F493103

General Info

Members Datasets Scaffolds Average Seq Length
1334 630 1185 195

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10065921|Ga0307509_100659213
Length 208
Sequence MDKPASTPSTAAAPPISRFSIPDLATLPDDVRARIQEVQDKAGFVPNVFLVLARRPDEFRAFFAYHDALMAKDGGGLSKGEREMIVVATSAANQCHYCVIAHGAILRIYEKRPLLADQVAVNYRKADLTPRQRAMLEFAIKVALRSPEIEDGDFARLREHGFSDEDAWDIAAIAAFFAMSNRLANATAMRPNDEFYLMGRLPKQPAGR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2643221651 Afipia sp. Root123D2 Isolate Unclassified
16 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
19 2791355199
20 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
26 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
27 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
28 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
29 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
30 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
31 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
32 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
33 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
34 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
35 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
36 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
37 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
38 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
39 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
40 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
41 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
42 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
43 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
44 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
45 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
46 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
47 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
48 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
49 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
50 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
51 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
52 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
53 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
54 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
55 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
56 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
57 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
58 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
59 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
60 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
61 2922368715
62 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
63 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
64 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
65 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
66 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
67 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
68 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
69 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
70 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
71 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
72 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
73 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
74 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
75 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
76 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
77 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
78 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
79 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
80 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
81 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
82 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
83 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
84 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
85 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
86 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
87 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
88 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
89 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
90 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
91 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
92 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
93 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
94 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
95 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
96 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
97 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
98 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
99 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
100 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
101 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
102 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
103 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
104 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
105 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
106 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
107 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
108 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
109 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
110 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
111 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
112 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
113 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
114 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
115 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
116 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
117 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
118 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
119 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
120 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
121 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
122 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
123 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
125 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
126 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
128 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
129 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
130 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
131 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
132 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
133 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
134 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
135 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
136 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
137 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
138 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
139 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
140 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
141 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
142 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
143 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
144 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
145 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
146 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
147 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
148 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
149 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
150 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
151 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
152 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
153 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
154 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
155 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
156 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
157 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
158 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
159 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
160 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
161 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
162 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
163 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
164 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
165 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
166 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
167 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
168 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
169 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
170 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
171 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
172 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
173 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
174 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
175 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
176 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
177 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
178 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
179 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
180 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
181 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
182 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
183 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
184 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
185 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
186 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
187 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
188 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
189 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
190 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
191 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
192 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
193 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
194 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
195 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
196 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
197 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
198 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
200 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
201 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
202 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
203 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
204 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
205 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
206 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
207 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
208 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
209 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
210 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
211 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
212 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
213 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
214 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
215 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
216 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
217 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
218 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
219 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
220 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
221 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
222 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
223 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
224 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
225 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
226 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
227 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
228 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
229 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
230 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
231 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
232 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
233 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
234 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
235 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
236 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
237 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
238 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
239 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
240 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
241 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
242 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
245 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
246 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
247 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
248 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
249 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
250 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
251 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
252 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
253 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
254 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
255 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
258 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
259 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
260 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
261 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
262 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
263 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
270 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
274 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
276 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
341 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
342 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
343 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
345 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
346 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
350 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
351 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
352 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
353 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
354 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
355 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
356 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
357 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
358 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
359 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
360 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
361 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
362 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
363 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
364 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
365 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
366 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
367 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
368 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
369 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
370 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
371 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
372 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
373 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
374 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
375 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
376 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
377 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
378 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
379 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
380 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
381 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
382 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
383 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
384 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
385 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
387 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
388 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
389 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
390 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
391 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
392 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
393 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
394 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
395 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
396 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
397 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
398 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
399 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
400 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
401 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
402 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
403 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
404 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
405 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
406 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
407 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
408 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
409 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
410 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
411 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
412 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
413 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
414 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
415 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
416 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
417 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
418 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
419 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
420 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
421 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
422 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
423 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
424 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
425 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
426 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
427 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
428 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
429 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
430 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
431 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
432 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
433 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
434 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
435 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
436 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
437 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
438 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
439 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
440 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
441 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
442 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
443 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
444 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
445 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
446 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
447 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
448 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
449 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
450 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
451 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
452 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
453 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
454 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
455 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
462 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
463 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
464 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
465 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
466 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
467 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
468 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
469 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
470 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
471 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
472 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
473 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
474 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
475 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
476 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
477 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
478 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
479 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
480 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
481 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
482 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
483 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
484 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
485 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
486 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
487 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
488 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
489 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
490 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
491 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
492 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
493 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
494 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
495 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
496 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
497 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
498 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
499 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
500 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
501 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
502 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
503 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
504 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
505 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
506 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
507 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
508 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
509 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
510 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
511 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
512 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
513 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
514 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
515 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
516 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
523 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
524 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
532 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
535 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
536 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
537 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
538 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
539 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
540 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
543 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
544 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
545 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
546 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
547 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
548 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
549 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
550 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
551 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
552 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
553 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
554 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
555 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
556 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
557 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
558 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
559 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
560 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
561 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
562 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
563 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
564 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
565 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
566 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
567 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
568 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
569 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
570 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
571 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
572 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
573 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
574 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
575 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
576 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
577 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
578 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
579 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
580 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
581 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
582 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
583 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
584 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
585 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
586 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
587 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
588 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
589 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
590 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
591 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
592 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
593 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
594 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
595 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
596 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
597 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
598 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
599 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
600 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
601 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
602 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
603 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
604 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
605 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
606 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
607 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
608 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
609 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
610 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
611 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
612 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
613 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
614 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
615 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
616 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
617 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
618 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
619 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
620 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
621 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
622 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
623 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
624 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
625 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
626 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
627 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
628 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
629 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
630 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.96
Metatranscriptomes 0
Isolates 11.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.02
Nodule 9.22
Rhizoplane 5.85
Rhizosphere 67.77
Stem 0
Stem Tuber 0.07
Unclassified 6.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005748 3300000549 Bacteria 1562
2 JGI24739J22299_10004675 3300001989 Bacteria 5233
3 JGI24737J22298_10003599 3300001990 Bacteria 5463
4 JGI24737J22298_10010858 3300001990 Bacteria 2994
5 JGI24735J21928_10003477 3300002067 Bacteria 5365
6 JGI24750J21931_1026045 3300002070 Bacteria 840
7 JGI25406J46586_10006716 3300003203 Bacteria 5288
8 JGI25153J46596_10004034 3300003215 Bacteria 8006
9 JGI25153J46596_10063189 3300003215 Bacteria 994
10 JGI25160J50197_1000921 3300003354 Bacteria 15453
11 JGI25160J50197_1009395 3300003354 Bacteria 3630
12 JGI25404J52841_10026147 3300003659 Bacteria 1256
13 JGI25404J52841_10042784 3300003659 Bacteria 958
14 Ga0055538_1000019 3300003751 Bacteria 282365
15 Ga0055539_1000024 3300003752 Bacteria 282365
16 Ga0055533_1000032 3300003756 Bacteria 282365
17 Ga0055525_1000041 3300003759 Bacteria 282365
18 Ga0055541_1000018 3300003841 Bacteria 282365
19 Ga0065165_1007079 3300005262 Bacteria 5634
20 Ga0065165_1008084 3300005262 Bacteria 5017
21 Ga0070658_10326807 3300005327 Bacteria 1310
22 Ga0070676_10040507 3300005328 Bacteria 2697
23 Ga0070676_10046538 3300005328 Bacteria 2530
24 Ga0070676_10061229 3300005328 Unclassified 2237
25 Ga0070683_100020596 3300005329 Bacteria 5870
26 Ga0070683_100045726 3300005329 Bacteria 4041
27 Ga0070683_100164968 3300005329 Bacteria 2102
28 Ga0070690_100002084 3300005330 Bacteria 10682
29 Ga0070690_100123477 3300005330 Bacteria 1741
30 Ga0070690_100199738 3300005330 Bacteria 1391
31 Ga0070690_100603217 3300005330 Bacteria 834
32 Ga0070670_100064364 3300005331 Bacteria 3146
33 Ga0070670_100117136 3300005331 Bacteria 2297
34 Ga0070670_100168447 3300005331 Bacteria 1900
35 Ga0070670_100186060 3300005331 Bacteria 1803
36 Ga0070677_10079041 3300005333 Bacteria 1403
37 Ga0068869_100047651 3300005334 Bacteria 3096
38 Ga0068869_100064006 3300005334 Bacteria 2704
39 Ga0068869_100182199 3300005334 Bacteria 1647
40 Ga0070666_10054453 3300005335 Unclassified 2699
41 Ga0070666_10055893 3300005335 Bacteria 2665
42 Ga0070666_10671631 3300005335 Bacteria 759
43 Ga0070680_100118878 3300005336 Bacteria 2205
44 Ga0070682_100202331 3300005337 Bacteria 1401
45 Ga0070682_101038063 3300005337 Bacteria 683
46 Ga0068868_100002211 3300005338 Bacteria 13438
47 Ga0068868_100086295 3300005338 Bacteria 2523
48 Ga0068868_100233532 3300005338 Bacteria 1543
49 Ga0068868_100315573 3300005338 Bacteria 1330
50 Ga0068868_100384892 3300005338 Bacteria 1207
51 Ga0070660_100001944 3300005339 Bacteria 14250
52 Ga0070689_100785405 3300005340 Bacteria 836
53 Ga0070661_100009779 3300005344 Bacteria 6652
54 Ga0070661_100309883 3300005344 Bacteria 1231
55 Ga0070661_100844656 3300005344 Bacteria 753
56 Ga0070668_100290149 3300005347 Bacteria 1369
57 Ga0070669_100456600 3300005353 Bacteria 1054
58 Ga0070675_100006484 3300005354 Bacteria 8986
59 Ga0070675_100156919 3300005354 Bacteria 1954
60 Ga0070671_100004974 3300005355 Bacteria 10582
61 Ga0070671_100049969 3300005355 Bacteria 3478
62 Ga0070671_100057073 3300005355 Bacteria 3248
63 Ga0070671_100101291 3300005355 Bacteria 2416
64 Ga0070671_100198119 3300005355 Bacteria 1703
65 Ga0070671_100243917 3300005355 Bacteria 1525
66 Ga0070674_100039953 3300005356 Bacteria 3171
67 Ga0070674_100056697 3300005356 Bacteria 2717
68 Ga0070674_100167957 3300005356 Bacteria 1670
69 Ga0070673_100010231 3300005364 Bacteria 6340
70 Ga0070673_100439798 3300005364 Bacteria 1172
71 Ga0070659_100338807 3300005366 Bacteria 1259
72 Ga0070667_100032334 3300005367 Bacteria 4363
73 Ga0070667_100104314 3300005367 Bacteria 2452
74 Ga0070667_100157499 3300005367 Bacteria 1998
75 Ga0070667_100175540 3300005367 Bacteria 1893
76 Ga0070667_100216809 3300005367 Bacteria 1702
77 Ga0070667_100229731 3300005367 Bacteria 1654
78 Ga0070667_100304493 3300005367 Bacteria 1435
79 Ga0070667_100561173 3300005367 Bacteria 1050
80 Ga0070667_100691833 3300005367 Bacteria 943
81 Ga0070709_10000751 3300005434 Bacteria 18320
82 Ga0070709_10098062 3300005434 Bacteria 1947
83 Ga0070709_10320075 3300005434 Bacteria 1138
84 Ga0070714_100001123 3300005435 Bacteria 19235
85 Ga0070713_100000647 3300005436 Bacteria 22255
86 Ga0070713_101135603 3300005436 Bacteria 756
87 Ga0070713_101299207 3300005436 Bacteria 705
88 Ga0070711_100045601 3300005439 Bacteria 2983
89 Ga0070711_100082879 3300005439 Bacteria 2290
90 Ga0070711_100129075 3300005439 Bacteria 1880
91 Ga0070705_100413347 3300005440 Bacteria 1002
92 Ga0070705_100716380 3300005440 Bacteria 788
93 Ga0070700_100057018 3300005441 Bacteria 2450
94 Ga0070700_100201951 3300005441 Bacteria 1397
95 Ga0070700_100575485 3300005441 Bacteria 879
96 Ga0070663_100039596 3300005455 Bacteria 3294
97 Ga0070663_100042935 3300005455 Bacteria 3179
98 Ga0070663_100051561 3300005455 Bacteria 2932
99 Ga0070663_100125891 3300005455 Bacteria 1941
100 Ga0070663_100221772 3300005455 Bacteria 1485
101 Ga0070663_100243363 3300005455 Bacteria 1421
102 Ga0070663_100298089 3300005455 Bacteria 1289
103 Ga0070678_100006561 3300005456 Bacteria 6838
104 Ga0070678_100083683 3300005456 Bacteria 2426
105 Ga0070678_100257631 3300005456 Bacteria 1465
106 Ga0070678_100574519 3300005456 Bacteria 1003
107 Ga0070678_100580568 3300005456 Bacteria 998
108 Ga0070678_100974863 3300005456 Bacteria 778
109 Ga0070662_100195379 3300005457 Bacteria 1602
110 Ga0070662_100447894 3300005457 Bacteria 1071
111 Ga0070681_10009117 3300005458 Bacteria 9750
112 Ga0070681_10059381 3300005458 Bacteria 3804
113 Ga0068867_100010469 3300005459 Bacteria 6544
114 Ga0068867_100014371 3300005459 Bacteria 5609
115 Ga0068867_100103825 3300005459 Bacteria 2174
116 Ga0068867_100116656 3300005459 Bacteria 2058
117 Ga0068867_100422297 3300005459 Bacteria 1130
118 Ga0068867_100490206 3300005459 Bacteria 1054
119 Ga0070685_10051976 3300005466 Bacteria 2370
120 Ga0070685_10084375 3300005466 Bacteria 1911
121 Ga0070707_100184068 3300005468 Bacteria 2037
122 Ga0070698_100258430 3300005471 Bacteria 1674
123 Ga0070699_100121433 3300005518 Bacteria 2298
124 Ga0070699_100186336 3300005518 Bacteria 1843
125 Ga0070679_100477395 3300005530 Bacteria 1191
126 Ga0070684_100048525 3300005535 Bacteria 3683
127 Ga0070684_100236066 3300005535 Bacteria 1670
128 Ga0070697_100058137 3300005536 Bacteria 3146
129 Ga0068853_100008723 3300005539 Bacteria 8155
130 Ga0068853_100022298 3300005539 Bacteria 5288
131 Ga0068853_100035826 3300005539 Bacteria 4217
132 Ga0068853_100263706 3300005539 Bacteria 1584
133 Ga0068853_100278905 3300005539 Bacteria 1540
134 Ga0068853_100874851 3300005539 Bacteria 862
135 Ga0070672_100004623 3300005543 Bacteria 9014
136 Ga0070672_100103124 3300005543 Bacteria 2316
137 Ga0070672_100126053 3300005543 Bacteria 2100
138 Ga0070672_100196724 3300005543 Bacteria 1684
139 Ga0070672_100552692 3300005543 Bacteria 1000
140 Ga0070686_100020725 3300005544 Bacteria 3894
141 Ga0070686_100146194 3300005544 Bacteria 1651
142 Ga0070686_100271719 3300005544 Bacteria 1247
143 Ga0070695_100409731 3300005545 Bacteria 1030
144 Ga0070696_100844130 3300005546 Bacteria 757
145 Ga0070693_100001570 3300005547 Bacteria 10307
146 Ga0070693_100230210 3300005547 Bacteria 1219
147 Ga0070693_100311342 3300005547 Bacteria 1065
148 Ga0070693_100318695 3300005547 Bacteria 1054
149 Ga0070665_100037219 3300005548 Bacteria 4895
150 Ga0070665_100055378 3300005548 Bacteria 3978
151 Ga0070665_100194472 3300005548 Bacteria 2029
152 Ga0070665_100227881 3300005548 Bacteria 1863
153 Ga0070665_100319271 3300005548 Bacteria 1557
154 Ga0068855_100017322 3300005563 Bacteria 8668
155 Ga0068855_100018996 3300005563 Bacteria 8264
156 Ga0068855_100046858 3300005563 Bacteria 5109
157 Ga0068855_100083668 3300005563 Bacteria 3696
158 Ga0068855_100135272 3300005563 Bacteria 2812
159 Ga0068855_100154198 3300005563 Bacteria 2611
160 Ga0068855_100275018 3300005563 Bacteria 1872
161 Ga0068855_100768736 3300005563 Bacteria 1026
162 Ga0068855_101168479 3300005563 Bacteria 801
163 Ga0070664_100023846 3300005564 Bacteria 5054
164 Ga0070664_100257820 3300005564 Bacteria 1568
165 Ga0068857_100013666 3300005577 Bacteria 7074
166 Ga0068857_100016794 3300005577 Bacteria 6412
167 Ga0068857_100025993 3300005577 Bacteria 5156
168 Ga0068857_100090271 3300005577 Bacteria 2742
169 Ga0068857_100178756 3300005577 Bacteria 1931
170 Ga0068857_100377876 3300005577 Bacteria 1315
171 Ga0068857_100866258 3300005577 Bacteria 865
172 Ga0068854_100002059 3300005578 Bacteria 12329
173 Ga0068854_100006321 3300005578 Bacteria 7533
174 Ga0068854_100016295 3300005578 Bacteria 4951
175 Ga0068854_100086460 3300005578 Bacteria 2324
176 Ga0068854_100134775 3300005578 Bacteria 1890
177 Ga0068854_100199620 3300005578 Bacteria 1572
178 Ga0068856_100001874 3300005614 Bacteria 21950
179 Ga0068856_100029048 3300005614 Bacteria 5402
180 Ga0068856_100054733 3300005614 Bacteria 3937
181 Ga0068856_100096583 3300005614 Bacteria 2943
182 Ga0068856_100107099 3300005614 Bacteria 2790
183 Ga0068856_100257601 3300005614 Bacteria 1760
184 Ga0068856_100718182 3300005614 Bacteria 1019
185 Ga0070702_100006992 3300005615 Bacteria 5377
186 Ga0070702_100018208 3300005615 Bacteria 3639
187 Ga0070702_100639692 3300005615 Bacteria 803
188 Ga0068852_100011069 3300005616 Bacteria 6772
189 Ga0068852_100040373 3300005616 Bacteria 3936
190 Ga0068852_100055734 3300005616 Bacteria 3413
191 Ga0068852_100104537 3300005616 Bacteria 2563
192 Ga0068852_100128249 3300005616 Bacteria 2332
193 Ga0068852_100233518 3300005616 Bacteria 1754
194 Ga0068852_100312894 3300005616 Bacteria 1523
195 Ga0068852_100455909 3300005616 Bacteria 1267
196 Ga0068852_100991840 3300005616 Bacteria 858
197 Ga0068859_100147451 3300005617 Bacteria 2428
198 Ga0068859_100295503 3300005617 Bacteria 1713
199 Ga0068859_100645413 3300005617 Bacteria 1151
200 Ga0068864_100020059 3300005618 Bacteria 5590
201 Ga0068864_100064105 3300005618 Bacteria 3186
202 Ga0068864_100365958 3300005618 Bacteria 1363
203 Ga0068866_10002289 3300005718 Bacteria 7928
204 Ga0068866_10020376 3300005718 Bacteria 3038
205 Ga0068861_100006429 3300005719 Bacteria 8006
206 Ga0068861_100059899 3300005719 Bacteria 2917
207 Ga0068861_100230752 3300005719 Bacteria 1569
208 Ga0068861_101559912 3300005719 Bacteria 650
209 Ga0068851_10000665 3300005834 Bacteria 14682
210 Ga0068851_10001506 3300005834 Bacteria 10221
211 Ga0068851_10006993 3300005834 Bacteria 5174
212 Ga0068851_10142701 3300005834 Bacteria 1303
213 Ga0068870_10112519 3300005840 Bacteria 1556
214 Ga0068863_100081005 3300005841 Bacteria 3075
215 Ga0068863_100086511 3300005841 Bacteria 2970
216 Ga0068863_100282064 3300005841 Bacteria 1609
217 Ga0068863_100498042 3300005841 Bacteria 1199
218 Ga0068863_100589644 3300005841 Bacteria 1099
219 Ga0068858_100095139 3300005842 Bacteria 2775
220 Ga0068858_100335879 3300005842 Bacteria 1445
221 Ga0068858_100337981 3300005842 Bacteria 1441
222 Ga0068860_100000213 3300005843 Bacteria 91105
223 Ga0068860_100023118 3300005843 Bacteria 6011
224 Ga0068860_100291645 3300005843 Bacteria 1597
225 Ga0068860_100389135 3300005843 Bacteria 1377
226 Ga0068860_100539684 3300005843 Bacteria 1167
227 Ga0068860_100727792 3300005843 Bacteria 1003
228 Ga0068862_100014954 3300005844 Bacteria 6445
229 Ga0068862_100168868 3300005844 Bacteria 1957
230 Ga0068862_100196454 3300005844 Bacteria 1817
231 Ga0081455_10007959 3300005937 Bacteria 11084
232 Ga0081455_10033401 3300005937 Bacteria 4624
233 Ga0081540_1002690 3300005983 Bacteria 14454
234 Ga0081540_1003654 3300005983 Bacteria 12058
235 Ga0081540_1005056 3300005983 Bacteria 9896
236 Ga0081540_1009757 3300005983 Bacteria 6578
237 Ga0081540_1010774 3300005983 Bacteria 6148
238 Ga0081540_1025433 3300005983 Bacteria 3406
239 Ga0081540_1071432 3300005983 Bacteria 1604
240 Ga0081539_10000148 3300005985 Bacteria 163442
241 Ga0081539_10016757 3300005985 Bacteria 5203
242 Ga0070717_11168232 3300006028 Bacteria 701
243 Ga0075365_10003838 3300006038 Bacteria 7843
244 Ga0075365_10032195 3300006038 Bacteria 3369
245 Ga0075365_10067397 3300006038 Bacteria 2403
246 Ga0075365_10149909 3300006038 Bacteria 1622
247 Ga0075365_10287590 3300006038 Bacteria 1157
248 Ga0075368_10002426 3300006042 Bacteria 6083
249 Ga0075368_10009350 3300006042 Bacteria 3524
250 Ga0075368_10050268 3300006042 Bacteria 1655
251 Ga0075363_100001327 3300006048 Bacteria 9262
252 Ga0075363_100020674 3300006048 Bacteria 3304
253 Ga0075363_100053024 3300006048 Bacteria 2166
254 Ga0075363_100094818 3300006048 Bacteria 1645
255 Ga0075364_10065283 3300006051 Bacteria 2389
256 Ga0075364_10238924 3300006051 Bacteria 1234
257 Ga0070715_10013591 3300006163 Bacteria 2994
258 Ga0070716_100003547 3300006173 Bacteria 7364
259 Ga0070716_100576521 3300006173 Bacteria 843
260 Ga0070716_100649533 3300006173 Bacteria 800
261 Ga0070712_100021012 3300006175 Bacteria 4280
262 Ga0070712_100152940 3300006175 Bacteria 1773
263 Ga0070712_100363904 3300006175 Bacteria 1187
264 Ga0070712_100605234 3300006175 Bacteria 928
265 Ga0075362_10054241 3300006177 Bacteria 1801
266 Ga0075362_10140258 3300006177 Bacteria 1155
267 Ga0075367_10002297 3300006178 Bacteria 8676
268 Ga0075367_10009600 3300006178 Bacteria 5064
269 Ga0075367_10060115 3300006178 Bacteria 2264
270 Ga0075367_10126478 3300006178 Bacteria 1577
271 Ga0075367_10185516 3300006178 Bacteria 1297
272 Ga0075367_10286818 3300006178 Bacteria 1035
273 Ga0075369_10088176 3300006186 Bacteria 1382
274 Ga0075369_10169745 3300006186 Bacteria 1001
275 Ga0075366_10007498 3300006195 Bacteria 6029
276 Ga0075366_10019086 3300006195 Bacteria 3962
277 Ga0097621_100011478 3300006237 Bacteria 6525
278 Ga0097621_100042158 3300006237 Bacteria 3675
279 Ga0097621_100078820 3300006237 Bacteria 2737
280 Ga0097621_100116282 3300006237 Bacteria 2265
281 Ga0097621_100136235 3300006237 Bacteria 2094
282 Ga0097621_100389056 3300006237 Bacteria 1247
283 Ga0075370_10035136 3300006353 Bacteria 2812
284 Ga0075370_10079108 3300006353 Bacteria 1888
285 Ga0068871_100019286 3300006358 Bacteria 5206
286 Ga0068871_100027614 3300006358 Bacteria 4440
287 Ga0068871_100031162 3300006358 Bacteria 4203
288 Ga0068871_100223209 3300006358 Bacteria 1633
289 Ga0068871_100411868 3300006358 Bacteria 1205
290 Ga0075428_100071694 3300006844 Bacteria 3786
291 Ga0075434_100017694 3300006871 Bacteria 6870
292 Ga0075434_100393898 3300006871 Bacteria 1406
293 Ga0075434_100665107 3300006871 Bacteria 1060
294 Ga0075429_100158532 3300006880 Bacteria 1982
295 Ga0068865_100003720 3300006881 Bacteria 9156
296 Ga0068865_100131111 3300006881 Bacteria 1878
297 Ga0068865_100254427 3300006881 Bacteria 1387
298 Ga0068865_100321204 3300006881 Bacteria 1245
299 Ga0097620_100147448 3300006931 Bacteria 2428
300 Ga0097620_100295498 3300006931 Bacteria 1713
301 Ga0097620_100645431 3300006931 Bacteria 1151
302 Ga0099824_1010553 3300006942 Bacteria 10831
303 Ga0099822_1067191 3300006943 Bacteria 1061
304 Ga0075435_100022344 3300007076 Bacteria 4881
305 Ga0099794_10119692 3300007265 Bacteria 1324
306 Ga0099795_10068565 3300007788 Bacteria 1333
307 Ga0099795_10112602 3300007788 Bacteria 1080
308 Ga0105244_10256859 3300009036 Bacteria 814
309 Ga0105250_10090462 3300009092 Bacteria 1244
310 Ga0105240_10012206 3300009093 Bacteria 11879
311 Ga0105240_10015453 3300009093 Bacteria 10380
312 Ga0105240_10019644 3300009093 Bacteria 9023
313 Ga0105240_10204805 3300009093 Bacteria 2310
314 Ga0105240_10235380 3300009093 Bacteria 2126
315 Ga0105240_10553482 3300009093 Bacteria 1272
316 Ga0105240_10584371 3300009093 Bacteria 1232
317 Ga0105240_11011289 3300009093 Bacteria 888
318 Ga0105240_11612825 3300009093 Bacteria 679
319 Ga0111539_10207315 3300009094 Bacteria 2284
320 Ga0111539_10371335 3300009094 Bacteria 1665
321 Ga0105245_10035254 3300009098 Bacteria 4440
322 Ga0105245_10111250 3300009098 Bacteria 2547
323 Ga0105245_10172862 3300009098 Bacteria 2058
324 Ga0105245_10194798 3300009098 Bacteria 1943
325 Ga0105245_10214003 3300009098 Bacteria 1856
326 Ga0105247_10074437 3300009101 Bacteria 2130
327 Ga0105247_10431046 3300009101 Bacteria 946
328 Ga0105247_10676183 3300009101 Bacteria 774
329 Ga0105243_10048411 3300009148 Bacteria 3351
330 Ga0105243_10195973 3300009148 Bacteria 1768
331 Ga0105241_10001128 3300009174 Bacteria 20332
332 Ga0105241_10010710 3300009174 Bacteria 6729
333 Ga0105241_10038244 3300009174 Bacteria 3616
334 Ga0105241_10051559 3300009174 Bacteria 3138
335 Ga0105241_10277950 3300009174 Bacteria 1429
336 Ga0105242_10034685 3300009176 Bacteria 4045
337 Ga0105242_10039027 3300009176 Bacteria 3821
338 Ga0105242_10229076 3300009176 Bacteria 1664
339 Ga0105248_10032462 3300009177 Bacteria 5836
340 Ga0105248_10039667 3300009177 Bacteria 5277
341 Ga0105248_10394372 3300009177 Bacteria 1559
342 Ga0105248_11050293 3300009177 Bacteria 920
343 Ga0105237_10016711 3300009545 Bacteria 7618
344 Ga0105237_10039759 3300009545 Bacteria 4746
345 Ga0105237_10087117 3300009545 Bacteria 3112
346 Ga0105237_10097240 3300009545 Bacteria 2934
347 Ga0105237_10117017 3300009545 Bacteria 2659
348 Ga0105237_10125974 3300009545 Bacteria 2556
349 Ga0105237_10165645 3300009545 Bacteria 2209
350 Ga0105238_10000006 3300009551 Bacteria 346249
351 Ga0105238_10005356 3300009551 Bacteria 12677
352 Ga0105238_10033734 3300009551 Bacteria 5208
353 Ga0105238_10538707 3300009551 Bacteria 1171
354 Ga0105238_10727802 3300009551 Bacteria 1005
355 Ga0105249_10219612 3300009553 Bacteria 1870
356 Ga0105249_10246467 3300009553 Bacteria 1769
357 Ga0099796_10000987 3300010159 Bacteria 5345
358 Ga0105239_10003581 3300010375 Bacteria 18987
359 Ga0105239_10010252 3300010375 Bacteria 10494
360 Ga0105239_10013525 3300010375 Bacteria 9059
361 Ga0105239_10038755 3300010375 Bacteria 5221
362 Ga0105239_10076483 3300010375 Bacteria 3682
363 Ga0105239_10151195 3300010375 Bacteria 2591
364 Ga0105239_10350184 3300010375 Bacteria 1667
365 Ga0105239_10523367 3300010375 Bacteria 1349
366 Ga0105246_10071979 3300011119 Bacteria 2436
367 Ga0105246_10107900 3300011119 Bacteria 2040
368 Ga0105246_10680542 3300011119 Bacteria 899
369 Ga0157371_10030779 3300013102 Bacteria 3869
370 Ga0157371_10361194 3300013102 Bacteria 1058
371 Ga0157370_10040329 3300013104 Bacteria 4508
372 Ga0157370_10054676 3300013104 Bacteria 3805
373 Ga0157369_10066689 3300013105 Bacteria 3871
374 Ga0157369_10551805 3300013105 Bacteria 1191
375 Ga0157374_10037138 3300013296 Bacteria 4468
376 Ga0157374_10157085 3300013296 Bacteria 2214
377 Ga0157374_10758943 3300013296 Bacteria 985
378 Ga0157378_10007281 3300013297 Bacteria 9663
379 Ga0157378_10013278 3300013297 Bacteria 7202
380 Ga0157378_10026219 3300013297 Bacteria 5138
381 Ga0157378_10154957 3300013297 Bacteria 2137
382 Ga0157378_10168161 3300013297 Bacteria 2055
383 Ga0157378_11187248 3300013297 Bacteria 802
384 Ga0163162_10011527 3300013306 Bacteria 8622
385 Ga0163162_10035074 3300013306 Bacteria 4995
386 Ga0163162_10039978 3300013306 Bacteria 4688
387 Ga0163162_10041818 3300013306 Bacteria 4586
388 Ga0163162_10200071 3300013306 Bacteria 2126
389 Ga0163162_10225184 3300013306 Bacteria 2005
390 Ga0163162_10319734 3300013306 Bacteria 1684
391 Ga0163162_10618287 3300013306 Bacteria 1209
392 Ga0157372_10055636 3300013307 Bacteria 4419
393 Ga0157375_10048580 3300013308 Bacteria 4152
394 Ga0157375_10057722 3300013308 Bacteria 3837
395 Ga0157375_10251804 3300013308 Bacteria 1927
396 Ga0157375_10298662 3300013308 Bacteria 1774
397 Ga0157375_10479684 3300013308 Bacteria 1409
398 Ga0157375_10682786 3300013308 Bacteria 1181
399 Ga0157375_10730970 3300013308 Bacteria 1142
400 Ga0163163_10051487 3300014325 Bacteria 4060
401 Ga0163163_10300177 3300014325 Bacteria 1659
402 Ga0163163_10467958 3300014325 Bacteria 1321
403 Ga0157380_10010841 3300014326 Bacteria 6571
404 Ga0157380_10133887 3300014326 Bacteria 2118
405 Ga0157380_10403654 3300014326 Bacteria 1297
406 Ga0157380_10880432 3300014326 Bacteria 920
407 Ga0182008_10206915 3300014497 Bacteria 1000
408 Ga0182008_10282620 3300014497 Bacteria 864
409 Ga0157377_10197850 3300014745 Bacteria 1274
410 Ga0157379_10033015 3300014968 Bacteria 4616
411 Ga0157379_10688565 3300014968 Bacteria 959
412 Ga0157376_10204895 3300014969 Bacteria 1817
413 Ga0157376_10299006 3300014969 Bacteria 1523
414 Ga0157376_10365929 3300014969 Bacteria 1384
415 Ga0157376_10440153 3300014969 Bacteria 1269
416 Ga0157376_10649097 3300014969 Bacteria 1055
417 Ga0157376_10831970 3300014969 Bacteria 937
418 Ga0182006_1008158 3300015261 Bacteria 4752
419 Ga0163161_10094489 3300017792 Bacteria 2217
420 Ga0214544_1000002 3300021320 Bacteria 753857
421 Ga0214542_1000001 3300021321 Bacteria 1018696
422 Ga0214545_1000001 3300021324 Bacteria 1092817
423 Ga0214543_1000001 3300021327 Bacteria 776921
424 Ga0213872_10007408 3300021361 Bacteria 5402
425 Ga0213876_10151807 3300021384 Bacteria 1232
426 Ga0209784_100009 3300025224 Bacteria 688031
427 Ga0209566_100007 3300025225 Bacteria 688031
428 Ga0209674_100018 3300025226 Bacteria 688031
429 Ga0209563_100020 3300025230 Bacteria 688031
430 Ga0209677_100010 3300025253 Bacteria 688031
431 Ga0209148_1000500 3300025254 Bacteria 39994
432 Ga0209233_1001622 3300025261 Bacteria 8756
433 Ga0209233_1002635 3300025261 Bacteria 6509
434 Ga0209233_1008753 3300025261 Bacteria 3110
435 Ga0209233_1010397 3300025261 Bacteria 2790
436 Ga0207666_1032107 3300025271 Bacteria 806
437 Ga0209455_1001381 3300025272 Bacteria 11081
438 Ga0209455_1001411 3300025272 Bacteria 10891
439 Ga0209455_1014791 3300025272 Bacteria 1747
440 Ga0209564_1031964 3300025295 Bacteria 1595
441 Ga0209758_1002091 3300025297 Bacteria 21224
442 Ga0209758_1002990 3300025297 Bacteria 16204
443 Ga0209758_1006039 3300025297 Bacteria 8935
444 Ga0209758_1028088 3300025297 Bacteria 2388
445 Ga0209758_1071513 3300025297 Bacteria 1089
446 Ga0209256_1069700 3300025299 Bacteria 794
447 Ga0207426_1000238 3300025302 Bacteria 124393
448 Ga0207426_1000726 3300025302 Bacteria 37826
449 Ga0207426_1010515 3300025302 Bacteria 3587
450 Ga0207426_1018462 3300025302 Bacteria 2456
451 Ga0209257_1016377 3300025304 Bacteria 3003
452 Ga0209257_1029697 3300025304 Bacteria 1777
453 Ga0207697_10032045 3300025315 Bacteria 2151
454 Ga0207656_10020655 3300025321 Bacteria 2620
455 Ga0207656_10023820 3300025321 Bacteria 2469
456 Ga0207653_10020940 3300025885 Bacteria 2072
457 Ga0207692_10005452 3300025898 Bacteria 5098
458 Ga0207642_10001698 3300025899 Bacteria 6811
459 Ga0207642_10024183 3300025899 Bacteria 2439
460 Ga0207642_10058877 3300025899 Bacteria 1774
461 Ga0207642_10120908 3300025899 Bacteria 1350
462 Ga0207710_10040185 3300025900 Bacteria 2072
463 Ga0207710_10352615 3300025900 Bacteria 750
464 Ga0207688_10014787 3300025901 Bacteria 4235
465 Ga0207688_10022654 3300025901 Bacteria 3438
466 Ga0207688_10718549 3300025901 Bacteria 632
467 Ga0207680_10011092 3300025903 Bacteria 4539
468 Ga0207680_10080583 3300025903 Bacteria 2044
469 Ga0207680_10210837 3300025903 Bacteria 1328
470 Ga0207680_10425906 3300025903 Bacteria 940
471 Ga0207680_10507445 3300025903 Bacteria 859
472 Ga0207647_10001739 3300025904 Bacteria 16681
473 Ga0207647_10004412 3300025904 Bacteria 10434
474 Ga0207685_10280953 3300025905 Bacteria 817
475 Ga0207699_10031838 3300025906 Bacteria 2965
476 Ga0207645_10002659 3300025907 Bacteria 13907
477 Ga0207645_10076504 3300025907 Bacteria 2144
478 Ga0207645_10104653 3300025907 Bacteria 1828
479 Ga0207645_10141766 3300025907 Bacteria 1566
480 Ga0207643_10009703 3300025908 Bacteria 5166
481 Ga0207705_10054017 3300025909 Bacteria 2895
482 Ga0207684_10147447 3300025910 Bacteria 2024
483 Ga0207654_10000232 3300025911 Bacteria 34089
484 Ga0207654_10007223 3300025911 Bacteria 5597
485 Ga0207654_10008189 3300025911 Bacteria 5272
486 Ga0207654_10018133 3300025911 Bacteria 3690
487 Ga0207654_10217514 3300025911 Bacteria 1265
488 Ga0207707_10004626 3300025912 Bacteria 12087
489 Ga0207707_10153907 3300025912 Bacteria 2010
490 Ga0207695_10001547 3300025913 Bacteria 37828
491 Ga0207695_10018027 3300025913 Bacteria 8174
492 Ga0207695_10021133 3300025913 Bacteria 7435
493 Ga0207695_10029145 3300025913 Bacteria 6107
494 Ga0207695_10211998 3300025913 Bacteria 1847
495 Ga0207695_10225135 3300025913 Bacteria 1782
496 Ga0207695_10272263 3300025913 Bacteria 1589
497 Ga0207671_10044857 3300025914 Bacteria 3269
498 Ga0207671_10061493 3300025914 Bacteria 2786
499 Ga0207671_10106153 3300025914 Bacteria 2132
500 Ga0207671_10361026 3300025914 Bacteria 1153
501 Ga0207671_10596836 3300025914 Bacteria 880
502 Ga0207671_10730982 3300025914 Bacteria 787
503 Ga0207693_10004043 3300025915 Bacteria 12466
504 Ga0207693_10096048 3300025915 Bacteria 2323
505 Ga0207693_10218848 3300025915 Bacteria 1496
506 Ga0207693_10468550 3300025915 Bacteria 984
507 Ga0207663_10000098 3300025916 Bacteria 41171
508 Ga0207663_10077320 3300025916 Bacteria 2166
509 Ga0207660_10002564 3300025917 Bacteria 11938
510 Ga0207660_10049575 3300025917 Bacteria 2978
511 Ga0207662_10021702 3300025918 Bacteria 3674
512 Ga0207657_10000658 3300025919 Bacteria 36762
513 Ga0207657_10169532 3300025919 Bacteria 1769
514 Ga0207649_10031218 3300025920 Bacteria 3165
515 Ga0207649_10531499 3300025920 Bacteria 898
516 Ga0207652_10003470 3300025921 Bacteria 12999
517 Ga0207652_10104025 3300025921 Bacteria 2511
518 Ga0207652_10673781 3300025921 Bacteria 924
519 Ga0207646_10063050 3300025922 Bacteria 3309
520 Ga0207681_10208519 3300025923 Bacteria 1505
521 Ga0207694_10000050 3300025924 Bacteria 159920
522 Ga0207694_10000129 3300025924 Bacteria 77922
523 Ga0207694_10017085 3300025924 Bacteria 5481
524 Ga0207694_10063725 3300025924 Bacteria 2872
525 Ga0207694_10154466 3300025924 Bacteria 1850
526 Ga0207650_10070842 3300025925 Bacteria 2621
527 Ga0207650_10215193 3300025925 Unclassified 1544
528 Ga0207659_10003508 3300025926 Bacteria 9425
529 Ga0207659_10044448 3300025926 Bacteria 3125
530 Ga0207659_10380865 3300025926 Bacteria 1176
531 Ga0207687_10006047 3300025927 Bacteria 8006
532 Ga0207687_10190002 3300025927 Bacteria 1598
533 Ga0207687_10478189 3300025927 Bacteria 1037
534 Ga0207687_10509630 3300025927 Bacteria 1005
535 Ga0207664_10017228 3300025929 Bacteria 5291
536 Ga0207664_10810461 3300025929 Bacteria 842
537 Ga0207644_10002628 3300025931 Bacteria 11568
538 Ga0207644_10083186 3300025931 Bacteria 2369
539 Ga0207644_10157177 3300025931 Bacteria 1764
540 Ga0207644_10325732 3300025931 Bacteria 1243
541 Ga0207706_10042483 3300025933 Bacteria 4029
542 Ga0207706_10122664 3300025933 Bacteria 2286
543 Ga0207706_10175601 3300025933 Bacteria 1882
544 Ga0207706_10210667 3300025933 Bacteria 1704
545 Ga0207706_10308903 3300025933 Bacteria 1377
546 Ga0207686_10000485 3300025934 Bacteria 26204
547 Ga0207709_10028770 3300025935 Bacteria 3216
548 Ga0207709_10174249 3300025935 Bacteria 1513
549 Ga0207709_10410928 3300025935 Bacteria 1037
550 Ga0207709_10442205 3300025935 Bacteria 1003
551 Ga0207670_10098558 3300025936 Bacteria 2083
552 Ga0207670_10422402 3300025936 Bacteria 1070
553 Ga0207670_10658863 3300025936 Bacteria 864
554 Ga0207669_10020565 3300025937 Bacteria 3465
555 Ga0207704_10035220 3300025938 Bacteria 2866
556 Ga0207704_10060292 3300025938 Bacteria 2347
557 Ga0207704_10121951 3300025938 Bacteria 1786
558 Ga0207704_10174673 3300025938 Bacteria 1545
559 Ga0207704_10517648 3300025938 Bacteria 964
560 Ga0207665_10000355 3300025939 Bacteria 31763
561 Ga0207665_10316251 3300025939 Bacteria 1170
562 Ga0207665_10730464 3300025939 Bacteria 780
563 Ga0207665_10794906 3300025939 Bacteria 747
564 Ga0207691_10000734 3300025940 Bacteria 32373
565 Ga0207691_10043338 3300025940 Bacteria 4147
566 Ga0207691_10305385 3300025940 Bacteria 1366
567 Ga0207691_10328974 3300025940 Bacteria 1309
568 Ga0207711_10078422 3300025941 Bacteria 2881
569 Ga0207711_10821497 3300025941 Bacteria 865
570 Ga0207689_10015745 3300025942 Bacteria 6404
571 Ga0207689_10018993 3300025942 Bacteria 5797
572 Ga0207689_10031264 3300025942 Bacteria 4433
573 Ga0207689_10124415 3300025942 Bacteria 2121
574 Ga0207689_10184590 3300025942 Bacteria 1720
575 Ga0207661_10022075 3300025944 Bacteria 4785
576 Ga0207661_10291060 3300025944 Bacteria 1462
577 Ga0207661_10446571 3300025944 Bacteria 1177
578 Ga0207679_10024963 3300025945 Bacteria 4104
579 Ga0207679_10400752 3300025945 Bacteria 1207
580 Ga0207679_10556362 3300025945 Bacteria 1030
581 Ga0207667_10014083 3300025949 Bacteria 9131
582 Ga0207667_10015706 3300025949 Bacteria 8586
583 Ga0207667_10018609 3300025949 Bacteria 7784
584 Ga0207667_10043266 3300025949 Bacteria 4780
585 Ga0207667_10097440 3300025949 Bacteria 3035
586 Ga0207667_10236835 3300025949 Bacteria 1868
587 Ga0207667_10285835 3300025949 Bacteria 1685
588 Ga0207651_10215578 3300025960 Bacteria 1548
589 Ga0207651_10360982 3300025960 Bacteria 1226
590 Ga0207668_10292329 3300025972 Bacteria 1341
591 Ga0207668_10321278 3300025972 Bacteria 1284
592 Ga0207640_10016085 3300025981 Bacteria 4344
593 Ga0207640_10043908 3300025981 Bacteria 2860
594 Ga0207640_10052613 3300025981 Bacteria 2653
595 Ga0207640_10079187 3300025981 Unclassified 2239
596 Ga0207640_10119092 3300025981 Bacteria 1887
597 Ga0207640_10258346 3300025981 Bacteria 1356
598 Ga0207640_10285402 3300025981 Bacteria 1299
599 Ga0207677_10004777 3300026023 Bacteria 7311
600 Ga0207677_10125605 3300026023 Bacteria 1938
601 Ga0207703_10140794 3300026035 Bacteria 2093
602 Ga0207639_10021331 3300026041 Bacteria 4651
603 Ga0207639_10478909 3300026041 Bacteria 1134
604 Ga0207639_10910586 3300026041 Bacteria 822
605 Ga0207639_11089091 3300026041 Bacteria 749
606 Ga0207678_10008230 3300026067 Bacteria 9189
607 Ga0207678_10008831 3300026067 Bacteria 8871
608 Ga0207678_10029682 3300026067 Bacteria 4774
609 Ga0207678_10065077 3300026067 Bacteria 3131
610 Ga0207678_10150609 3300026067 Bacteria 1986
611 Ga0207678_10310698 3300026067 Bacteria 1355
612 Ga0207678_10354152 3300026067 Bacteria 1266
613 Ga0207678_10429827 3300026067 Bacteria 1146
614 Ga0207708_10028723 3300026075 Bacteria 4211
615 Ga0207708_10067333 3300026075 Bacteria 2739
616 Ga0207708_10611095 3300026075 Bacteria 924
617 Ga0207708_10773519 3300026075 Bacteria 825
618 Ga0207702_10000002 3300026078 Bacteria 491507
619 Ga0207702_10010350 3300026078 Bacteria 7813
620 Ga0207702_10051226 3300026078 Bacteria 3488
621 Ga0207702_10079035 3300026078 Bacteria 2850
622 Ga0207702_10080745 3300026078 Bacteria 2822
623 Ga0207702_10097487 3300026078 Bacteria 2588
624 Ga0207702_10205406 3300026078 Bacteria 1829
625 Ga0207702_10269781 3300026078 Bacteria 1605
626 Ga0207641_10229824 3300026088 Bacteria 1723
627 Ga0207641_10313119 3300026088 Bacteria 1486
628 Ga0207641_10636814 3300026088 Bacteria 1046
629 Ga0207641_11090006 3300026088 Bacteria 797
630 Ga0207648_10002498 3300026089 Bacteria 19740
631 Ga0207648_10012844 3300026089 Bacteria 7821
632 Ga0207648_10018957 3300026089 Bacteria 6214
633 Ga0207648_10044357 3300026089 Bacteria 3901
634 Ga0207648_10049980 3300026089 Bacteria 3657
635 Ga0207648_10055009 3300026089 Bacteria 3475
636 Ga0207648_10502058 3300026089 Bacteria 1110
637 Ga0207648_10870686 3300026089 Bacteria 841
638 Ga0207676_10089834 3300026095 Bacteria 2519
639 Ga0207676_10215181 3300026095 Bacteria 1708
640 Ga0207676_10258444 3300026095 Bacteria 1571
641 Ga0207676_10287859 3300026095 Bacteria 1494
642 Ga0207676_10866087 3300026095 Bacteria 884
643 Ga0207674_10010794 3300026116 Bacteria 10301
644 Ga0207674_10012018 3300026116 Bacteria 9700
645 Ga0207674_10014258 3300026116 Bacteria 8783
646 Ga0207674_10097514 3300026116 Bacteria 2923
647 Ga0207675_100003157 3300026118 Bacteria 16167
648 Ga0207675_100042005 3300026118 Bacteria 4269
649 Ga0207675_100162819 3300026118 Bacteria 2129
650 Ga0207675_100193834 3300026118 Bacteria 1950
651 Ga0207675_100232070 3300026118 Bacteria 1781
652 Ga0207675_100441456 3300026118 Bacteria 1288
653 Ga0207683_10001672 3300026121 Bacteria 19869
654 Ga0207683_10002522 3300026121 Bacteria 15987
655 Ga0207683_10061259 3300026121 Bacteria 3311
656 Ga0207683_10104462 3300026121 Bacteria 2532
657 Ga0207683_10343648 3300026121 Bacteria 1369
658 Ga0207683_10440052 3300026121 Bacteria 1201
659 Ga0207683_10467756 3300026121 Bacteria 1163
660 Ga0207698_10003755 3300026142 Bacteria 9180
661 Ga0207698_10027502 3300026142 Bacteria 4039
662 Ga0207698_10030725 3300026142 Bacteria 3868
663 Ga0207698_10183800 3300026142 Bacteria 1855
664 Ga0207698_10681066 3300026142 Bacteria 1021
665 Ga0207698_11127917 3300026142 Bacteria 797
666 Ga0207698_11217242 3300026142 Bacteria 767
667 Ga0209389_1005934 3300027296 Bacteria 10512
668 Ga0209589_1000092 3300027357 Bacteria 89530
669 Ga0209489_100006 3300027361 Bacteria 475698
670 Ga0209588_1025913 3300027671 Bacteria 1859
671 Ga0209813_10014735 3300027866 Bacteria 2109
672 Ga0209813_10132505 3300027866 Bacteria 878
673 Ga0207428_10097532 3300027907 Bacteria 2275
674 Ga0207428_10119691 3300027907 Bacteria 2020
675 Ga0268266_10008395 3300028379 Bacteria 9183
676 Ga0268266_10046593 3300028379 Bacteria 3712
677 Ga0268266_10062176 3300028379 Bacteria 3221
678 Ga0268266_10914601 3300028379 Bacteria 848
679 Ga0268266_11083511 3300028379 Bacteria 775
680 Ga0268265_10019499 3300028380 Bacteria 4716
681 Ga0268265_10190091 3300028380 Bacteria 1772
682 Ga0268264_10000065 3300028381 Bacteria 298403
683 Ga0268264_10006431 3300028381 Bacteria 9893
684 Ga0268264_10551098 3300028381 Bacteria 1131
685 Ga0307515_10074714 3300028794 Bacteria 4528
686 Ga0265328_10034595 3300031239 Bacteria 1871
687 Ga0265325_10013395 3300031241 Bacteria 4669
688 Ga0265339_10063987 3300031249 Bacteria 1974
689 Ga0265339_10071466 3300031249 Bacteria 1849
690 Ga0265339_10101543 3300031249 Bacteria 1496
691 Ga0307513_10302368 3300031456 Bacteria 1366
692 Ga0307509_10065921 3300031507 Bacteria 3800
693 Ga0307509_10596543 3300031507 Bacteria 777
694 Ga0265313_10067731 3300031595 Bacteria 1651
695 Ga0265314_10005784 3300031711 Bacteria 11093
696 Ga0265314_10075664 3300031711 Bacteria 2239
697 Ga0265314_10098506 3300031711 Bacteria 1886
698 Ga0265342_10029779 3300031712 Bacteria 3387
699 Ga0265342_10077859 3300031712 Bacteria 1919
700 Ga0307516_10004992 3300031730 Bacteria 16102
701 Ga0307405_10139955 3300031731 Bacteria 1686
702 Ga0307406_10090379 3300031901 Bacteria 2060
703 Ga0307406_10820446 3300031901 Bacteria 786
704 Ga0307416_100054674 3300032002 Bacteria 3210
705 Ga0307411_10931942 3300032005 Bacteria 773
706 Ga0307415_100881300 3300032126 Bacteria 823
707 Ga0307510_10016959 3300033180 Bacteria 8590
708 Ga0307510_10060670 3300033180 Bacteria 3889
709 Ga0307510_10200324 3300033180 Bacteria 1532
710 Ga0373930_0006141 3300034816 Bacteria 2020
711 Ga0373928_0055920 3300035084 Bacteria 943
712 Ga0373944_0157513 3300035089 Bacteria 804
713 Ga0373951_0032943 3300035091 Bacteria 1227
714 Ga0373923_0104184 3300035111 Bacteria 1254
715 Ga0373941_0026182 3300035115 Bacteria 1692
716 Ga0373953_0024360 3300035117 Bacteria 2300
717 Ga0373954_0003560 3300035118 Bacteria 6618
718 Ga0373956_0056972 3300035119 Bacteria 1765
719 Ga0373957_0012158 3300035120 Bacteria 2891
720 Ga0373943_0004723 3300035170 Bacteria 6161
721 Ga0373946_0010067 3300035171 Bacteria 3496
722 Ga0373955_0092505 3300035172 Bacteria 1725
723 Ga0373955_0264978 3300035172 Bacteria 1032
724 Ga0373924_0026828 3300035410 Bacteria 2287
725 Ga0373931_0038508 3300035691 Bacteria 2501
726 Ga0373931_0144646 3300035691 Bacteria 1381
727 Ga0373935_0022640 3300035692 Bacteria 3855
728 Ga0373935_0229179 3300035692 Bacteria 1293
729 Ga0373935_0412377 3300035692 Bacteria 971
730 Ga0373927_0024231 3300035695 Bacteria 3970
731 Ga0373927_0036402 3300035695 Bacteria 3201
732 Ga0373927_0046989 3300035695 Bacteria 2792
733 Ga0373927_0267854 3300035695 Bacteria 1123
734 Ga0373927_0324252 3300035695 Bacteria 1014
735 Ga0373927_0391148 3300035695 Bacteria 917
736 Ga0373933_0014758 3300035724 Bacteria 4348
737 Ga0373933_0017008 3300035724 Bacteria 4077
738 Ga0373933_0133256 3300035724 Bacteria 1564
739 Ga0373947_0023699 3300035725 Bacteria 3573
740 Ga0373947_0053850 3300035725 Bacteria 2427
741 Ga0373937_0012233 3300036401 Bacteria 7538
742 Ga0373937_0074306 3300036401 Bacteria 3136
743 Ga0373937_0251215 3300036401 Bacteria 1667
744 Ga0373937_0750281 3300036401 Bacteria 923
745 Ga0373925_0006190 3300037068 Bacteria 8839
746 Ga0373925_0010015 3300037068 Bacteria 6884
747 Ga0373925_0147237 3300037068 Bacteria 1846
748 Ga0373925_0357268 3300037068 Bacteria 1187
749 Ga0373925_0465515 3300037068 Bacteria 1036
750 Ga0395899_0268825 3300037312 Bacteria 1163
751 Ga0395899_0494693 3300037312 Bacteria 794
752 Ga0395900_0153330 3300037418 Bacteria 2354
753 Ga0395900_0233750 3300037418 Bacteria 1847
754 Ga0395898_0229371 3300037466 Bacteria 1771
755 Ga0395898_0243167 3300037466 Bacteria 1716
756 Ga0395905_0069832 3300037471 Bacteria 3290
757 Ga0395905_0092718 3300037471 Bacteria 2833
758 Ga0395905_0182186 3300037471 Bacteria 1972
759 Ga0395901_0380552 3300038443 Bacteria 1453
760 Ga0395901_0392858 3300038443 Bacteria 1426
761 Ga0395901_0432768 3300038443 Bacteria 1348
762 Ga0395901_0674514 3300038443 Bacteria 1034
763 Ga0436365_0905497 3300039437 Bacteria 2390
764 Ga0436365_1149165 3300039437 Bacteria 2335
765 Ga0436361_0011286 3300039447 Bacteria 11058
766 Ga0436363_1425212 3300039450 Bacteria 2794
767 Ga0451793_0066431 3300041452 Bacteria 951
768 Ga0451837_1034308 3300041494 Bacteria 1301
769 Ga0439457_107661 3300042014 Bacteria 653
770 Ga0439458_0009294 3300042157 Bacteria 2189
771 Ga0451577_0028784 3300042876 Bacteria 5024
772 Ga0451577_0084183 3300042876 Bacteria 2838
773 Ga0466969_0078556 3300044656 Bacteria 1578
774 Ga0466972_0054950 3300044658 Bacteria 1915
775 Ga0466966_0000334 3300044684 Bacteria 30532
776 Ga0466966_0524082 3300044684 Bacteria 713
777 Ga0466961_0000038 3300044693 Bacteria 80721
778 Ga0466963_0005517 3300044694 Bacteria 7404
779 Ga0466964_0116996 3300044706 Bacteria 1196
780 Ga0453684_0049348 3300044712 Bacteria 5552
781 Ga0466968_0015575 3300044735 Bacteria 3015
782 Ga0466968_0193226 3300044735 Bacteria 951
783 Ga0466957_0171612 3300044842 Bacteria 1413
784 Ga0466960_0122745 3300044901 Bacteria 1362
785 Ga0466959_0092862 3300045049 Bacteria 2166
786 Ga0466959_0556464 3300045049 Bacteria 773
787 Ga0451576_0520459 3300045051 Bacteria 1250
788 Ga0466967_0108493 3300045976 Bacteria 2547
789 Ga0466967_0358013 3300045976 Bacteria 1413
790 Ga0495617_032547 3300046452 Bacteria 1750
791 Ga0495592_0060008 3300046454 Bacteria 2798
792 Ga0495603_0014382 3300046455 Bacteria 4786
793 Ga0495603_0036781 3300046455 Bacteria 2939
794 Ga0495603_0225587 3300046455 Bacteria 1080
795 Ga0495590_0064242 3300046457 Bacteria 1284
796 Ga0495590_0150170 3300046457 Bacteria 844
797 Ga0495629_0003217 3300046459 Bacteria 12360
798 Ga0495629_0080045 3300046459 Bacteria 2281
799 Ga0495629_0122411 3300046459 Bacteria 1812
800 Ga0495638_0006201 3300046460 Bacteria 8735
801 Ga0495638_0145928 3300046460 Bacteria 1376
802 Ga0495651_0070309 3300046462 Bacteria 2663
803 Ga0495651_0220773 3300046462 Bacteria 1312
804 Ga0495653_0012009 3300046463 Bacteria 7070
805 Ga0495650_0055372 3300046471 Bacteria 1614
806 Ga0495580_0264567 3300046472 Bacteria 1176
807 Ga0495582_0036696 3300046473 Bacteria 2696
808 Ga0495582_0520540 3300046473 Bacteria 688
809 Ga0495605_0129610 3300046474 Bacteria 1138
810 Ga0495639_0078334 3300046475 Bacteria 1536
811 Ga0495639_0381587 3300046475 Bacteria 710
812 Ga0495662_0077741 3300046476 Bacteria 1612
813 Ga0495662_0249246 3300046476 Bacteria 875
814 Ga0495664_0418600 3300046477 Bacteria 804
815 Ga0495584_0042216 3300046491 Bacteria 2302
816 Ga0495585_0173204 3300046492 Bacteria 1113
817 Ga0495585_0175924 3300046492 Bacteria 1103
818 Ga0495594_0012205 3300046499 Bacteria 4474
819 Ga0495594_0085371 3300046499 Bacteria 1766
820 Ga0495594_0089078 3300046499 Bacteria 1728
821 Ga0495594_0126312 3300046499 Bacteria 1447
822 Ga0495606_0046966 3300046507 Bacteria 2850
823 Ga0495606_0332008 3300046507 Bacteria 813
824 Ga0495608_0242533 3300046511 Bacteria 1125
825 Ga0495610_0044603 3300046512 Bacteria 2200
826 Ga0495616_0009944 3300046513 Bacteria 5528
827 Ga0495616_0034535 3300046513 Bacteria 2626
828 Ga0495616_0049017 3300046513 Bacteria 2119
829 Ga0495618_0003822 3300046514 Bacteria 9319
830 Ga0495620_0132633 3300046515 Bacteria 977
831 Ga0495628_0070333 3300046516 Bacteria 2728
832 Ga0495630_0170225 3300046517 Bacteria 1659
833 Ga0495630_0573235 3300046517 Bacteria 865
834 Ga0495631_0053605 3300046518 Bacteria 1760
835 Ga0495631_0273399 3300046518 Bacteria 719
836 Ga0495632_0124516 3300046519 Bacteria 1202
837 Ga0495632_0134778 3300046519 Bacteria 1148
838 Ga0495644_0032007 3300046523 Bacteria 1988
839 Ga0495648_0004153 3300046524 Bacteria 12451
840 Ga0495648_0061772 3300046524 Bacteria 2223
841 Ga0495648_0099316 3300046524 Bacteria 1611
842 Ga0495663_0143268 3300046525 Bacteria 812
843 Ga0495642_0309020 3300046528 Bacteria 693
844 Ga0495652_0035676 3300046529 Bacteria 4327
845 Ga0495652_0100750 3300046529 Bacteria 2342
846 Ga0495665_0277532 3300046531 Bacteria 860
847 Ga0495640_0025473 3300046533 Bacteria 4290
848 Ga0495640_0206206 3300046533 Bacteria 1244
849 Ga0495586_0179880 3300046535 Bacteria 1196
850 Ga0495587_0032723 3300046536 Bacteria 3141
851 Ga0495609_0069177 3300046538 Bacteria 1552
852 Ga0495621_0032826 3300046539 Bacteria 1787
853 Ga0495621_0038579 3300046539 Bacteria 1667
854 Ga0495621_0107673 3300046539 Bacteria 1066
855 Ga0495645_0009636 3300046543 Bacteria 6753
856 Ga0495622_0030649 3300046557 Bacteria 2513
857 Ga0495633_0054492 3300046558 Bacteria 1881
858 Ga0495633_0328782 3300046558 Bacteria 693
859 Ga0495667_0056479 3300046559 Bacteria 2581
860 Ga0495656_0012617 3300046615 Bacteria 3123
861 Ga0495656_0095704 3300046615 Bacteria 1365
862 Ga0495656_0271051 3300046615 Bacteria 862
863 Ga0495668_0022682 3300046616 Bacteria 3586
864 Ga0495634_0078269 3300046642 Bacteria 2166
865 Ga0495611_0032629 3300046648 Bacteria 2296
866 Ga0495625_0363691 3300046660 Bacteria 911
867 Ga0495635_0032410 3300046663 Bacteria 3625
868 Ga0495659_0039206 3300046664 Bacteria 1684
869 Ga0495659_0133284 3300046664 Bacteria 986
870 Ga0495657_0033593 3300046675 Bacteria 3570
871 Ga0495599_0009127 3300046678 Bacteria 6048
872 Ga0495623_0058918 3300046679 Bacteria 2413
873 Ga0495623_0286858 3300046679 Bacteria 914
874 Ga0495646_0026126 3300046680 Bacteria 3668
875 Ga0495647_0002647 3300046681 Bacteria 5681
876 Ga0495647_0044199 3300046681 Bacteria 1708
877 Ga0495658_0004054 3300046683 Bacteria 7217
878 Ga0495669_0107138 3300046684 Bacteria 1302
879 Ga0495613_0344836 3300046689 Bacteria 1024
880 Ga0495624_0215782 3300046690 Bacteria 1164
881 Ga0495624_0271506 3300046690 Bacteria 1024
882 Ga0495670_0116972 3300046691 Bacteria 1383
883 Ga0495671_0039889 3300046692 Bacteria 2369
884 Ga0495671_0071158 3300046692 Bacteria 1709
885 Ga0495671_0123247 3300046692 Bacteria 1264
886 Ga0495649_0201124 3300046694 Bacteria 1034
887 Ga0495589_0059202 3300046794 Bacteria 1883
888 Ga0495600_0033714 3300046809 Bacteria 3323
889 Ga0495600_0174090 3300046809 Bacteria 1388
890 Ga0495600_0174770 3300046809 Bacteria 1385
891 Ga0495660_0201389 3300046810 Bacteria 950
892 Ga0495581_0004461 3300047315 Bacteria 8093
893 Ga0495581_0194874 3300047315 Bacteria 1185
894 Ga0495581_0194930 3300047315 Bacteria 1185
895 Ga0495581_0342323 3300047315 Bacteria 873
896 Ga0495604_0013959 3300047317 Bacteria 6406
897 Ga0495604_0016857 3300047317 Bacteria 5841
898 Ga0495674_0024247 3300047319 Bacteria 5577
899 Ga0495674_0063302 3300047319 Bacteria 3218
900 Ga0495680_0071472 3300047322 Bacteria 2642
901 Ga0495683_0094403 3300047323 Bacteria 1445
902 Ga0495687_173467 3300047443 Bacteria 711
903 Ga0495675_0014638 3300047444 Bacteria 4955
904 Ga0495677_0125732 3300047445 Bacteria 979
905 Ga0495679_065519 3300047446 Bacteria 1057
906 Ga0495673_0120654 3300047469 Bacteria 1039
907 Ga0495684_0087827 3300047471 Bacteria 2356
908 Ga0495684_0095441 3300047471 Bacteria 2251
909 Ga0495686_0071106 3300047472 Bacteria 2143
910 Ga0495686_0256771 3300047472 Bacteria 980
911 Ga0495686_0259194 3300047472 Bacteria 974
912 Ga0495602_0096785 3300048088 Bacteria 2433
913 Ga0495626_0067254 3300048091 Bacteria 1619
914 Ga0496100_0007662 3300048903 Bacteria 5973
915 Ga0496100_0086541 3300048903 Bacteria 2129
916 Ga0496100_0233105 3300048903 Bacteria 1355
917 Ga0496100_0693935 3300048903 Bacteria 794
918 Ga0496100_0891295 3300048903 Bacteria 698
919 Ga0496101_0249292 3300048904 Bacteria 1383
920 Ga0496101_0406347 3300048904 Bacteria 1073
921 Ga0496102_0003526 3300048905 Bacteria 13263
922 Ga0496102_0006768 3300048905 Bacteria 9781
923 Ga0496102_0027968 3300048905 Bacteria 5038
924 Ga0496102_0028322 3300048905 Bacteria 5003
925 Ga0496102_0098561 3300048905 Bacteria 2712
926 Ga0496102_0171580 3300048905 Bacteria 2042
927 Ga0496102_0239702 3300048905 Bacteria 1710
928 Ga0496102_0586218 3300048905 Bacteria 1038
929 Ga0496102_0703959 3300048905 Bacteria 933
930 Ga0496103_0036969 3300048906 Bacteria 2991
931 Ga0496103_0307970 3300048906 Bacteria 1019
932 Ga0496104_0006629 3300048907 Bacteria 10188
933 Ga0496104_0008661 3300048907 Bacteria 9052
934 Ga0496104_0046639 3300048907 Bacteria 4081
935 Ga0496104_0055336 3300048907 Bacteria 3751
936 Ga0496104_0104315 3300048907 Bacteria 2716
937 Ga0496104_0125604 3300048907 Bacteria 2463
938 Ga0496104_0301067 3300048907 Bacteria 1516
939 Ga0496105_0014118 3300048908 Bacteria 6355
940 Ga0496105_0025056 3300048908 Bacteria 4851
941 Ga0496105_0025338 3300048908 Bacteria 4828
942 Ga0496105_0060696 3300048908 Bacteria 3120
943 Ga0496105_0254629 3300048908 Bacteria 1421
944 Ga0496105_0265153 3300048908 Bacteria 1388
945 Ga0496106_0027981 3300048909 Bacteria 4197
946 Ga0496106_0044425 3300048909 Bacteria 3335
947 Ga0496106_0164563 3300048909 Bacteria 1755
948 Ga0496107_0089106 3300048910 Bacteria 2253
949 Ga0496107_0179865 3300048910 Bacteria 1570
950 Ga0496107_0305294 3300048910 Bacteria 1184
951 Ga0496108_0004162 3300048911 Bacteria 11640
952 Ga0496108_0050833 3300048911 Bacteria 3471
953 Ga0496108_0059885 3300048911 Bacteria 3202
954 Ga0496108_0187419 3300048911 Bacteria 1792
955 Ga0496108_0634814 3300048911 Bacteria 929
956 Ga0496109_0181886 3300048912 Bacteria 1975
957 Ga0496109_0252924 3300048912 Bacteria 1659
958 Ga0496109_0280158 3300048912 Bacteria 1571
959 Ga0496110_0005115 3300048913 Bacteria 10244
960 Ga0496110_0024513 3300048913 Bacteria 5141
961 Ga0496110_0032862 3300048913 Bacteria 4485
962 Ga0496110_0311556 3300048913 Bacteria 1433
963 Ga0496110_0544127 3300048913 Bacteria 1055
964 Ga0496111_0039965 3300048914 Bacteria 3365
965 Ga0496111_0052523 3300048914 Bacteria 2943
966 Ga0496111_0189177 3300048914 Bacteria 1530
967 Ga0496112_0107232 3300048915 Bacteria 2763
968 Ga0496112_0154174 3300048915 Bacteria 2264
969 Ga0496112_0173687 3300048915 Bacteria 2120
970 Ga0496112_0173955 3300048915 Bacteria 2118
971 Ga0496112_0254038 3300048915 Bacteria 1708
972 Ga0496112_0950647 3300048915 Bacteria 780
973 Ga0496113_0039679 3300048916 Bacteria 3467
974 Ga0496113_0052398 3300048916 Bacteria 3047
975 Ga0496113_0053908 3300048916 Bacteria 3008
976 Ga0496113_0071006 3300048916 Bacteria 2648
977 Ga0496113_0087561 3300048916 Bacteria 2395
978 Ga0496113_0119470 3300048916 Bacteria 2059
979 Ga0496114_0053872 3300048917 Bacteria 3353
980 Ga0496114_0079601 3300048917 Bacteria 2766
981 Ga0496114_0269417 3300048917 Bacteria 1500
982 Ga0496114_0280522 3300048917 Bacteria 1469
983 Ga0496114_0287607 3300048917 Bacteria 1450
984 Ga0496115_0011990 3300048918 Bacteria 6514
985 Ga0496115_0034188 3300048918 Bacteria 4017
986 Ga0496115_0055461 3300048918 Bacteria 3183
987 Ga0496115_0064825 3300048918 Bacteria 2950
988 Ga0496115_0072699 3300048918 Bacteria 2790
989 Ga0496115_0121595 3300048918 Bacteria 2149
990 Ga0496115_0440391 3300048918 Bacteria 1054
991 Ga0496116_0007877 3300048919 Bacteria 9349
992 Ga0496116_0063979 3300048919 Bacteria 2366
993 Ga0496116_0183766 3300048919 Bacteria 1116
994 Ga0496117_0109010 3300048920 Bacteria 1730
995 Ga0496118_0024256 3300048921 Bacteria 5243
996 Ga0496118_0083713 3300048921 Bacteria 2229
997 Ga0496118_0105697 3300048921 Bacteria 1886
998 Ga0496118_0327868 3300048921 Bacteria 827
999 Ga0496118_0373546 3300048921 Bacteria 751
1000 Ga0496119_0055595 3300048922 Bacteria 2403
1001 Ga0496119_0076439 3300048922 Bacteria 1943
1002 Ga0496119_0196340 3300048922 Bacteria 1048
1003 Ga0496119_0208447 3300048922 Bacteria 1007
1004 Ga0496120_0008444 3300048923 Bacteria 7475
1005 Ga0496120_0030923 3300048923 Bacteria 3248
1006 Ga0496121_0000594 3300048924 Bacteria 67953
1007 Ga0496121_0002279 3300048924 Bacteria 29850
1008 Ga0496121_0016133 3300048924 Bacteria 7740
1009 Ga0496121_0032438 3300048924 Bacteria 4746
1010 Ga0496121_0038456 3300048924 Bacteria 4237
1011 Ga0496121_0099176 3300048924 Bacteria 2252
1012 Ga0496121_0208639 3300048924 Bacteria 1386
1013 Ga0496121_0227288 3300048924 Bacteria 1309
1014 Ga0496121_0372853 3300048924 Bacteria 944
1015 Ga0496121_0563375 3300048924 Bacteria 710
1016 Ga0496124_0136426 3300048927 Bacteria 1942
1017 Ga0496126_0004957 3300048929 Bacteria 15524
1018 Ga0496126_0052922 3300048929 Bacteria 3686
1019 Ga0496126_0106575 3300048929 Bacteria 2446
1020 Ga0496126_0109051 3300048929 Bacteria 2413
1021 Ga0496126_0137333 3300048929 Bacteria 2107
1022 Ga0496126_0192896 3300048929 Bacteria 1724
1023 Ga0496126_0193712 3300048929 Bacteria 1720
1024 Ga0496126_0247466 3300048929 Bacteria 1487
1025 Ga0496126_0365535 3300048929 Bacteria 1177
1026 Ga0496126_0492859 3300048929 Bacteria 980
1027 Ga0496126_0557927 3300048929 Bacteria 908
1028 Ga0496126_0613170 3300048929 Bacteria 856
1029 Ga0495682_0125547 3300049460 Bacteria 918
1030 Ga0501031_0000268 3300049568 Bacteria 29430
1031 Ga0501032_0000765 3300049569 Bacteria 26091
1032 Ga0501032_0324914 3300049569 Bacteria 992
1033 Ga0501033_0000095 3300049570 Bacteria 84522
1034 Ga0501033_0000344 3300049570 Bacteria 44238
1035 Ga0501034_0000100 3300049571 Bacteria 159536
1036 Ga0501034_0002052 3300049571 Bacteria 25285
1037 Ga0501036_0000007 3300049572 Bacteria 240500
1038 Ga0501036_0000228 3300049572 Bacteria 37800
1039 Ga0501037_0000109 3300049573 Bacteria 77490
1040 Ga0501037_0002522 3300049573 Bacteria 13227
1041 Ga0501038_0000028 3300049574 Bacteria 144481
1042 Ga0501038_0000350 3300049574 Bacteria 39547
1043 Ga0501038_0259222 3300049574 Bacteria 1375
1044 Ga0501038_0275878 3300049574 Bacteria 1324
1045 Ga0501039_0000005 3300049575 Bacteria 295471
1046 Ga0501039_0092091 3300049575 Bacteria 2362
1047 Ga0501039_0330699 3300049575 Bacteria 1197
1048 Ga0501040_0386338 3300049576 Bacteria 1004
1049 Ga0501042_0158164 3300049578 Bacteria 1634
1050 Ga0501042_0379922 3300049578 Bacteria 1023
1051 Ga0501043_0000085 3300049579 Bacteria 83544
1052 Ga0501043_0000122 3300049579 Bacteria 71952
1053 Ga0501046_0000032 3300049580 Bacteria 180265
1054 Ga0501046_0000426 3300049580 Bacteria 42186
1055 Ga0501047_0000077 3300049581 Bacteria 123480
1056 Ga0501047_0000493 3300049581 Bacteria 42827
1057 Ga0501048_0000233 3300049582 Bacteria 36758
1058 Ga0501048_0004655 3300049582 Bacteria 10441
1059 Ga0501048_0524613 3300049582 Bacteria 849
1060 Ga0501067_0000384 3300049583 Bacteria 24036
1061 Ga0501067_0009253 3300049583 Bacteria 5456
1062 Ga0501068_0003858 3300049584 Bacteria 8138
1063 Ga0501068_0090889 3300049584 Bacteria 1883
1064 Ga0501069_0006612 3300049585 Bacteria 6064
1065 Ga0501069_0032838 3300049585 Bacteria 2857
1066 Ga0501069_0485801 3300049585 Bacteria 736
1067 Ga0501070_0000152 3300049586 Bacteria 63679
1068 Ga0501070_0001419 3300049586 Bacteria 21462
1069 Ga0501072_0001233 3300049588 Bacteria 19088
1070 Ga0501072_0028477 3300049588 Bacteria 4362
1071 Ga0501073_0001343 3300049589 Bacteria 18116
1072 Ga0501073_0041571 3300049589 Bacteria 3248
1073 Ga0501074_0000094 3300049590 Bacteria 42565
1074 Ga0501074_0009987 3300049590 Bacteria 6893
1075 Ga0501079_0002879 3300049741 Bacteria 12559
1076 Ga0501079_0072469 3300049741 Bacteria 2662
1077 Ga0501079_0556759 3300049741 Bacteria 902
1078 Ga0501080_0006214 3300049742 Bacteria 10717
1079 Ga0501080_0258797 3300049742 Bacteria 1586
1080 Ga0501083_0046583 3300049744 Bacteria 2931
1081 Ga0501035_0000016 3300049822 Bacteria 243412
1082 Ga0501035_0000496 3300049822 Bacteria 44296
1083 Ga0501035_0099379 3300049822 Bacteria 2554
1084 Ga0501035_0403006 3300049822 Bacteria 1138
1085 Ga0501044_0000970 3300049823 Bacteria 34530
1086 Ga0501044_0002765 3300049823 Bacteria 19972
1087 Ga0501044_0469149 3300049823 Bacteria 1163
1088 Ga0501045_0027447 3300049824 Bacteria 4103
1089 nmdc:mga03n38_196479_c1 3300050490 Bacteria 1042
1090 nmdc:mga03n38_22431_c1 3300050490 Bacteria 2555
1091 nmdc:mga03n38_4949_c1 3300050490 Bacteria 3307
1092 nmdc:mga0yw44_234994_c1 3300050492 Bacteria 1217
1093 nmdc:mga0yw44_31057_c1 3300050492 Bacteria 3103
1094 nmdc:mga0yw44_41674_c1 3300050492 Bacteria 2734
1095 nmdc:mga0yw44_7001_c1 3300050492 Bacteria 5513
1096 nmdc:mga0k408_119055_c1 3300050493 Bacteria 1563
1097 nmdc:mga06z11_149473_c1 3300050494 Bacteria 1327
1098 nmdc:mga06z11_338738_c1 3300050494 Bacteria 899
1099 nmdc:mga07m45_128707_c1 3300050496 Bacteria 1465
1100 nmdc:mga07m45_142599_c1 3300050496 Bacteria 1388
1101 nmdc:mga07m45_194617_c1 3300050496 Bacteria 1179
1102 nmdc:mga07m45_44437_c1 3300050496 Bacteria 2493
1103 nmdc:mga05p37_252921_c1 3300050507 Bacteria 2112
1104 nmdc:mga09592_645214_c1 3300050508 Bacteria 904
1105 nmdc:mga08y16_153990_c1 3300050511 Bacteria 2389
1106 nmdc:mga08y16_289648_c1 3300050511 Bacteria 1688
1107 nmdc:mga0n895_409200_c1 3300050512 Bacteria 1372
1108 nmdc:mga0n895_419144_c1 3300050512 Bacteria 1353
1109 nmdc:mga0n895_95087_c1 3300050512 Bacteria 2984
1110 nmdc:mga0rr50_526043_c1 3300050513 Bacteria 1006
1111 nmdc:mga0rr50_779384_c1 3300050513 Bacteria 816
1112 nmdc:mga0rr50_8902_c1 3300050513 Bacteria 6271
1113 nmdc:mga0sz30_111097_c1 3300050516 Bacteria 1201
1114 nmdc:mga0sz30_154243_c1 3300050516 Bacteria 1017
1115 nmdc:mga0sz30_303075_c1 3300050516 Bacteria 712
1116 nmdc:mga0sz30_49431_c1 3300050516 Bacteria 1781
1117 nmdc:mga0sz30_89818_c1 3300050516 Bacteria 1336
1118 nmdc:mga0sz30_93217_c1 3300050516 Bacteria 1312
1119 Ga0495612_0017319 3300053078 Bacteria 2886
1120 Ga0495612_0126493 3300053078 Bacteria 1102
1121 Ga0495612_0171249 3300053078 Bacteria 951
1122 Ga0500635_0227427 3300053080 Bacteria 729
1123 Ga0495619_0066317 3300053085 Bacteria 2409
1124 Ga0495619_0395754 3300053085 Bacteria 954
1125 Ga0500643_000007 3300053087 Bacteria 462836
1126 Ga0500646_0033663 3300053090 Bacteria 1419
1127 Ga0500647_0010677 3300053091 Bacteria 4072
1128 Ga0500651_0007614 3300053093 Bacteria 6333
1129 Ga0500566_0000732 3300053094 Bacteria 18439
1130 Ga0500566_0008320 3300053094 Bacteria 6135
1131 Ga0500640_102910 3300053095 Bacteria 1177
1132 Ga0500641_0059206 3300053096 Bacteria 1592
1133 Ga0500641_0088154 3300053096 Bacteria 1323
1134 Ga0500650_0040373 3300053098 Bacteria 2153
1135 Ga0500650_0238861 3300053098 Bacteria 818
1136 Ga0500554_063818 3300053102 Bacteria 1187
1137 Ga0500555_001232 3300053103 Bacteria 8233
1138 Ga0500555_018189 3300053103 Bacteria 2026
1139 Ga0500562_004298 3300053108 Bacteria 3605
1140 Ga0500562_015137 3300053108 Bacteria 1978
1141 Ga0500592_031538 3300053116 Bacteria 855
1142 Ga0500594_0003422 3300053118 Bacteria 3482
1143 Ga0500595_000932 3300053119 Bacteria 16564
1144 Ga0500595_002620 3300053119 Bacteria 8759
1145 Ga0500595_004781 3300053119 Bacteria 6001
1146 Ga0500595_007598 3300053119 Bacteria 4488
1147 Ga0500595_008465 3300053119 Bacteria 4198
1148 Ga0500595_032345 3300053119 Bacteria 1747
1149 Ga0500597_128310 3300053120 Bacteria 1097
1150 Ga0500608_051069 3300053122 Bacteria 1986
1151 Ga0500614_082112 3300053123 Bacteria 904
1152 Ga0500617_075353 3300053124 Bacteria 1471
1153 Ga0500642_0031165 3300053130 Bacteria 2226
1154 Ga0500652_001387 3300053131 Bacteria 7555
1155 Ga0500658_0067985 3300053134 Bacteria 1497
1156 Ga0500559_0000066 3300053136 Bacteria 84664
1157 Ga0500559_0218023 3300053136 Bacteria 900
1158 Ga0500568_0004322 3300053139 Bacteria 7622
1159 Ga0500568_0010375 3300053139 Bacteria 4367
1160 Ga0500568_0014447 3300053139 Bacteria 3565
1161 Ga0500577_0000062 3300053142 Bacteria 24421
1162 Ga0500589_022305 3300053147 Bacteria 2911
1163 Ga0500590_210597 3300053148 Bacteria 812
1164 Ga0500603_005970 3300053150 Bacteria 2637
1165 Ga0500604_0019850 3300053151 Bacteria 1886
1166 Ga0500616_0068866 3300053153 Bacteria 1811
1167 Ga0500622_0216135 3300053156 Bacteria 862
1168 Ga0500627_0148666 3300053158 Bacteria 1058
1169 Ga0500634_0074912 3300053161 Bacteria 1761
1170 Ga0500634_0080054 3300053161 Bacteria 1686
1171 Ga0500638_014840 3300053162 Bacteria 3561
1172 Ga0500638_238907 3300053162 Bacteria 740
1173 Ga0500639_080010 3300053163 Bacteria 1648
1174 Ga0500636_0002347 3300053177 Bacteria 10501
1175 Ga0500636_0028744 3300053177 Bacteria 3283
1176 Ga0500636_0119412 3300053177 Bacteria 1480
1177 Ga0500637_0000132 3300053178 Bacteria 27236
1178 Ga0500637_0010848 3300053178 Bacteria 4686
1179 Ga0500637_0074211 3300053178 Bacteria 1959
1180 Ga0500625_003709 3300053729 Bacteria 6095
1181 Ga0500552_005220 3300053733 Bacteria 1406
1182 Ga0500599_000415 3300053736 Bacteria 4359
1183 Ga0501084_0241325 3300054114 Bacteria 1525
1184 Ga0500661_000757 3300055283 Bacteria 6057
1185 Ga0501082_0000452 3300060353 Bacteria 36318

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0099316 Ga0495648_0099316_393_980 174
2 3300046459 Ga0495629_0003217 Ga0495629_0003217_10126_10695 177
3 3300005843 Ga0068860_100727792 Ga0068860_1007277921 181
4 3300009148 Ga0105243_10195973 Ga0105243_101959732 182
5 3300013297 Ga0157378_10026219 Ga0157378_100262192 182
6 3300013306 Ga0163162_10035074 Ga0163162_100350742 182
7 3300013308 Ga0157375_10730970 Ga0157375_107309702 182
8 3300014326 Ga0157380_10010841 Ga0157380_100108412 182
9 3300014968 Ga0157379_10033015 Ga0157379_100330154 182
10 3300035695 Ga0373927_0267854 Ga0373927_0267854_69_632 182
11 3300037068 Ga0373925_0006190 Ga0373925_0006190_2425_2988 182
12 iso_pu_bacteria 8057132660 8057134976 184
13 iso_pu_bacteria 2524023205 2524437741 186
14 iso_pu_bacteria 2744054633 2745074851 186
15 iso_pu_bacteria 2876761206 2876764963 186
16 3300037471 Ga0395905_0092718 Ga0395905_0092718_1021_1596 187
17 3300046499 Ga0495594_0085371 Ga0495594_0085371_244_807 187
18 iso_pu_bacteria 2507262055 2507508216 187
19 iso_pu_bacteria 2508501042 2508691953 187
20 iso_pu_bacteria 2513237094 2513640522 187
21 iso_pu_bacteria 2513237141 2513890024 187
22 iso_pu_bacteria 2515154112 2515627278 187
23 iso_pu_bacteria 2721755755 2723846532 187
24 iso_pu_bacteria 2824696289 2824697119 187
25 iso_pu_bacteria 2844315083 2844319413 187
26 iso_pu_bacteria 2847939898 2847946933 187
27 iso_pu_bacteria 2849076700 2849078956 187
28 iso_pu_bacteria 2855020534 2855022684 187
29 iso_pu_bacteria 2874590934 2874598414 187
30 iso_pu_bacteria 2874645413 2874652531 187
31 iso_pu_bacteria 2876771140 2876778108 187
32 iso_pu_bacteria 2876818435 2876826023 187
33 iso_pu_bacteria 2879074833 2879081902 187
34 iso_pu_bacteria 2879127579 2879135024 187
35 iso_pu_bacteria 2879142872 2879149709 187
36 iso_pu_bacteria 2885409591 2885413309 187
37 iso_pu_bacteria 2891633521 2891635224 187
38 iso_pu_bacteria 2903727486 2903734355 187
39 iso_pu_bacteria 2906602504 2906605599 187
40 iso_pu_bacteria 2932794094 2932797990 187
41 iso_pu_bacteria 2932801729 2932807168 187
42 iso_pu_bacteria 2935883170 2935886717 187
43 iso_pu_bacteria 2935908558 2935908733 187
44 iso_pu_bacteria 2935916978 2935917878 187
45 iso_pu_bacteria 2935926038 2935926693 187
46 iso_pu_bacteria 2935934488 2935935143 187
47 iso_pu_bacteria 2935942939 2935943593 187
48 iso_pu_bacteria 2935951376 2935952031 187
49 iso_pu_bacteria 2935967501 2935968156 187
50 iso_pu_bacteria 2935975950 2935978772 187
51 iso_pu_bacteria 2941531003 2941533185 187
52 iso_pu_bacteria 3005594810 3005599614 187
53 iso_pu_bacteria 3005710791 3005715271 187
54 iso_pu_bacteria 3005718088 3005722652 187
55 iso_pu_bacteria 8019619141 8019628581 187
56 iso_pu_bacteria 8019629233 8019634055 187
57 iso_pu_bacteria 8019638758 8019645674 187
58 iso_pu_bacteria 8019648815 8019658937 187
59 iso_pu_bacteria 8019659431 8019661935 187
60 iso_pu_bacteria 8019668869 8019671457 187
61 iso_pu_bacteria 8019678201 8019684647 187
62 iso_pu_bacteria 8019687851 8019690469 187
63 iso_pu_bacteria 8056967851 8056968405 187
64 3300005330 Ga0070690_100002084 Ga0070690_1000020844 188
65 3300005335 Ga0070666_10055893 Ga0070666_100558932 188
66 3300005544 Ga0070686_100020725 Ga0070686_1000207252 188
67 3300005547 Ga0070693_100318695 Ga0070693_1003186952 188
68 3300005578 Ga0068854_100134775 Ga0068854_1001347751 188
69 3300005615 Ga0070702_100639692 Ga0070702_1006396921 188
70 3300005719 Ga0068861_100059899 Ga0068861_1000598992 188
71 3300006871 Ga0075434_100393898 Ga0075434_1003938981 188
72 3300007076 Ga0075435_100022344 Ga0075435_1000223444 188
73 3300009174 Ga0105241_10277950 Ga0105241_102779502 188
74 3300025903 Ga0207680_10011092 Ga0207680_100110924 188
75 3300025911 Ga0207654_10217514 Ga0207654_102175142 188
76 3300026075 Ga0207708_10773519 Ga0207708_107735191 188
77 3300048907 Ga0496104_0046639 Ga0496104_0046639_2882_3457 188
78 3300048909 Ga0496106_0044425 Ga0496106_0044425_383_949 188
79 3300049576 Ga0501040_0386338 Ga0501040_0386338_381_953 188
80 3300049578 Ga0501042_0158164 Ga0501042_0158164_540_1112 188
81 3300050512 nmdc:mga0n895_95087_c1 nmdc:mga0n895_95087_c1_1737_2303 188
82 3300050513 nmdc:mga0rr50_8902_c1 nmdc:mga0rr50_8902_c1_3960_4526 188
83 iso_pu_bacteria 2511231028 2511397528 188
84 iso_pu_bacteria 2513237092 2513622345 188
85 iso_pu_bacteria 2513237095 2513645440 188
86 iso_pu_bacteria 2513237098 2513676595 188
87 iso_pu_bacteria 2513237102 2513701724 188
88 iso_pu_bacteria 2513237104 2513718388 188
89 iso_pu_bacteria 2517093001 2517102619 188
90 iso_pu_bacteria 2643221651 2644288903 188
91 iso_pu_bacteria 2791355199 2793079936 188
92 iso_pu_bacteria 2824617872 2824618117 188
93 iso_pu_bacteria 2824626560 2824626785 188
94 iso_pu_bacteria 2824635225 2824636580 188
95 iso_pu_bacteria 2824644064 2824645114 188
96 iso_pu_bacteria 2824661429 2824661599 188
97 iso_pu_bacteria 2824679649 2824679871 188
98 iso_pu_bacteria 2824714736 2824720408 188
99 iso_pu_bacteria 2824723954 2824729458 188
100 iso_pu_bacteria 2824732956 2824734597 188
101 iso_pu_bacteria 2841957949 2841960983 188
102 iso_pu_bacteria 2874604998 2874605548 188
103 iso_pu_bacteria 2874612657 2874619370 188
104 iso_pu_bacteria 2874628541 2874632276 188
105 iso_pu_bacteria 2879099564 2879108353 188
106 iso_pu_bacteria 2881364244 2881368459 188
107 iso_pu_bacteria 2881665667 2881672525 188
108 iso_pu_bacteria 2888378607 2888384482 188
109 iso_pu_bacteria 2888388044 2888393424 188
110 iso_pu_bacteria 2889033259 2889039403 188
111 iso_pu_bacteria 2893066018 2893068695 188
112 iso_pu_bacteria 2906626472 2906627155 188
113 iso_pu_bacteria 2922361189 2922365738 188
114 iso_pu_bacteria 2922368715 2922374899 188
115 iso_pu_bacteria 2922386360 2922391308 188
116 iso_pu_bacteria 2922393267 2922400420 188
117 iso_pu_bacteria 2929615660 2929621941 188
118 iso_pu_bacteria 2929624759 2929629752 188
119 iso_pu_bacteria 2932809354 2932812781 188
120 iso_pu_bacteria 2932818245 2932819127 188
121 iso_pu_bacteria 2933577622 2933583784 188
122 iso_pu_bacteria 2935675223 2935675839 188
123 iso_pu_bacteria 2935684952 2935685836 188
124 iso_pu_bacteria 2935713505 2935714388 188
125 iso_pu_bacteria 2935722832 2935725007 188
126 iso_pu_bacteria 2935732158 2935732634 188
127 iso_pu_bacteria 2935741537 2935742013 188
128 iso_pu_bacteria 2935750917 2935751801 188
129 iso_pu_bacteria 2935760218 2935765058 188
130 iso_pu_bacteria 2935769743 2935771672 188
131 iso_pu_bacteria 2935777560 2935778913 188
132 iso_pu_bacteria 2935785616 2935791166 188
133 iso_pu_bacteria 2935793552 2935795505 188
134 iso_pu_bacteria 2940556831 2940557396 188
135 iso_pu_bacteria 3005483717 3005484665 188
136 iso_pu_bacteria 3005587118 3005587684 188
137 iso_pu_bacteria 8006964411 8006972432 188
138 iso_pu_bacteria 8016530956 8016534437 188
139 iso_pu_bacteria 8016539877 8016547660 188
140 iso_pu_bacteria 8016548790 8016554478 188
141 iso_pu_bacteria 8016566248 8016572779 188
142 iso_pu_bacteria 8016575299 8016576937 188
143 iso_pu_bacteria 8016583857 8016593285 188
144 iso_pu_bacteria 8016603502 8016610113 188
145 iso_pu_bacteria 8016613128 8016614827 188
146 iso_pu_bacteria 8016622563 8016626154 188
147 iso_pu_bacteria 8019530166 8019534199 188
148 iso_pu_bacteria 8019538911 8019545262 188
149 iso_pu_bacteria 8019547302 8019553251 188
150 iso_pu_bacteria 8055742211 8055745894 188
151 iso_pu_bacteria 8056673599 8056677707 188
152 iso_pu_bacteria 8056681323 8056689243 188
153 3300005614 Ga0068856_100054733 Ga0068856_1000547334 189
154 3300014497 Ga0182008_10206915 Ga0182008_102069152 189
155 3300025913 Ga0207695_10272263 Ga0207695_102722632 189
156 3300026078 Ga0207702_10051226 Ga0207702_100512263 189
157 3300037068 Ga0373925_0465515 Ga0373925_0465515_347_916 189
158 3300046472 Ga0495580_0264567 Ga0495580_0264567_338_907 189
159 3300049578 Ga0501042_0379922 Ga0501042_0379922_32_646 189
160 3300053078 Ga0495612_0126493 Ga0495612_0126493_214_783 189
161 iso_pu_bacteria 2899259804 2899259983 189
162 iso_pu_bacteria 2935959822 2935960797 189
163 3300005983 Ga0081540_1009757 Ga0081540_10097573 190
164 3300031456 Ga0307513_10302368 Ga0307513_103023682 190
165 3300048929 Ga0496126_0613170 Ga0496126_0613170_202_783 190
166 3300053142 Ga0500577_0000062 Ga0500577_0000062_18852_19439 190
167 3300003354 JGI25160J50197_1009395 JGI25160J50197_10093953 191
168 3300005330 Ga0070690_100199738 Ga0070690_1001997382 191
169 3300005334 Ga0068869_100047651 Ga0068869_1000476513 191
170 3300005335 Ga0070666_10671631 Ga0070666_106716311 191
171 3300005347 Ga0070668_100290149 Ga0070668_1002901492 191
172 3300005353 Ga0070669_100456600 Ga0070669_1004566002 191
173 3300005356 Ga0070674_100056697 Ga0070674_1000566973 191
174 3300005367 Ga0070667_100561173 Ga0070667_1005611731 191
175 3300005367 Ga0070667_100691833 Ga0070667_1006918331 191
176 3300005434 Ga0070709_10000751 Ga0070709_100007519 191
177 3300005434 Ga0070709_10098062 Ga0070709_100980622 191
178 3300005435 Ga0070714_100001123 Ga0070714_1000011237 191
179 3300005436 Ga0070713_100000647 Ga0070713_10000064715 191
180 3300005439 Ga0070711_100045601 Ga0070711_1000456013 191
181 3300005440 Ga0070705_100716380 Ga0070705_1007163801 191
182 3300005441 Ga0070700_100201951 Ga0070700_1002019512 191
183 3300005455 Ga0070663_100125891 Ga0070663_1001258912 191
184 3300005459 Ga0068867_100010469 Ga0068867_1000104692 191
185 3300005539 Ga0068853_100263706 Ga0068853_1002637062 191
186 3300005545 Ga0070695_100409731 Ga0070695_1004097312 191
187 3300005547 Ga0070693_100311342 Ga0070693_1003113421 191
188 3300005563 Ga0068855_100154198 Ga0068855_1001541983 191
189 3300005577 Ga0068857_100866258 Ga0068857_1008662581 191
190 3300005578 Ga0068854_100086460 Ga0068854_1000864602 191
191 3300005614 Ga0068856_100718182 Ga0068856_1007181821 191
192 3300005616 Ga0068852_100312894 Ga0068852_1003128942 191
193 3300005616 Ga0068852_100991840 Ga0068852_1009918401 191
194 3300005718 Ga0068866_10020376 Ga0068866_100203763 191
195 3300005719 Ga0068861_100006429 Ga0068861_1000064298 191
196 3300005842 Ga0068858_100337981 Ga0068858_1003379812 191
197 3300005843 Ga0068860_100023118 Ga0068860_1000231186 191
198 3300005844 Ga0068862_100014954 Ga0068862_1000149542 191
199 3300006028 Ga0070717_11168232 Ga0070717_111682321 191
200 3300006163 Ga0070715_10013591 Ga0070715_100135913 191
201 3300006173 Ga0070716_100003547 Ga0070716_1000035476 191
202 3300006175 Ga0070712_100152940 Ga0070712_1001529401 191
203 3300006881 Ga0068865_100003720 Ga0068865_1000037203 191
204 3300009093 Ga0105240_11612825 Ga0105240_116128251 191
205 3300009094 Ga0111539_10207315 Ga0111539_102073152 191
206 3300009101 Ga0105247_10074437 Ga0105247_100744373 191
207 3300009174 Ga0105241_10010710 Ga0105241_100107102 191
208 3300009545 Ga0105237_10097240 Ga0105237_100972402 191
209 3300009551 Ga0105238_10538707 Ga0105238_105387072 191
210 3300009553 Ga0105249_10219612 Ga0105249_102196122 191
211 3300013105 Ga0157369_10551805 Ga0157369_105518051 191
212 3300013296 Ga0157374_10157085 Ga0157374_101570853 191
213 3300021384 Ga0213876_10151807 Ga0213876_101518072 191
214 3300025254 Ga0209148_1000500 Ga0209148_100050033 191
215 3300025261 Ga0209233_1008753 Ga0209233_10087534 191
216 3300025261 Ga0209233_1010397 Ga0209233_10103972 191
217 3300025272 Ga0209455_1001381 Ga0209455_10013814 191
218 3300025272 Ga0209455_1014791 Ga0209455_10147912 191
219 3300025297 Ga0209758_1002091 Ga0209758_10020915 191
220 3300025302 Ga0207426_1010515 Ga0207426_10105152 191
221 3300025898 Ga0207692_10005452 Ga0207692_100054521 191
222 3300025899 Ga0207642_10058877 Ga0207642_100588772 191
223 3300025906 Ga0207699_10031838 Ga0207699_100318382 191
224 3300025911 Ga0207654_10007223 Ga0207654_100072232 191
225 3300025915 Ga0207693_10004043 Ga0207693_1000404312 191
226 3300025916 Ga0207663_10000098 Ga0207663_1000009812 191
227 3300025919 Ga0207657_10169532 Ga0207657_101695322 191
228 3300025923 Ga0207681_10208519 Ga0207681_102085192 191
229 3300025929 Ga0207664_10017228 Ga0207664_100172285 191
230 3300025935 Ga0207709_10174249 Ga0207709_101742492 191
231 3300025936 Ga0207670_10422402 Ga0207670_104224022 191
232 3300025938 Ga0207704_10121951 Ga0207704_101219512 191
233 3300025938 Ga0207704_10517648 Ga0207704_105176482 191
234 3300025939 Ga0207665_10000355 Ga0207665_1000035514 191
235 3300025942 Ga0207689_10031264 Ga0207689_100312643 191
236 3300025949 Ga0207667_10097440 Ga0207667_100974402 191
237 3300025949 Ga0207667_10236835 Ga0207667_102368353 191
238 3300025972 Ga0207668_10292329 Ga0207668_102923292 191
239 3300026035 Ga0207703_10140794 Ga0207703_101407942 191
240 3300026078 Ga0207702_10079035 Ga0207702_100790354 191
241 3300026078 Ga0207702_10080745 Ga0207702_100807456 191
242 3300026089 Ga0207648_10002498 Ga0207648_1000249814 191
243 3300026118 Ga0207675_100003157 Ga0207675_1000031578 191
244 3300026118 Ga0207675_100193834 Ga0207675_1001938343 191
245 3300026142 Ga0207698_10183800 Ga0207698_101838002 191
246 3300028380 Ga0268265_10019499 Ga0268265_100194993 191
247 3300028381 Ga0268264_10006431 Ga0268264_100064314 191
248 3300031249 Ga0265339_10101543 Ga0265339_101015431 191
249 3300031711 Ga0265314_10005784 Ga0265314_1000578412 191
250 3300031711 Ga0265314_10075664 Ga0265314_100756642 191
251 3300031712 Ga0265342_10029779 Ga0265342_100297793 191
252 3300031712 Ga0265342_10077859 Ga0265342_100778592 191
253 3300033180 Ga0307510_10060670 Ga0307510_100606704 191
254 3300035724 Ga0373933_0133256 Ga0373933_0133256_762_1343 191
255 3300036401 Ga0373937_0251215 Ga0373937_0251215_52_633 191
256 3300039437 Ga0436365_0905497 Ga0436365_0905497_927_1538 191
257 3300039437 Ga0436365_1149165 Ga0436365_1149165_345_920 191
258 3300039450 Ga0436363_1425212 Ga0436363_1425212_1788_2363 191
259 3300041452 Ga0451793_0066431 Ga0451793_0066431_91_702 191
260 3300044656 Ga0466969_0078556 Ga0466969_0078556_47_625 191
261 3300044684 Ga0466966_0000334 Ga0466966_0000334_4525_5103 191
262 3300044693 Ga0466961_0000038 Ga0466961_0000038_78399_78977 191
263 3300044694 Ga0466963_0005517 Ga0466963_0005517_5488_6075 191
264 3300044706 Ga0466964_0116996 Ga0466964_0116996_513_1100 191
265 3300044735 Ga0466968_0193226 Ga0466968_0193226_254_841 191
266 3300045049 Ga0466959_0092862 Ga0466959_0092862_230_808 191
267 3300045051 Ga0451576_0520459 Ga0451576_0520459_86_691 191
268 3300045976 Ga0466967_0108493 Ga0466967_0108493_1147_1734 191
269 3300045976 Ga0466967_0358013 Ga0466967_0358013_681_1322 191
270 3300046473 Ga0495582_0520540 Ga0495582_0520540_51_653 191
271 3300046507 Ga0495606_0046966 Ga0495606_0046966_285_896 191
272 3300046517 Ga0495630_0573235 Ga0495630_0573235_65_643 191
273 3300046529 Ga0495652_0035676 Ga0495652_0035676_1122_1733 191
274 3300046533 Ga0495640_0206206 Ga0495640_0206206_62_673 191
275 3300046679 Ga0495623_0286858 Ga0495623_0286858_205_783 191
276 3300046690 Ga0495624_0271506 Ga0495624_0271506_128_739 191
277 3300046692 Ga0495671_0123247 Ga0495671_0123247_555_1235 191
278 3300046694 Ga0495649_0201124 Ga0495649_0201124_301_981 191
279 3300046809 Ga0495600_0174090 Ga0495600_0174090_383_994 191
280 3300047317 Ga0495604_0013959 Ga0495604_0013959_601_1212 191
281 3300047471 Ga0495684_0095441 Ga0495684_0095441_36_614 191
282 3300047472 Ga0495686_0256771 Ga0495686_0256771_263_874 191
283 3300048903 Ga0496100_0693935 Ga0496100_0693935_179_754 191
284 3300048904 Ga0496101_0406347 Ga0496101_0406347_97_681 191
285 3300048905 Ga0496102_0171580 Ga0496102_0171580_1058_1642 191
286 3300048905 Ga0496102_0586218 Ga0496102_0586218_396_1016 191
287 3300048907 Ga0496104_0006629 Ga0496104_0006629_5325_5936 191
288 3300048908 Ga0496105_0025338 Ga0496105_0025338_235_846 191
289 3300048911 Ga0496108_0634814 Ga0496108_0634814_286_897 191
290 3300048912 Ga0496109_0181886 Ga0496109_0181886_902_1522 191
291 3300048916 Ga0496113_0039679 Ga0496113_0039679_824_1444 191
292 3300048916 Ga0496113_0053908 Ga0496113_0053908_2248_2859 191
293 3300048917 Ga0496114_0280522 Ga0496114_0280522_632_1210 191
294 3300048918 Ga0496115_0034188 Ga0496115_0034188_1362_1943 191
295 3300048922 Ga0496119_0055595 Ga0496119_0055595_924_1535 191
296 3300048923 Ga0496120_0008444 Ga0496120_0008444_53_664 191
297 3300048924 Ga0496121_0016133 Ga0496121_0016133_41_616 191
298 3300048924 Ga0496121_0208639 Ga0496121_0208639_506_1087 191
299 3300048929 Ga0496126_0137333 Ga0496126_0137333_971_1552 191
300 3300048929 Ga0496126_0192896 Ga0496126_0192896_318_929 191
301 3300048929 Ga0496126_0247466 Ga0496126_0247466_367_942 191
302 3300048929 Ga0496126_0557927 Ga0496126_0557927_145_720 191
303 3300049460 Ga0495682_0125547 Ga0495682_0125547_298_876 191
304 3300053078 Ga0495612_0171249 Ga0495612_0171249_64_639 191
305 3300053085 Ga0495619_0395754 Ga0495619_0395754_76_654 191
306 3300053119 Ga0500595_032345 Ga0500595_032345_111_689 191
307 3300053136 Ga0500559_0218023 Ga0500559_0218023_129_704 191
308 3300053163 Ga0500639_080010 Ga0500639_080010_823_1434 191
309 3300053177 Ga0500636_0028744 Ga0500636_0028744_1403_2023 191
310 3300053733 Ga0500552_005220 Ga0500552_005220_521_1132 191
311 iso_pu_bacteria 2513237139 2513873142 191
312 iso_pu_bacteria 2802429603 2805914959 191
313 3300000549 LJQas_1005748 LJQas_10057481 192
314 3300001989 JGI24739J22299_10004675 JGI24739J22299_100046752 192
315 3300001990 JGI24737J22298_10003599 JGI24737J22298_100035997 192
316 3300001990 JGI24737J22298_10010858 JGI24737J22298_100108583 192
317 3300002067 JGI24735J21928_10003477 JGI24735J21928_100034772 192
318 3300002070 JGI24750J21931_1026045 JGI24750J21931_10260451 192
319 3300003203 JGI25406J46586_10006716 JGI25406J46586_100067166 192
320 3300003215 JGI25153J46596_10004034 JGI25153J46596_100040343 192
321 3300003215 JGI25153J46596_10063189 JGI25153J46596_100631891 192
322 3300003354 JGI25160J50197_1000921 JGI25160J50197_10009214 192
323 3300003659 JGI25404J52841_10026147 JGI25404J52841_100261472 192
324 3300003659 JGI25404J52841_10042784 JGI25404J52841_100427842 192
325 3300003751 Ga0055538_1000019 Ga0055538_100001958 192
326 3300003752 Ga0055539_1000024 Ga0055539_1000024232 192
327 3300003756 Ga0055533_1000032 Ga0055533_100003258 192
328 3300003759 Ga0055525_1000041 Ga0055525_100004158 192
329 3300003841 Ga0055541_1000018 Ga0055541_1000018232 192
330 3300005262 Ga0065165_1007079 Ga0065165_10070792 192
331 3300005262 Ga0065165_1008084 Ga0065165_10080842 192
332 3300005327 Ga0070658_10326807 Ga0070658_103268072 192
333 3300005328 Ga0070676_10040507 Ga0070676_100405072 192
334 3300005328 Ga0070676_10046538 Ga0070676_100465382 192
335 3300005328 Ga0070676_10061229 Ga0070676_100612292 192
336 3300005329 Ga0070683_100020596 Ga0070683_1000205964 192
337 3300005329 Ga0070683_100045726 Ga0070683_1000457262 192
338 3300005329 Ga0070683_100164968 Ga0070683_1001649682 192
339 3300005330 Ga0070690_100123477 Ga0070690_1001234772 192
340 3300005330 Ga0070690_100603217 Ga0070690_1006032171 192
341 3300005331 Ga0070670_100064364 Ga0070670_1000643643 192
342 3300005331 Ga0070670_100117136 Ga0070670_1001171362 192
343 3300005331 Ga0070670_100168447 Ga0070670_1001684471 192
344 3300005331 Ga0070670_100186060 Ga0070670_1001860601 192
345 3300005333 Ga0070677_10079041 Ga0070677_100790411 192
346 3300005334 Ga0068869_100064006 Ga0068869_1000640062 192
347 3300005334 Ga0068869_100182199 Ga0068869_1001821992 192
348 3300005335 Ga0070666_10054453 Ga0070666_100544533 192
349 3300005336 Ga0070680_100118878 Ga0070680_1001188782 192
350 3300005337 Ga0070682_100202331 Ga0070682_1002023312 192
351 3300005337 Ga0070682_101038063 Ga0070682_1010380631 192
352 3300005338 Ga0068868_100002211 Ga0068868_1000022118 192
353 3300005338 Ga0068868_100086295 Ga0068868_1000862953 192
354 3300005338 Ga0068868_100233532 Ga0068868_1002335322 192
355 3300005338 Ga0068868_100315573 Ga0068868_1003155732 192
356 3300005338 Ga0068868_100384892 Ga0068868_1003848922 192
357 3300005339 Ga0070660_100001944 Ga0070660_1000019449 192
358 3300005340 Ga0070689_100785405 Ga0070689_1007854051 192
359 3300005344 Ga0070661_100009779 Ga0070661_1000097794 192
360 3300005344 Ga0070661_100309883 Ga0070661_1003098831 192
361 3300005344 Ga0070661_100844656 Ga0070661_1008446561 192
362 3300005354 Ga0070675_100006484 Ga0070675_1000064847 192
363 3300005354 Ga0070675_100156919 Ga0070675_1001569192 192
364 3300005355 Ga0070671_100004974 Ga0070671_1000049742 192
365 3300005355 Ga0070671_100049969 Ga0070671_1000499692 192
366 3300005355 Ga0070671_100057073 Ga0070671_1000570733 192
367 3300005355 Ga0070671_100101291 Ga0070671_1001012912 192
368 3300005355 Ga0070671_100198119 Ga0070671_1001981192 192
369 3300005355 Ga0070671_100243917 Ga0070671_1002439172 192
370 3300005356 Ga0070674_100039953 Ga0070674_1000399533 192
371 3300005356 Ga0070674_100167957 Ga0070674_1001679572 192
372 3300005364 Ga0070673_100010231 Ga0070673_1000102314 192
373 3300005364 Ga0070673_100439798 Ga0070673_1004397981 192
374 3300005366 Ga0070659_100338807 Ga0070659_1003388071 192
375 3300005367 Ga0070667_100032334 Ga0070667_1000323342 192
376 3300005367 Ga0070667_100104314 Ga0070667_1001043141 192
377 3300005367 Ga0070667_100157499 Ga0070667_1001574992 192
378 3300005367 Ga0070667_100175540 Ga0070667_1001755401 192
379 3300005367 Ga0070667_100216809 Ga0070667_1002168092 192
380 3300005367 Ga0070667_100229731 Ga0070667_1002297312 192
381 3300005367 Ga0070667_100304493 Ga0070667_1003044932 192
382 3300005434 Ga0070709_10320075 Ga0070709_103200752 192
383 3300005436 Ga0070713_101135603 Ga0070713_1011356031 192
384 3300005436 Ga0070713_101299207 Ga0070713_1012992071 192
385 3300005439 Ga0070711_100082879 Ga0070711_1000828792 192
386 3300005439 Ga0070711_100129075 Ga0070711_1001290751 192
387 3300005440 Ga0070705_100413347 Ga0070705_1004133471 192
388 3300005441 Ga0070700_100057018 Ga0070700_1000570183 192
389 3300005441 Ga0070700_100575485 Ga0070700_1005754851 192
390 3300005455 Ga0070663_100039596 Ga0070663_1000395962 192
391 3300005455 Ga0070663_100042935 Ga0070663_1000429352 192
392 3300005455 Ga0070663_100051561 Ga0070663_1000515612 192
393 3300005455 Ga0070663_100221772 Ga0070663_1002217721 192
394 3300005455 Ga0070663_100243363 Ga0070663_1002433632 192
395 3300005455 Ga0070663_100298089 Ga0070663_1002980892 192
396 3300005456 Ga0070678_100006561 Ga0070678_1000065612 192
397 3300005456 Ga0070678_100083683 Ga0070678_1000836834 192
398 3300005456 Ga0070678_100257631 Ga0070678_1002576311 192
399 3300005456 Ga0070678_100574519 Ga0070678_1005745192 192
400 3300005456 Ga0070678_100580568 Ga0070678_1005805681 192
401 3300005456 Ga0070678_100974863 Ga0070678_1009748631 192
402 3300005457 Ga0070662_100195379 Ga0070662_1001953792 192
403 3300005457 Ga0070662_100447894 Ga0070662_1004478942 192
404 3300005458 Ga0070681_10009117 Ga0070681_1000911712 192
405 3300005458 Ga0070681_10059381 Ga0070681_100593813 192
406 3300005459 Ga0068867_100014371 Ga0068867_1000143713 192
407 3300005459 Ga0068867_100103825 Ga0068867_1001038252 192
408 3300005459 Ga0068867_100116656 Ga0068867_1001166562 192
409 3300005459 Ga0068867_100422297 Ga0068867_1004222972 192
410 3300005459 Ga0068867_100490206 Ga0068867_1004902061 192
411 3300005466 Ga0070685_10051976 Ga0070685_100519762 192
412 3300005466 Ga0070685_10084375 Ga0070685_100843751 192
413 3300005468 Ga0070707_100184068 Ga0070707_1001840682 192
414 3300005471 Ga0070698_100258430 Ga0070698_1002584302 192
415 3300005518 Ga0070699_100121433 Ga0070699_1001214332 192
416 3300005518 Ga0070699_100186336 Ga0070699_1001863361 192
417 3300005530 Ga0070679_100477395 Ga0070679_1004773951 192
418 3300005535 Ga0070684_100048525 Ga0070684_1000485252 192
419 3300005535 Ga0070684_100236066 Ga0070684_1002360662 192
420 3300005536 Ga0070697_100058137 Ga0070697_1000581374 192
421 3300005539 Ga0068853_100008723 Ga0068853_1000087238 192
422 3300005539 Ga0068853_100022298 Ga0068853_1000222982 192
423 3300005539 Ga0068853_100035826 Ga0068853_1000358262 192
424 3300005539 Ga0068853_100278905 Ga0068853_1002789052 192
425 3300005539 Ga0068853_100874851 Ga0068853_1008748511 192
426 3300005543 Ga0070672_100004623 Ga0070672_1000046232 192
427 3300005543 Ga0070672_100103124 Ga0070672_1001031242 192
428 3300005543 Ga0070672_100126053 Ga0070672_1001260532 192
429 3300005543 Ga0070672_100196724 Ga0070672_1001967242 192
430 3300005543 Ga0070672_100552692 Ga0070672_1005526922 192
431 3300005544 Ga0070686_100146194 Ga0070686_1001461941 192
432 3300005544 Ga0070686_100271719 Ga0070686_1002717192 192
433 3300005546 Ga0070696_100844130 Ga0070696_1008441301 192
434 3300005547 Ga0070693_100001570 Ga0070693_1000015703 192
435 3300005547 Ga0070693_100230210 Ga0070693_1002302102 192
436 3300005548 Ga0070665_100037219 Ga0070665_1000372192 192
437 3300005548 Ga0070665_100055378 Ga0070665_1000553782 192
438 3300005548 Ga0070665_100194472 Ga0070665_1001944723 192
439 3300005548 Ga0070665_100227881 Ga0070665_1002278812 192
440 3300005548 Ga0070665_100319271 Ga0070665_1003192714 192
441 3300005563 Ga0068855_100017322 Ga0068855_1000173225 192
442 3300005563 Ga0068855_100018996 Ga0068855_1000189962 192
443 3300005563 Ga0068855_100046858 Ga0068855_1000468583 192
444 3300005563 Ga0068855_100083668 Ga0068855_1000836683 192
445 3300005563 Ga0068855_100135272 Ga0068855_1001352723 192
446 3300005563 Ga0068855_100275018 Ga0068855_1002750182 192
447 3300005563 Ga0068855_100768736 Ga0068855_1007687362 192
448 3300005563 Ga0068855_101168479 Ga0068855_1011684791 192
449 3300005564 Ga0070664_100023846 Ga0070664_1000238463 192
450 3300005564 Ga0070664_100257820 Ga0070664_1002578202 192
451 3300005577 Ga0068857_100013666 Ga0068857_1000136663 192
452 3300005577 Ga0068857_100016794 Ga0068857_1000167945 192
453 3300005577 Ga0068857_100025993 Ga0068857_1000259933 192
454 3300005577 Ga0068857_100090271 Ga0068857_1000902714 192
455 3300005577 Ga0068857_100178756 Ga0068857_1001787562 192
456 3300005577 Ga0068857_100377876 Ga0068857_1003778762 192
457 3300005578 Ga0068854_100002059 Ga0068854_1000020595 192
458 3300005578 Ga0068854_100006321 Ga0068854_1000063216 192
459 3300005578 Ga0068854_100016295 Ga0068854_1000162954 192
460 3300005578 Ga0068854_100199620 Ga0068854_1001996203 192
461 3300005614 Ga0068856_100001874 Ga0068856_10000187416 192
462 3300005614 Ga0068856_100029048 Ga0068856_1000290484 192
463 3300005614 Ga0068856_100096583 Ga0068856_1000965832 192
464 3300005614 Ga0068856_100107099 Ga0068856_1001070993 192
465 3300005614 Ga0068856_100257601 Ga0068856_1002576012 192
466 3300005615 Ga0070702_100006992 Ga0070702_1000069924 192
467 3300005615 Ga0070702_100018208 Ga0070702_1000182083 192
468 3300005616 Ga0068852_100011069 Ga0068852_1000110693 192
469 3300005616 Ga0068852_100040373 Ga0068852_1000403733 192
470 3300005616 Ga0068852_100055734 Ga0068852_1000557342 192
471 3300005616 Ga0068852_100104537 Ga0068852_1001045371 192
472 3300005616 Ga0068852_100128249 Ga0068852_1001282493 192
473 3300005616 Ga0068852_100233518 Ga0068852_1002335182 192
474 3300005616 Ga0068852_100455909 Ga0068852_1004559092 192
475 3300005617 Ga0068859_100147451 Ga0068859_1001474513 192
476 3300005617 Ga0068859_100295503 Ga0068859_1002955032 192
477 3300005617 Ga0068859_100645413 Ga0068859_1006454132 192
478 3300005618 Ga0068864_100020059 Ga0068864_1000200596 192
479 3300005618 Ga0068864_100064105 Ga0068864_1000641052 192
480 3300005618 Ga0068864_100365958 Ga0068864_1003659582 192
481 3300005718 Ga0068866_10002289 Ga0068866_1000228910 192
482 3300005719 Ga0068861_100230752 Ga0068861_1002307523 192
483 3300005719 Ga0068861_101559912 Ga0068861_1015599121 192
484 3300005834 Ga0068851_10000665 Ga0068851_100006656 192
485 3300005834 Ga0068851_10001506 Ga0068851_1000150610 192
486 3300005834 Ga0068851_10006993 Ga0068851_100069932 192
487 3300005834 Ga0068851_10142701 Ga0068851_101427012 192
488 3300005840 Ga0068870_10112519 Ga0068870_101125192 192
489 3300005841 Ga0068863_100081005 Ga0068863_1000810052 192
490 3300005841 Ga0068863_100086511 Ga0068863_1000865112 192
491 3300005841 Ga0068863_100282064 Ga0068863_1002820642 192
492 3300005841 Ga0068863_100498042 Ga0068863_1004980421 192
493 3300005841 Ga0068863_100589644 Ga0068863_1005896441 192
494 3300005842 Ga0068858_100095139 Ga0068858_1000951392 192
495 3300005842 Ga0068858_100335879 Ga0068858_1003358792 192
496 3300005843 Ga0068860_100000213 Ga0068860_10000021358 192
497 3300005843 Ga0068860_100291645 Ga0068860_1002916452 192
498 3300005843 Ga0068860_100389135 Ga0068860_1003891352 192
499 3300005843 Ga0068860_100539684 Ga0068860_1005396842 192
500 3300005844 Ga0068862_100168868 Ga0068862_1001688682 192
501 3300005844 Ga0068862_100196454 Ga0068862_1001964542 192
502 3300005937 Ga0081455_10007959 Ga0081455_100079596 192
503 3300005937 Ga0081455_10033401 Ga0081455_100334015 192
504 3300005983 Ga0081540_1002690 Ga0081540_10026903 192
505 3300005983 Ga0081540_1003654 Ga0081540_100365410 192
506 3300005983 Ga0081540_1005056 Ga0081540_10050564 192
507 3300005983 Ga0081540_1010774 Ga0081540_10107745 192
508 3300005983 Ga0081540_1025433 Ga0081540_10254335 192
509 3300005983 Ga0081540_1071432 Ga0081540_10714322 192
510 3300005985 Ga0081539_10000148 Ga0081539_10000148125 192
511 3300005985 Ga0081539_10016757 Ga0081539_100167574 192
512 3300006038 Ga0075365_10003838 Ga0075365_100038384 192
513 3300006038 Ga0075365_10032195 Ga0075365_100321955 192
514 3300006038 Ga0075365_10067397 Ga0075365_100673973 192
515 3300006038 Ga0075365_10149909 Ga0075365_101499092 192
516 3300006038 Ga0075365_10287590 Ga0075365_102875901 192
517 3300006042 Ga0075368_10002426 Ga0075368_100024263 192
518 3300006042 Ga0075368_10009350 Ga0075368_100093504 192
519 3300006042 Ga0075368_10050268 Ga0075368_100502682 192
520 3300006048 Ga0075363_100001327 Ga0075363_1000013273 192
521 3300006048 Ga0075363_100020674 Ga0075363_1000206744 192
522 3300006048 Ga0075363_100053024 Ga0075363_1000530243 192
523 3300006048 Ga0075363_100094818 Ga0075363_1000948183 192
524 3300006051 Ga0075364_10065283 Ga0075364_100652831 192
525 3300006051 Ga0075364_10238924 Ga0075364_102389242 192
526 3300006173 Ga0070716_100576521 Ga0070716_1005765212 192
527 3300006173 Ga0070716_100649533 Ga0070716_1006495331 192
528 3300006175 Ga0070712_100021012 Ga0070712_1000210122 192
529 3300006175 Ga0070712_100363904 Ga0070712_1003639042 192
530 3300006175 Ga0070712_100605234 Ga0070712_1006052341 192
531 3300006177 Ga0075362_10054241 Ga0075362_100542412 192
532 3300006177 Ga0075362_10140258 Ga0075362_101402582 192
533 3300006178 Ga0075367_10002297 Ga0075367_100022976 192
534 3300006178 Ga0075367_10009600 Ga0075367_100096005 192
535 3300006178 Ga0075367_10060115 Ga0075367_100601152 192
536 3300006178 Ga0075367_10126478 Ga0075367_101264783 192
537 3300006178 Ga0075367_10185516 Ga0075367_101855162 192
538 3300006178 Ga0075367_10286818 Ga0075367_102868181 192
539 3300006186 Ga0075369_10088176 Ga0075369_100881761 192
540 3300006186 Ga0075369_10169745 Ga0075369_101697452 192
541 3300006195 Ga0075366_10007498 Ga0075366_100074984 192
542 3300006195 Ga0075366_10019086 Ga0075366_100190863 192
543 3300006237 Ga0097621_100011478 Ga0097621_1000114787 192
544 3300006237 Ga0097621_100042158 Ga0097621_1000421584 192
545 3300006237 Ga0097621_100078820 Ga0097621_1000788202 192
546 3300006237 Ga0097621_100116282 Ga0097621_1001162821 192
547 3300006237 Ga0097621_100136235 Ga0097621_1001362352 192
548 3300006237 Ga0097621_100389056 Ga0097621_1003890562 192
549 3300006353 Ga0075370_10035136 Ga0075370_100351362 192
550 3300006353 Ga0075370_10079108 Ga0075370_100791082 192
551 3300006358 Ga0068871_100019286 Ga0068871_1000192864 192
552 3300006358 Ga0068871_100027614 Ga0068871_1000276145 192
553 3300006358 Ga0068871_100031162 Ga0068871_1000311622 192
554 3300006358 Ga0068871_100223209 Ga0068871_1002232092 192
555 3300006358 Ga0068871_100411868 Ga0068871_1004118682 192
556 3300006844 Ga0075428_100071694 Ga0075428_1000716942 192
557 3300006871 Ga0075434_100017694 Ga0075434_1000176943 192
558 3300006871 Ga0075434_100665107 Ga0075434_1006651072 192
559 3300006880 Ga0075429_100158532 Ga0075429_1001585322 192
560 3300006881 Ga0068865_100131111 Ga0068865_1001311112 192
561 3300006881 Ga0068865_100254427 Ga0068865_1002544272 192
562 3300006881 Ga0068865_100321204 Ga0068865_1003212042 192
563 3300006931 Ga0097620_100147448 Ga0097620_1001474483 192
564 3300006931 Ga0097620_100295498 Ga0097620_1002954982 192
565 3300006931 Ga0097620_100645431 Ga0097620_1006454312 192
566 3300006942 Ga0099824_1010553 Ga0099824_10105532 192
567 3300006943 Ga0099822_1067191 Ga0099822_10671912 192
568 3300007265 Ga0099794_10119692 Ga0099794_101196921 192
569 3300007788 Ga0099795_10068565 Ga0099795_100685652 192
570 3300007788 Ga0099795_10112602 Ga0099795_101126022 192
571 3300009036 Ga0105244_10256859 Ga0105244_102568591 192
572 3300009092 Ga0105250_10090462 Ga0105250_100904622 192
573 3300009093 Ga0105240_10012206 Ga0105240_100122065 192
574 3300009093 Ga0105240_10015453 Ga0105240_100154535 192
575 3300009093 Ga0105240_10019644 Ga0105240_100196443 192
576 3300009093 Ga0105240_10204805 Ga0105240_102048053 192
577 3300009093 Ga0105240_10235380 Ga0105240_102353802 192
578 3300009093 Ga0105240_10553482 Ga0105240_105534821 192
579 3300009093 Ga0105240_10584371 Ga0105240_105843712 192
580 3300009093 Ga0105240_11011289 Ga0105240_110112891 192
581 3300009094 Ga0111539_10371335 Ga0111539_103713353 192
582 3300009098 Ga0105245_10035254 Ga0105245_100352542 192
583 3300009098 Ga0105245_10111250 Ga0105245_101112503 192
584 3300009098 Ga0105245_10172862 Ga0105245_101728622 192
585 3300009098 Ga0105245_10194798 Ga0105245_101947982 192
586 3300009098 Ga0105245_10214003 Ga0105245_102140032 192
587 3300009101 Ga0105247_10431046 Ga0105247_104310462 192
588 3300009101 Ga0105247_10676183 Ga0105247_106761831 192
589 3300009148 Ga0105243_10048411 Ga0105243_100484112 192
590 3300009174 Ga0105241_10001128 Ga0105241_1000112812 192
591 3300009174 Ga0105241_10038244 Ga0105241_100382443 192
592 3300009174 Ga0105241_10051559 Ga0105241_100515592 192
593 3300009176 Ga0105242_10034685 Ga0105242_100346853 192
594 3300009176 Ga0105242_10039027 Ga0105242_100390275 192
595 3300009176 Ga0105242_10229076 Ga0105242_102290762 192
596 3300009177 Ga0105248_10032462 Ga0105248_100324623 192
597 3300009177 Ga0105248_10039667 Ga0105248_100396672 192
598 3300009177 Ga0105248_10394372 Ga0105248_103943722 192
599 3300009177 Ga0105248_11050293 Ga0105248_110502932 192
600 3300009545 Ga0105237_10016711 Ga0105237_100167114 192
601 3300009545 Ga0105237_10039759 Ga0105237_100397594 192
602 3300009545 Ga0105237_10087117 Ga0105237_100871174 192
603 3300009545 Ga0105237_10117017 Ga0105237_101170171 192
604 3300009545 Ga0105237_10125974 Ga0105237_101259744 192
605 3300009545 Ga0105237_10165645 Ga0105237_101656453 192
606 3300009551 Ga0105238_10000006 Ga0105238_1000000655 192
607 3300009551 Ga0105238_10005356 Ga0105238_100053569 192
608 3300009551 Ga0105238_10033734 Ga0105238_100337343 192
609 3300009551 Ga0105238_10727802 Ga0105238_107278022 192
610 3300009553 Ga0105249_10246467 Ga0105249_102464672 192
611 3300010159 Ga0099796_10000987 Ga0099796_100009872 192
612 3300010375 Ga0105239_10003581 Ga0105239_1000358121 192
613 3300010375 Ga0105239_10010252 Ga0105239_100102525 192
614 3300010375 Ga0105239_10013525 Ga0105239_100135259 192
615 3300010375 Ga0105239_10038755 Ga0105239_100387555 192
616 3300010375 Ga0105239_10076483 Ga0105239_100764833 192
617 3300010375 Ga0105239_10151195 Ga0105239_101511951 192
618 3300010375 Ga0105239_10350184 Ga0105239_103501843 192
619 3300010375 Ga0105239_10523367 Ga0105239_105233672 192
620 3300011119 Ga0105246_10071979 Ga0105246_100719792 192
621 3300011119 Ga0105246_10107900 Ga0105246_101079003 192
622 3300011119 Ga0105246_10680542 Ga0105246_106805421 192
623 3300013102 Ga0157371_10030779 Ga0157371_100307792 192
624 3300013102 Ga0157371_10361194 Ga0157371_103611942 192
625 3300013104 Ga0157370_10040329 Ga0157370_100403292 192
626 3300013104 Ga0157370_10054676 Ga0157370_100546763 192
627 3300013105 Ga0157369_10066689 Ga0157369_100666896 192
628 3300013296 Ga0157374_10037138 Ga0157374_100371383 192
629 3300013296 Ga0157374_10758943 Ga0157374_107589432 192
630 3300013297 Ga0157378_10007281 Ga0157378_100072812 192
631 3300013297 Ga0157378_10013278 Ga0157378_100132788 192
632 3300013297 Ga0157378_10154957 Ga0157378_101549573 192
633 3300013297 Ga0157378_10168161 Ga0157378_101681613 192
634 3300013297 Ga0157378_11187248 Ga0157378_111872481 192
635 3300013306 Ga0163162_10011527 Ga0163162_100115277 192
636 3300013306 Ga0163162_10039978 Ga0163162_100399782 192
637 3300013306 Ga0163162_10041818 Ga0163162_100418182 192
638 3300013306 Ga0163162_10200071 Ga0163162_102000712 192
639 3300013306 Ga0163162_10225184 Ga0163162_102251842 192
640 3300013306 Ga0163162_10319734 Ga0163162_103197343 192
641 3300013306 Ga0163162_10618287 Ga0163162_106182871 192
642 3300013307 Ga0157372_10055636 Ga0157372_100556366 192
643 3300013308 Ga0157375_10048580 Ga0157375_100485802 192
644 3300013308 Ga0157375_10057722 Ga0157375_100577224 192
645 3300013308 Ga0157375_10251804 Ga0157375_102518042 192
646 3300013308 Ga0157375_10298662 Ga0157375_102986622 192
647 3300013308 Ga0157375_10479684 Ga0157375_104796842 192
648 3300013308 Ga0157375_10682786 Ga0157375_106827862 192
649 3300014325 Ga0163163_10051487 Ga0163163_100514873 192
650 3300014325 Ga0163163_10300177 Ga0163163_103001772 192
651 3300014325 Ga0163163_10467958 Ga0163163_104679582 192
652 3300014326 Ga0157380_10133887 Ga0157380_101338873 192
653 3300014326 Ga0157380_10403654 Ga0157380_104036542 192
654 3300014326 Ga0157380_10880432 Ga0157380_108804322 192
655 3300014497 Ga0182008_10282620 Ga0182008_102826201 192
656 3300014745 Ga0157377_10197850 Ga0157377_101978502 192
657 3300014968 Ga0157379_10688565 Ga0157379_106885652 192
658 3300014969 Ga0157376_10204895 Ga0157376_102048952 192
659 3300014969 Ga0157376_10299006 Ga0157376_102990062 192
660 3300014969 Ga0157376_10365929 Ga0157376_103659292 192
661 3300014969 Ga0157376_10440153 Ga0157376_104401532 192
662 3300014969 Ga0157376_10649097 Ga0157376_106490971 192
663 3300014969 Ga0157376_10831970 Ga0157376_108319702 192
664 3300015261 Ga0182006_1008158 Ga0182006_10081584 192
665 3300017792 Ga0163161_10094489 Ga0163161_100944892 192
666 3300021320 Ga0214544_1000002 Ga0214544_100000285 192
667 3300021321 Ga0214542_1000001 Ga0214542_1000001435 192
668 3300021324 Ga0214545_1000001 Ga0214545_1000001501 192
669 3300021327 Ga0214543_1000001 Ga0214543_1000001695 192
670 3300021361 Ga0213872_10007408 Ga0213872_100074082 192
671 3300025224 Ga0209784_100009 Ga0209784_100009297 192
672 3300025225 Ga0209566_100007 Ga0209566_100007297 192
673 3300025226 Ga0209674_100018 Ga0209674_100018297 192
674 3300025230 Ga0209563_100020 Ga0209563_100020297 192
675 3300025253 Ga0209677_100010 Ga0209677_100010297 192
676 3300025261 Ga0209233_1001622 Ga0209233_10016228 192
677 3300025261 Ga0209233_1002635 Ga0209233_10026352 192
678 3300025271 Ga0207666_1032107 Ga0207666_10321072 192
679 3300025272 Ga0209455_1001411 Ga0209455_10014113 192
680 3300025295 Ga0209564_1031964 Ga0209564_10319642 192
681 3300025297 Ga0209758_1002990 Ga0209758_100299019 192
682 3300025297 Ga0209758_1006039 Ga0209758_10060396 192
683 3300025297 Ga0209758_1028088 Ga0209758_10280884 192
684 3300025297 Ga0209758_1071513 Ga0209758_10715131 192
685 3300025299 Ga0209256_1069700 Ga0209256_10697001 192
686 3300025302 Ga0207426_1000238 Ga0207426_100023820 192
687 3300025302 Ga0207426_1000726 Ga0207426_100072635 192
688 3300025302 Ga0207426_1018462 Ga0207426_10184622 192
689 3300025304 Ga0209257_1016377 Ga0209257_10163773 192
690 3300025304 Ga0209257_1029697 Ga0209257_10296972 192
691 3300025315 Ga0207697_10032045 Ga0207697_100320453 192
692 3300025321 Ga0207656_10020655 Ga0207656_100206553 192
693 3300025321 Ga0207656_10023820 Ga0207656_100238203 192
694 3300025885 Ga0207653_10020940 Ga0207653_100209402 192
695 3300025899 Ga0207642_10001698 Ga0207642_100016981 192
696 3300025899 Ga0207642_10024183 Ga0207642_100241833 192
697 3300025899 Ga0207642_10120908 Ga0207642_101209082 192
698 3300025900 Ga0207710_10040185 Ga0207710_100401852 192
699 3300025900 Ga0207710_10352615 Ga0207710_103526151 192
700 3300025901 Ga0207688_10014787 Ga0207688_100147873 192
701 3300025901 Ga0207688_10022654 Ga0207688_100226544 192
702 3300025901 Ga0207688_10718549 Ga0207688_107185491 192
703 3300025903 Ga0207680_10080583 Ga0207680_100805833 192
704 3300025903 Ga0207680_10210837 Ga0207680_102108372 192
705 3300025903 Ga0207680_10425906 Ga0207680_104259062 192
706 3300025903 Ga0207680_10507445 Ga0207680_105074451 192
707 3300025904 Ga0207647_10001739 Ga0207647_100017395 192
708 3300025904 Ga0207647_10004412 Ga0207647_100044123 192
709 3300025905 Ga0207685_10280953 Ga0207685_102809531 192
710 3300025907 Ga0207645_10002659 Ga0207645_100026596 192
711 3300025907 Ga0207645_10076504 Ga0207645_100765042 192
712 3300025907 Ga0207645_10104653 Ga0207645_101046532 192
713 3300025907 Ga0207645_10141766 Ga0207645_101417662 192
714 3300025908 Ga0207643_10009703 Ga0207643_100097032 192
715 3300025909 Ga0207705_10054017 Ga0207705_100540172 192
716 3300025910 Ga0207684_10147447 Ga0207684_101474472 192
717 3300025911 Ga0207654_10000232 Ga0207654_1000023213 192
718 3300025911 Ga0207654_10008189 Ga0207654_100081892 192
719 3300025911 Ga0207654_10018133 Ga0207654_100181333 192
720 3300025912 Ga0207707_10004626 Ga0207707_100046269 192
721 3300025912 Ga0207707_10153907 Ga0207707_101539073 192
722 3300025913 Ga0207695_10001547 Ga0207695_1000154710 192
723 3300025913 Ga0207695_10018027 Ga0207695_100180278 192
724 3300025913 Ga0207695_10021133 Ga0207695_100211335 192
725 3300025913 Ga0207695_10029145 Ga0207695_100291454 192
726 3300025913 Ga0207695_10211998 Ga0207695_102119983 192
727 3300025913 Ga0207695_10225135 Ga0207695_102251352 192
728 3300025914 Ga0207671_10044857 Ga0207671_100448572 192
729 3300025914 Ga0207671_10061493 Ga0207671_100614932 192
730 3300025914 Ga0207671_10106153 Ga0207671_101061533 192
731 3300025914 Ga0207671_10361026 Ga0207671_103610262 192
732 3300025914 Ga0207671_10596836 Ga0207671_105968362 192
733 3300025914 Ga0207671_10730982 Ga0207671_107309822 192
734 3300025915 Ga0207693_10096048 Ga0207693_100960483 192
735 3300025915 Ga0207693_10218848 Ga0207693_102188481 192
736 3300025915 Ga0207693_10468550 Ga0207693_104685502 192
737 3300025916 Ga0207663_10077320 Ga0207663_100773202 192
738 3300025917 Ga0207660_10002564 Ga0207660_100025649 192
739 3300025917 Ga0207660_10049575 Ga0207660_100495752 192
740 3300025918 Ga0207662_10021702 Ga0207662_100217023 192
741 3300025919 Ga0207657_10000658 Ga0207657_100006587 192
742 3300025920 Ga0207649_10031218 Ga0207649_100312182 192
743 3300025920 Ga0207649_10531499 Ga0207649_105314992 192
744 3300025921 Ga0207652_10003470 Ga0207652_100034707 192
745 3300025921 Ga0207652_10104025 Ga0207652_101040252 192
746 3300025921 Ga0207652_10673781 Ga0207652_106737812 192
747 3300025922 Ga0207646_10063050 Ga0207646_100630503 192
748 3300025924 Ga0207694_10000050 Ga0207694_10000050101 192
749 3300025924 Ga0207694_10000129 Ga0207694_1000012954 192
750 3300025924 Ga0207694_10017085 Ga0207694_100170852 192
751 3300025924 Ga0207694_10063725 Ga0207694_100637254 192
752 3300025924 Ga0207694_10154466 Ga0207694_101544662 192
753 3300025925 Ga0207650_10070842 Ga0207650_100708422 192
754 3300025925 Ga0207650_10215193 Ga0207650_102151932 192
755 3300025926 Ga0207659_10003508 Ga0207659_100035087 192
756 3300025926 Ga0207659_10044448 Ga0207659_100444482 192
757 3300025926 Ga0207659_10380865 Ga0207659_103808652 192
758 3300025927 Ga0207687_10006047 Ga0207687_100060474 192
759 3300025927 Ga0207687_10190002 Ga0207687_101900021 192
760 3300025927 Ga0207687_10478189 Ga0207687_104781892 192
761 3300025927 Ga0207687_10509630 Ga0207687_105096302 192
762 3300025929 Ga0207664_10810461 Ga0207664_108104611 192
763 3300025931 Ga0207644_10002628 Ga0207644_100026283 192
764 3300025931 Ga0207644_10083186 Ga0207644_100831862 192
765 3300025931 Ga0207644_10157177 Ga0207644_101571772 192
766 3300025931 Ga0207644_10325732 Ga0207644_103257321 192
767 3300025933 Ga0207706_10042483 Ga0207706_100424833 192
768 3300025933 Ga0207706_10122664 Ga0207706_101226643 192
769 3300025933 Ga0207706_10175601 Ga0207706_101756012 192
770 3300025933 Ga0207706_10210667 Ga0207706_102106672 192
771 3300025933 Ga0207706_10308903 Ga0207706_103089032 192
772 3300025934 Ga0207686_10000485 Ga0207686_100004855 192
773 3300025935 Ga0207709_10028770 Ga0207709_100287702 192
774 3300025935 Ga0207709_10410928 Ga0207709_104109282 192
775 3300025935 Ga0207709_10442205 Ga0207709_104422052 192
776 3300025936 Ga0207670_10098558 Ga0207670_100985583 192
777 3300025936 Ga0207670_10658863 Ga0207670_106588632 192
778 3300025937 Ga0207669_10020565 Ga0207669_100205653 192
779 3300025938 Ga0207704_10035220 Ga0207704_100352203 192
780 3300025938 Ga0207704_10060292 Ga0207704_100602923 192
781 3300025938 Ga0207704_10174673 Ga0207704_101746733 192
782 3300025939 Ga0207665_10316251 Ga0207665_103162511 192
783 3300025939 Ga0207665_10730464 Ga0207665_107304641 192
784 3300025939 Ga0207665_10794906 Ga0207665_107949061 192
785 3300025940 Ga0207691_10000734 Ga0207691_1000073413 192
786 3300025940 Ga0207691_10043338 Ga0207691_100433382 192
787 3300025940 Ga0207691_10305385 Ga0207691_103053851 192
788 3300025940 Ga0207691_10328974 Ga0207691_103289742 192
789 3300025941 Ga0207711_10078422 Ga0207711_100784223 192
790 3300025941 Ga0207711_10821497 Ga0207711_108214971 192
791 3300025942 Ga0207689_10015745 Ga0207689_100157452 192
792 3300025942 Ga0207689_10018993 Ga0207689_100189932 192
793 3300025942 Ga0207689_10124415 Ga0207689_101244152 192
794 3300025942 Ga0207689_10184590 Ga0207689_101845902 192
795 3300025944 Ga0207661_10022075 Ga0207661_100220752 192
796 3300025944 Ga0207661_10291060 Ga0207661_102910602 192
797 3300025944 Ga0207661_10446571 Ga0207661_104465712 192
798 3300025945 Ga0207679_10024963 Ga0207679_100249632 192
799 3300025945 Ga0207679_10400752 Ga0207679_104007522 192
800 3300025945 Ga0207679_10556362 Ga0207679_105563622 192
801 3300025949 Ga0207667_10014083 Ga0207667_100140833 192
802 3300025949 Ga0207667_10015706 Ga0207667_100157064 192
803 3300025949 Ga0207667_10018609 Ga0207667_100186099 192
804 3300025949 Ga0207667_10043266 Ga0207667_100432664 192
805 3300025949 Ga0207667_10285835 Ga0207667_102858352 192
806 3300025960 Ga0207651_10215578 Ga0207651_102155782 192
807 3300025960 Ga0207651_10360982 Ga0207651_103609822 192
808 3300025972 Ga0207668_10321278 Ga0207668_103212781 192
809 3300025981 Ga0207640_10016085 Ga0207640_100160852 192
810 3300025981 Ga0207640_10043908 Ga0207640_100439083 192
811 3300025981 Ga0207640_10052613 Ga0207640_100526134 192
812 3300025981 Ga0207640_10079187 Ga0207640_100791873 192
813 3300025981 Ga0207640_10119092 Ga0207640_101190922 192
814 3300025981 Ga0207640_10258346 Ga0207640_102583462 192
815 3300025981 Ga0207640_10285402 Ga0207640_102854022 192
816 3300026023 Ga0207677_10004777 Ga0207677_100047774 192
817 3300026023 Ga0207677_10125605 Ga0207677_101256053 192
818 3300026041 Ga0207639_10021331 Ga0207639_100213314 192
819 3300026041 Ga0207639_10478909 Ga0207639_104789092 192
820 3300026041 Ga0207639_10910586 Ga0207639_109105861 192
821 3300026041 Ga0207639_11089091 Ga0207639_110890911 192
822 3300026067 Ga0207678_10008230 Ga0207678_1000823011 192
823 3300026067 Ga0207678_10008831 Ga0207678_100088312 192
824 3300026067 Ga0207678_10029682 Ga0207678_100296826 192
825 3300026067 Ga0207678_10065077 Ga0207678_100650772 192
826 3300026067 Ga0207678_10150609 Ga0207678_101506092 192
827 3300026067 Ga0207678_10310698 Ga0207678_103106982 192
828 3300026067 Ga0207678_10354152 Ga0207678_103541522 192
829 3300026067 Ga0207678_10429827 Ga0207678_104298272 192
830 3300026075 Ga0207708_10028723 Ga0207708_100287232 192
831 3300026075 Ga0207708_10067333 Ga0207708_100673332 192
832 3300026075 Ga0207708_10611095 Ga0207708_106110952 192
833 3300026078 Ga0207702_10000002 Ga0207702_10000002211 192
834 3300026078 Ga0207702_10010350 Ga0207702_100103507 192
835 3300026078 Ga0207702_10097487 Ga0207702_100974873 192
836 3300026078 Ga0207702_10205406 Ga0207702_102054063 192
837 3300026078 Ga0207702_10269781 Ga0207702_102697812 192
838 3300026088 Ga0207641_10229824 Ga0207641_102298242 192
839 3300026088 Ga0207641_10313119 Ga0207641_103131192 192
840 3300026088 Ga0207641_10636814 Ga0207641_106368142 192
841 3300026088 Ga0207641_11090006 Ga0207641_110900062 192
842 3300026089 Ga0207648_10012844 Ga0207648_100128444 192
843 3300026089 Ga0207648_10018957 Ga0207648_100189572 192
844 3300026089 Ga0207648_10044357 Ga0207648_100443575 192
845 3300026089 Ga0207648_10049980 Ga0207648_100499802 192
846 3300026089 Ga0207648_10055009 Ga0207648_100550093 192
847 3300026089 Ga0207648_10502058 Ga0207648_105020581 192
848 3300026089 Ga0207648_10870686 Ga0207648_108706862 192
849 3300026095 Ga0207676_10089834 Ga0207676_100898342 192
850 3300026095 Ga0207676_10215181 Ga0207676_102151813 192
851 3300026095 Ga0207676_10258444 Ga0207676_102584442 192
852 3300026095 Ga0207676_10287859 Ga0207676_102878592 192
853 3300026095 Ga0207676_10866087 Ga0207676_108660872 192
854 3300026116 Ga0207674_10010794 Ga0207674_100107945 192
855 3300026116 Ga0207674_10012018 Ga0207674_100120186 192
856 3300026116 Ga0207674_10014258 Ga0207674_100142585 192
857 3300026116 Ga0207674_10097514 Ga0207674_100975143 192
858 3300026118 Ga0207675_100042005 Ga0207675_1000420053 192
859 3300026118 Ga0207675_100162819 Ga0207675_1001628191 192
860 3300026118 Ga0207675_100232070 Ga0207675_1002320703 192
861 3300026118 Ga0207675_100441456 Ga0207675_1004414562 192
862 3300026121 Ga0207683_10001672 Ga0207683_100016724 192
863 3300026121 Ga0207683_10002522 Ga0207683_1000252216 192
864 3300026121 Ga0207683_10061259 Ga0207683_100612593 192
865 3300026121 Ga0207683_10104462 Ga0207683_101044622 192
866 3300026121 Ga0207683_10343648 Ga0207683_103436482 192
867 3300026121 Ga0207683_10440052 Ga0207683_104400522 192
868 3300026121 Ga0207683_10467756 Ga0207683_104677562 192
869 3300026142 Ga0207698_10003755 Ga0207698_100037559 192
870 3300026142 Ga0207698_10027502 Ga0207698_100275022 192
871 3300026142 Ga0207698_10030725 Ga0207698_100307256 192
872 3300026142 Ga0207698_10681066 Ga0207698_106810662 192
873 3300026142 Ga0207698_11127917 Ga0207698_111279171 192
874 3300026142 Ga0207698_11217242 Ga0207698_112172421 192
875 3300027296 Ga0209389_1005934 Ga0209389_10059349 192
876 3300027357 Ga0209589_1000092 Ga0209589_10000923 192
877 3300027361 Ga0209489_100006 Ga0209489_100006460 192
878 3300027671 Ga0209588_1025913 Ga0209588_10259132 192
879 3300027866 Ga0209813_10014735 Ga0209813_100147351 192
880 3300027866 Ga0209813_10132505 Ga0209813_101325051 192
881 3300027907 Ga0207428_10097532 Ga0207428_100975322 192
882 3300027907 Ga0207428_10119691 Ga0207428_101196913 192
883 3300028379 Ga0268266_10008395 Ga0268266_100083953 192
884 3300028379 Ga0268266_10046593 Ga0268266_100465935 192
885 3300028379 Ga0268266_10062176 Ga0268266_100621762 192
886 3300028379 Ga0268266_10914601 Ga0268266_109146012 192
887 3300028379 Ga0268266_11083511 Ga0268266_110835111 192
888 3300028380 Ga0268265_10190091 Ga0268265_101900913 192
889 3300028381 Ga0268264_10000065 Ga0268264_10000065173 192
890 3300028381 Ga0268264_10551098 Ga0268264_105510981 192
891 3300028794 Ga0307515_10074714 Ga0307515_100747142 192
892 3300031239 Ga0265328_10034595 Ga0265328_100345951 192
893 3300031241 Ga0265325_10013395 Ga0265325_100133955 192
894 3300031249 Ga0265339_10063987 Ga0265339_100639872 192
895 3300031249 Ga0265339_10071466 Ga0265339_100714662 192
896 3300031507 Ga0307509_10065921 Ga0307509_100659213 192
897 3300031507 Ga0307509_10596543 Ga0307509_105965431 192
898 3300031595 Ga0265313_10067731 Ga0265313_100677312 192
899 3300031711 Ga0265314_10098506 Ga0265314_100985063 192
900 3300031730 Ga0307516_10004992 Ga0307516_100049928 192
901 3300031731 Ga0307405_10139955 Ga0307405_101399552 192
902 3300031901 Ga0307406_10090379 Ga0307406_100903792 192
903 3300031901 Ga0307406_10820446 Ga0307406_108204461 192
904 3300032002 Ga0307416_100054674 Ga0307416_1000546742 192
905 3300032005 Ga0307411_10931942 Ga0307411_109319422 192
906 3300032126 Ga0307415_100881300 Ga0307415_1008813002 192
907 3300033180 Ga0307510_10016959 Ga0307510_100169595 192
908 3300033180 Ga0307510_10200324 Ga0307510_102003243 192
909 3300034816 Ga0373930_0006141 Ga0373930_0006141_1107_1685 192
910 3300035084 Ga0373928_0055920 Ga0373928_0055920_110_688 192
911 3300035089 Ga0373944_0157513 Ga0373944_0157513_142_720 192
912 3300035091 Ga0373951_0032943 Ga0373951_0032943_401_979 192
913 3300035111 Ga0373923_0104184 Ga0373923_0104184_256_834 192
914 3300035115 Ga0373941_0026182 Ga0373941_0026182_886_1464 192
915 3300035117 Ga0373953_0024360 Ga0373953_0024360_607_1185 192
916 3300035118 Ga0373954_0003560 Ga0373954_0003560_4112_4690 192
917 3300035119 Ga0373956_0056972 Ga0373956_0056972_1116_1694 192
918 3300035120 Ga0373957_0012158 Ga0373957_0012158_2173_2751 192
919 3300035170 Ga0373943_0004723 Ga0373943_0004723_1140_1733 192
920 3300035171 Ga0373946_0010067 Ga0373946_0010067_944_1537 192
921 3300035172 Ga0373955_0092505 Ga0373955_0092505_1025_1603 192
922 3300035172 Ga0373955_0264978 Ga0373955_0264978_286_864 192
923 3300035410 Ga0373924_0026828 Ga0373924_0026828_297_875 192
924 3300035691 Ga0373931_0038508 Ga0373931_0038508_382_960 192
925 3300035691 Ga0373931_0144646 Ga0373931_0144646_669_1253 192
926 3300035692 Ga0373935_0022640 Ga0373935_0022640_2485_3078 192
927 3300035692 Ga0373935_0229179 Ga0373935_0229179_630_1208 192
928 3300035692 Ga0373935_0412377 Ga0373935_0412377_184_762 192
929 3300035695 Ga0373927_0024231 Ga0373927_0024231_903_1481 192
930 3300035695 Ga0373927_0036402 Ga0373927_0036402_2091_2669 192
931 3300035695 Ga0373927_0046989 Ga0373927_0046989_1324_1902 192
932 3300035695 Ga0373927_0324252 Ga0373927_0324252_412_993 192
933 3300035695 Ga0373927_0391148 Ga0373927_0391148_123_701 192
934 3300035724 Ga0373933_0014758 Ga0373933_0014758_2377_2970 192
935 3300035724 Ga0373933_0017008 Ga0373933_0017008_859_1437 192
936 3300035725 Ga0373947_0023699 Ga0373947_0023699_855_1433 192
937 3300035725 Ga0373947_0053850 Ga0373947_0053850_1494_2087 192
938 3300036401 Ga0373937_0012233 Ga0373937_0012233_6760_7353 192
939 3300036401 Ga0373937_0074306 Ga0373937_0074306_2444_3022 192
940 3300036401 Ga0373937_0750281 Ga0373937_0750281_249_872 192
941 3300037068 Ga0373925_0010015 Ga0373925_0010015_2876_3454 192
942 3300037068 Ga0373925_0147237 Ga0373925_0147237_636_1229 192
943 3300037068 Ga0373925_0357268 Ga0373925_0357268_454_1032 192
944 3300037312 Ga0395899_0268825 Ga0395899_0268825_363_959 192
945 3300037312 Ga0395899_0494693 Ga0395899_0494693_118_696 192
946 3300037418 Ga0395900_0153330 Ga0395900_0153330_1146_1751 192
947 3300037418 Ga0395900_0233750 Ga0395900_0233750_1059_1655 192
948 3300037466 Ga0395898_0229371 Ga0395898_0229371_863_1441 192
949 3300037466 Ga0395898_0243167 Ga0395898_0243167_731_1327 192
950 3300037471 Ga0395905_0069832 Ga0395905_0069832_179_760 192
951 3300037471 Ga0395905_0182186 Ga0395905_0182186_510_1088 192
952 3300038443 Ga0395901_0380552 Ga0395901_0380552_439_1017 192
953 3300038443 Ga0395901_0392858 Ga0395901_0392858_155_736 192
954 3300038443 Ga0395901_0432768 Ga0395901_0432768_176_766 192
955 3300038443 Ga0395901_0674514 Ga0395901_0674514_213_818 192
956 3300039447 Ga0436361_0011286 Ga0436361_0011286_9616_10206 192
957 3300041494 Ga0451837_1034308 Ga0451837_1034308_256_840 192
958 3300042014 Ga0439457_107661 Ga0439457_107661_28_612 192
959 3300042157 Ga0439458_0009294 Ga0439458_0009294_1161_1745 192
960 3300042876 Ga0451577_0028784 Ga0451577_0028784_260_850 192
961 3300042876 Ga0451577_0084183 Ga0451577_0084183_417_1004 192
962 3300044658 Ga0466972_0054950 Ga0466972_0054950_280_861 192
963 3300044684 Ga0466966_0524082 Ga0466966_0524082_74_655 192
964 3300044712 Ga0453684_0049348 Ga0453684_0049348_2624_3223 192
965 3300044735 Ga0466968_0015575 Ga0466968_0015575_1027_1608 192
966 3300044842 Ga0466957_0171612 Ga0466957_0171612_402_986 192
967 3300044901 Ga0466960_0122745 Ga0466960_0122745_196_777 192
968 3300045049 Ga0466959_0556464 Ga0466959_0556464_172_759 192
969 3300046452 Ga0495617_032547 Ga0495617_032547_18_602 192
970 3300046454 Ga0495592_0060008 Ga0495592_0060008_1024_1602 192
971 3300046455 Ga0495603_0014382 Ga0495603_0014382_170_754 192
972 3300046455 Ga0495603_0036781 Ga0495603_0036781_1330_1908 192
973 3300046455 Ga0495603_0225587 Ga0495603_0225587_162_740 192
974 3300046457 Ga0495590_0064242 Ga0495590_0064242_531_1115 192
975 3300046457 Ga0495590_0150170 Ga0495590_0150170_142_795 192
976 3300046459 Ga0495629_0080045 Ga0495629_0080045_852_1430 192
977 3300046459 Ga0495629_0122411 Ga0495629_0122411_1195_1773 192
978 3300046460 Ga0495638_0006201 Ga0495638_0006201_7887_8501 192
979 3300046460 Ga0495638_0145928 Ga0495638_0145928_747_1331 192
980 3300046462 Ga0495651_0070309 Ga0495651_0070309_2052_2630 192
981 3300046462 Ga0495651_0220773 Ga0495651_0220773_462_1040 192
982 3300046463 Ga0495653_0012009 Ga0495653_0012009_4731_5309 192
983 3300046471 Ga0495650_0055372 Ga0495650_0055372_740_1318 192
984 3300046473 Ga0495582_0036696 Ga0495582_0036696_1786_2364 192
985 3300046474 Ga0495605_0129610 Ga0495605_0129610_442_1026 192
986 3300046475 Ga0495639_0078334 Ga0495639_0078334_907_1491 192
987 3300046475 Ga0495639_0381587 Ga0495639_0381587_50_628 192
988 3300046476 Ga0495662_0077741 Ga0495662_0077741_978_1556 192
989 3300046476 Ga0495662_0249246 Ga0495662_0249246_170_748 192
990 3300046477 Ga0495664_0418600 Ga0495664_0418600_22_600 192
991 3300046491 Ga0495584_0042216 Ga0495584_0042216_1056_1640 192
992 3300046492 Ga0495585_0173204 Ga0495585_0173204_104_688 192
993 3300046492 Ga0495585_0175924 Ga0495585_0175924_42_620 192
994 3300046499 Ga0495594_0012205 Ga0495594_0012205_1354_1947 192
995 3300046499 Ga0495594_0089078 Ga0495594_0089078_680_1258 192
996 3300046499 Ga0495594_0126312 Ga0495594_0126312_170_748 192
997 3300046507 Ga0495606_0332008 Ga0495606_0332008_112_726 192
998 3300046511 Ga0495608_0242533 Ga0495608_0242533_306_884 192
999 3300046512 Ga0495610_0044603 Ga0495610_0044603_1363_1977 192
1000 3300046513 Ga0495616_0009944 Ga0495616_0009944_3728_4312 192
1001 3300046513 Ga0495616_0034535 Ga0495616_0034535_628_1242 192
1002 3300046513 Ga0495616_0049017 Ga0495616_0049017_634_1287 192
1003 3300046514 Ga0495618_0003822 Ga0495618_0003822_4644_5222 192
1004 3300046515 Ga0495620_0132633 Ga0495620_0132633_41_673 192
1005 3300046516 Ga0495628_0070333 Ga0495628_0070333_1908_2486 192
1006 3300046517 Ga0495630_0170225 Ga0495630_0170225_838_1416 192
1007 3300046518 Ga0495631_0053605 Ga0495631_0053605_700_1284 192
1008 3300046518 Ga0495631_0273399 Ga0495631_0273399_33_611 192
1009 3300046519 Ga0495632_0124516 Ga0495632_0124516_401_985 192
1010 3300046519 Ga0495632_0134778 Ga0495632_0134778_354_938 192
1011 3300046523 Ga0495644_0032007 Ga0495644_0032007_1032_1616 192
1012 3300046524 Ga0495648_0004153 Ga0495648_0004153_11860_12438 192
1013 3300046524 Ga0495648_0061772 Ga0495648_0061772_582_1166 192
1014 3300046525 Ga0495663_0143268 Ga0495663_0143268_162_746 192
1015 3300046528 Ga0495642_0309020 Ga0495642_0309020_26_649 192
1016 3300046529 Ga0495652_0100750 Ga0495652_0100750_306_884 192
1017 3300046531 Ga0495665_0277532 Ga0495665_0277532_271_849 192
1018 3300046533 Ga0495640_0025473 Ga0495640_0025473_993_1571 192
1019 3300046535 Ga0495586_0179880 Ga0495586_0179880_367_945 192
1020 3300046536 Ga0495587_0032723 Ga0495587_0032723_1341_1919 192
1021 3300046538 Ga0495609_0069177 Ga0495609_0069177_621_1205 192
1022 3300046539 Ga0495621_0032826 Ga0495621_0032826_1155_1736 192
1023 3300046539 Ga0495621_0038579 Ga0495621_0038579_275_853 192
1024 3300046539 Ga0495621_0107673 Ga0495621_0107673_45_629 192
1025 3300046543 Ga0495645_0009636 Ga0495645_0009636_1651_2229 192
1026 3300046557 Ga0495622_0030649 Ga0495622_0030649_335_919 192
1027 3300046558 Ga0495633_0054492 Ga0495633_0054492_305_889 192
1028 3300046558 Ga0495633_0328782 Ga0495633_0328782_34_618 192
1029 3300046559 Ga0495667_0056479 Ga0495667_0056479_1034_1612 192
1030 3300046615 Ga0495656_0012617 Ga0495656_0012617_1626_2249 192
1031 3300046615 Ga0495656_0095704 Ga0495656_0095704_74_658 192
1032 3300046615 Ga0495656_0271051 Ga0495656_0271051_10_588 192
1033 3300046616 Ga0495668_0022682 Ga0495668_0022682_2128_2712 192
1034 3300046642 Ga0495634_0078269 Ga0495634_0078269_871_1449 192
1035 3300046648 Ga0495611_0032629 Ga0495611_0032629_824_1438 192
1036 3300046660 Ga0495625_0363691 Ga0495625_0363691_39_623 192
1037 3300046663 Ga0495635_0032410 Ga0495635_0032410_2065_2643 192
1038 3300046664 Ga0495659_0039206 Ga0495659_0039206_528_1112 192
1039 3300046664 Ga0495659_0133284 Ga0495659_0133284_22_600 192
1040 3300046675 Ga0495657_0033593 Ga0495657_0033593_1201_1779 192
1041 3300046678 Ga0495599_0009127 Ga0495599_0009127_3467_4045 192
1042 3300046679 Ga0495623_0058918 Ga0495623_0058918_1672_2250 192
1043 3300046680 Ga0495646_0026126 Ga0495646_0026126_133_711 192
1044 3300046681 Ga0495647_0002647 Ga0495647_0002647_971_1564 192
1045 3300046681 Ga0495647_0044199 Ga0495647_0044199_306_890 192
1046 3300046683 Ga0495658_0004054 Ga0495658_0004054_5360_5953 192
1047 3300046684 Ga0495669_0107138 Ga0495669_0107138_119_703 192
1048 3300046689 Ga0495613_0344836 Ga0495613_0344836_161_739 192
1049 3300046690 Ga0495624_0215782 Ga0495624_0215782_69_647 192
1050 3300046691 Ga0495670_0116972 Ga0495670_0116972_681_1265 192
1051 3300046692 Ga0495671_0039889 Ga0495671_0039889_1181_1762 192
1052 3300046692 Ga0495671_0071158 Ga0495671_0071158_124_708 192
1053 3300046794 Ga0495589_0059202 Ga0495589_0059202_315_899 192
1054 3300046809 Ga0495600_0033714 Ga0495600_0033714_1635_2213 192
1055 3300046809 Ga0495600_0174770 Ga0495600_0174770_559_1140 192
1056 3300046810 Ga0495660_0201389 Ga0495660_0201389_90_743 192
1057 3300047315 Ga0495581_0004461 Ga0495581_0004461_1225_1818 192
1058 3300047315 Ga0495581_0194874 Ga0495581_0194874_468_1046 192
1059 3300047315 Ga0495581_0194930 Ga0495581_0194930_82_660 192
1060 3300047315 Ga0495581_0342323 Ga0495581_0342323_276_860 192
1061 3300047317 Ga0495604_0016857 Ga0495604_0016857_983_1561 192
1062 3300047319 Ga0495674_0024247 Ga0495674_0024247_4053_4631 192
1063 3300047319 Ga0495674_0063302 Ga0495674_0063302_289_867 192
1064 3300047322 Ga0495680_0071472 Ga0495680_0071472_136_714 192
1065 3300047323 Ga0495683_0094403 Ga0495683_0094403_805_1389 192
1066 3300047443 Ga0495687_173467 Ga0495687_173467_33_647 192
1067 3300047444 Ga0495675_0014638 Ga0495675_0014638_3950_4528 192
1068 3300047445 Ga0495677_0125732 Ga0495677_0125732_77_661 192
1069 3300047446 Ga0495679_065519 Ga0495679_065519_186_764 192
1070 3300047469 Ga0495673_0120654 Ga0495673_0120654_183_764 192
1071 3300047471 Ga0495684_0087827 Ga0495684_0087827_1536_2114 192
1072 3300047472 Ga0495686_0071106 Ga0495686_0071106_319_897 192
1073 3300047472 Ga0495686_0259194 Ga0495686_0259194_15_635 192
1074 3300048088 Ga0495602_0096785 Ga0495602_0096785_1837_2415 192
1075 3300048091 Ga0495626_0067254 Ga0495626_0067254_525_1139 192
1076 3300048903 Ga0496100_0007662 Ga0496100_0007662_5369_5947 192
1077 3300048903 Ga0496100_0086541 Ga0496100_0086541_84_671 192
1078 3300048903 Ga0496100_0233105 Ga0496100_0233105_107_685 192
1079 3300048903 Ga0496100_0891295 Ga0496100_0891295_96_686 192
1080 3300048904 Ga0496101_0249292 Ga0496101_0249292_504_1082 192
1081 3300048905 Ga0496102_0003526 Ga0496102_0003526_4698_5276 192
1082 3300048905 Ga0496102_0006768 Ga0496102_0006768_1001_1591 192
1083 3300048905 Ga0496102_0027968 Ga0496102_0027968_1534_2112 192
1084 3300048905 Ga0496102_0028322 Ga0496102_0028322_1945_2526 192
1085 3300048905 Ga0496102_0098561 Ga0496102_0098561_1135_1719 192
1086 3300048905 Ga0496102_0239702 Ga0496102_0239702_261_839 192
1087 3300048905 Ga0496102_0703959 Ga0496102_0703959_264_851 192
1088 3300048906 Ga0496103_0036969 Ga0496103_0036969_191_805 192
1089 3300048906 Ga0496103_0307970 Ga0496103_0307970_413_997 192
1090 3300048907 Ga0496104_0008661 Ga0496104_0008661_446_1036 192
1091 3300048907 Ga0496104_0055336 Ga0496104_0055336_1577_2155 192
1092 3300048907 Ga0496104_0104315 Ga0496104_0104315_120_698 192
1093 3300048907 Ga0496104_0125604 Ga0496104_0125604_615_1229 192
1094 3300048907 Ga0496104_0301067 Ga0496104_0301067_186_770 192
1095 3300048908 Ga0496105_0014118 Ga0496105_0014118_343_921 192
1096 3300048908 Ga0496105_0025056 Ga0496105_0025056_3286_3876 192
1097 3300048908 Ga0496105_0060696 Ga0496105_0060696_677_1255 192
1098 3300048908 Ga0496105_0254629 Ga0496105_0254629_49_630 192
1099 3300048908 Ga0496105_0265153 Ga0496105_0265153_502_1128 192
1100 3300048909 Ga0496106_0027981 Ga0496106_0027981_64_654 192
1101 3300048909 Ga0496106_0164563 Ga0496106_0164563_675_1328 192
1102 3300048910 Ga0496107_0089106 Ga0496107_0089106_1482_2063 192
1103 3300048910 Ga0496107_0179865 Ga0496107_0179865_882_1472 192
1104 3300048910 Ga0496107_0305294 Ga0496107_0305294_142_720 192
1105 3300048911 Ga0496108_0004162 Ga0496108_0004162_2190_2777 192
1106 3300048911 Ga0496108_0050833 Ga0496108_0050833_2585_3163 192
1107 3300048911 Ga0496108_0059885 Ga0496108_0059885_386_1000 192
1108 3300048911 Ga0496108_0187419 Ga0496108_0187419_602_1180 192
1109 3300048912 Ga0496109_0252924 Ga0496109_0252924_1015_1605 192
1110 3300048912 Ga0496109_0280158 Ga0496109_0280158_301_879 192
1111 3300048913 Ga0496110_0005115 Ga0496110_0005115_3547_4134 192
1112 3300048913 Ga0496110_0024513 Ga0496110_0024513_3319_3897 192
1113 3300048913 Ga0496110_0032862 Ga0496110_0032862_902_1492 192
1114 3300048913 Ga0496110_0311556 Ga0496110_0311556_101_679 192
1115 3300048913 Ga0496110_0544127 Ga0496110_0544127_347_931 192
1116 3300048914 Ga0496111_0039965 Ga0496111_0039965_771_1361 192
1117 3300048914 Ga0496111_0052523 Ga0496111_0052523_1263_1877 192
1118 3300048914 Ga0496111_0189177 Ga0496111_0189177_730_1314 192
1119 3300048915 Ga0496112_0107232 Ga0496112_0107232_259_873 192
1120 3300048915 Ga0496112_0154174 Ga0496112_0154174_1259_1837 192
1121 3300048915 Ga0496112_0173687 Ga0496112_0173687_566_1180 192
1122 3300048915 Ga0496112_0173955 Ga0496112_0173955_1049_1639 192
1123 3300048915 Ga0496112_0254038 Ga0496112_0254038_205_789 192
1124 3300048915 Ga0496112_0950647 Ga0496112_0950647_79_693 192
1125 3300048916 Ga0496113_0052398 Ga0496113_0052398_2194_2808 192
1126 3300048916 Ga0496113_0071006 Ga0496113_0071006_1958_2536 192
1127 3300048916 Ga0496113_0087561 Ga0496113_0087561_793_1377 192
1128 3300048916 Ga0496113_0119470 Ga0496113_0119470_1404_1982 192
1129 3300048917 Ga0496114_0053872 Ga0496114_0053872_1922_2500 192
1130 3300048917 Ga0496114_0079601 Ga0496114_0079601_607_1194 192
1131 3300048917 Ga0496114_0269417 Ga0496114_0269417_505_1086 192
1132 3300048917 Ga0496114_0287607 Ga0496114_0287607_359_943 192
1133 3300048918 Ga0496115_0011990 Ga0496115_0011990_5734_6312 192
1134 3300048918 Ga0496115_0055461 Ga0496115_0055461_2061_2684 192
1135 3300048918 Ga0496115_0064825 Ga0496115_0064825_2022_2600 192
1136 3300048918 Ga0496115_0072699 Ga0496115_0072699_469_1047 192
1137 3300048918 Ga0496115_0121595 Ga0496115_0121595_489_1076 192
1138 3300048918 Ga0496115_0440391 Ga0496115_0440391_95_679 192
1139 3300048919 Ga0496116_0007877 Ga0496116_0007877_1239_1892 192
1140 3300048919 Ga0496116_0063979 Ga0496116_0063979_552_1166 192
1141 3300048919 Ga0496116_0183766 Ga0496116_0183766_102_686 192
1142 3300048920 Ga0496117_0109010 Ga0496117_0109010_387_1040 192
1143 3300048921 Ga0496118_0024256 Ga0496118_0024256_356_934 192
1144 3300048921 Ga0496118_0083713 Ga0496118_0083713_434_1018 192
1145 3300048921 Ga0496118_0105697 Ga0496118_0105697_17_598 192
1146 3300048921 Ga0496118_0327868 Ga0496118_0327868_53_667 192
1147 3300048921 Ga0496118_0373546 Ga0496118_0373546_24_608 192
1148 3300048922 Ga0496119_0076439 Ga0496119_0076439_129_713 192
1149 3300048922 Ga0496119_0196340 Ga0496119_0196340_88_666 192
1150 3300048922 Ga0496119_0208447 Ga0496119_0208447_380_994 192
1151 3300048923 Ga0496120_0030923 Ga0496120_0030923_1044_1622 192
1152 3300048924 Ga0496121_0000594 Ga0496121_0000594_47540_48178 192
1153 3300048924 Ga0496121_0002279 Ga0496121_0002279_27942_28520 192
1154 3300048924 Ga0496121_0032438 Ga0496121_0032438_3562_4143 192
1155 3300048924 Ga0496121_0038456 Ga0496121_0038456_2136_2720 192
1156 3300048924 Ga0496121_0099176 Ga0496121_0099176_956_1540 192
1157 3300048924 Ga0496121_0227288 Ga0496121_0227288_26_610 192
1158 3300048924 Ga0496121_0372853 Ga0496121_0372853_81_659 192
1159 3300048924 Ga0496121_0563375 Ga0496121_0563375_46_669 192
1160 3300048927 Ga0496124_0136426 Ga0496124_0136426_104_718 192
1161 3300048929 Ga0496126_0004957 Ga0496126_0004957_2094_2672 192
1162 3300048929 Ga0496126_0052922 Ga0496126_0052922_531_1184 192
1163 3300048929 Ga0496126_0106575 Ga0496126_0106575_1283_1867 192
1164 3300048929 Ga0496126_0109051 Ga0496126_0109051_770_1348 192
1165 3300048929 Ga0496126_0193712 Ga0496126_0193712_591_1175 192
1166 3300048929 Ga0496126_0365535 Ga0496126_0365535_346_924 192
1167 3300048929 Ga0496126_0492859 Ga0496126_0492859_151_729 192
1168 3300049568 Ga0501031_0000268 Ga0501031_0000268_9716_10303 192
1169 3300049569 Ga0501032_0000765 Ga0501032_0000765_10563_11150 192
1170 3300049569 Ga0501032_0324914 Ga0501032_0324914_377_970 192
1171 3300049570 Ga0501033_0000095 Ga0501033_0000095_83443_84069 192
1172 3300049570 Ga0501033_0000344 Ga0501033_0000344_2642_3229 192
1173 3300049571 Ga0501034_0000100 Ga0501034_0000100_93966_94553 192
1174 3300049571 Ga0501034_0002052 Ga0501034_0002052_23596_24222 192
1175 3300049572 Ga0501036_0000007 Ga0501036_0000007_9526_10152 192
1176 3300049572 Ga0501036_0000228 Ga0501036_0000228_28991_29578 192
1177 3300049573 Ga0501037_0000109 Ga0501037_0000109_49959_50585 192
1178 3300049573 Ga0501037_0002522 Ga0501037_0002522_5642_6229 192
1179 3300049574 Ga0501038_0000028 Ga0501038_0000028_90326_90952 192
1180 3300049574 Ga0501038_0000350 Ga0501038_0000350_14942_15529 192
1181 3300049574 Ga0501038_0259222 Ga0501038_0259222_282_923 192
1182 3300049574 Ga0501038_0275878 Ga0501038_0275878_483_1076 192
1183 3300049575 Ga0501039_0000005 Ga0501039_0000005_242039_242665 192
1184 3300049575 Ga0501039_0092091 Ga0501039_0092091_1359_1946 192
1185 3300049575 Ga0501039_0330699 Ga0501039_0330699_382_975 192
1186 3300049579 Ga0501043_0000085 Ga0501043_0000085_81783_82370 192
1187 3300049579 Ga0501043_0000122 Ga0501043_0000122_55974_56600 192
1188 3300049580 Ga0501046_0000032 Ga0501046_0000032_52359_52985 192
1189 3300049580 Ga0501046_0000426 Ga0501046_0000426_29532_30119 192
1190 3300049581 Ga0501047_0000077 Ga0501047_0000077_9418_10044 192
1191 3300049581 Ga0501047_0000493 Ga0501047_0000493_1359_1946 192
1192 3300049582 Ga0501048_0000233 Ga0501048_0000233_32547_33134 192
1193 3300049582 Ga0501048_0004655 Ga0501048_0004655_6105_6731 192
1194 3300049582 Ga0501048_0524613 Ga0501048_0524613_209_802 192
1195 3300049583 Ga0501067_0000384 Ga0501067_0000384_7029_7616 192
1196 3300049583 Ga0501067_0009253 Ga0501067_0009253_607_1233 192
1197 3300049584 Ga0501068_0003858 Ga0501068_0003858_971_1597 192
1198 3300049584 Ga0501068_0090889 Ga0501068_0090889_737_1324 192
1199 3300049585 Ga0501069_0006612 Ga0501069_0006612_4120_4746 192
1200 3300049585 Ga0501069_0032838 Ga0501069_0032838_1157_1744 192
1201 3300049585 Ga0501069_0485801 Ga0501069_0485801_122_700 192
1202 3300049586 Ga0501070_0000152 Ga0501070_0000152_49047_49673 192
1203 3300049586 Ga0501070_0001419 Ga0501070_0001419_1359_1946 192
1204 3300049588 Ga0501072_0001233 Ga0501072_0001233_598_1185 192
1205 3300049588 Ga0501072_0028477 Ga0501072_0028477_548_1174 192
1206 3300049589 Ga0501073_0001343 Ga0501073_0001343_5097_5684 192
1207 3300049589 Ga0501073_0041571 Ga0501073_0041571_980_1606 192
1208 3300049590 Ga0501074_0000094 Ga0501074_0000094_753_1340 192
1209 3300049590 Ga0501074_0009987 Ga0501074_0009987_5110_5736 192
1210 3300049741 Ga0501079_0002879 Ga0501079_0002879_2335_2922 192
1211 3300049741 Ga0501079_0072469 Ga0501079_0072469_1989_2615 192
1212 3300049741 Ga0501079_0556759 Ga0501079_0556759_152_745 192
1213 3300049742 Ga0501080_0006214 Ga0501080_0006214_1487_2074 192
1214 3300049742 Ga0501080_0258797 Ga0501080_0258797_721_1362 192
1215 3300049744 Ga0501083_0046583 Ga0501083_0046583_859_1446 192
1216 3300049822 Ga0501035_0000016 Ga0501035_0000016_184022_184648 192
1217 3300049822 Ga0501035_0000496 Ga0501035_0000496_8387_8974 192
1218 3300049822 Ga0501035_0099379 Ga0501035_0099379_129_707 192
1219 3300049822 Ga0501035_0403006 Ga0501035_0403006_406_1047 192
1220 3300049823 Ga0501044_0000970 Ga0501044_0000970_30991_31578 192
1221 3300049823 Ga0501044_0002765 Ga0501044_0002765_11334_11960 192
1222 3300049823 Ga0501044_0469149 Ga0501044_0469149_131_766 192
1223 3300049824 Ga0501045_0027447 Ga0501045_0027447_2753_3340 192
1224 3300050490 nmdc:mga03n38_196479_c1 nmdc:mga03n38_196479_c1_77_691 192
1225 3300050490 nmdc:mga03n38_22431_c1 nmdc:mga03n38_22431_c1_1842_2468 192
1226 3300050490 nmdc:mga03n38_4949_c1 nmdc:mga03n38_4949_c1_2432_3016 192
1227 3300050492 nmdc:mga0yw44_234994_c1 nmdc:mga0yw44_234994_c1_560_1174 192
1228 3300050492 nmdc:mga0yw44_31057_c1 nmdc:mga0yw44_31057_c1_536_1162 192
1229 3300050492 nmdc:mga0yw44_41674_c1 nmdc:mga0yw44_41674_c1_115_693 192
1230 3300050492 nmdc:mga0yw44_7001_c1 nmdc:mga0yw44_7001_c1_2827_3411 192
1231 3300050493 nmdc:mga0k408_119055_c1 nmdc:mga0k408_119055_c1_472_1050 192
1232 3300050494 nmdc:mga06z11_149473_c1 nmdc:mga06z11_149473_c1_559_1143 192
1233 3300050494 nmdc:mga06z11_338738_c1 nmdc:mga06z11_338738_c1_50_628 192
1234 3300050496 nmdc:mga07m45_128707_c1 nmdc:mga07m45_128707_c1_198_812 192
1235 3300050496 nmdc:mga07m45_142599_c1 nmdc:mga07m45_142599_c1_83_667 192
1236 3300050496 nmdc:mga07m45_194617_c1 nmdc:mga07m45_194617_c1_273_860 192
1237 3300050496 nmdc:mga07m45_44437_c1 nmdc:mga07m45_44437_c1_834_1418 192
1238 3300050507 nmdc:mga05p37_252921_c1 nmdc:mga05p37_252921_c1_1075_1653 192
1239 3300050508 nmdc:mga09592_645214_c1 nmdc:mga09592_645214_c1_66_689 192
1240 3300050511 nmdc:mga08y16_153990_c1 nmdc:mga08y16_153990_c1_1014_1595 192
1241 3300050511 nmdc:mga08y16_289648_c1 nmdc:mga08y16_289648_c1_497_1135 192
1242 3300050512 nmdc:mga0n895_409200_c1 nmdc:mga0n895_409200_c1_632_1216 192
1243 3300050512 nmdc:mga0n895_419144_c1 nmdc:mga0n895_419144_c1_59_643 192
1244 3300050513 nmdc:mga0rr50_526043_c1 nmdc:mga0rr50_526043_c1_403_987 192
1245 3300050513 nmdc:mga0rr50_779384_c1 nmdc:mga0rr50_779384_c1_201_785 192
1246 3300050516 nmdc:mga0sz30_111097_c1 nmdc:mga0sz30_111097_c1_581_1162 192
1247 3300050516 nmdc:mga0sz30_154243_c1 nmdc:mga0sz30_154243_c1_176_757 192
1248 3300050516 nmdc:mga0sz30_303075_c1 nmdc:mga0sz30_303075_c1_37_621 192
1249 3300050516 nmdc:mga0sz30_49431_c1 nmdc:mga0sz30_49431_c1_674_1258 192
1250 3300050516 nmdc:mga0sz30_89818_c1 nmdc:mga0sz30_89818_c1_353_967 192
1251 3300050516 nmdc:mga0sz30_93217_c1 nmdc:mga0sz30_93217_c1_530_1144 192
1252 3300053078 Ga0495612_0017319 Ga0495612_0017319_1249_1827 192
1253 3300053080 Ga0500635_0227427 Ga0500635_0227427_51_629 192
1254 3300053085 Ga0495619_0066317 Ga0495619_0066317_1485_2063 192
1255 3300053087 Ga0500643_000007 Ga0500643_000007_15966_16580 192
1256 3300053090 Ga0500646_0033663 Ga0500646_0033663_459_1073 192
1257 3300053091 Ga0500647_0010677 Ga0500647_0010677_1516_2130 192
1258 3300053093 Ga0500651_0007614 Ga0500651_0007614_4522_5100 192
1259 3300053094 Ga0500566_0000732 Ga0500566_0000732_253_906 192
1260 3300053094 Ga0500566_0008320 Ga0500566_0008320_3802_4380 192
1261 3300053095 Ga0500640_102910 Ga0500640_102910_177_791 192
1262 3300053096 Ga0500641_0059206 Ga0500641_0059206_635_1288 192
1263 3300053096 Ga0500641_0088154 Ga0500641_0088154_134_718 192
1264 3300053098 Ga0500650_0040373 Ga0500650_0040373_97_711 192
1265 3300053098 Ga0500650_0238861 Ga0500650_0238861_64_642 192
1266 3300053102 Ga0500554_063818 Ga0500554_063818_283_861 192
1267 3300053103 Ga0500555_001232 Ga0500555_001232_2672_3286 192
1268 3300053103 Ga0500555_018189 Ga0500555_018189_1410_1994 192
1269 3300053108 Ga0500562_004298 Ga0500562_004298_1983_2636 192
1270 3300053108 Ga0500562_015137 Ga0500562_015137_545_1159 192
1271 3300053116 Ga0500592_031538 Ga0500592_031538_215_793 192
1272 3300053118 Ga0500594_0003422 Ga0500594_0003422_1445_2098 192
1273 3300053119 Ga0500595_000932 Ga0500595_000932_7220_7798 192
1274 3300053119 Ga0500595_002620 Ga0500595_002620_5957_6595 192
1275 3300053119 Ga0500595_004781 Ga0500595_004781_4067_4645 192
1276 3300053119 Ga0500595_007598 Ga0500595_007598_2234_2818 192
1277 3300053119 Ga0500595_008465 Ga0500595_008465_3269_3847 192
1278 3300053120 Ga0500597_128310 Ga0500597_128310_194_808 192
1279 3300053122 Ga0500608_051069 Ga0500608_051069_1294_1947 192
1280 3300053123 Ga0500614_082112 Ga0500614_082112_180_761 192
1281 3300053124 Ga0500617_075353 Ga0500617_075353_371_955 192
1282 3300053130 Ga0500642_0031165 Ga0500642_0031165_699_1277 192
1283 3300053131 Ga0500652_001387 Ga0500652_001387_5811_6464 192
1284 3300053134 Ga0500658_0067985 Ga0500658_0067985_675_1289 192
1285 3300053136 Ga0500559_0000066 Ga0500559_0000066_75489_76142 192
1286 3300053139 Ga0500568_0004322 Ga0500568_0004322_3559_4212 192
1287 3300053139 Ga0500568_0010375 Ga0500568_0010375_3006_3641 192
1288 3300053139 Ga0500568_0014447 Ga0500568_0014447_2544_3158 192
1289 3300053147 Ga0500589_022305 Ga0500589_022305_1750_2334 192
1290 3300053148 Ga0500590_210597 Ga0500590_210597_22_645 192
1291 3300053150 Ga0500603_005970 Ga0500603_005970_35_622 192
1292 3300053151 Ga0500604_0019850 Ga0500604_0019850_1215_1829 192
1293 3300053153 Ga0500616_0068866 Ga0500616_0068866_86_700 192
1294 3300053156 Ga0500622_0216135 Ga0500622_0216135_184_798 192
1295 3300053158 Ga0500627_0148666 Ga0500627_0148666_43_657 192
1296 3300053161 Ga0500634_0074912 Ga0500634_0074912_759_1373 192
1297 3300053161 Ga0500634_0080054 Ga0500634_0080054_1027_1611 192
1298 3300053162 Ga0500638_014840 Ga0500638_014840_613_1191 192
1299 3300053162 Ga0500638_238907 Ga0500638_238907_18_596 192
1300 3300053177 Ga0500636_0002347 Ga0500636_0002347_5009_5662 192
1301 3300053177 Ga0500636_0119412 Ga0500636_0119412_378_962 192
1302 3300053178 Ga0500637_0000132 Ga0500637_0000132_14995_15573 192
1303 3300053178 Ga0500637_0010848 Ga0500637_0010848_3756_4343 192
1304 3300053178 Ga0500637_0074211 Ga0500637_0074211_845_1429 192
1305 3300053729 Ga0500625_003709 Ga0500625_003709_198_812 192
1306 3300053736 Ga0500599_000415 Ga0500599_000415_339_953 192
1307 3300054114 Ga0501084_0241325 Ga0501084_0241325_209_796 192
1308 3300055283 Ga0500661_000757 Ga0500661_000757_747_1325 192
1309 3300060353 Ga0501082_0000452 Ga0501082_0000452_19549_20136 192
1310 iso_pu_bacteria 2713897090 2715500937 192
1311 iso_pu_bacteria 2932784394 2932788807 192
1312 iso_pu_bacteria 2932828146 2932830473 192
1313 iso_pu_bacteria 2935616580 2935616767 192
1314 iso_pu_bacteria 2935638405 2935641903 192
1315 iso_pu_bacteria 2935665750 2935673034 192
1316 iso_pu_bacteria 2935694250 2935697918 192
1317 iso_pu_bacteria 2935703347 2935705676 192
1318 iso_pu_bacteria 2935801545 2935802654 192
1319 iso_pu_bacteria 2935810662 2935813516 192
1320 iso_pu_bacteria 2935827899 2935830070 192
1321 iso_pu_bacteria 2935837841 2935837988 192
1322 iso_pu_bacteria 2935855204 2935855391 192
1323 iso_pu_bacteria 2935864058 2935867365 192
1324 iso_pu_bacteria 2935873716 2935875816 192
1325 iso_pu_bacteria 2935992306 2935996480 192
1326 iso_pu_bacteria 2936002035 2936003760 192
1327 iso_pu_bacteria 2936037263 2936042465 192
1328 iso_pu_bacteria 2941538514 2941539346 192
1329 iso_pu_bacteria 8016511872 8016521818 192
1330 iso_pu_bacteria 8017057580 8017063834 192
1331 iso_pu_bacteria 8019576017 8019583183 192
1332 iso_pu_bacteria 8019586578 8019590990 192
1333 iso_pu_bacteria 8019597564 8019600355 192
1334 iso_pu_bacteria 8019608314 8019618186 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

56

113

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.9041 16 189
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.8968 8 192
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8898 12 189
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.888 8 189
2pfx-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution 0.8868 3 189
ID Description Score Start End Superfamily
2prrF01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.9785 13 65 1.20.5.810
2prrD01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.9777 13 65 1.20.5.810
2prrG01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.9771 13 65 1.20.5.810
2prrA01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.975 13 65 1.20.5.810
2prrF01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.9605 13 65 1.20.5.810
ID Description Score Start End GO Terms
AF-A0A7Z9MLV0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9606 35 174 GO:0051920
AF-L0JHT6-F1-model_v4 Peroxidase-like protein (Peroxidase-related enzyme) 0.9422 9 169 GO:0051920
AF-A0A7V2S7Z7-F1-model_v4 Peroxidase 0.9378 32 189 GO:0051920
AF-A0A2N0LYU0-F1-model_v4 DNA primase/nucleoside triphosphatase C-terminal domain-containing protein 0.9374 35 187 GO:0004386
GO:0005524
AF-A0A2E8EZX0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9345 35 187

Feature Viewer

pLDDT pTM Quality
90.38 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map