
| 87 | iso_pu_bacteria | 2513237102 | 2513701724 | 188 |
| 88 | iso_pu_bacteria | 2513237104 | 2513718388 | 188 |
| 89 | iso_pu_bacteria | 2517093001 | 2517102619 | 188 |
| 90 | iso_pu_bacteria | 2643221651 | 2644288903 | 188 |
| 91 | iso_pu_bacteria | 2791355199 | 2793079936 | 188 |
| 92 | iso_pu_bacteria | 2824617872 | 2824618117 | 188 |
| 93 | iso_pu_bacteria | 2824626560 | 2824626785 | 188 |
| 94 | iso_pu_bacteria | 2824635225 | 2824636580 | 188 |
| 95 | iso_pu_bacteria | 2824644064 | 2824645114 | 188 |
| 96 | iso_pu_bacteria | 2824661429 | 2824661599 | 188 |
| 97 | iso_pu_bacteria | 2824679649 | 2824679871 | 188 |
| 98 | iso_pu_bacteria | 2824714736 | 2824720408 | 188 |
| 99 | iso_pu_bacteria | 2824723954 | 2824729458 | 188 |
| 100 | iso_pu_bacteria | 2824732956 | 2824734597 | 188 |
| 101 | iso_pu_bacteria | 2841957949 | 2841960983 | 188 |
| 102 | iso_pu_bacteria | 2874604998 | 2874605548 | 188 |
| 103 | iso_pu_bacteria | 2874612657 | 2874619370 | 188 |
| 104 | iso_pu_bacteria | 2874628541 | 2874632276 | 188 |
| 105 | iso_pu_bacteria | 2879099564 | 2879108353 | 188 |
| 106 | iso_pu_bacteria | 2881364244 | 2881368459 | 188 |
| 107 | iso_pu_bacteria | 2881665667 | 2881672525 | 188 |
| 108 | iso_pu_bacteria | 2888378607 | 2888384482 | 188 |
| 109 | iso_pu_bacteria | 2888388044 | 2888393424 | 188 |
| 110 | iso_pu_bacteria | 2889033259 | 2889039403 | 188 |
| 111 | iso_pu_bacteria | 2893066018 | 2893068695 | 188 |
| 112 | iso_pu_bacteria | 2906626472 | 2906627155 | 188 |
| 113 | iso_pu_bacteria | 2922361189 | 2922365738 | 188 |
| 114 | iso_pu_bacteria | 2922368715 | 2922374899 | 188 |
| 115 | iso_pu_bacteria | 2922386360 | 2922391308 | 188 |
| 116 | iso_pu_bacteria | 2922393267 | 2922400420 | 188 |
| 117 | iso_pu_bacteria | 2929615660 | 2929621941 | 188 |
| 118 | iso_pu_bacteria | 2929624759 | 2929629752 | 188 |
| 119 | iso_pu_bacteria | 2932809354 | 2932812781 | 188 |
| 120 | iso_pu_bacteria | 2932818245 | 2932819127 | 188 |
| 121 | iso_pu_bacteria | 2933577622 | 2933583784 | 188 |
| 122 | iso_pu_bacteria | 2935675223 | 2935675839 | 188 |
| 123 | iso_pu_bacteria | 2935684952 | 2935685836 | 188 |
| 124 | iso_pu_bacteria | 2935713505 | 2935714388 | 188 |
| 125 | iso_pu_bacteria | 2935722832 | 2935725007 | 188 |
| 126 | iso_pu_bacteria | 2935732158 | 2935732634 | 188 |
| 127 | iso_pu_bacteria | 2935741537 | 2935742013 | 188 |
| 128 | iso_pu_bacteria | 2935750917 | 2935751801 | 188 |
| 129 | iso_pu_bacteria | 2935760218 | 2935765058 | 188 |
| 130 | iso_pu_bacteria | 2935769743 | 2935771672 | 188 |
| 131 | iso_pu_bacteria | 2935777560 | 2935778913 | 188 |
| 132 | iso_pu_bacteria | 2935785616 | 2935791166 | 188 |
| 133 | iso_pu_bacteria | 2935793552 | 2935795505 | 188 |
| 134 | iso_pu_bacteria | 2940556831 | 2940557396 | 188 |
| 135 | iso_pu_bacteria | 3005483717 | 3005484665 | 188 |
| 136 | iso_pu_bacteria | 3005587118 | 3005587684 | 188 |
| 137 | iso_pu_bacteria | 8006964411 | 8006972432 | 188 |
| 138 | iso_pu_bacteria | 8016530956 | 8016534437 | 188 |
| 139 | iso_pu_bacteria | 8016539877 | 8016547660 | 188 |
| 140 | iso_pu_bacteria | 8016548790 | 8016554478 | 188 |
| 141 | iso_pu_bacteria | 8016566248 | 8016572779 | 188 |
| 142 | iso_pu_bacteria | 8016575299 | 8016576937 | 188 |
| 143 | iso_pu_bacteria | 8016583857 | 8016593285 | 188 |
| 144 | iso_pu_bacteria | 8016603502 | 8016610113 | 188 |
| 145 | iso_pu_bacteria | 8016613128 | 8016614827 | 188 |
| 146 | iso_pu_bacteria | 8016622563 | 8016626154 | 188 |
| 147 | iso_pu_bacteria | 8019530166 | 8019534199 | 188 |
| 148 | iso_pu_bacteria | 8019538911 | 8019545262 | 188 |
| 149 | iso_pu_bacteria | 8019547302 | 8019553251 | 188 |
| 150 | iso_pu_bacteria | 8055742211 | 8055745894 | 188 |
| 151 | iso_pu_bacteria | 8056673599 | 8056677707 | 188 |
| 152 | iso_pu_bacteria | 8056681323 | 8056689243 | 188 |
| 153 | 3300005614 | Ga0068856_100054733 | Ga0068856_1000547334 | 189 |
| 154 | 3300014497 | Ga0182008_10206915 | Ga0182008_102069152 | 189 |
| 155 | 3300025913 | Ga0207695_10272263 | Ga0207695_102722632 | 189 |
| 156 | 3300026078 | Ga0207702_10051226 | Ga0207702_100512263 | 189 |
| 157 | 3300037068 | Ga0373925_0465515 | Ga0373925_0465515_347_916 | 189 |
| 158 | 3300046472 | Ga0495580_0264567 | Ga0495580_0264567_338_907 | 189 |
| 159 | 3300049578 | Ga0501042_0379922 | Ga0501042_0379922_32_646 | 189 |
| 160 | 3300053078 | Ga0495612_0126493 | Ga0495612_0126493_214_783 | 189 |
| 161 | iso_pu_bacteria | 2899259804 | 2899259983 | 189 |
| 162 | iso_pu_bacteria | 2935959822 | 2935960797 | 189 |
| 163 | 3300005983 | Ga0081540_1009757 | Ga0081540_10097573 | 190 |
| 164 | 3300031456 | Ga0307513_10302368 | Ga0307513_103023682 | 190 |
| 165 | 3300048929 | Ga0496126_0613170 | Ga0496126_0613170_202_783 | 190 |
| 166 | 3300053142 | Ga0500577_0000062 | Ga0500577_0000062_18852_19439 | 190 |
| 167 | 3300003354 | JGI25160J50197_1009395 | JGI25160J50197_10093953 | 191 |
| 168 | 3300005330 | Ga0070690_100199738 | Ga0070690_1001997382 | 191 |
| 169 | 3300005334 | Ga0068869_100047651 | Ga0068869_1000476513 | 191 |
| 170 | 3300005335 | Ga0070666_10671631 | Ga0070666_106716311 | 191 |
| 171 | 3300005347 | Ga0070668_100290149 | Ga0070668_1002901492 | 191 |
| 172 | 3300005353 | Ga0070669_100456600 | Ga0070669_1004566002 | 191 |
| 173 | 3300005356 | Ga0070674_100056697 | Ga0070674_1000566973 | 191 |
| 174 | 3300005367 | Ga0070667_100561173 | Ga0070667_1005611731 | 191 |
| 175 | 3300005367 | Ga0070667_100691833 | Ga0070667_1006918331 | 191 |
| 176 | 3300005434 | Ga0070709_10000751 | Ga0070709_100007519 | 191 |
| 177 | 3300005434 | Ga0070709_10098062 | Ga0070709_100980622 | 191 |
| 178 | 3300005435 | Ga0070714_100001123 | Ga0070714_1000011237 | 191 |
| 179 | 3300005436 | Ga0070713_100000647 | Ga0070713_10000064715 | 191 |
| 180 | 3300005439 | Ga0070711_100045601 | Ga0070711_1000456013 | 191 |
| 181 | 3300005440 | Ga0070705_100716380 | Ga0070705_1007163801 | 191 |
| 182 | 3300005441 | Ga0070700_100201951 | Ga0070700_1002019512 | 191 |
| 183 | 3300005455 | Ga0070663_100125891 | Ga0070663_1001258912 | 191 |
| 184 | 3300005459 | Ga0068867_100010469 | Ga0068867_1000104692 | 191 |
| 185 | 3300005539 | Ga0068853_100263706 | Ga0068853_1002637062 | 191 |
| 186 | 3300005545 | Ga0070695_100409731 | Ga0070695_1004097312 | 191 |
| 187 | 3300005547 | Ga0070693_100311342 | Ga0070693_1003113421 | 191 |
| 188 | 3300005563 | Ga0068855_100154198 | Ga0068855_1001541983 | 191 |
| 189 | 3300005577 | Ga0068857_100866258 | Ga0068857_1008662581 | 191 |
| 190 | 3300005578 | Ga0068854_100086460 | Ga0068854_1000864602 | 191 |
| 191 | 3300005614 | Ga0068856_100718182 | Ga0068856_1007181821 | 191 |
| 192 | 3300005616 | Ga0068852_100312894 | Ga0068852_1003128942 | 191 |
| 193 | 3300005616 | Ga0068852_100991840 | Ga0068852_1009918401 | 191 |
| 194 | 3300005718 | Ga0068866_10020376 | Ga0068866_100203763 | 191 |
| 195 | 3300005719 | Ga0068861_100006429 | Ga0068861_1000064298 | 191 |
| 196 | 3300005842 | Ga0068858_100337981 | Ga0068858_1003379812 | 191 |
| 197 | 3300005843 | Ga0068860_100023118 | Ga0068860_1000231186 | 191 |
| 198 | 3300005844 | Ga0068862_100014954 | Ga0068862_1000149542 | 191 |
| 199 | 3300006028 | Ga0070717_11168232 | Ga0070717_111682321 | 191 |
| 200 | 3300006163 | Ga0070715_10013591 | Ga0070715_100135913 | 191 |
| 201 | 3300006173 | Ga0070716_100003547 | Ga0070716_1000035476 | 191 |
| 202 | 3300006175 | Ga0070712_100152940 | Ga0070712_1001529401 | 191 |
| 203 | 3300006881 | Ga0068865_100003720 | Ga0068865_1000037203 | 191 |
| 204 | 3300009093 | Ga0105240_11612825 | Ga0105240_116128251 | 191 |
| 205 | 3300009094 | Ga0111539_10207315 | Ga0111539_102073152 | 191 |
| 206 | 3300009101 | Ga0105247_10074437 | Ga0105247_100744373 | 191 |
| 207 | 3300009174 | Ga0105241_10010710 | Ga0105241_100107102 | 191 |
| 208 | 3300009545 | Ga0105237_10097240 | Ga0105237_100972402 | 191 |
| 209 | 3300009551 | Ga0105238_10538707 | Ga0105238_105387072 | 191 |
| 210 | 3300009553 | Ga0105249_10219612 | Ga0105249_102196122 | 191 |
| 211 | 3300013105 | Ga0157369_10551805 | Ga0157369_105518051 | 191 |
| 212 | 3300013296 | Ga0157374_10157085 | Ga0157374_101570853 | 191 |
| 213 | 3300021384 | Ga0213876_10151807 | Ga0213876_101518072 | 191 |
| 214 | 3300025254 | Ga0209148_1000500 | Ga0209148_100050033 | 191 |
| 215 | 3300025261 | Ga0209233_1008753 | Ga0209233_10087534 | 191 |
| 216 | 3300025261 | Ga0209233_1010397 | Ga0209233_10103972 | 191 |
| 217 | 3300025272 | Ga0209455_1001381 | Ga0209455_10013814 | 191 |
| 218 | 3300025272 | Ga0209455_1014791 | Ga0209455_10147912 | 191 |
| 219 | 3300025297 | Ga0209758_1002091 | Ga0209758_10020915 | 191 |
| 220 | 3300025302 | Ga0207426_1010515 | Ga0207426_10105152 | 191 |
| 221 | 3300025898 | Ga0207692_10005452 | Ga0207692_100054521 | 191 |
| 222 | 3300025899 | Ga0207642_10058877 | Ga0207642_100588772 | 191 |
| 223 | 3300025906 | Ga0207699_10031838 | Ga0207699_100318382 | 191 |
| 224 | 3300025911 | Ga0207654_10007223 | Ga0207654_100072232 | 191 |
| 225 | 3300025915 | Ga0207693_10004043 | Ga0207693_1000404312 | 191 |
| 226 | 3300025916 | Ga0207663_10000098 | Ga0207663_1000009812 | 191 |
| 227 | 3300025919 | Ga0207657_10169532 | Ga0207657_101695322 | 191 |
| 228 | 3300025923 | Ga0207681_10208519 | Ga0207681_102085192 | 191 |
| 229 | 3300025929 | Ga0207664_10017228 | Ga0207664_100172285 | 191 |
| 230 | 3300025935 | Ga0207709_10174249 | Ga0207709_101742492 | 191 |
| 231 | 3300025936 | Ga0207670_10422402 | Ga0207670_104224022 | 191 |
| 232 | 3300025938 | Ga0207704_10121951 | Ga0207704_101219512 | 191 |
| 233 | 3300025938 | Ga0207704_10517648 | Ga0207704_105176482 | 191 |
| 234 | 3300025939 | Ga0207665_10000355 | Ga0207665_1000035514 | 191 |
| 235 | 3300025942 | Ga0207689_10031264 | Ga0207689_100312643 | 191 |
| 236 | 3300025949 | Ga0207667_10097440 | Ga0207667_100974402 | 191 |
| 237 | 3300025949 | Ga0207667_10236835 | Ga0207667_102368353 | 191 |
| 238 | 3300025972 | Ga0207668_10292329 | Ga0207668_102923292 | 191 |
| 239 | 3300026035 | Ga0207703_10140794 | Ga0207703_101407942 | 191 |
| 240 | 3300026078 | Ga0207702_10079035 | Ga0207702_100790354 | 191 |
| 241 | 3300026078 | Ga0207702_10080745 | Ga0207702_100807456 | 191 |
| 242 | 3300026089 | Ga0207648_10002498 | Ga0207648_1000249814 | 191 |
| 243 | 3300026118 | Ga0207675_100003157 | Ga0207675_1000031578 | 191 |
| 244 | 3300026118 | Ga0207675_100193834 | Ga0207675_1001938343 | 191 |
| 245 | 3300026142 | Ga0207698_10183800 | Ga0207698_101838002 | 191 |
| 246 | 3300028380 | Ga0268265_10019499 | Ga0268265_100194993 | 191 |
| 247 | 3300028381 | Ga0268264_10006431 | Ga0268264_100064314 | 191 |
| 248 | 3300031249 | Ga0265339_10101543 | Ga0265339_101015431 | 191 |
| 249 | 3300031711 | Ga0265314_10005784 | Ga0265314_1000578412 | 191 |
| 250 | 3300031711 | Ga0265314_10075664 | Ga0265314_100756642 | 191 |
| 251 | 3300031712 | Ga0265342_10029779 | Ga0265342_100297793 | 191 |
| 252 | 3300031712 | Ga0265342_10077859 | Ga0265342_100778592 | 191 |
| 253 | 3300033180 | Ga0307510_10060670 | Ga0307510_100606704 | 191 |
| 254 | 3300035724 | Ga0373933_0133256 | Ga0373933_0133256_762_1343 | 191 |
| 255 | 3300036401 | Ga0373937_0251215 | Ga0373937_0251215_52_633 | 191 |
| 256 | 3300039437 | Ga0436365_0905497 | Ga0436365_0905497_927_1538 | 191 |
| 257 | 3300039437 | Ga0436365_1149165 | Ga0436365_1149165_345_920 | 191 |
| 258 | 3300039450 | Ga0436363_1425212 | Ga0436363_1425212_1788_2363 | 191 |
| 259 | 3300041452 | Ga0451793_0066431 | Ga0451793_0066431_91_702 | 191 |
| 260 | 3300044656 | Ga0466969_0078556 | Ga0466969_0078556_47_625 | 191 |
| 261 | 3300044684 | Ga0466966_0000334 | Ga0466966_0000334_4525_5103 | 191 |
| 262 | 3300044693 | Ga0466961_0000038 | Ga0466961_0000038_78399_78977 | 191 |
| 263 | 3300044694 | Ga0466963_0005517 | Ga0466963_0005517_5488_6075 | 191 |
| 264 | 3300044706 | Ga0466964_0116996 | Ga0466964_0116996_513_1100 | 191 |
| 265 | 3300044735 | Ga0466968_0193226 | Ga0466968_0193226_254_841 | 191 |
| 266 | 3300045049 | Ga0466959_0092862 | Ga0466959_0092862_230_808 | 191 |
| 267 | 3300045051 | Ga0451576_0520459 | Ga0451576_0520459_86_691 | 191 |
| 268 | 3300045976 | Ga0466967_0108493 | Ga0466967_0108493_1147_1734 | 191 |
| 269 | 3300045976 | Ga0466967_0358013 | Ga0466967_0358013_681_1322 | 191 |
| 270 | 3300046473 | Ga0495582_0520540 | Ga0495582_0520540_51_653 | 191 |
| 271 | 3300046507 | Ga0495606_0046966 | Ga0495606_0046966_285_896 | 191 |
| 272 | 3300046517 | Ga0495630_0573235 | Ga0495630_0573235_65_643 | 191 |
| 273 | 3300046529 | Ga0495652_0035676 | Ga0495652_0035676_1122_1733 | 191 |
| 274 | 3300046533 | Ga0495640_0206206 | Ga0495640_0206206_62_673 | 191 |
| 275 | 3300046679 | Ga0495623_0286858 | Ga0495623_0286858_205_783 | 191 |
| 276 | 3300046690 | Ga0495624_0271506 | Ga0495624_0271506_128_739 | 191 |
| 277 | 3300046692 | Ga0495671_0123247 | Ga0495671_0123247_555_1235 | 191 |
| 278 | 3300046694 | Ga0495649_0201124 | Ga0495649_0201124_301_981 | 191 |
| 279 | 3300046809 | Ga0495600_0174090 | Ga0495600_0174090_383_994 | 191 |
| 280 | 3300047317 | Ga0495604_0013959 | Ga0495604_0013959_601_1212 | 191 |
| 281 | 3300047471 | Ga0495684_0095441 | Ga0495684_0095441_36_614 | 191 |
| 282 | 3300047472 | Ga0495686_0256771 | Ga0495686_0256771_263_874 | 191 |
| 283 | 3300048903 | Ga0496100_0693935 | Ga0496100_0693935_179_754 | 191 |
| 284 | 3300048904 | Ga0496101_0406347 | Ga0496101_0406347_97_681 | 191 |
| 285 | 3300048905 | Ga0496102_0171580 | Ga0496102_0171580_1058_1642 | 191 |
| 286 | 3300048905 | Ga0496102_0586218 | Ga0496102_0586218_396_1016 | 191 |
| 287 | 3300048907 | Ga0496104_0006629 | Ga0496104_0006629_5325_5936 | 191 |
| 288 | 3300048908 | Ga0496105_0025338 | Ga0496105_0025338_235_846 | 191 |
| 289 | 3300048911 | Ga0496108_0634814 | Ga0496108_0634814_286_897 | 191 |
| 290 | 3300048912 | Ga0496109_0181886 | Ga0496109_0181886_902_1522 | 191 |
| 291 | 3300048916 | Ga0496113_0039679 | Ga0496113_0039679_824_1444 | 191 |
| 292 | 3300048916 | Ga0496113_0053908 | Ga0496113_0053908_2248_2859 | 191 |
| 293 | 3300048917 | Ga0496114_0280522 | Ga0496114_0280522_632_1210 | 191 |
| 294 | 3300048918 | Ga0496115_0034188 | Ga0496115_0034188_1362_1943 | 191 |
| 295 | 3300048922 | Ga0496119_0055595 | Ga0496119_0055595_924_1535 | 191 |
| 296 | 3300048923 | Ga0496120_0008444 | Ga0496120_0008444_53_664 | 191 |
| 297 | 3300048924 | Ga0496121_0016133 | Ga0496121_0016133_41_616 | 191 |
| 298 | 3300048924 | Ga0496121_0208639 | Ga0496121_0208639_506_1087 | 191 |
| 299 | 3300048929 | Ga0496126_0137333 | Ga0496126_0137333_971_1552 | 191 |
| 300 | 3300048929 | Ga0496126_0192896 | Ga0496126_0192896_318_929 | 191 |
| 301 | 3300048929 | Ga0496126_0247466 | Ga0496126_0247466_367_942 | 191 |
| 302 | 3300048929 | Ga0496126_0557927 | Ga0496126_0557927_145_720 | 191 |
| 303 | 3300049460 | Ga0495682_0125547 | Ga0495682_0125547_298_876 | 191 |
| 304 | 3300053078 | Ga0495612_0171249 | Ga0495612_0171249_64_639 | 191 |
| 305 | 3300053085 | Ga0495619_0395754 | Ga0495619_0395754_76_654 | 191 |
| 306 | 3300053119 | Ga0500595_032345 | Ga0500595_032345_111_689 | 191 |
| 307 | 3300053136 | Ga0500559_0218023 | Ga0500559_0218023_129_704 | 191 |
| 308 | 3300053163 | Ga0500639_080010 | Ga0500639_080010_823_1434 | 191 |
| 309 | 3300053177 | Ga0500636_0028744 | Ga0500636_0028744_1403_2023 | 191 |
| 310 | 3300053733 | Ga0500552_005220 | Ga0500552_005220_521_1132 | 191 |
| 311 | iso_pu_bacteria | 2513237139 | 2513873142 | 191 |
| 312 | iso_pu_bacteria | 2802429603 | 2805914959 | 191 |
| 313 | 3300000549 | LJQas_1005748 | LJQas_10057481 | 192 |
| 314 | 3300001989 | JGI24739J22299_10004675 | JGI24739J22299_100046752 | 192 |
| 315 | 3300001990 | JGI24737J22298_10003599 | JGI24737J22298_100035997 | 192 |
| 316 | 3300001990 | JGI24737J22298_10010858 | JGI24737J22298_100108583 | 192 |
| 317 | 3300002067 | JGI24735J21928_10003477 | JGI24735J21928_100034772 | 192 |
| 318 | 3300002070 | JGI24750J21931_1026045 | JGI24750J21931_10260451 | 192 |
| 319 | 3300003203 | JGI25406J46586_10006716 | JGI25406J46586_100067166 | 192 |
| 320 | 3300003215 | JGI25153J46596_10004034 | JGI25153J46596_100040343 | 192 |
| 321 | 3300003215 | JGI25153J46596_10063189 | JGI25153J46596_100631891 | 192 |
| 322 | 3300003354 | JGI25160J50197_1000921 | JGI25160J50197_10009214 | 192 |
| 323 | 3300003659 | JGI25404J52841_10026147 | JGI25404J52841_100261472 | 192 |
| 324 | 3300003659 | JGI25404J52841_10042784 | JGI25404J52841_100427842 | 192 |
| 325 | 3300003751 | Ga0055538_1000019 | Ga0055538_100001958 | 192 |
| 326 | 3300003752 | Ga0055539_1000024 | Ga0055539_1000024232 | 192 |
| 327 | 3300003756 | Ga0055533_1000032 | Ga0055533_100003258 | 192 |
| 328 | 3300003759 | Ga0055525_1000041 | Ga0055525_100004158 | 192 |
| 329 | 3300003841 | Ga0055541_1000018 | Ga0055541_1000018232 | 192 |
| 330 | 3300005262 | Ga0065165_1007079 | Ga0065165_10070792 | 192 |
| 331 | 3300005262 | Ga0065165_1008084 | Ga0065165_10080842 | 192 |
| 332 | 3300005327 | Ga0070658_10326807 | Ga0070658_103268072 | 192 |
| 333 | 3300005328 | Ga0070676_10040507 | Ga0070676_100405072 | 192 |
| 334 | 3300005328 | Ga0070676_10046538 | Ga0070676_100465382 | 192 |
| 335 | 3300005328 | Ga0070676_10061229 | Ga0070676_100612292 | 192 |
| 336 | 3300005329 | Ga0070683_100020596 | Ga0070683_1000205964 | 192 |
| 337 | 3300005329 | Ga0070683_100045726 | Ga0070683_1000457262 | 192 |
| 338 | 3300005329 | Ga0070683_100164968 | Ga0070683_1001649682 | 192 |
| 339 | 3300005330 | Ga0070690_100123477 | Ga0070690_1001234772 | 192 |
| 340 | 3300005330 | Ga0070690_100603217 | Ga0070690_1006032171 | 192 |
| 341 | 3300005331 | Ga0070670_100064364 | Ga0070670_1000643643 | 192 |
| 342 | 3300005331 | Ga0070670_100117136 | Ga0070670_1001171362 | 192 |
| 343 | 3300005331 | Ga0070670_100168447 | Ga0070670_1001684471 | 192 |
| 344 | 3300005331 | Ga0070670_100186060 | Ga0070670_1001860601 | 192 |
| 345 | 3300005333 | Ga0070677_10079041 | Ga0070677_100790411 | 192 |
| 346 | 3300005334 | Ga0068869_100064006 | Ga0068869_1000640062 | 192 |
| 347 | 3300005334 | Ga0068869_100182199 | Ga0068869_1001821992 | 192 |
| 348 | 3300005335 | Ga0070666_10054453 | Ga0070666_100544533 | 192 |
| 349 | 3300005336 | Ga0070680_100118878 | Ga0070680_1001188782 | 192 |
| 350 | 3300005337 | Ga0070682_100202331 | Ga0070682_1002023312 | 192 |
| 351 | 3300005337 | Ga0070682_101038063 | Ga0070682_1010380631 | 192 |
| 352 | 3300005338 | Ga0068868_100002211 | Ga0068868_1000022118 | 192 |
| 353 | 3300005338 | Ga0068868_100086295 | Ga0068868_1000862953 | 192 |
| 354 | 3300005338 | Ga0068868_100233532 | Ga0068868_1002335322 | 192 |
| 355 | 3300005338 | Ga0068868_100315573 | Ga0068868_1003155732 | 192 |
| 356 | 3300005338 | Ga0068868_100384892 | Ga0068868_1003848922 | 192 |
| 357 | 3300005339 | Ga0070660_100001944 | Ga0070660_1000019449 | 192 |
| 358 | 3300005340 | Ga0070689_100785405 | Ga0070689_1007854051 | 192 |
| 359 | 3300005344 | Ga0070661_100009779 | Ga0070661_1000097794 | 192 |
| 360 | 3300005344 | Ga0070661_100309883 | Ga0070661_1003098831 | 192 |
| 361 | 3300005344 | Ga0070661_100844656 | Ga0070661_1008446561 | 192 |
| 362 | 3300005354 | Ga0070675_100006484 | Ga0070675_1000064847 | 192 |
| 363 | 3300005354 | Ga0070675_100156919 | Ga0070675_1001569192 | 192 |
| 364 | 3300005355 | Ga0070671_100004974 | Ga0070671_1000049742 | 192 |
| 365 | 3300005355 | Ga0070671_100049969 | Ga0070671_1000499692 | 192 |
| 366 | 3300005355 | Ga0070671_100057073 | Ga0070671_1000570733 | 192 |
| 367 | 3300005355 | Ga0070671_100101291 | Ga0070671_1001012912 | 192 |
| 368 | 3300005355 | Ga0070671_100198119 | Ga0070671_1001981192 | 192 |
| 369 | 3300005355 | Ga0070671_100243917 | Ga0070671_1002439172 | 192 |
| 370 | 3300005356 | Ga0070674_100039953 | Ga0070674_1000399533 | 192 |
| 371 | 3300005356 | Ga0070674_100167957 | Ga0070674_1001679572 | 192 |
| 372 | 3300005364 | Ga0070673_100010231 | Ga0070673_1000102314 | 192 |
| 373 | 3300005364 | Ga0070673_100439798 | Ga0070673_1004397981 | 192 |
| 374 | 3300005366 | Ga0070659_100338807 | Ga0070659_1003388071 | 192 |
| 375 | 3300005367 | Ga0070667_100032334 | Ga0070667_1000323342 | 192 |
| 376 | 3300005367 | Ga0070667_100104314 | Ga0070667_1001043141 | 192 |
| 377 | 3300005367 | Ga0070667_100157499 | Ga0070667_1001574992 | 192 |
| 378 | 3300005367 | Ga0070667_100175540 | Ga0070667_1001755401 | 192 |
| 379 | 3300005367 | Ga0070667_100216809 | Ga0070667_1002168092 | 192 |
| 380 | 3300005367 | Ga0070667_100229731 | Ga0070667_1002297312 | 192 |
| 381 | 3300005367 | Ga0070667_100304493 | Ga0070667_1003044932 | 192 |
| 382 | 3300005434 | Ga0070709_10320075 | Ga0070709_103200752 | 192 |
| 383 | 3300005436 | Ga0070713_101135603 | Ga0070713_1011356031 | 192 |
| 384 | 3300005436 | Ga0070713_101299207 | Ga0070713_1012992071 | 192 |
| 385 | 3300005439 | Ga0070711_100082879 | Ga0070711_1000828792 | 192 |
| 386 | 3300005439 | Ga0070711_100129075 | Ga0070711_1001290751 | 192 |
| 387 | 3300005440 | Ga0070705_100413347 | Ga0070705_1004133471 | 192 |
| 388 | 3300005441 | Ga0070700_100057018 | Ga0070700_1000570183 | 192 |
| 389 | 3300005441 | Ga0070700_100575485 | Ga0070700_1005754851 | 192 |
| 390 | 3300005455 | Ga0070663_100039596 | Ga0070663_1000395962 | 192 |
| 391 | 3300005455 | Ga0070663_100042935 | Ga0070663_1000429352 | 192 |
| 392 | 3300005455 | Ga0070663_100051561 | Ga0070663_1000515612 | 192 |
| 393 | 3300005455 | Ga0070663_100221772 | Ga0070663_1002217721 | 192 |
| 394 | 3300005455 | Ga0070663_100243363 | Ga0070663_1002433632 | 192 |
| 395 | 3300005455 | Ga0070663_100298089 | Ga0070663_1002980892 | 192 |
| 396 | 3300005456 | Ga0070678_100006561 | Ga0070678_1000065612 | 192 |
| 397 | 3300005456 | Ga0070678_100083683 | Ga0070678_1000836834 | 192 |
| 398 | 3300005456 | Ga0070678_100257631 | Ga0070678_1002576311 | 192 |
| 399 | 3300005456 | Ga0070678_100574519 | Ga0070678_1005745192 | 192 |
| 400 | 3300005456 | Ga0070678_100580568 | Ga0070678_1005805681 | 192 |
| 401 | 3300005456 | Ga0070678_100974863 | Ga0070678_1009748631 | 192 |
| 402 | 3300005457 | Ga0070662_100195379 | Ga0070662_1001953792 | 192 |
| 403 | 3300005457 | Ga0070662_100447894 | Ga0070662_1004478942 | 192 |
| 404 | 3300005458 | Ga0070681_10009117 | Ga0070681_1000911712 | 192 |
| 405 | 3300005458 | Ga0070681_10059381 | Ga0070681_100593813 | 192 |
| 406 | 3300005459 | Ga0068867_100014371 | Ga0068867_1000143713 | 192 |
| 407 | 3300005459 | Ga0068867_100103825 | Ga0068867_1001038252 | 192 |
| 408 | 3300005459 | Ga0068867_100116656 | Ga0068867_1001166562 | 192 |
| 409 | 3300005459 | Ga0068867_100422297 | Ga0068867_1004222972 | 192 |
| 410 | 3300005459 | Ga0068867_100490206 | Ga0068867_1004902061 | 192 |
| 411 | 3300005466 | Ga0070685_10051976 | Ga0070685_100519762 | 192 |
| 412 | 3300005466 | Ga0070685_10084375 | Ga0070685_100843751 | 192 |
| 413 | 3300005468 | Ga0070707_100184068 | Ga0070707_1001840682 | 192 |
| 414 | 3300005471 | Ga0070698_100258430 | Ga0070698_1002584302 | 192 |
| 415 | 3300005518 | Ga0070699_100121433 | Ga0070699_1001214332 | 192 |
| 416 | 3300005518 | Ga0070699_100186336 | Ga0070699_1001863361 | 192 |
| 417 | 3300005530 | Ga0070679_100477395 | Ga0070679_1004773951 | 192 |
| 418 | 3300005535 | Ga0070684_100048525 | Ga0070684_1000485252 | 192 |
| 419 | 3300005535 | Ga0070684_100236066 | Ga0070684_1002360662 | 192 |
| 420 | 3300005536 | Ga0070697_100058137 | Ga0070697_1000581374 | 192 |
| 421 | 3300005539 | Ga0068853_100008723 | Ga0068853_1000087238 | 192 |
| 422 | 3300005539 | Ga0068853_100022298 | Ga0068853_1000222982 | 192 |
| 423 | 3300005539 | Ga0068853_100035826 | Ga0068853_1000358262 | 192 |
| 424 | 3300005539 | Ga0068853_100278905 | Ga0068853_1002789052 | 192 |
| 425 | 3300005539 | Ga0068853_100874851 | Ga0068853_1008748511 | 192 |
| 426 | 3300005543 | Ga0070672_100004623 | Ga0070672_1000046232 | 192 |
| 427 | 3300005543 | Ga0070672_100103124 | Ga0070672_1001031242 | 192 |
| 428 | 3300005543 | Ga0070672_100126053 | Ga0070672_1001260532 | 192 |
| 429 | 3300005543 | Ga0070672_100196724 | Ga0070672_1001967242 | 192 |
| 430 | 3300005543 | Ga0070672_100552692 | Ga0070672_1005526922 | 192 |
| 431 | 3300005544 | Ga0070686_100146194 | Ga0070686_1001461941 | 192 |
| 432 | 3300005544 | Ga0070686_100271719 | Ga0070686_1002717192 | 192 |
| 433 | 3300005546 | Ga0070696_100844130 | Ga0070696_1008441301 | 192 |
| 434 | 3300005547 | Ga0070693_100001570 | Ga0070693_1000015703 | 192 |
| 435 | 3300005547 | Ga0070693_100230210 | Ga0070693_1002302102 | 192 |
| 436 | 3300005548 | Ga0070665_100037219 | Ga0070665_1000372192 | 192 |
| 437 | 3300005548 | Ga0070665_100055378 | Ga0070665_1000553782 | 192 |
| 438 | 3300005548 | Ga0070665_100194472 | Ga0070665_1001944723 | 192 |
| 439 | 3300005548 | Ga0070665_100227881 | Ga0070665_1002278812 | 192 |
| 440 | 3300005548 | Ga0070665_100319271 | Ga0070665_1003192714 | 192 |
| 441 | 3300005563 | Ga0068855_100017322 | Ga0068855_1000173225 | 192 |
| 442 | 3300005563 | Ga0068855_100018996 | Ga0068855_1000189962 | 192 |
| 443 | 3300005563 | Ga0068855_100046858 | Ga0068855_1000468583 | 192 |
| 444 | 3300005563 | Ga0068855_100083668 | Ga0068855_1000836683 | 192 |
| 445 | 3300005563 | Ga0068855_100135272 | Ga0068855_1001352723 | 192 |
| 446 | 3300005563 | Ga0068855_100275018 | Ga0068855_1002750182 | 192 |
| 447 | 3300005563 | Ga0068855_100768736 | Ga0068855_1007687362 | 192 |
| 448 | 3300005563 | Ga0068855_101168479 | Ga0068855_1011684791 | 192 |
| 449 | 3300005564 | Ga0070664_100023846 | Ga0070664_1000238463 | 192 |
| 450 | 3300005564 | Ga0070664_100257820 | Ga0070664_1002578202 | 192 |
| 451 | 3300005577 | Ga0068857_100013666 | Ga0068857_1000136663 | 192 |
| 452 | 3300005577 | Ga0068857_100016794 | Ga0068857_1000167945 | 192 |
| 453 | 3300005577 | Ga0068857_100025993 | Ga0068857_1000259933 | 192 |
| 454 | 3300005577 | Ga0068857_100090271 | Ga0068857_1000902714 | 192 |
| 455 | 3300005577 | Ga0068857_100178756 | Ga0068857_1001787562 | 192 |
| 456 | 3300005577 | Ga0068857_100377876 | Ga0068857_1003778762 | 192 |
| 457 | 3300005578 | Ga0068854_100002059 | Ga0068854_1000020595 | 192 |
| 458 | 3300005578 | Ga0068854_100006321 | Ga0068854_1000063216 | 192 |
| 459 | 3300005578 | Ga0068854_100016295 | Ga0068854_1000162954 | 192 |
| 460 | 3300005578 | Ga0068854_100199620 | Ga0068854_1001996203 | 192 |
| 461 | 3300005614 | Ga0068856_100001874 | Ga0068856_10000187416 | 192 |
| 462 | 3300005614 | Ga0068856_100029048 | Ga0068856_1000290484 | 192 |
| 463 | 3300005614 | Ga0068856_100096583 | Ga0068856_1000965832 | 192 |
| 464 | 3300005614 | Ga0068856_100107099 | Ga0068856_1001070993 | 192 |
| 465 | 3300005614 | Ga0068856_100257601 | Ga0068856_1002576012 | 192 |
| 466 | 3300005615 | Ga0070702_100006992 | Ga0070702_1000069924 | 192 |
| 467 | 3300005615 | Ga0070702_100018208 | Ga0070702_1000182083 | 192 |
| 468 | 3300005616 | Ga0068852_100011069 | Ga0068852_1000110693 | 192 |
| 469 | 3300005616 | Ga0068852_100040373 | Ga0068852_1000403733 | 192 |
| 470 | 3300005616 | Ga0068852_100055734 | Ga0068852_1000557342 | 192 |
| 471 | 3300005616 | Ga0068852_100104537 | Ga0068852_1001045371 | 192 |
| 472 | 3300005616 | Ga0068852_100128249 | Ga0068852_1001282493 | 192 |
| 473 | 3300005616 | Ga0068852_100233518 | Ga0068852_1002335182 | 192 |
| 474 | 3300005616 | Ga0068852_100455909 | Ga0068852_1004559092 | 192 |
| 475 | 3300005617 | Ga0068859_100147451 | Ga0068859_1001474513 | 192 |
| 476 | 3300005617 | Ga0068859_100295503 | Ga0068859_1002955032 | 192 |
| 477 | 3300005617 | Ga0068859_100645413 | Ga0068859_1006454132 | 192 |
| 478 | 3300005618 | Ga0068864_100020059 | Ga0068864_1000200596 | 192 |
| 479 | 3300005618 | Ga0068864_100064105 | Ga0068864_1000641052 | 192 |
| 480 | 3300005618 | Ga0068864_100365958 | Ga0068864_1003659582 | 192 |
| 481 | 3300005718 | Ga0068866_10002289 | Ga0068866_1000228910 | 192 |
| 482 | 3300005719 | Ga0068861_100230752 | Ga0068861_1002307523 | 192 |
| 483 | 3300005719 | Ga0068861_101559912 | Ga0068861_1015599121 | 192 |
| 484 | 3300005834 | Ga0068851_10000665 | Ga0068851_100006656 | 192 |
| 485 | 3300005834 | Ga0068851_10001506 | Ga0068851_1000150610 | 192 |
| 486 | 3300005834 | Ga0068851_10006993 | Ga0068851_100069932 | 192 |
| 487 | 3300005834 | Ga0068851_10142701 | Ga0068851_101427012 | 192 |
| 488 | 3300005840 | Ga0068870_10112519 | Ga0068870_101125192 | 192 |
| 489 | 3300005841 | Ga0068863_100081005 | Ga0068863_1000810052 | 192 |
| 490 | 3300005841 | Ga0068863_100086511 | Ga0068863_1000865112 | 192 |
| 491 | 3300005841 | Ga0068863_100282064 | Ga0068863_1002820642 | 192 |
| 492 | 3300005841 | Ga0068863_100498042 | Ga0068863_1004980421 | 192 |
| 493 | 3300005841 | Ga0068863_100589644 | Ga0068863_1005896441 | 192 |
| 494 | 3300005842 | Ga0068858_100095139 | Ga0068858_1000951392 | 192 |
| 495 | 3300005842 | Ga0068858_100335879 | Ga0068858_1003358792 | 192 |
| 496 | 3300005843 | Ga0068860_100000213 | Ga0068860_10000021358 | 192 |
| 497 | 3300005843 | Ga0068860_100291645 | Ga0068860_1002916452 | 192 |
| 498 | 3300005843 | Ga0068860_100389135 | Ga0068860_1003891352 | 192 |
| 499 | 3300005843 | Ga0068860_100539684 | Ga0068860_1005396842 | 192 |
| 500 | 3300005844 | Ga0068862_100168868 | Ga0068862_1001688682 | 192 |
| 501 | 3300005844 | Ga0068862_100196454 | Ga0068862_1001964542 | 192 |
| 502 | 3300005937 | Ga0081455_10007959 | Ga0081455_100079596 | 192 |
| 503 | 3300005937 | Ga0081455_10033401 | Ga0081455_100334015 | 192 |
| 504 | 3300005983 | Ga0081540_1002690 | Ga0081540_10026903 | 192 |
| 505 | 3300005983 | Ga0081540_1003654 | Ga0081540_100365410 | 192 |
| 506 | 3300005983 | Ga0081540_1005056 | Ga0081540_10050564 | 192 |
| 507 | 3300005983 | Ga0081540_1010774 | Ga0081540_10107745 | 192 |
| 508 | 3300005983 | Ga0081540_1025433 | Ga0081540_10254335 | 192 |
| 509 | 3300005983 | Ga0081540_1071432 | Ga0081540_10714322 | 192 |
| 510 | 3300005985 | Ga0081539_10000148 | Ga0081539_10000148125 | 192 |
| 511 | 3300005985 | Ga0081539_10016757 | Ga0081539_100167574 | 192 |
| 512 | 3300006038 | Ga0075365_10003838 | Ga0075365_100038384 | 192 |
| 513 | 3300006038 | Ga0075365_10032195 | Ga0075365_100321955 | 192 |
| 514 | 3300006038 | Ga0075365_10067397 | Ga0075365_100673973 | 192 |
| 515 | 3300006038 | Ga0075365_10149909 | Ga0075365_101499092 | 192 |
| 516 | 3300006038 | Ga0075365_10287590 | Ga0075365_102875901 | 192 |
| 517 | 3300006042 | Ga0075368_10002426 | Ga0075368_100024263 | 192 |
| 518 | 3300006042 | Ga0075368_10009350 | Ga0075368_100093504 | 192 |
| 519 | 3300006042 | Ga0075368_10050268 | Ga0075368_100502682 | 192 |
| 520 | 3300006048 | Ga0075363_100001327 | Ga0075363_1000013273 | 192 |
| 521 | 3300006048 | Ga0075363_100020674 | Ga0075363_1000206744 | 192 |
| 522 | 3300006048 | Ga0075363_100053024 | Ga0075363_1000530243 | 192 |
| 523 | 3300006048 | Ga0075363_100094818 | Ga0075363_1000948183 | 192 |
| 524 | 3300006051 | Ga0075364_10065283 | Ga0075364_100652831 | 192 |
| 525 | 3300006051 | Ga0075364_10238924 | Ga0075364_102389242 | 192 |
| 526 | 3300006173 | Ga0070716_100576521 | Ga0070716_1005765212 | 192 |
| 527 | 3300006173 | Ga0070716_100649533 | Ga0070716_1006495331 | 192 |
| 528 | 3300006175 | Ga0070712_100021012 | Ga0070712_1000210122 | 192 |
| 529 | 3300006175 | Ga0070712_100363904 | Ga0070712_1003639042 | 192 |
| 530 | 3300006175 | Ga0070712_100605234 | Ga0070712_1006052341 | 192 |
| 531 | 3300006177 | Ga0075362_10054241 | Ga0075362_100542412 | 192 |
| 532 | 3300006177 | Ga0075362_10140258 | Ga0075362_101402582 | 192 |
| 533 | 3300006178 | Ga0075367_10002297 | Ga0075367_100022976 | 192 |
| 534 | 3300006178 | Ga0075367_10009600 | Ga0075367_100096005 | 192 |
| 535 | 3300006178 | Ga0075367_10060115 | Ga0075367_100601152 | 192 |
| 536 | 3300006178 | Ga0075367_10126478 | Ga0075367_101264783 | 192 |
| 537 | 3300006178 | Ga0075367_10185516 | Ga0075367_101855162 | 192 |
| 538 | 3300006178 | Ga0075367_10286818 | Ga0075367_102868181 | 192 |
| 539 | 3300006186 | Ga0075369_10088176 | Ga0075369_100881761 | 192 |
| 540 | 3300006186 | Ga0075369_10169745 | Ga0075369_101697452 | 192 |
| 541 | 3300006195 | Ga0075366_10007498 | Ga0075366_100074984 | 192 |
| 542 | 3300006195 | Ga0075366_10019086 | Ga0075366_100190863 | 192 |
| 543 | 3300006237 | Ga0097621_100011478 | Ga0097621_1000114787 | 192 |
| 544 | 3300006237 | Ga0097621_100042158 | Ga0097621_1000421584 | 192 |
| 545 | 3300006237 | Ga0097621_100078820 | Ga0097621_1000788202 | 192 |
| 546 | 3300006237 | Ga0097621_100116282 | Ga0097621_1001162821 | 192 |
| 547 | 3300006237 | Ga0097621_100136235 | Ga0097621_1001362352 | 192 |
| 548 | 3300006237 | Ga0097621_100389056 | Ga0097621_1003890562 | 192 |
| 549 | 3300006353 | Ga0075370_10035136 | Ga0075370_100351362 | 192 |
| 550 | 3300006353 | Ga0075370_10079108 | Ga0075370_100791082 | 192 |
| 551 | 3300006358 | Ga0068871_100019286 | Ga0068871_1000192864 | 192 |
| 552 | 3300006358 | Ga0068871_100027614 | Ga0068871_1000276145 | 192 |
| 553 | 3300006358 | Ga0068871_100031162 | Ga0068871_1000311622 | 192 |
| 554 | 3300006358 | Ga0068871_100223209 | Ga0068871_1002232092 | 192 |
| 555 | 3300006358 | Ga0068871_100411868 | Ga0068871_1004118682 | 192 |
| 556 | 3300006844 | Ga0075428_100071694 | Ga0075428_1000716942 | 192 |
| 557 | 3300006871 | Ga0075434_100017694 | Ga0075434_1000176943 | 192 |
| 558 | 3300006871 | Ga0075434_100665107 | Ga0075434_1006651072 | 192 |
| 559 | 3300006880 | Ga0075429_100158532 | Ga0075429_1001585322 | 192 |
| 560 | 3300006881 | Ga0068865_100131111 | Ga0068865_1001311112 | 192 |
| 561 | 3300006881 | Ga0068865_100254427 | Ga0068865_1002544272 | 192 |
| 562 | 3300006881 | Ga0068865_100321204 | Ga0068865_1003212042 | 192 |
| 563 | 3300006931 | Ga0097620_100147448 | Ga0097620_1001474483 | 192 |
| 564 | 3300006931 | Ga0097620_100295498 | Ga0097620_1002954982 | 192 |
| 565 | 3300006931 | Ga0097620_100645431 | Ga0097620_1006454312 | 192 |
| 566 | 3300006942 | Ga0099824_1010553 | Ga0099824_10105532 | 192 |
| 567 | 3300006943 | Ga0099822_1067191 | Ga0099822_10671912 | 192 |
| 568 | 3300007265 | Ga0099794_10119692 | Ga0099794_101196921 | 192 |
| 569 | 3300007788 | Ga0099795_10068565 | Ga0099795_100685652 | 192 |
| 570 | 3300007788 | Ga0099795_10112602 | Ga0099795_101126022 | 192 |
| 571 | 3300009036 | Ga0105244_10256859 | Ga0105244_102568591 | 192 |
| 572 | 3300009092 | Ga0105250_10090462 | Ga0105250_100904622 | 192 |
| 573 | 3300009093 | Ga0105240_10012206 | Ga0105240_100122065 | 192 |
| 574 | 3300009093 | Ga0105240_10015453 | Ga0105240_100154535 | 192 |
| 575 | 3300009093 | Ga0105240_10019644 | Ga0105240_100196443 | 192 |
| 576 | 3300009093 | Ga0105240_10204805 | Ga0105240_102048053 | 192 |
| 577 | 3300009093 | Ga0105240_10235380 | Ga0105240_102353802 | 192 |
| 578 | 3300009093 | Ga0105240_10553482 | Ga0105240_105534821 | 192 |
| 579 | 3300009093 | Ga0105240_10584371 | Ga0105240_105843712 | 192 |
| 580 | 3300009093 | Ga0105240_11011289 | Ga0105240_110112891 | 192 |
| 581 | 3300009094 | Ga0111539_10371335 | Ga0111539_103713353 | 192 |
| 582 | 3300009098 | Ga0105245_10035254 | Ga0105245_100352542 | 192 |
| 583 | 3300009098 | Ga0105245_10111250 | Ga0105245_101112503 | 192 |
| 584 | 3300009098 | Ga0105245_10172862 | Ga0105245_101728622 | 192 |
| 585 | 3300009098 | Ga0105245_10194798 | Ga0105245_101947982 | 192 |
| 586 | 3300009098 | Ga0105245_10214003 | Ga0105245_102140032 | 192 |
| 587 | 3300009101 | Ga0105247_10431046 | Ga0105247_104310462 | 192 |
| 588 | 3300009101 | Ga0105247_10676183 | Ga0105247_106761831 | 192 |
| 589 | 3300009148 | Ga0105243_10048411 | Ga0105243_100484112 | 192 |
| 590 | 3300009174 | Ga0105241_10001128 | Ga0105241_1000112812 | 192 |
| 591 | 3300009174 | Ga0105241_10038244 | Ga0105241_100382443 | 192 |
| 592 | 3300009174 | Ga0105241_10051559 | Ga0105241_100515592 | 192 |
| 593 | 3300009176 | Ga0105242_10034685 | Ga0105242_100346853 | 192 |
| 594 | 3300009176 | Ga0105242_10039027 | Ga0105242_100390275 | 192 |
| 595 | 3300009176 | Ga0105242_10229076 | Ga0105242_102290762 | 192 |
| 596 | 3300009177 | Ga0105248_10032462 | Ga0105248_100324623 | 192 |
| 597 | 3300009177 | Ga0105248_10039667 | Ga0105248_100396672 | 192 |
| 598 | 3300009177 | Ga0105248_10394372 | Ga0105248_103943722 | 192 |
| 599 | 3300009177 | Ga0105248_11050293 | Ga0105248_110502932 | 192 |
| 600 | 3300009545 | Ga0105237_10016711 | Ga0105237_100167114 | 192 |
| 601 | 3300009545 | Ga0105237_10039759 | Ga0105237_100397594 | 192 |
| 602 | 3300009545 | Ga0105237_10087117 | Ga0105237_100871174 | 192 |
| 603 | 3300009545 | Ga0105237_10117017 | Ga0105237_101170171 | 192 |
| 604 | 3300009545 | Ga0105237_10125974 | Ga0105237_101259744 | 192 |
| 605 | 3300009545 | Ga0105237_10165645 | Ga0105237_101656453 | 192 |
| 606 | 3300009551 | Ga0105238_10000006 | Ga0105238_1000000655 | 192 |
| 607 | 3300009551 | Ga0105238_10005356 | Ga0105238_100053569 | 192 |
| 608 | 3300009551 | Ga0105238_10033734 | Ga0105238_100337343 | 192 |
| 609 | 3300009551 | Ga0105238_10727802 | Ga0105238_107278022 | 192 |
| 610 | 3300009553 | Ga0105249_10246467 | Ga0105249_102464672 | 192 |
| 611 | 3300010159 | Ga0099796_10000987 | Ga0099796_100009872 | 192 |
| 612 | 3300010375 | Ga0105239_10003581 | Ga0105239_1000358121 | 192 |
| 613 | 3300010375 | Ga0105239_10010252 | Ga0105239_100102525 | 192 |
| 614 | 3300010375 | Ga0105239_10013525 | Ga0105239_100135259 | 192 |
| 615 | 3300010375 | Ga0105239_10038755 | Ga0105239_100387555 | 192 |
| 616 | 3300010375 | Ga0105239_10076483 | Ga0105239_100764833 | 192 |
| 617 | 3300010375 | Ga0105239_10151195 | Ga0105239_101511951 | 192 |
| 618 | 3300010375 | Ga0105239_10350184 | Ga0105239_103501843 | 192 |
| 619 | 3300010375 | Ga0105239_10523367 | Ga0105239_105233672 | 192 |
| 620 | 3300011119 | Ga0105246_10071979 | Ga0105246_100719792 | 192 |
| 621 | 3300011119 | Ga0105246_10107900 | Ga0105246_101079003 | 192 |
| 622 | 3300011119 | Ga0105246_10680542 | Ga0105246_106805421 | 192 |
| 623 | 3300013102 | Ga0157371_10030779 | Ga0157371_100307792 | 192 |
| 624 | 3300013102 | Ga0157371_10361194 | Ga0157371_103611942 | 192 |
| 625 | 3300013104 | Ga0157370_10040329 | Ga0157370_100403292 | 192 |
| 626 | 3300013104 | Ga0157370_10054676 | Ga0157370_100546763 | 192 |
| 627 | 3300013105 | Ga0157369_10066689 | Ga0157369_100666896 | 192 |
| 628 | 3300013296 | Ga0157374_10037138 | Ga0157374_100371383 | 192 |
| 629 | 3300013296 | Ga0157374_10758943 | Ga0157374_107589432 | 192 |
| 630 | 3300013297 | Ga0157378_10007281 | Ga0157378_100072812 | 192 |
| 631 | 3300013297 | Ga0157378_10013278 | Ga0157378_100132788 | 192 |
| 632 | 3300013297 | Ga0157378_10154957 | Ga0157378_101549573 | 192 |
| 633 | 3300013297 | Ga0157378_10168161 | Ga0157378_101681613 | 192 |
| 634 | 3300013297 | Ga0157378_11187248 | Ga0157378_111872481 | 192 |
| 635 | 3300013306 | Ga0163162_10011527 | Ga0163162_100115277 | 192 |
| 636 | 3300013306 | Ga0163162_10039978 | Ga0163162_100399782 | 192 |
| 637 | 3300013306 | Ga0163162_10041818 | Ga0163162_100418182 | 192 |
| 638 | 3300013306 | Ga0163162_10200071 | Ga0163162_102000712 | 192 |
| 639 | 3300013306 | Ga0163162_10225184 | Ga0163162_102251842 | 192 |
| 640 | 3300013306 | Ga0163162_10319734 | Ga0163162_103197343 | 192 |
| 641 | 3300013306 | Ga0163162_10618287 | Ga0163162_106182871 | 192 |
| 642 | 3300013307 | Ga0157372_10055636 | Ga0157372_100556366 | 192 |
| 643 | 3300013308 | Ga0157375_10048580 | Ga0157375_100485802 | 192 |
| 644 | 3300013308 | Ga0157375_10057722 | Ga0157375_100577224 | 192 |
| 645 | 3300013308 | Ga0157375_10251804 | Ga0157375_102518042 | 192 |
| 646 | 3300013308 | Ga0157375_10298662 | Ga0157375_102986622 | 192 |
| 647 | 3300013308 | Ga0157375_10479684 | Ga0157375_104796842 | 192 |
| 648 | 3300013308 | Ga0157375_10682786 | Ga0157375_106827862 | 192 |
| 649 | 3300014325 | Ga0163163_10051487 | Ga0163163_100514873 | 192 |
| 650 | 3300014325 | Ga0163163_10300177 | Ga0163163_103001772 | 192 |
| 651 | 3300014325 | Ga0163163_10467958 | Ga0163163_104679582 | 192 |
| 652 | 3300014326 | Ga0157380_10133887 | Ga0157380_101338873 | 192 |
| 653 | 3300014326 | Ga0157380_10403654 | Ga0157380_104036542 | 192 |
| 654 | 3300014326 | Ga0157380_10880432 | Ga0157380_108804322 | 192 |
| 655 | 3300014497 | Ga0182008_10282620 | Ga0182008_102826201 | 192 |
| 656 | 3300014745 | Ga0157377_10197850 | Ga0157377_101978502 | 192 |
| 657 | 3300014968 | Ga0157379_10688565 | Ga0157379_106885652 | 192 |
| 658 | 3300014969 | Ga0157376_10204895 | Ga0157376_102048952 | 192 |
| 659 | 3300014969 | Ga0157376_10299006 | Ga0157376_102990062 | 192 |
| 660 | 3300014969 | Ga0157376_10365929 | Ga0157376_103659292 | 192 |
| 661 | 3300014969 | Ga0157376_10440153 | Ga0157376_104401532 | 192 |
| 662 | 3300014969 | Ga0157376_10649097 | Ga0157376_106490971 | 192 |
| 663 | 3300014969 | Ga0157376_10831970 | Ga0157376_108319702 | 192 |
| 664 | 3300015261 | Ga0182006_1008158 | Ga0182006_10081584 | 192 |
| 665 | 3300017792 | Ga0163161_10094489 | Ga0163161_100944892 | 192 |
| 666 | 3300021320 | Ga0214544_1000002 | Ga0214544_100000285 | 192 |
| 667 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001435 | 192 |
| 668 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001501 | 192 |
| 669 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001695 | 192 |
| 670 | 3300021361 | Ga0213872_10007408 | Ga0213872_100074082 | 192 |
| 671 | 3300025224 | Ga0209784_100009 | Ga0209784_100009297 | 192 |
| 672 | 3300025225 | Ga0209566_100007 | Ga0209566_100007297 | 192 |
| 673 | 3300025226 | Ga0209674_100018 | Ga0209674_100018297 | 192 |
| 674 | 3300025230 | Ga0209563_100020 | Ga0209563_100020297 | 192 |
| 675 | 3300025253 | Ga0209677_100010 | Ga0209677_100010297 | 192 |
| 676 | 3300025261 | Ga0209233_1001622 | Ga0209233_10016228 | 192 |
| 677 | 3300025261 | Ga0209233_1002635 | Ga0209233_10026352 | 192 |
| 678 | 3300025271 | Ga0207666_1032107 | Ga0207666_10321072 | 192 |
| 679 | 3300025272 | Ga0209455_1001411 | Ga0209455_10014113 | 192 |
| 680 | 3300025295 | Ga0209564_1031964 | Ga0209564_10319642 | 192 |
| 681 | 3300025297 | Ga0209758_1002990 | Ga0209758_100299019 | 192 |
| 682 | 3300025297 | Ga0209758_1006039 | Ga0209758_10060396 | 192 |
| 683 | 3300025297 | Ga0209758_1028088 | Ga0209758_10280884 | 192 |
| 684 | 3300025297 | Ga0209758_1071513 | Ga0209758_10715131 | 192 |
| 685 | 3300025299 | Ga0209256_1069700 | Ga0209256_10697001 | 192 |
| 686 | 3300025302 | Ga0207426_1000238 | Ga0207426_100023820 | 192 |
| 687 | 3300025302 | Ga0207426_1000726 | Ga0207426_100072635 | 192 |
| 688 | 3300025302 | Ga0207426_1018462 | Ga0207426_10184622 | 192 |
| 689 | 3300025304 | Ga0209257_1016377 | Ga0209257_10163773 | 192 |
| 690 | 3300025304 | Ga0209257_1029697 | Ga0209257_10296972 | 192 |
| 691 | 3300025315 | Ga0207697_10032045 | Ga0207697_100320453 | 192 |
| 692 | 3300025321 | Ga0207656_10020655 | Ga0207656_100206553 | 192 |
| 693 | 3300025321 | Ga0207656_10023820 | Ga0207656_100238203 | 192 |
| 694 | 3300025885 | Ga0207653_10020940 | Ga0207653_100209402 | 192 |
| 695 | 3300025899 | Ga0207642_10001698 | Ga0207642_100016981 | 192 |
| 696 | 3300025899 | Ga0207642_10024183 | Ga0207642_100241833 | 192 |
| 697 | 3300025899 | Ga0207642_10120908 | Ga0207642_101209082 | 192 |
| 698 | 3300025900 | Ga0207710_10040185 | Ga0207710_100401852 | 192 |
| 699 | 3300025900 | Ga0207710_10352615 | Ga0207710_103526151 | 192 |
| 700 | 3300025901 | Ga0207688_10014787 | Ga0207688_100147873 | 192 |
| 701 | 3300025901 | Ga0207688_10022654 | Ga0207688_100226544 | 192 |
| 702 | 3300025901 | Ga0207688_10718549 | Ga0207688_107185491 | 192 |
| 703 | 3300025903 | Ga0207680_10080583 | Ga0207680_100805833 | 192 |
| 704 | 3300025903 | Ga0207680_10210837 | Ga0207680_102108372 | 192 |
| 705 | 3300025903 | Ga0207680_10425906 | Ga0207680_104259062 | 192 |
| 706 | 3300025903 | Ga0207680_10507445 | Ga0207680_105074451 | 192 |
| 707 | 3300025904 | Ga0207647_10001739 | Ga0207647_100017395 | 192 |
| 708 | 3300025904 | Ga0207647_10004412 | Ga0207647_100044123 | 192 |
| 709 | 3300025905 | Ga0207685_10280953 | Ga0207685_102809531 | 192 |
| 710 | 3300025907 | Ga0207645_10002659 | Ga0207645_100026596 | 192 |
| 711 | 3300025907 | Ga0207645_10076504 | Ga0207645_100765042 | 192 |
| 712 | 3300025907 | Ga0207645_10104653 | Ga0207645_101046532 | 192 |
| 713 | 3300025907 | Ga0207645_10141766 | Ga0207645_101417662 | 192 |
| 714 | 3300025908 | Ga0207643_10009703 | Ga0207643_100097032 | 192 |
| 715 | 3300025909 | Ga0207705_10054017 | Ga0207705_100540172 | 192 |
| 716 | 3300025910 | Ga0207684_10147447 | Ga0207684_101474472 | 192 |
| 717 | 3300025911 | Ga0207654_10000232 | Ga0207654_1000023213 | 192 |
| 718 | 3300025911 | Ga0207654_10008189 | Ga0207654_100081892 | 192 |
| 719 | 3300025911 | Ga0207654_10018133 | Ga0207654_100181333 | 192 |
| 720 | 3300025912 | Ga0207707_10004626 | Ga0207707_100046269 | 192 |
| 721 | 3300025912 | Ga0207707_10153907 | Ga0207707_101539073 | 192 |
| 722 | 3300025913 | Ga0207695_10001547 | Ga0207695_1000154710 | 192 |
| 723 | 3300025913 | Ga0207695_10018027 | Ga0207695_100180278 | 192 |
| 724 | 3300025913 | Ga0207695_10021133 | Ga0207695_100211335 | 192 |
| 725 | 3300025913 | Ga0207695_10029145 | Ga0207695_100291454 | 192 |
| 726 | 3300025913 | Ga0207695_10211998 | Ga0207695_102119983 | 192 |
| 727 | 3300025913 | Ga0207695_10225135 | Ga0207695_102251352 | 192 |
| 728 | 3300025914 | Ga0207671_10044857 | Ga0207671_100448572 | 192 |
| 729 | 3300025914 | Ga0207671_10061493 | Ga0207671_100614932 | 192 |
| 730 | 3300025914 | Ga0207671_10106153 | Ga0207671_101061533 | 192 |
| 731 | 3300025914 | Ga0207671_10361026 | Ga0207671_103610262 | 192 |
| 732 | 3300025914 | Ga0207671_10596836 | Ga0207671_105968362 | 192 |
| 733 | 3300025914 | Ga0207671_10730982 | Ga0207671_107309822 | 192 |
| 734 | 3300025915 | Ga0207693_10096048 | Ga0207693_100960483 | 192 |
| 735 | 3300025915 | Ga0207693_10218848 | Ga0207693_102188481 | 192 |
| 736 | 3300025915 | Ga0207693_10468550 | Ga0207693_104685502 | 192 |
| 737 | 3300025916 | Ga0207663_10077320 | Ga0207663_100773202 | 192 |
| 738 | 3300025917 | Ga0207660_10002564 | Ga0207660_100025649 | 192 |
| 739 | 3300025917 | Ga0207660_10049575 | Ga0207660_100495752 | 192 |
| 740 | 3300025918 | Ga0207662_10021702 | Ga0207662_100217023 | 192 |
| 741 | 3300025919 | Ga0207657_10000658 | Ga0207657_100006587 | 192 |
| 742 | 3300025920 | Ga0207649_10031218 | Ga0207649_100312182 | 192 |
| 743 | 3300025920 | Ga0207649_10531499 | Ga0207649_105314992 | 192 |
| 744 | 3300025921 | Ga0207652_10003470 | Ga0207652_100034707 | 192 |
| 745 | 3300025921 | Ga0207652_10104025 | Ga0207652_101040252 | 192 |
| 746 | 3300025921 | Ga0207652_10673781 | Ga0207652_106737812 | 192 |
| 747 | 3300025922 | Ga0207646_10063050 | Ga0207646_100630503 | 192 |
| 748 | 3300025924 | Ga0207694_10000050 | Ga0207694_10000050101 | 192 |
| 749 | 3300025924 | Ga0207694_10000129 | Ga0207694_1000012954 | 192 |
| 750 | 3300025924 | Ga0207694_10017085 | Ga0207694_100170852 | 192 |
| 751 | 3300025924 | Ga0207694_10063725 | Ga0207694_100637254 | 192 |
| 752 | 3300025924 | Ga0207694_10154466 | Ga0207694_101544662 | 192 |
| 753 | 3300025925 | Ga0207650_10070842 | Ga0207650_100708422 | 192 |
| 754 | 3300025925 | Ga0207650_10215193 | Ga0207650_102151932 | 192 |
| 755 | 3300025926 | Ga0207659_10003508 | Ga0207659_100035087 | 192 |
| 756 | 3300025926 | Ga0207659_10044448 | Ga0207659_100444482 | 192 |
| 757 | 3300025926 | Ga0207659_10380865 | Ga0207659_103808652 | 192 |
| 758 | 3300025927 | Ga0207687_10006047 | Ga0207687_100060474 | 192 |
| 759 | 3300025927 | Ga0207687_10190002 | Ga0207687_101900021 | 192 |
| 760 | 3300025927 | Ga0207687_10478189 | Ga0207687_104781892 | 192 |
| 761 | 3300025927 | Ga0207687_10509630 | Ga0207687_105096302 | 192 |
| 762 | 3300025929 | Ga0207664_10810461 | Ga0207664_108104611 | 192 |
| 763 | 3300025931 | Ga0207644_10002628 | Ga0207644_100026283 | 192 |
| 764 | 3300025931 | Ga0207644_10083186 | Ga0207644_100831862 | 192 |
| 765 | 3300025931 | Ga0207644_10157177 | Ga0207644_101571772 | 192 |
| 766 | 3300025931 | Ga0207644_10325732 | Ga0207644_103257321 | 192 |
| 767 | 3300025933 | Ga0207706_10042483 | Ga0207706_100424833 | 192 |
| 768 | 3300025933 | Ga0207706_10122664 | Ga0207706_101226643 | 192 |
| 769 | 3300025933 | Ga0207706_10175601 | Ga0207706_101756012 | 192 |
| 770 | 3300025933 | Ga0207706_10210667 | Ga0207706_102106672 | 192 |
| 771 | 3300025933 | Ga0207706_10308903 | Ga0207706_103089032 | 192 |
| 772 | 3300025934 | Ga0207686_10000485 | Ga0207686_100004855 | 192 |
| 773 | 3300025935 | Ga0207709_10028770 | Ga0207709_100287702 | 192 |
| 774 | 3300025935 | Ga0207709_10410928 | Ga0207709_104109282 | 192 |
| 775 | 3300025935 | Ga0207709_10442205 | Ga0207709_104422052 | 192 |
| 776 | 3300025936 | Ga0207670_10098558 | Ga0207670_100985583 | 192 |
| 777 | 3300025936 | Ga0207670_10658863 | Ga0207670_106588632 | 192 |
| 778 | 3300025937 | Ga0207669_10020565 | Ga0207669_100205653 | 192 |
| 779 | 3300025938 | Ga0207704_10035220 | Ga0207704_100352203 | 192 |
| 780 | 3300025938 | Ga0207704_10060292 | Ga0207704_100602923 | 192 |
| 781 | 3300025938 | Ga0207704_10174673 | Ga0207704_101746733 | 192 |
| 782 | 3300025939 | Ga0207665_10316251 | Ga0207665_103162511 | 192 |
| 783 | 3300025939 | Ga0207665_10730464 | Ga0207665_107304641 | 192 |
| 784 | 3300025939 | Ga0207665_10794906 | Ga0207665_107949061 | 192 |
| 785 | 3300025940 | Ga0207691_10000734 | Ga0207691_1000073413 | 192 |
| 786 | 3300025940 | Ga0207691_10043338 | Ga0207691_100433382 | 192 |
| 787 | 3300025940 | Ga0207691_10305385 | Ga0207691_103053851 | 192 |
| 788 | 3300025940 | Ga0207691_10328974 | Ga0207691_103289742 | 192 |
| 789 | 3300025941 | Ga0207711_10078422 | Ga0207711_100784223 | 192 |
| 790 | 3300025941 | Ga0207711_10821497 | Ga0207711_108214971 | 192 |
| 791 | 3300025942 | Ga0207689_10015745 | Ga0207689_100157452 | 192 |
| 792 | 3300025942 | Ga0207689_10018993 | Ga0207689_100189932 | 192 |
| 793 | 3300025942 | Ga0207689_10124415 | Ga0207689_101244152 | 192 |
| 794 | 3300025942 | Ga0207689_10184590 | Ga0207689_101845902 | 192 |
| 795 | 3300025944 | Ga0207661_10022075 | Ga0207661_100220752 | 192 |
| 796 | 3300025944 | Ga0207661_10291060 | Ga0207661_102910602 | 192 |
| 797 | 3300025944 | Ga0207661_10446571 | Ga0207661_104465712 | 192 |
| 798 | 3300025945 | Ga0207679_10024963 | Ga0207679_100249632 | 192 |
| 799 | 3300025945 | Ga0207679_10400752 | Ga0207679_104007522 | 192 |
| 800 | 3300025945 | Ga0207679_10556362 | Ga0207679_105563622 | 192 |
| 801 | 3300025949 | Ga0207667_10014083 | Ga0207667_100140833 | 192 |
| 802 | 3300025949 | Ga0207667_10015706 | Ga0207667_100157064 | 192 |
| 803 | 3300025949 | Ga0207667_10018609 | Ga0207667_100186099 | 192 |
| 804 | 3300025949 | Ga0207667_10043266 | Ga0207667_100432664 | 192 |
| 805 | 3300025949 | Ga0207667_10285835 | Ga0207667_102858352 | 192 |
| 806 | 3300025960 | Ga0207651_10215578 | Ga0207651_102155782 | 192 |
| 807 | 3300025960 | Ga0207651_10360982 | Ga0207651_103609822 | 192 |
| 808 | 3300025972 | Ga0207668_10321278 | Ga0207668_103212781 | 192 |
| 809 | 3300025981 | Ga0207640_10016085 | Ga0207640_100160852 | 192 |
| 810 | 3300025981 | Ga0207640_10043908 | Ga0207640_100439083 | 192 |
| 811 | 3300025981 | Ga0207640_10052613 | Ga0207640_100526134 | 192 |
| 812 | 3300025981 | Ga0207640_10079187 | Ga0207640_100791873 | 192 |
| 813 | 3300025981 | Ga0207640_10119092 | Ga0207640_101190922 | 192 |
| 814 | 3300025981 | Ga0207640_10258346 | Ga0207640_102583462 | 192 |
| 815 | 3300025981 | Ga0207640_10285402 | Ga0207640_102854022 | 192 |
| 816 | 3300026023 | Ga0207677_10004777 | Ga0207677_100047774 | 192 |
| 817 | 3300026023 | Ga0207677_10125605 | Ga0207677_101256053 | 192 |
| 818 | 3300026041 | Ga0207639_10021331 | Ga0207639_100213314 | 192 |
| 819 | 3300026041 | Ga0207639_10478909 | Ga0207639_104789092 | 192 |
| 820 | 3300026041 | Ga0207639_10910586 | Ga0207639_109105861 | 192 |
| 821 | 3300026041 | Ga0207639_11089091 | Ga0207639_110890911 | 192 |
| 822 | 3300026067 | Ga0207678_10008230 | Ga0207678_1000823011 | 192 |
| 823 | 3300026067 | Ga0207678_10008831 | Ga0207678_100088312 | 192 |
| 824 | 3300026067 | Ga0207678_10029682 | Ga0207678_100296826 | 192 |
| 825 | 3300026067 | Ga0207678_10065077 | Ga0207678_100650772 | 192 |
| 826 | 3300026067 | Ga0207678_10150609 | Ga0207678_101506092 | 192 |
| 827 | 3300026067 | Ga0207678_10310698 | Ga0207678_103106982 | 192 |
| 828 | 3300026067 | Ga0207678_10354152 | Ga0207678_103541522 | 192 |
| 829 | 3300026067 | Ga0207678_10429827 | Ga0207678_104298272 | 192 |
| 830 | 3300026075 | Ga0207708_10028723 | Ga0207708_100287232 | 192 |
| 831 | 3300026075 | Ga0207708_10067333 | Ga0207708_100673332 | 192 |
| 832 | 3300026075 | Ga0207708_10611095 | Ga0207708_106110952 | 192 |
| 833 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002211 | 192 |
| 834 | 3300026078 | Ga0207702_10010350 | Ga0207702_100103507 | 192 |
| 835 | 3300026078 | Ga0207702_10097487 | Ga0207702_100974873 | 192 |
| 836 | 3300026078 | Ga0207702_10205406 | Ga0207702_102054063 | 192 |
| 837 | 3300026078 | Ga0207702_10269781 | Ga0207702_102697812 | 192 |
| 838 | 3300026088 | Ga0207641_10229824 | Ga0207641_102298242 | 192 |
| 839 | 3300026088 | Ga0207641_10313119 | Ga0207641_103131192 | 192 |
| 840 | 3300026088 | Ga0207641_10636814 | Ga0207641_106368142 | 192 |
| 841 | 3300026088 | Ga0207641_11090006 | Ga0207641_110900062 | 192 |
| 842 | 3300026089 | Ga0207648_10012844 | Ga0207648_100128444 | 192 |
| 843 | 3300026089 | Ga0207648_10018957 | Ga0207648_100189572 | 192 |
| 844 | 3300026089 | Ga0207648_10044357 | Ga0207648_100443575 | 192 |
| 845 | 3300026089 | Ga0207648_10049980 | Ga0207648_100499802 | 192 |
| 846 | 3300026089 | Ga0207648_10055009 | Ga0207648_100550093 | 192 |
| 847 | 3300026089 | Ga0207648_10502058 | Ga0207648_105020581 | 192 |
| 848 | 3300026089 | Ga0207648_10870686 | Ga0207648_108706862 | 192 |
| 849 | 3300026095 | Ga0207676_10089834 | Ga0207676_100898342 | 192 |
| 850 | 3300026095 | Ga0207676_10215181 | Ga0207676_102151813 | 192 |
| 851 | 3300026095 | Ga0207676_10258444 | Ga0207676_102584442 | 192 |
| 852 | 3300026095 | Ga0207676_10287859 | Ga0207676_102878592 | 192 |
| 853 | 3300026095 | Ga0207676_10866087 | Ga0207676_108660872 | 192 |
| 854 | 3300026116 | Ga0207674_10010794 | Ga0207674_100107945 | 192 |
| 855 | 3300026116 | Ga0207674_10012018 | Ga0207674_100120186 | 192 |
| 856 | 3300026116 | Ga0207674_10014258 | Ga0207674_100142585 | 192 |
| 857 | 3300026116 | Ga0207674_10097514 | Ga0207674_100975143 | 192 |
| 858 | 3300026118 | Ga0207675_100042005 | Ga0207675_1000420053 | 192 |
| 859 | 3300026118 | Ga0207675_100162819 | Ga0207675_1001628191 | 192 |
| 860 | 3300026118 | Ga0207675_100232070 | Ga0207675_1002320703 | 192 |
| 861 | 3300026118 | Ga0207675_100441456 | Ga0207675_1004414562 | 192 |
| 862 | 3300026121 | Ga0207683_10001672 | Ga0207683_100016724 | 192 |
| 863 | 3300026121 | Ga0207683_10002522 | Ga0207683_1000252216 | 192 |
| 864 | 3300026121 | Ga0207683_10061259 | Ga0207683_100612593 | 192 |
| 865 | 3300026121 | Ga0207683_10104462 | Ga0207683_101044622 | 192 |
| 866 | 3300026121 | Ga0207683_10343648 | Ga0207683_103436482 | 192 |
| 867 | 3300026121 | Ga0207683_10440052 | Ga0207683_104400522 | 192 |
| 868 | 3300026121 | Ga0207683_10467756 | Ga0207683_104677562 | 192 |
| 869 | 3300026142 | Ga0207698_10003755 | Ga0207698_100037559 | 192 |
| 870 | 3300026142 | Ga0207698_10027502 | Ga0207698_100275022 | 192 |
| 871 | 3300026142 | Ga0207698_10030725 | Ga0207698_100307256 | 192 |
| 872 | 3300026142 | Ga0207698_10681066 | Ga0207698_106810662 | 192 |
| 873 | 3300026142 | Ga0207698_11127917 | Ga0207698_111279171 | 192 |
| 874 | 3300026142 | Ga0207698_11217242 | Ga0207698_112172421 | 192 |
| 875 | 3300027296 | Ga0209389_1005934 | Ga0209389_10059349 | 192 |
| 876 | 3300027357 | Ga0209589_1000092 | Ga0209589_10000923 | 192 |
| 877 | 3300027361 | Ga0209489_100006 | Ga0209489_100006460 | 192 |
| 878 | 3300027671 | Ga0209588_1025913 | Ga0209588_10259132 | 192 |
| 879 | 3300027866 | Ga0209813_10014735 | Ga0209813_100147351 | 192 |
| 880 | 3300027866 | Ga0209813_10132505 | Ga0209813_101325051 | 192 |
| 881 | 3300027907 | Ga0207428_10097532 | Ga0207428_100975322 | 192 |
| 882 | 3300027907 | Ga0207428_10119691 | Ga0207428_101196913 | 192 |
| 883 | 3300028379 | Ga0268266_10008395 | Ga0268266_100083953 | 192 |
| 884 | 3300028379 | Ga0268266_10046593 | Ga0268266_100465935 | 192 |
| 885 | 3300028379 | Ga0268266_10062176 | Ga0268266_100621762 | 192 |
| 886 | 3300028379 | Ga0268266_10914601 | Ga0268266_109146012 | 192 |
| 887 | 3300028379 | Ga0268266_11083511 | Ga0268266_110835111 | 192 |
| 888 | 3300028380 | Ga0268265_10190091 | Ga0268265_101900913 | 192 |
| 889 | 3300028381 | Ga0268264_10000065 | Ga0268264_10000065173 | 192 |
| 890 | 3300028381 | Ga0268264_10551098 | Ga0268264_105510981 | 192 |
| 891 | 3300028794 | Ga0307515_10074714 | Ga0307515_100747142 | 192 |
| 892 | 3300031239 | Ga0265328_10034595 | Ga0265328_100345951 | 192 |
| 893 | 3300031241 | Ga0265325_10013395 | Ga0265325_100133955 | 192 |
| 894 | 3300031249 | Ga0265339_10063987 | Ga0265339_100639872 | 192 |
| 895 | 3300031249 | Ga0265339_10071466 | Ga0265339_100714662 | 192 |
| 896 | 3300031507 | Ga0307509_10065921 | Ga0307509_100659213 | 192 |
| 897 | 3300031507 | Ga0307509_10596543 | Ga0307509_105965431 | 192 |
| 898 | 3300031595 | Ga0265313_10067731 | Ga0265313_100677312 | 192 |
| 899 | 3300031711 | Ga0265314_10098506 | Ga0265314_100985063 | 192 |
| 900 | 3300031730 | Ga0307516_10004992 | Ga0307516_100049928 | 192 |
| 901 | 3300031731 | Ga0307405_10139955 | Ga0307405_101399552 | 192 |
| 902 | 3300031901 | Ga0307406_10090379 | Ga0307406_100903792 | 192 |
| 903 | 3300031901 | Ga0307406_10820446 | Ga0307406_108204461 | 192 |
| 904 | 3300032002 | Ga0307416_100054674 | Ga0307416_1000546742 | 192 |
| 905 | 3300032005 | Ga0307411_10931942 | Ga0307411_109319422 | 192 |
| 906 | 3300032126 | Ga0307415_100881300 | Ga0307415_1008813002 | 192 |
| 907 | 3300033180 | Ga0307510_10016959 | Ga0307510_100169595 | 192 |
| 908 | 3300033180 | Ga0307510_10200324 | Ga0307510_102003243 | 192 |
| 909 | 3300034816 | Ga0373930_0006141 | Ga0373930_0006141_1107_1685 | 192 |
| 910 | 3300035084 | Ga0373928_0055920 | Ga0373928_0055920_110_688 | 192 |
| 911 | 3300035089 | Ga0373944_0157513 | Ga0373944_0157513_142_720 | 192 |
| 912 | 3300035091 | Ga0373951_0032943 | Ga0373951_0032943_401_979 | 192 |
| 913 | 3300035111 | Ga0373923_0104184 | Ga0373923_0104184_256_834 | 192 |
| 914 | 3300035115 | Ga0373941_0026182 | Ga0373941_0026182_886_1464 | 192 |
| 915 | 3300035117 | Ga0373953_0024360 | Ga0373953_0024360_607_1185 | 192 |
| 916 | 3300035118 | Ga0373954_0003560 | Ga0373954_0003560_4112_4690 | 192 |
| 917 | 3300035119 | Ga0373956_0056972 | Ga0373956_0056972_1116_1694 | 192 |
| 918 | 3300035120 | Ga0373957_0012158 | Ga0373957_0012158_2173_2751 | 192 |
| 919 | 3300035170 | Ga0373943_0004723 | Ga0373943_0004723_1140_1733 | 192 |
| 920 | 3300035171 | Ga0373946_0010067 | Ga0373946_0010067_944_1537 | 192 |
| 921 | 3300035172 | Ga0373955_0092505 | Ga0373955_0092505_1025_1603 | 192 |
| 922 | 3300035172 | Ga0373955_0264978 | Ga0373955_0264978_286_864 | 192 |
| 923 | 3300035410 | Ga0373924_0026828 | Ga0373924_0026828_297_875 | 192 |
| 924 | 3300035691 | Ga0373931_0038508 | Ga0373931_0038508_382_960 | 192 |
| 925 | 3300035691 | Ga0373931_0144646 | Ga0373931_0144646_669_1253 | 192 |
| 926 | 3300035692 | Ga0373935_0022640 | Ga0373935_0022640_2485_3078 | 192 |
| 927 | 3300035692 | Ga0373935_0229179 | Ga0373935_0229179_630_1208 | 192 |
| 928 | 3300035692 | Ga0373935_0412377 | Ga0373935_0412377_184_762 | 192 |
| 929 | 3300035695 | Ga0373927_0024231 | Ga0373927_0024231_903_1481 | 192 |
| 930 | 3300035695 | Ga0373927_0036402 | Ga0373927_0036402_2091_2669 | 192 |
| 931 | 3300035695 | Ga0373927_0046989 | Ga0373927_0046989_1324_1902 | 192 |
| 932 | 3300035695 | Ga0373927_0324252 | Ga0373927_0324252_412_993 | 192 |
| 933 | 3300035695 | Ga0373927_0391148 | Ga0373927_0391148_123_701 | 192 |
| 934 | 3300035724 | Ga0373933_0014758 | Ga0373933_0014758_2377_2970 | 192 |
| 935 | 3300035724 | Ga0373933_0017008 | Ga0373933_0017008_859_1437 | 192 |
| 936 | 3300035725 | Ga0373947_0023699 | Ga0373947_0023699_855_1433 | 192 |
| 937 | 3300035725 | Ga0373947_0053850 | Ga0373947_0053850_1494_2087 | 192 |
| 938 | 3300036401 | Ga0373937_0012233 | Ga0373937_0012233_6760_7353 | 192 |
| 939 | 3300036401 | Ga0373937_0074306 | Ga0373937_0074306_2444_3022 | 192 |
| 940 | 3300036401 | Ga0373937_0750281 | Ga0373937_0750281_249_872 | 192 |
| 941 | 3300037068 | Ga0373925_0010015 | Ga0373925_0010015_2876_3454 | 192 |
| 942 | 3300037068 | Ga0373925_0147237 | Ga0373925_0147237_636_1229 | 192 |
| 943 | 3300037068 | Ga0373925_0357268 | Ga0373925_0357268_454_1032 | 192 |
| 944 | 3300037312 | Ga0395899_0268825 | Ga0395899_0268825_363_959 | 192 |
| 945 | 3300037312 | Ga0395899_0494693 | Ga0395899_0494693_118_696 | 192 |
| 946 | 3300037418 | Ga0395900_0153330 | Ga0395900_0153330_1146_1751 | 192 |
| 947 | 3300037418 | Ga0395900_0233750 | Ga0395900_0233750_1059_1655 | 192 |
| 948 | 3300037466 | Ga0395898_0229371 | Ga0395898_0229371_863_1441 | 192 |
| 949 | 3300037466 | Ga0395898_0243167 | Ga0395898_0243167_731_1327 | 192 |
| 950 | 3300037471 | Ga0395905_0069832 | Ga0395905_0069832_179_760 | 192 |
| 951 | 3300037471 | Ga0395905_0182186 | Ga0395905_0182186_510_1088 | 192 |
| 952 | 3300038443 | Ga0395901_0380552 | Ga0395901_0380552_439_1017 | 192 |
| 953 | 3300038443 | Ga0395901_0392858 | Ga0395901_0392858_155_736 | 192 |
| 954 | 3300038443 | Ga0395901_0432768 | Ga0395901_0432768_176_766 | 192 |
| 955 | 3300038443 | Ga0395901_0674514 | Ga0395901_0674514_213_818 | 192 |
| 956 | 3300039447 | Ga0436361_0011286 | Ga0436361_0011286_9616_10206 | 192 |
| 957 | 3300041494 | Ga0451837_1034308 | Ga0451837_1034308_256_840 | 192 |
| 958 | 3300042014 | Ga0439457_107661 | Ga0439457_107661_28_612 | 192 |
| 959 | 3300042157 | Ga0439458_0009294 | Ga0439458_0009294_1161_1745 | 192 |
| 960 | 3300042876 | Ga0451577_0028784 | Ga0451577_0028784_260_850 | 192 |
| 961 | 3300042876 | Ga0451577_0084183 | Ga0451577_0084183_417_1004 | 192 |
| 962 | 3300044658 | Ga0466972_0054950 | Ga0466972_0054950_280_861 | 192 |
| 963 | 3300044684 | Ga0466966_0524082 | Ga0466966_0524082_74_655 | 192 |
| 964 | 3300044712 | Ga0453684_0049348 | Ga0453684_0049348_2624_3223 | 192 |
| 965 | 3300044735 | Ga0466968_0015575 | Ga0466968_0015575_1027_1608 | 192 |
| 966 | 3300044842 | Ga0466957_0171612 | Ga0466957_0171612_402_986 | 192 |
| 967 | 3300044901 | Ga0466960_0122745 | Ga0466960_0122745_196_777 | 192 |
| 968 | 3300045049 | Ga0466959_0556464 | Ga0466959_0556464_172_759 | 192 |
| 969 | 3300046452 | Ga0495617_032547 | Ga0495617_032547_18_602 | 192 |
| 970 | 3300046454 | Ga0495592_0060008 | Ga0495592_0060008_1024_1602 | 192 |
| 971 | 3300046455 | Ga0495603_0014382 | Ga0495603_0014382_170_754 | 192 |
| 972 | 3300046455 | Ga0495603_0036781 | Ga0495603_0036781_1330_1908 | 192 |
| 973 | 3300046455 | Ga0495603_0225587 | Ga0495603_0225587_162_740 | 192 |
| 974 | 3300046457 | Ga0495590_0064242 | Ga0495590_0064242_531_1115 | 192 |
| 975 | 3300046457 | Ga0495590_0150170 | Ga0495590_0150170_142_795 | 192 |
| 976 | 3300046459 | Ga0495629_0080045 | Ga0495629_0080045_852_1430 | 192 |
| 977 | 3300046459 | Ga0495629_0122411 | Ga0495629_0122411_1195_1773 | 192 |
| 978 | 3300046460 | Ga0495638_0006201 | Ga0495638_0006201_7887_8501 | 192 |
| 979 | 3300046460 | Ga0495638_0145928 | Ga0495638_0145928_747_1331 | 192 |
| 980 | 3300046462 | Ga0495651_0070309 | Ga0495651_0070309_2052_2630 | 192 |
| 981 | 3300046462 | Ga0495651_0220773 | Ga0495651_0220773_462_1040 | 192 |
| 982 | 3300046463 | Ga0495653_0012009 | Ga0495653_0012009_4731_5309 | 192 |
| 983 | 3300046471 | Ga0495650_0055372 | Ga0495650_0055372_740_1318 | 192 |
| 984 | 3300046473 | Ga0495582_0036696 | Ga0495582_0036696_1786_2364 | 192 |
| 985 | 3300046474 | Ga0495605_0129610 | Ga0495605_0129610_442_1026 | 192 |
| 986 | 3300046475 | Ga0495639_0078334 | Ga0495639_0078334_907_1491 | 192 |
| 987 | 3300046475 | Ga0495639_0381587 | Ga0495639_0381587_50_628 | 192 |
| 988 | 3300046476 | Ga0495662_0077741 | Ga0495662_0077741_978_1556 | 192 |
| 989 | 3300046476 | Ga0495662_0249246 | Ga0495662_0249246_170_748 | 192 |
| 990 | 3300046477 | Ga0495664_0418600 | Ga0495664_0418600_22_600 | 192 |
| 991 | 3300046491 | Ga0495584_0042216 | Ga0495584_0042216_1056_1640 | 192 |
| 992 | 3300046492 | Ga0495585_0173204 | Ga0495585_0173204_104_688 | 192 |
| 993 | 3300046492 | Ga0495585_0175924 | Ga0495585_0175924_42_620 | 192 |
| 994 | 3300046499 | Ga0495594_0012205 | Ga0495594_0012205_1354_1947 | 192 |
| 995 | 3300046499 | Ga0495594_0089078 | Ga0495594_0089078_680_1258 | 192 |
| 996 | 3300046499 | Ga0495594_0126312 | Ga0495594_0126312_170_748 | 192 |
| 997 | 3300046507 | Ga0495606_0332008 | Ga0495606_0332008_112_726 | 192 |
| 998 | 3300046511 | Ga0495608_0242533 | Ga0495608_0242533_306_884 | 192 |
| 999 | 3300046512 | Ga0495610_0044603 | Ga0495610_0044603_1363_1977 | 192 |
| 1000 | 3300046513 | Ga0495616_0009944 | Ga0495616_0009944_3728_4312 | 192 |
| 1001 | 3300046513 | Ga0495616_0034535 | Ga0495616_0034535_628_1242 | 192 |
| 1002 | 3300046513 | Ga0495616_0049017 | Ga0495616_0049017_634_1287 | 192 |
| 1003 | 3300046514 | Ga0495618_0003822 | Ga0495618_0003822_4644_5222 | 192 |
| 1004 | 3300046515 | Ga0495620_0132633 | Ga0495620_0132633_41_673 | 192 |
| 1005 | 3300046516 | Ga0495628_0070333 | Ga0495628_0070333_1908_2486 | 192 |
| 1006 | 3300046517 | Ga0495630_0170225 | Ga0495630_0170225_838_1416 | 192 |
| 1007 | 3300046518 | Ga0495631_0053605 | Ga0495631_0053605_700_1284 | 192 |
| 1008 | 3300046518 | Ga0495631_0273399 | Ga0495631_0273399_33_611 | 192 |
| 1009 | 3300046519 | Ga0495632_0124516 | Ga0495632_0124516_401_985 | 192 |
| 1010 | 3300046519 | Ga0495632_0134778 | Ga0495632_0134778_354_938 | 192 |
| 1011 | 3300046523 | Ga0495644_0032007 | Ga0495644_0032007_1032_1616 | 192 |
| 1012 | 3300046524 | Ga0495648_0004153 | Ga0495648_0004153_11860_12438 | 192 |
| 1013 | 3300046524 | Ga0495648_0061772 | Ga0495648_0061772_582_1166 | 192 |
| 1014 | 3300046525 | Ga0495663_0143268 | Ga0495663_0143268_162_746 | 192 |
| 1015 | 3300046528 | Ga0495642_0309020 | Ga0495642_0309020_26_649 | 192 |
| 1016 | 3300046529 | Ga0495652_0100750 | Ga0495652_0100750_306_884 | 192 |
| 1017 | 3300046531 | Ga0495665_0277532 | Ga0495665_0277532_271_849 | 192 |
| 1018 | 3300046533 | Ga0495640_0025473 | Ga0495640_0025473_993_1571 | 192 |
| 1019 | 3300046535 | Ga0495586_0179880 | Ga0495586_0179880_367_945 | 192 |
| 1020 | 3300046536 | Ga0495587_0032723 | Ga0495587_0032723_1341_1919 | 192 |
| 1021 | 3300046538 | Ga0495609_0069177 | Ga0495609_0069177_621_1205 | 192 |
| 1022 | 3300046539 | Ga0495621_0032826 | Ga0495621_0032826_1155_1736 | 192 |
| 1023 | 3300046539 | Ga0495621_0038579 | Ga0495621_0038579_275_853 | 192 |
| 1024 | 3300046539 | Ga0495621_0107673 | Ga0495621_0107673_45_629 | 192 |
| 1025 | 3300046543 | Ga0495645_0009636 | Ga0495645_0009636_1651_2229 | 192 |
| 1026 | 3300046557 | Ga0495622_0030649 | Ga0495622_0030649_335_919 | 192 |
| 1027 | 3300046558 | Ga0495633_0054492 | Ga0495633_0054492_305_889 | 192 |
| 1028 | 3300046558 | Ga0495633_0328782 | Ga0495633_0328782_34_618 | 192 |
| 1029 | 3300046559 | Ga0495667_0056479 | Ga0495667_0056479_1034_1612 | 192 |
| 1030 | 3300046615 | Ga0495656_0012617 | Ga0495656_0012617_1626_2249 | 192 |
| 1031 | 3300046615 | Ga0495656_0095704 | Ga0495656_0095704_74_658 | 192 |
| 1032 | 3300046615 | Ga0495656_0271051 | Ga0495656_0271051_10_588 | 192 |
| 1033 | 3300046616 | Ga0495668_0022682 | Ga0495668_0022682_2128_2712 | 192 |
| 1034 | 3300046642 | Ga0495634_0078269 | Ga0495634_0078269_871_1449 | 192 |
| 1035 | 3300046648 | Ga0495611_0032629 | Ga0495611_0032629_824_1438 | 192 |
| 1036 | 3300046660 | Ga0495625_0363691 | Ga0495625_0363691_39_623 | 192 |
| 1037 | 3300046663 | Ga0495635_0032410 | Ga0495635_0032410_2065_2643 | 192 |
| 1038 | 3300046664 | Ga0495659_0039206 | Ga0495659_0039206_528_1112 | 192 |
| 1039 | 3300046664 | Ga0495659_0133284 | Ga0495659_0133284_22_600 | 192 |
| 1040 | 3300046675 | Ga0495657_0033593 | Ga0495657_0033593_1201_1779 | 192 |
| 1041 | 3300046678 | Ga0495599_0009127 | Ga0495599_0009127_3467_4045 | 192 |
| 1042 | 3300046679 | Ga0495623_0058918 | Ga0495623_0058918_1672_2250 | 192 |
| 1043 | 3300046680 | Ga0495646_0026126 | Ga0495646_0026126_133_711 | 192 |
| 1044 | 3300046681 | Ga0495647_0002647 | Ga0495647_0002647_971_1564 | 192 |
| 1045 | 3300046681 | Ga0495647_0044199 | Ga0495647_0044199_306_890 | 192 |
| 1046 | 3300046683 | Ga0495658_0004054 | Ga0495658_0004054_5360_5953 | 192 |
| 1047 | 3300046684 | Ga0495669_0107138 | Ga0495669_0107138_119_703 | 192 |
| 1048 | 3300046689 | Ga0495613_0344836 | Ga0495613_0344836_161_739 | 192 |
| 1049 | 3300046690 | Ga0495624_0215782 | Ga0495624_0215782_69_647 | 192 |
| 1050 | 3300046691 | Ga0495670_0116972 | Ga0495670_0116972_681_1265 | 192 |
| 1051 | 3300046692 | Ga0495671_0039889 | Ga0495671_0039889_1181_1762 | 192 |
| 1052 | 3300046692 | Ga0495671_0071158 | Ga0495671_0071158_124_708 | 192 |
| 1053 | 3300046794 | Ga0495589_0059202 | Ga0495589_0059202_315_899 | 192 |
| 1054 | 3300046809 | Ga0495600_0033714 | Ga0495600_0033714_1635_2213 | 192 |
| 1055 | 3300046809 | Ga0495600_0174770 | Ga0495600_0174770_559_1140 | 192 |
| 1056 | 3300046810 | Ga0495660_0201389 | Ga0495660_0201389_90_743 | 192 |
| 1057 | 3300047315 | Ga0495581_0004461 | Ga0495581_0004461_1225_1818 | 192 |
| 1058 | 3300047315 | Ga0495581_0194874 | Ga0495581_0194874_468_1046 | 192 |
| 1059 | 3300047315 | Ga0495581_0194930 | Ga0495581_0194930_82_660 | 192 |
| 1060 | 3300047315 | Ga0495581_0342323 | Ga0495581_0342323_276_860 | 192 |
| 1061 | 3300047317 | Ga0495604_0016857 | Ga0495604_0016857_983_1561 | 192 |
| 1062 | 3300047319 | Ga0495674_0024247 | Ga0495674_0024247_4053_4631 | 192 |
| 1063 | 3300047319 | Ga0495674_0063302 | Ga0495674_0063302_289_867 | 192 |
| 1064 | 3300047322 | Ga0495680_0071472 | Ga0495680_0071472_136_714 | 192 |
| 1065 | 3300047323 | Ga0495683_0094403 | Ga0495683_0094403_805_1389 | 192 |
| 1066 | 3300047443 | Ga0495687_173467 | Ga0495687_173467_33_647 | 192 |
| 1067 | 3300047444 | Ga0495675_0014638 | Ga0495675_0014638_3950_4528 | 192 |
| 1068 | 3300047445 | Ga0495677_0125732 | Ga0495677_0125732_77_661 | 192 |
| 1069 | 3300047446 | Ga0495679_065519 | Ga0495679_065519_186_764 | 192 |
| 1070 | 3300047469 | Ga0495673_0120654 | Ga0495673_0120654_183_764 | 192 |
| 1071 | 3300047471 | Ga0495684_0087827 | Ga0495684_0087827_1536_2114 | 192 |
| 1072 | 3300047472 | Ga0495686_0071106 | Ga0495686_0071106_319_897 | 192 |
| 1073 | 3300047472 | Ga0495686_0259194 | Ga0495686_0259194_15_635 | 192 |
| 1074 | 3300048088 | Ga0495602_0096785 | Ga0495602_0096785_1837_2415 | 192 |
| 1075 | 3300048091 | Ga0495626_0067254 | Ga0495626_0067254_525_1139 | 192 |
| 1076 | 3300048903 | Ga0496100_0007662 | Ga0496100_0007662_5369_5947 | 192 |
| 1077 | 3300048903 | Ga0496100_0086541 | Ga0496100_0086541_84_671 | 192 |
| 1078 | 3300048903 | Ga0496100_0233105 | Ga0496100_0233105_107_685 | 192 |
| 1079 | 3300048903 | Ga0496100_0891295 | Ga0496100_0891295_96_686 | 192 |
| 1080 | 3300048904 | Ga0496101_0249292 | Ga0496101_0249292_504_1082 | 192 |
| 1081 | 3300048905 | Ga0496102_0003526 | Ga0496102_0003526_4698_5276 | 192 |
| 1082 | 3300048905 | Ga0496102_0006768 | Ga0496102_0006768_1001_1591 | 192 |
| 1083 | 3300048905 | Ga0496102_0027968 | Ga0496102_0027968_1534_2112 | 192 |
| 1084 | 3300048905 | Ga0496102_0028322 | Ga0496102_0028322_1945_2526 | 192 |
| 1085 | 3300048905 | Ga0496102_0098561 | Ga0496102_0098561_1135_1719 | 192 |
| 1086 | 3300048905 | Ga0496102_0239702 | Ga0496102_0239702_261_839 | 192 |
| 1087 | 3300048905 | Ga0496102_0703959 | Ga0496102_0703959_264_851 | 192 |
| 1088 | 3300048906 | Ga0496103_0036969 | Ga0496103_0036969_191_805 | 192 |
| 1089 | 3300048906 | Ga0496103_0307970 | Ga0496103_0307970_413_997 | 192 |
| 1090 | 3300048907 | Ga0496104_0008661 | Ga0496104_0008661_446_1036 | 192 |
| 1091 | 3300048907 | Ga0496104_0055336 | Ga0496104_0055336_1577_2155 | 192 |
| 1092 | 3300048907 | Ga0496104_0104315 | Ga0496104_0104315_120_698 | 192 |
| 1093 | 3300048907 | Ga0496104_0125604 | Ga0496104_0125604_615_1229 | 192 |
| 1094 | 3300048907 | Ga0496104_0301067 | Ga0496104_0301067_186_770 | 192 |
| 1095 | 3300048908 | Ga0496105_0014118 | Ga0496105_0014118_343_921 | 192 |
| 1096 | 3300048908 | Ga0496105_0025056 | Ga0496105_0025056_3286_3876 | 192 |
| 1097 | 3300048908 | Ga0496105_0060696 | Ga0496105_0060696_677_1255 | 192 |
| 1098 | 3300048908 | Ga0496105_0254629 | Ga0496105_0254629_49_630 | 192 |
| 1099 | 3300048908 | Ga0496105_0265153 | Ga0496105_0265153_502_1128 | 192 |
| 1100 | 3300048909 | Ga0496106_0027981 | Ga0496106_0027981_64_654 | 192 |
| 1101 | 3300048909 | Ga0496106_0164563 | Ga0496106_0164563_675_1328 | 192 |
| 1102 | 3300048910 | Ga0496107_0089106 | Ga0496107_0089106_1482_2063 | 192 |
| 1103 | 3300048910 | Ga0496107_0179865 | Ga0496107_0179865_882_1472 | 192 |
| 1104 | 3300048910 | Ga0496107_0305294 | Ga0496107_0305294_142_720 | 192 |
| 1105 | 3300048911 | Ga0496108_0004162 | Ga0496108_0004162_2190_2777 | 192 |
| 1106 | 3300048911 | Ga0496108_0050833 | Ga0496108_0050833_2585_3163 | 192 |
| 1107 | 3300048911 | Ga0496108_0059885 | Ga0496108_0059885_386_1000 | 192 |
| 1108 | 3300048911 | Ga0496108_0187419 | Ga0496108_0187419_602_1180 | 192 |
| 1109 | 3300048912 | Ga0496109_0252924 | Ga0496109_0252924_1015_1605 | 192 |
| 1110 | 3300048912 | Ga0496109_0280158 | Ga0496109_0280158_301_879 | 192 |
| 1111 | 3300048913 | Ga0496110_0005115 | Ga0496110_0005115_3547_4134 | 192 |
| 1112 | 3300048913 | Ga0496110_0024513 | Ga0496110_0024513_3319_3897 | 192 |
| 1113 | 3300048913 | Ga0496110_0032862 | Ga0496110_0032862_902_1492 | 192 |
| 1114 | 3300048913 | Ga0496110_0311556 | Ga0496110_0311556_101_679 | 192 |
| 1115 | 3300048913 | Ga0496110_0544127 | Ga0496110_0544127_347_931 | 192 |
| 1116 | 3300048914 | Ga0496111_0039965 | Ga0496111_0039965_771_1361 | 192 |
| 1117 | 3300048914 | Ga0496111_0052523 | Ga0496111_0052523_1263_1877 | 192 |
| 1118 | 3300048914 | Ga0496111_0189177 | Ga0496111_0189177_730_1314 | 192 |
| 1119 | 3300048915 | Ga0496112_0107232 | Ga0496112_0107232_259_873 | 192 |
| 1120 | 3300048915 | Ga0496112_0154174 | Ga0496112_0154174_1259_1837 | 192 |
| 1121 | 3300048915 | Ga0496112_0173687 | Ga0496112_0173687_566_1180 | 192 |
| 1122 | 3300048915 | Ga0496112_0173955 | Ga0496112_0173955_1049_1639 | 192 |
| 1123 | 3300048915 | Ga0496112_0254038 | Ga0496112_0254038_205_789 | 192 |
| 1124 | 3300048915 | Ga0496112_0950647 | Ga0496112_0950647_79_693 | 192 |
| 1125 | 3300048916 | Ga0496113_0052398 | Ga0496113_0052398_2194_2808 | 192 |
| 1126 | 3300048916 | Ga0496113_0071006 | Ga0496113_0071006_1958_2536 | 192 |
| 1127 | 3300048916 | Ga0496113_0087561 | Ga0496113_0087561_793_1377 | 192 |
| 1128 | 3300048916 | Ga0496113_0119470 | Ga0496113_0119470_1404_1982 | 192 |
| 1129 | 3300048917 | Ga0496114_0053872 | Ga0496114_0053872_1922_2500 | 192 |
| 1130 | 3300048917 | Ga0496114_0079601 | Ga0496114_0079601_607_1194 | 192 |
| 1131 | 3300048917 | Ga0496114_0269417 | Ga0496114_0269417_505_1086 | 192 |
| 1132 | 3300048917 | Ga0496114_0287607 | Ga0496114_0287607_359_943 | 192 |
| 1133 | 3300048918 | Ga0496115_0011990 | Ga0496115_0011990_5734_6312 | 192 |
| 1134 | 3300048918 | Ga0496115_0055461 | Ga0496115_0055461_2061_2684 | 192 |
| 1135 | 3300048918 | Ga0496115_0064825 | Ga0496115_0064825_2022_2600 | 192 |
| 1136 | 3300048918 | Ga0496115_0072699 | Ga0496115_0072699_469_1047 | 192 |
| 1137 | 3300048918 | Ga0496115_0121595 | Ga0496115_0121595_489_1076 | 192 |
| 1138 | 3300048918 | Ga0496115_0440391 | Ga0496115_0440391_95_679 | 192 |
| 1139 | 3300048919 | Ga0496116_0007877 | Ga0496116_0007877_1239_1892 | 192 |
| 1140 | 3300048919 | Ga0496116_0063979 | Ga0496116_0063979_552_1166 | 192 |
| 1141 | 3300048919 | Ga0496116_0183766 | Ga0496116_0183766_102_686 | 192 |
| 1142 | 3300048920 | Ga0496117_0109010 | Ga0496117_0109010_387_1040 | 192 |
| 1143 | 3300048921 | Ga0496118_0024256 | Ga0496118_0024256_356_934 | 192 |
| 1144 | 3300048921 | Ga0496118_0083713 | Ga0496118_0083713_434_1018 | 192 |
| 1145 | 3300048921 | Ga0496118_0105697 | Ga0496118_0105697_17_598 | 192 |
| 1146 | 3300048921 | Ga0496118_0327868 | Ga0496118_0327868_53_667 | 192 |
| 1147 | 3300048921 | Ga0496118_0373546 | Ga0496118_0373546_24_608 | 192 |
| 1148 | 3300048922 | Ga0496119_0076439 | Ga0496119_0076439_129_713 | 192 |
| 1149 | 3300048922 | Ga0496119_0196340 | Ga0496119_0196340_88_666 | 192 |
| 1150 | 3300048922 | Ga0496119_0208447 | Ga0496119_0208447_380_994 | 192 |
| 1151 | 3300048923 | Ga0496120_0030923 | Ga0496120_0030923_1044_1622 | 192 |
| 1152 | 3300048924 | Ga0496121_0000594 | Ga0496121_0000594_47540_48178 | 192 |
| 1153 | 3300048924 | Ga0496121_0002279 | Ga0496121_0002279_27942_28520 | 192 |
| 1154 | 3300048924 | Ga0496121_0032438 | Ga0496121_0032438_3562_4143 | 192 |
| 1155 | 3300048924 | Ga0496121_0038456 | Ga0496121_0038456_2136_2720 | 192 |
| 1156 | 3300048924 | Ga0496121_0099176 | Ga0496121_0099176_956_1540 | 192 |
| 1157 | 3300048924 | Ga0496121_0227288 | Ga0496121_0227288_26_610 | 192 |
| 1158 | 3300048924 | Ga0496121_0372853 | Ga0496121_0372853_81_659 | 192 |
| 1159 | 3300048924 | Ga0496121_0563375 | Ga0496121_0563375_46_669 | 192 |
| 1160 | 3300048927 | Ga0496124_0136426 | Ga0496124_0136426_104_718 | 192 |
| 1161 | 3300048929 | Ga0496126_0004957 | Ga0496126_0004957_2094_2672 | 192 |
| 1162 | 3300048929 | Ga0496126_0052922 | Ga0496126_0052922_531_1184 | 192 |
| 1163 | 3300048929 | Ga0496126_0106575 | Ga0496126_0106575_1283_1867 | 192 |
| 1164 | 3300048929 | Ga0496126_0109051 | Ga0496126_0109051_770_1348 | 192 |
| 1165 | 3300048929 | Ga0496126_0193712 | Ga0496126_0193712_591_1175 | 192 |
| 1166 | 3300048929 | Ga0496126_0365535 | Ga0496126_0365535_346_924 | 192 |
| 1167 | 3300048929 | Ga0496126_0492859 | Ga0496126_0492859_151_729 | 192 |
| 1168 | 3300049568 | Ga0501031_0000268 | Ga0501031_0000268_9716_10303 | 192 |
| 1169 | 3300049569 | Ga0501032_0000765 | Ga0501032_0000765_10563_11150 | 192 |
| 1170 | 3300049569 | Ga0501032_0324914 | Ga0501032_0324914_377_970 | 192 |
| 1171 | 3300049570 | Ga0501033_0000095 | Ga0501033_0000095_83443_84069 | 192 |
| 1172 | 3300049570 | Ga0501033_0000344 | Ga0501033_0000344_2642_3229 | 192 |
| 1173 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_93966_94553 | 192 |
| 1174 | 3300049571 | Ga0501034_0002052 | Ga0501034_0002052_23596_24222 | 192 |
| 1175 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_9526_10152 | 192 |
| 1176 | 3300049572 | Ga0501036_0000228 | Ga0501036_0000228_28991_29578 | 192 |
| 1177 | 3300049573 | Ga0501037_0000109 | Ga0501037_0000109_49959_50585 | 192 |
| 1178 | 3300049573 | Ga0501037_0002522 | Ga0501037_0002522_5642_6229 | 192 |
| 1179 | 3300049574 | Ga0501038_0000028 | Ga0501038_0000028_90326_90952 | 192 |
| 1180 | 3300049574 | Ga0501038_0000350 | Ga0501038_0000350_14942_15529 | 192 |
| 1181 | 3300049574 | Ga0501038_0259222 | Ga0501038_0259222_282_923 | 192 |
| 1182 | 3300049574 | Ga0501038_0275878 | Ga0501038_0275878_483_1076 | 192 |
| 1183 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_242039_242665 | 192 |
| 1184 | 3300049575 | Ga0501039_0092091 | Ga0501039_0092091_1359_1946 | 192 |
| 1185 | 3300049575 | Ga0501039_0330699 | Ga0501039_0330699_382_975 | 192 |
| 1186 | 3300049579 | Ga0501043_0000085 | Ga0501043_0000085_81783_82370 | 192 |
| 1187 | 3300049579 | Ga0501043_0000122 | Ga0501043_0000122_55974_56600 | 192 |
| 1188 | 3300049580 | Ga0501046_0000032 | Ga0501046_0000032_52359_52985 | 192 |
| 1189 | 3300049580 | Ga0501046_0000426 | Ga0501046_0000426_29532_30119 | 192 |
| 1190 | 3300049581 | Ga0501047_0000077 | Ga0501047_0000077_9418_10044 | 192 |
| 1191 | 3300049581 | Ga0501047_0000493 | Ga0501047_0000493_1359_1946 | 192 |
| 1192 | 3300049582 | Ga0501048_0000233 | Ga0501048_0000233_32547_33134 | 192 |
| 1193 | 3300049582 | Ga0501048_0004655 | Ga0501048_0004655_6105_6731 | 192 |
| 1194 | 3300049582 | Ga0501048_0524613 | Ga0501048_0524613_209_802 | 192 |
| 1195 | 3300049583 | Ga0501067_0000384 | Ga0501067_0000384_7029_7616 | 192 |
| 1196 | 3300049583 | Ga0501067_0009253 | Ga0501067_0009253_607_1233 | 192 |
| 1197 | 3300049584 | Ga0501068_0003858 | Ga0501068_0003858_971_1597 | 192 |
| 1198 | 3300049584 | Ga0501068_0090889 | Ga0501068_0090889_737_1324 | 192 |
| 1199 | 3300049585 | Ga0501069_0006612 | Ga0501069_0006612_4120_4746 | 192 |
| 1200 | 3300049585 | Ga0501069_0032838 | Ga0501069_0032838_1157_1744 | 192 |
| 1201 | 3300049585 | Ga0501069_0485801 | Ga0501069_0485801_122_700 | 192 |
| 1202 | 3300049586 | Ga0501070_0000152 | Ga0501070_0000152_49047_49673 | 192 |
| 1203 | 3300049586 | Ga0501070_0001419 | Ga0501070_0001419_1359_1946 | 192 |
| 1204 | 3300049588 | Ga0501072_0001233 | Ga0501072_0001233_598_1185 | 192 |
| 1205 | 3300049588 | Ga0501072_0028477 | Ga0501072_0028477_548_1174 | 192 |
| 1206 | 3300049589 | Ga0501073_0001343 | Ga0501073_0001343_5097_5684 | 192 |
| 1207 | 3300049589 | Ga0501073_0041571 | Ga0501073_0041571_980_1606 | 192 |
| 1208 | 3300049590 | Ga0501074_0000094 | Ga0501074_0000094_753_1340 | 192 |
| 1209 | 3300049590 | Ga0501074_0009987 | Ga0501074_0009987_5110_5736 | 192 |
| 1210 | 3300049741 | Ga0501079_0002879 | Ga0501079_0002879_2335_2922 | 192 |
| 1211 | 3300049741 | Ga0501079_0072469 | Ga0501079_0072469_1989_2615 | 192 |
| 1212 | 3300049741 | Ga0501079_0556759 | Ga0501079_0556759_152_745 | 192 |
| 1213 | 3300049742 | Ga0501080_0006214 | Ga0501080_0006214_1487_2074 | 192 |
| 1214 | 3300049742 | Ga0501080_0258797 | Ga0501080_0258797_721_1362 | 192 |
| 1215 | 3300049744 | Ga0501083_0046583 | Ga0501083_0046583_859_1446 | 192 |
| 1216 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_184022_184648 | 192 |
| 1217 | 3300049822 | Ga0501035_0000496 | Ga0501035_0000496_8387_8974 | 192 |
| 1218 | 3300049822 | Ga0501035_0099379 | Ga0501035_0099379_129_707 | 192 |
| 1219 | 3300049822 | Ga0501035_0403006 | Ga0501035_0403006_406_1047 | 192 |
| 1220 | 3300049823 | Ga0501044_0000970 | Ga0501044_0000970_30991_31578 | 192 |
| 1221 | 3300049823 | Ga0501044_0002765 | Ga0501044_0002765_11334_11960 | 192 |
| 1222 | 3300049823 | Ga0501044_0469149 | Ga0501044_0469149_131_766 | 192 |
| 1223 | 3300049824 | Ga0501045_0027447 | Ga0501045_0027447_2753_3340 | 192 |
| 1224 | 3300050490 | nmdc:mga03n38_196479_c1 | nmdc:mga03n38_196479_c1_77_691 | 192 |
| 1225 | 3300050490 | nmdc:mga03n38_22431_c1 | nmdc:mga03n38_22431_c1_1842_2468 | 192 |
| 1226 | 3300050490 | nmdc:mga03n38_4949_c1 | nmdc:mga03n38_4949_c1_2432_3016 | 192 |
| 1227 | 3300050492 | nmdc:mga0yw44_234994_c1 | nmdc:mga0yw44_234994_c1_560_1174 | 192 |
| 1228 | 3300050492 | nmdc:mga0yw44_31057_c1 | nmdc:mga0yw44_31057_c1_536_1162 | 192 |
| 1229 | 3300050492 | nmdc:mga0yw44_41674_c1 | nmdc:mga0yw44_41674_c1_115_693 | 192 |
| 1230 | 3300050492 | nmdc:mga0yw44_7001_c1 | nmdc:mga0yw44_7001_c1_2827_3411 | 192 |
| 1231 | 3300050493 | nmdc:mga0k408_119055_c1 | nmdc:mga0k408_119055_c1_472_1050 | 192 |
| 1232 | 3300050494 | nmdc:mga06z11_149473_c1 | nmdc:mga06z11_149473_c1_559_1143 | 192 |
| 1233 | 3300050494 | nmdc:mga06z11_338738_c1 | nmdc:mga06z11_338738_c1_50_628 | 192 |
| 1234 | 3300050496 | nmdc:mga07m45_128707_c1 | nmdc:mga07m45_128707_c1_198_812 | 192 |
| 1235 | 3300050496 | nmdc:mga07m45_142599_c1 | nmdc:mga07m45_142599_c1_83_667 | 192 |
| 1236 | 3300050496 | nmdc:mga07m45_194617_c1 | nmdc:mga07m45_194617_c1_273_860 | 192 |
| 1237 | 3300050496 | nmdc:mga07m45_44437_c1 | nmdc:mga07m45_44437_c1_834_1418 | 192 |
| 1238 | 3300050507 | nmdc:mga05p37_252921_c1 | nmdc:mga05p37_252921_c1_1075_1653 | 192 |
| 1239 | 3300050508 | nmdc:mga09592_645214_c1 | nmdc:mga09592_645214_c1_66_689 | 192 |
| 1240 | 3300050511 | nmdc:mga08y16_153990_c1 | nmdc:mga08y16_153990_c1_1014_1595 | 192 |
| 1241 | 3300050511 | nmdc:mga08y16_289648_c1 | nmdc:mga08y16_289648_c1_497_1135 | 192 |
| 1242 | 3300050512 | nmdc:mga0n895_409200_c1 | nmdc:mga0n895_409200_c1_632_1216 | 192 |
| 1243 | 3300050512 | nmdc:mga0n895_419144_c1 | nmdc:mga0n895_419144_c1_59_643 | 192 |
| 1244 | 3300050513 | nmdc:mga0rr50_526043_c1 | nmdc:mga0rr50_526043_c1_403_987 | 192 |
| 1245 | 3300050513 | nmdc:mga0rr50_779384_c1 | nmdc:mga0rr50_779384_c1_201_785 | 192 |
| 1246 | 3300050516 | nmdc:mga0sz30_111097_c1 | nmdc:mga0sz30_111097_c1_581_1162 | 192 |
| 1247 | 3300050516 | nmdc:mga0sz30_154243_c1 | nmdc:mga0sz30_154243_c1_176_757 | 192 |
| 1248 | 3300050516 | nmdc:mga0sz30_303075_c1 | nmdc:mga0sz30_303075_c1_37_621 | 192 |
| 1249 | 3300050516 | nmdc:mga0sz30_49431_c1 | nmdc:mga0sz30_49431_c1_674_1258 | 192 |
| 1250 | 3300050516 | nmdc:mga0sz30_89818_c1 | nmdc:mga0sz30_89818_c1_353_967 | 192 |
| 1251 | 3300050516 | nmdc:mga0sz30_93217_c1 | nmdc:mga0sz30_93217_c1_530_1144 | 192 |
| 1252 | 3300053078 | Ga0495612_0017319 | Ga0495612_0017319_1249_1827 | 192 |
| 1253 | 3300053080 | Ga0500635_0227427 | Ga0500635_0227427_51_629 | 192 |
| 1254 | 3300053085 | Ga0495619_0066317 | Ga0495619_0066317_1485_2063 | 192 |
| 1255 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_15966_16580 | 192 |
| 1256 | 3300053090 | Ga0500646_0033663 | Ga0500646_0033663_459_1073 | 192 |
| 1257 | 3300053091 | Ga0500647_0010677 | Ga0500647_0010677_1516_2130 | 192 |
| 1258 | 3300053093 | Ga0500651_0007614 | Ga0500651_0007614_4522_5100 | 192 |
| 1259 | 3300053094 | Ga0500566_0000732 | Ga0500566_0000732_253_906 | 192 |
| 1260 | 3300053094 | Ga0500566_0008320 | Ga0500566_0008320_3802_4380 | 192 |
| 1261 | 3300053095 | Ga0500640_102910 | Ga0500640_102910_177_791 | 192 |
| 1262 | 3300053096 | Ga0500641_0059206 | Ga0500641_0059206_635_1288 | 192 |
| 1263 | 3300053096 | Ga0500641_0088154 | Ga0500641_0088154_134_718 | 192 |
| 1264 | 3300053098 | Ga0500650_0040373 | Ga0500650_0040373_97_711 | 192 |
| 1265 | 3300053098 | Ga0500650_0238861 | Ga0500650_0238861_64_642 | 192 |
| 1266 | 3300053102 | Ga0500554_063818 | Ga0500554_063818_283_861 | 192 |
| 1267 | 3300053103 | Ga0500555_001232 | Ga0500555_001232_2672_3286 | 192 |
| 1268 | 3300053103 | Ga0500555_018189 | Ga0500555_018189_1410_1994 | 192 |
| 1269 | 3300053108 | Ga0500562_004298 | Ga0500562_004298_1983_2636 | 192 |
| 1270 | 3300053108 | Ga0500562_015137 | Ga0500562_015137_545_1159 | 192 |
| 1271 | 3300053116 | Ga0500592_031538 | Ga0500592_031538_215_793 | 192 |
| 1272 | 3300053118 | Ga0500594_0003422 | Ga0500594_0003422_1445_2098 | 192 |
| 1273 | 3300053119 | Ga0500595_000932 | Ga0500595_000932_7220_7798 | 192 |
| 1274 | 3300053119 | Ga0500595_002620 | Ga0500595_002620_5957_6595 | 192 |
| 1275 | 3300053119 | Ga0500595_004781 | Ga0500595_004781_4067_4645 | 192 |
| 1276 | 3300053119 | Ga0500595_007598 | Ga0500595_007598_2234_2818 | 192 |
| 1277 | 3300053119 | Ga0500595_008465 | Ga0500595_008465_3269_3847 | 192 |
| 1278 | 3300053120 | Ga0500597_128310 | Ga0500597_128310_194_808 | 192 |
| 1279 | 3300053122 | Ga0500608_051069 | Ga0500608_051069_1294_1947 | 192 |
| 1280 | 3300053123 | Ga0500614_082112 | Ga0500614_082112_180_761 | 192 |
| 1281 | 3300053124 | Ga0500617_075353 | Ga0500617_075353_371_955 | 192 |
| 1282 | 3300053130 | Ga0500642_0031165 | Ga0500642_0031165_699_1277 | 192 |
| 1283 | 3300053131 | Ga0500652_001387 | Ga0500652_001387_5811_6464 | 192 |
| 1284 | 3300053134 | Ga0500658_0067985 | Ga0500658_0067985_675_1289 | 192 |
| 1285 | 3300053136 | Ga0500559_0000066 | Ga0500559_0000066_75489_76142 | 192 |
| 1286 | 3300053139 | Ga0500568_0004322 | Ga0500568_0004322_3559_4212 | 192 |
| 1287 | 3300053139 | Ga0500568_0010375 | Ga0500568_0010375_3006_3641 | 192 |
| 1288 | 3300053139 | Ga0500568_0014447 | Ga0500568_0014447_2544_3158 | 192 |
| 1289 | 3300053147 | Ga0500589_022305 | Ga0500589_022305_1750_2334 | 192 |
| 1290 | 3300053148 | Ga0500590_210597 | Ga0500590_210597_22_645 | 192 |
| 1291 | 3300053150 | Ga0500603_005970 | Ga0500603_005970_35_622 | 192 |
| 1292 | 3300053151 | Ga0500604_0019850 | Ga0500604_0019850_1215_1829 | 192 |
| 1293 | 3300053153 | Ga0500616_0068866 | Ga0500616_0068866_86_700 | 192 |
| 1294 | 3300053156 | Ga0500622_0216135 | Ga0500622_0216135_184_798 | 192 |
| 1295 | 3300053158 | Ga0500627_0148666 | Ga0500627_0148666_43_657 | 192 |
| 1296 | 3300053161 | Ga0500634_0074912 | Ga0500634_0074912_759_1373 | 192 |
| 1297 | 3300053161 | Ga0500634_0080054 | Ga0500634_0080054_1027_1611 | 192 |
| 1298 | 3300053162 | Ga0500638_014840 | Ga0500638_014840_613_1191 | 192 |
| 1299 | 3300053162 | Ga0500638_238907 | Ga0500638_238907_18_596 | 192 |
| 1300 | 3300053177 | Ga0500636_0002347 | Ga0500636_0002347_5009_5662 | 192 |
| 1301 | 3300053177 | Ga0500636_0119412 | Ga0500636_0119412_378_962 | 192 |
| 1302 | 3300053178 | Ga0500637_0000132 | Ga0500637_0000132_14995_15573 | 192 |
| 1303 | 3300053178 | Ga0500637_0010848 | Ga0500637_0010848_3756_4343 | 192 |
| 1304 | 3300053178 | Ga0500637_0074211 | Ga0500637_0074211_845_1429 | 192 |
| 1305 | 3300053729 | Ga0500625_003709 | Ga0500625_003709_198_812 | 192 |
| 1306 | 3300053736 | Ga0500599_000415 | Ga0500599_000415_339_953 | 192 |
| 1307 | 3300054114 | Ga0501084_0241325 | Ga0501084_0241325_209_796 | 192 |
| 1308 | 3300055283 | Ga0500661_000757 | Ga0500661_000757_747_1325 | 192 |
| 1309 | 3300060353 | Ga0501082_0000452 | Ga0501082_0000452_19549_20136 | 192 |
| 1310 | iso_pu_bacteria | 2713897090 | 2715500937 | 192 |
| 1311 | iso_pu_bacteria | 2932784394 | 2932788807 | 192 |
| 1312 | iso_pu_bacteria | 2932828146 | 2932830473 | 192 |
| 1313 | iso_pu_bacteria | 2935616580 | 2935616767 | 192 |
| 1314 | iso_pu_bacteria | 2935638405 | 2935641903 | 192 |
| 1315 | iso_pu_bacteria | 2935665750 | 2935673034 | 192 |
| 1316 | iso_pu_bacteria | 2935694250 | 2935697918 | 192 |
| 1317 | iso_pu_bacteria | 2935703347 | 2935705676 | 192 |
| 1318 | iso_pu_bacteria | 2935801545 | 2935802654 | 192 |
| 1319 | iso_pu_bacteria | 2935810662 | 2935813516 | 192 |
| 1320 | iso_pu_bacteria | 2935827899 | 2935830070 | 192 |
| 1321 | iso_pu_bacteria | 2935837841 | 2935837988 | 192 |
| 1322 | iso_pu_bacteria | 2935855204 | 2935855391 | 192 |
| 1323 | iso_pu_bacteria | 2935864058 | 2935867365 | 192 |
| 1324 | iso_pu_bacteria | 2935873716 | 2935875816 | 192 |
| 1325 | iso_pu_bacteria | 2935992306 | 2935996480 | 192 |
| 1326 | iso_pu_bacteria | 2936002035 | 2936003760 | 192 |
| 1327 | iso_pu_bacteria | 2936037263 | 2936042465 | 192 |
| 1328 | iso_pu_bacteria | 2941538514 | 2941539346 | 192 |
| 1329 | iso_pu_bacteria | 8016511872 | 8016521818 | 192 |
| 1330 | iso_pu_bacteria | 8017057580 | 8017063834 | 192 |
| 1331 | iso_pu_bacteria | 8019576017 | 8019583183 | 192 |
| 1332 | iso_pu_bacteria | 8019586578 | 8019590990 | 192 |
| 1333 | iso_pu_bacteria | 8019597564 | 8019600355 | 192 |
| 1334 | iso_pu_bacteria | 8019608314 | 8019618186 | 192 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c1l-assembly1.cif.gz_B | crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution | 0.9041 | 16 | 189 |
| 2prr-assembly1.cif.gz_E | crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution | 0.8968 | 8 | 192 |
| 6k40-assembly5.cif.gz_K | crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 | 0.8898 | 12 | 189 |
| 2oyo-assembly1.cif.gz_A | crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution | 0.888 | 8 | 189 |
| 2pfx-assembly1.cif.gz_A | crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution | 0.8868 | 3 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2prrF01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like | 0.9785 | 13 | 65 | 1.20.5.810 |
| 2prrD01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like | 0.9777 | 13 | 65 | 1.20.5.810 |
| 2prrG01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like | 0.9771 | 13 | 65 | 1.20.5.810 |
| 2prrA01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like | 0.975 | 13 | 65 | 1.20.5.810 |
| 2prrF01 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like | 0.9605 | 13 | 65 | 1.20.5.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9MLV0-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9606 | 35 | 174 |
GO:0051920
|
| AF-L0JHT6-F1-model_v4 | Peroxidase-like protein (Peroxidase-related enzyme) | 0.9422 | 9 | 169 |
GO:0051920
|
| AF-A0A7V2S7Z7-F1-model_v4 | Peroxidase | 0.9378 | 32 | 189 |
GO:0051920
|
| AF-A0A2N0LYU0-F1-model_v4 | DNA primase/nucleoside triphosphatase C-terminal domain-containing protein | 0.9374 | 35 | 187 |
GO:0004386
GO:0005524 |
| AF-A0A2E8EZX0-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9345 | 35 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar