F492998

General Info

Members Datasets Scaffolds Average Seq Length
1323 394 1323 387

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100001466|Ga0070687_1000014662
Length 461
Sequence MQWLILDFGMRISDFAFATSIDYYVGPITRALDAVATRNPKSAFLPFSFCLDYDATFQLNSLKNELLDMSQSQPVMAHIPHQPLTTLSEDEQMFRSSVREFAEGELRPRVEKMDEAGKLDPAIIRQCFDLGLMGIETPEEYGGAGANFFTAILAVEELSRVDGSVGVLVDVQNTLVNNAFIRWGTPEQKEKYLQKLASESVGAYALSEPSSGSDAFALQTRAVDQGDHFSLTGQKLWITNGNEADIFVLFANANPEAGYRGITAFVVEKGFEGFSVGKKENKLGIRASSTVELILDNCRVPKENVLGELGKGYKISIETLNEGRIGIGAQMIGIATGALESALAYTGERQQFGKSINQFQGVQFQLAEMATALEAARLMVYNAARMKDAGINFVKEAAMAKLYSSRVAEQVTSKAIELYGGYGYVKDYPVEKYWRDSKIGAIYEGTSNMQLQTIAKLIIGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
135 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
136 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
253 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
262 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
263 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
266 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
355 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
356 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
357 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
358 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
359 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
360 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
361 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
362 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
363 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
364 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
365 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
366 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
372 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 3.48
Rhizosphere 95.46
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2693654 2162886007 Bacteria 123938
2 CNAas_1000470 3300000532 Bacteria 3919
3 JGI24748J21848_1000010 3300002074 Bacteria 166979
4 JGI24034J26672_10000001 3300002239 Bacteria 1118280
5 JGI24751J29686_10000056 3300002459 Bacteria 63361
6 JGI25406J46586_10006504 3300003203 Bacteria 5376
7 JGI25406J46586_10007606 3300003203 Bacteria 4933
8 Ga0065714_10002185 3300005288 Bacteria 199213
9 Ga0065704_10116876 3300005289 Bacteria 1844
10 Ga0065712_10067734 3300005290 Bacteria 110577
11 Ga0065712_10072647 3300005290 Bacteria 4668
12 Ga0065712_10150600 3300005290 Bacteria 1373
13 Ga0065712_10156460 3300005290 Bacteria 1331
14 Ga0065715_10011578 3300005293 Bacteria 2610
15 Ga0065715_10089344 3300005293 Bacteria 10999
16 Ga0065715_10093745 3300005293 Bacteria 4577
17 Ga0065715_10099294 3300005293 Bacteria 3429
18 Ga0065715_10100780 3300005293 Bacteria 3270
19 Ga0065715_10109473 3300005293 Bacteria 2659
20 Ga0065715_10142151 3300005293 Bacteria 1838
21 Ga0065715_10151108 3300005293 Bacteria 1728
22 Ga0065707_10000832 3300005295 Bacteria 11469
23 Ga0065707_10023650 3300005295 Bacteria 2490
24 Ga0065707_10097283 3300005295 Bacteria 3188
25 Ga0065707_10098409 3300005295 Unclassified 3085
26 Ga0065707_10134448 3300005295 Bacteria 1865
27 Ga0065707_10142920 3300005295 Unclassified 1744
28 Ga0065707_10149468 3300005295 Bacteria 1673
29 Ga0065707_10161456 3300005295 Bacteria 1559
30 Ga0070658_10000046 3300005327 Bacteria 130559
31 Ga0070658_10139463 3300005327 Bacteria 2024
32 Ga0070676_10074442 3300005328 Bacteria 2045
33 Ga0070676_10137230 3300005328 Bacteria 1553
34 Ga0070676_10149469 3300005328 Unclassified 1494
35 Ga0070683_100006709 3300005329 Bacteria 9668
36 Ga0070683_100012571 3300005329 Bacteria 7359
37 Ga0070683_100023637 3300005329 Bacteria 5499
38 Ga0070683_100047604 3300005329 Bacteria 3962
39 Ga0070683_100067085 3300005329 Bacteria 3342
40 Ga0070683_100067488 3300005329 Bacteria 3331
41 Ga0070683_100149279 3300005329 Bacteria 2216
42 Ga0070690_100003475 3300005330 Bacteria 8622
43 Ga0070690_100004379 3300005330 Bacteria 7833
44 Ga0070690_100013034 3300005330 Unclassified 4903
45 Ga0070690_100020111 3300005330 Bacteria 4064
46 Ga0070690_100047583 3300005330 Bacteria 2729
47 Ga0070690_100060039 3300005330 Unclassified 2446
48 Ga0070690_100194537 3300005330 Bacteria 1408
49 Ga0070670_100000889 3300005331 Bacteria 23564
50 Ga0070670_100007520 3300005331 Bacteria 9249
51 Ga0068869_100000075 3300005334 Bacteria 44767
52 Ga0068869_100003334 3300005334 Bacteria 9811
53 Ga0068869_100010708 3300005334 Bacteria 5988
54 Ga0068869_100140246 3300005334 Bacteria 1866
55 Ga0068869_100151286 3300005334 Bacteria 1800
56 Ga0070666_10101582 3300005335 Bacteria 1982
57 Ga0070666_10279407 3300005335 Bacteria 1187
58 Ga0070680_100000437 3300005336 Bacteria 28394
59 Ga0070680_100003737 3300005336 Bacteria 11373
60 Ga0070680_100015314 3300005336 Bacteria 6008
61 Ga0070680_100231308 3300005336 Bacteria 1561
62 Ga0070682_100002309 3300005337 Bacteria 10542
63 Ga0070682_100010793 3300005337 Bacteria 5196
64 Ga0068868_100027182 3300005338 Bacteria 4364
65 Ga0068868_100027426 3300005338 Bacteria 4346
66 Ga0070660_100210128 3300005339 Bacteria 1580
67 Ga0070660_100254451 3300005339 Bacteria 1433
68 Ga0070689_100000856 3300005340 Bacteria 18891
69 Ga0070689_100047275 3300005340 Bacteria 3318
70 Ga0070689_100184288 3300005340 Bacteria 1697
71 Ga0070689_100244262 3300005340 Bacteria 1479
72 Ga0070687_100001466 3300005343 Bacteria 8312
73 Ga0070687_100003842 3300005343 Bacteria 5903
74 Ga0070687_100083974 3300005343 Bacteria 1745
75 Ga0070661_100004650 3300005344 Bacteria 9454
76 Ga0070661_100004845 3300005344 Bacteria 9264
77 Ga0070661_100019425 3300005344 Bacteria 4843
78 Ga0070661_100157260 3300005344 Bacteria 1720
79 Ga0070692_10001958 3300005345 Bacteria 7803
80 Ga0070692_10012594 3300005345 Bacteria 3919
81 Ga0070692_10017661 3300005345 Bacteria 3416
82 Ga0070668_100029411 3300005347 Bacteria 4173
83 Ga0070668_100120559 3300005347 Bacteria 2096
84 Ga0070668_100179078 3300005347 Bacteria 1730
85 Ga0070669_100003717 3300005353 Bacteria 11009
86 Ga0070669_100006696 3300005353 Bacteria 8294
87 Ga0070669_100021822 3300005353 Bacteria 4578
88 Ga0070669_100132463 3300005353 Unclassified 1914
89 Ga0070675_100000536 3300005354 Bacteria 25967
90 Ga0070675_100001582 3300005354 Bacteria 16807
91 Ga0070675_100009611 3300005354 Bacteria 7526
92 Ga0070675_100014027 3300005354 Bacteria 6311
93 Ga0070675_100015272 3300005354 Bacteria 6066
94 Ga0070675_100020027 3300005354 Bacteria 5338
95 Ga0070671_100003022 3300005355 Bacteria 13097
96 Ga0070671_100090127 3300005355 Bacteria 2567
97 Ga0070671_100106348 3300005355 Bacteria 2355
98 Ga0070671_100114487 3300005355 Bacteria 2267
99 Ga0070674_100000037 3300005356 Bacteria 58487
100 Ga0070674_100012898 3300005356 Bacteria 5147
101 Ga0070674_100041437 3300005356 Bacteria 3121
102 Ga0070674_100132515 3300005356 Bacteria 1860
103 Ga0070673_100010550 3300005364 Bacteria 6257
104 Ga0070673_100062058 3300005364 Bacteria 2968
105 Ga0070673_100099095 3300005364 Bacteria 2396
106 Ga0070673_100236907 3300005364 Bacteria 1585
107 Ga0070688_100078593 3300005365 Bacteria 2129
108 Ga0070688_100095408 3300005365 Bacteria 1952
109 Ga0070688_100180552 3300005365 Bacteria 1464
110 Ga0070659_100025513 3300005366 Unclassified 4540
111 Ga0070659_100037463 3300005366 Bacteria 3780
112 Ga0070667_100057510 3300005367 Bacteria 3287
113 Ga0070667_100121496 3300005367 Bacteria 2272
114 Ga0070667_100289921 3300005367 Bacteria 1471
115 Ga0070703_10000156 3300005406 Bacteria 34533
116 Ga0070703_10009971 3300005406 Bacteria 2681
117 Ga0070709_10228113 3300005434 Viruses 1331
118 Ga0070714_100028393 3300005435 Bacteria 4641
119 Ga0070714_100038550 3300005435 Bacteria 4017
120 Ga0070714_100052831 3300005435 Bacteria 3466
121 Ga0070713_100057569 3300005436 Bacteria 3237
122 Ga0070713_100088623 3300005436 Bacteria 2656
123 Ga0070710_10068198 3300005437 Unclassified 2043
124 Ga0070701_10035842 3300005438 Unclassified 2496
125 Ga0070711_100022934 3300005439 Bacteria 4053
126 Ga0070711_100043003 3300005439 Unclassified 3057
127 Ga0070705_100001046 3300005440 Bacteria 15427
128 Ga0070705_100007548 3300005440 Bacteria 5356
129 Ga0070705_100036640 3300005440 Bacteria 2760
130 Ga0070705_100141095 3300005440 Bacteria 1586
131 Ga0070700_100001938 3300005441 Bacteria 10477
132 Ga0070700_100009192 3300005441 Bacteria 5418
133 Ga0070700_100033040 3300005441 Unclassified 3114
134 Ga0070694_100004087 3300005444 Bacteria 8758
135 Ga0070694_100025213 3300005444 Bacteria 3846
136 Ga0070694_100041734 3300005444 Unclassified 3062
137 Ga0070694_100045846 3300005444 Bacteria 2932
138 Ga0070694_100062659 3300005444 Bacteria 2541
139 Ga0070708_100087193 3300005445 Bacteria 2836
140 Ga0070708_100132214 3300005445 Bacteria 2310
141 Ga0070663_100017038 3300005455 Bacteria 4732
142 Ga0070663_100032742 3300005455 Bacteria 3586
143 Ga0070663_100177259 3300005455 Bacteria 1651
144 Ga0070678_100001127 3300005456 Bacteria 14061
145 Ga0070678_100059496 3300005456 Bacteria 2808
146 Ga0070678_100077113 3300005456 Bacteria 2513
147 Ga0070662_100000166 3300005457 Bacteria 38279
148 Ga0070662_100027395 3300005457 Bacteria 3955
149 Ga0070681_10003060 3300005458 Bacteria 15508
150 Ga0070681_10004349 3300005458 Bacteria 13473
151 Ga0070681_10005084 3300005458 Bacteria 12688
152 Ga0070681_10008029 3300005458 Bacteria 10335
153 Ga0070681_10041987 3300005458 Bacteria 4584
154 Ga0070681_10055395 3300005458 Bacteria 3948
155 Ga0070681_10318086 3300005458 Bacteria 1466
156 Ga0068867_100000549 3300005459 Bacteria 24738
157 Ga0068867_100021218 3300005459 Bacteria 4634
158 Ga0070685_10031745 3300005466 Bacteria 2954
159 Ga0070706_100000398 3300005467 Bacteria 52374
160 Ga0070706_100006309 3300005467 Bacteria 11203
161 Ga0070706_100076465 3300005467 Bacteria 3098
162 Ga0070706_100118654 3300005467 Bacteria 2465
163 Ga0070706_100236204 3300005467 Unclassified 1707
164 Ga0070707_100000116 3300005468 Bacteria 74392
165 Ga0070707_100035627 3300005468 Bacteria 4748
166 Ga0070707_100037853 3300005468 Bacteria 4606
167 Ga0070707_100042070 3300005468 Bacteria 4373
168 Ga0070707_100238081 3300005468 Bacteria 1772
169 Ga0070698_100000618 3300005471 Bacteria 38241
170 Ga0070698_100000709 3300005471 Bacteria 35662
171 Ga0070698_100004867 3300005471 Bacteria 14741
172 Ga0070698_100004914 3300005471 Bacteria 14661
173 Ga0070698_100007013 3300005471 Bacteria 12206
174 Ga0070698_100020931 3300005471 Bacteria 6853
175 Ga0070698_100166533 3300005471 Unclassified 2147
176 Ga0070698_100244942 3300005471 Bacteria 1725
177 Ga0070699_100000017 3300005518 Bacteria 201366
178 Ga0070699_100000218 3300005518 Bacteria 57007
179 Ga0070699_100005300 3300005518 Bacteria 11309
180 Ga0070699_100013455 3300005518 Bacteria 7046
181 Ga0070699_100016295 3300005518 Bacteria 6382
182 Ga0070699_100034944 3300005518 Unclassified 4343
183 Ga0070699_100055683 3300005518 Bacteria 3424
184 Ga0070679_100000891 3300005530 Bacteria 25931
185 Ga0070679_100001158 3300005530 Bacteria 23071
186 Ga0070679_100001702 3300005530 Bacteria 19818
187 Ga0070679_100003140 3300005530 Bacteria 15100
188 Ga0070679_100018797 3300005530 Bacteria 6709
189 Ga0070679_100047521 3300005530 Bacteria 4278
190 Ga0070679_100102158 3300005530 Bacteria 2853
191 Ga0070684_100000156 3300005535 Bacteria 46517
192 Ga0070684_100001666 3300005535 Bacteria 16133
193 Ga0070684_100019966 3300005535 Bacteria 5555
194 Ga0070684_100063995 3300005535 Unclassified 3226
195 Ga0070684_100092905 3300005535 Bacteria 2685
196 Ga0070684_100133658 3300005535 Bacteria 2239
197 Ga0070684_100255889 3300005535 Bacteria 1601
198 Ga0070697_100000740 3300005536 Bacteria 24384
199 Ga0070697_100003833 3300005536 Bacteria 11546
200 Ga0070697_100005751 3300005536 Bacteria 9561
201 Ga0070697_100017334 3300005536 Bacteria 5666
202 Ga0070697_100208994 3300005536 Bacteria 1661
203 Ga0070697_100268105 3300005536 Bacteria 1463
204 Ga0068853_100000415 3300005539 Bacteria 29266
205 Ga0068853_100002224 3300005539 Bacteria 14501
206 Ga0068853_100039195 3300005539 Bacteria 4041
207 Ga0068853_100133451 3300005539 Unclassified 2224
208 Ga0070672_100000260 3300005543 Bacteria 29881
209 Ga0070672_100088594 3300005543 Bacteria 2492
210 Ga0070686_100000024 3300005544 Bacteria 128637
211 Ga0070686_100001910 3300005544 Bacteria 11598
212 Ga0070686_100017342 3300005544 Bacteria 4206
213 Ga0070686_100048979 3300005544 Unclassified 2679
214 Ga0070686_100057722 3300005544 Bacteria 2494
215 Ga0070686_100091867 3300005544 Bacteria 2032
216 Ga0070686_100099303 3300005544 Bacteria 1964
217 Ga0070686_100182746 3300005544 Bacteria 1491
218 Ga0070686_100240096 3300005544 Bacteria 1319
219 Ga0070695_100010571 3300005545 Bacteria 5514
220 Ga0070695_100016065 3300005545 Unclassified 4526
221 Ga0070695_100045580 3300005545 Bacteria 2796
222 Ga0070695_100083077 3300005545 Bacteria 2122
223 Ga0070696_100001986 3300005546 Bacteria 13432
224 Ga0070696_100011419 3300005546 Bacteria 5950
225 Ga0070696_100034724 3300005546 Bacteria 3470
226 Ga0070696_100063531 3300005546 Bacteria 2586
227 Ga0070693_100000344 3300005547 Bacteria 21170
228 Ga0070693_100004279 3300005547 Bacteria 6738
229 Ga0070693_100007936 3300005547 Bacteria 5209
230 Ga0070693_100111460 3300005547 Bacteria 1684
231 Ga0070665_100009896 3300005548 Bacteria 9641
232 Ga0070665_100145506 3300005548 Bacteria 2373
233 Ga0070665_100203306 3300005548 Bacteria 1981
234 Ga0070665_100215601 3300005548 Bacteria 1920
235 Ga0070704_100000287 3300005549 Bacteria 22139
236 Ga0070704_100009245 3300005549 Bacteria 5947
237 Ga0070704_100012406 3300005549 Bacteria 5263
238 Ga0070704_100021303 3300005549 Bacteria 4201
239 Ga0070704_100035771 3300005549 Bacteria 3378
240 Ga0070704_100141274 3300005549 Bacteria 1880
241 Ga0070704_100142232 3300005549 Bacteria 1875
242 Ga0070704_100219717 3300005549 Bacteria 1544
243 Ga0068855_100000813 3300005563 Bacteria 38637
244 Ga0068855_100001805 3300005563 Bacteria 26734
245 Ga0068855_100002494 3300005563 Bacteria 22679
246 Ga0068855_100019453 3300005563 Bacteria 8159
247 Ga0068855_100021927 3300005563 Bacteria 7658
248 Ga0068855_100022173 3300005563 Bacteria 7609
249 Ga0068855_100108337 3300005563 Bacteria 3191
250 Ga0070664_100005472 3300005564 Bacteria 10196
251 Ga0070664_100005502 3300005564 Bacteria 10172
252 Ga0070664_100016432 3300005564 Bacteria 6067
253 Ga0070664_100091324 3300005564 Bacteria 2635
254 Ga0070664_100093741 3300005564 Bacteria 2602
255 Ga0070664_100199603 3300005564 Bacteria 1785
256 Ga0070664_100376135 3300005564 Bacteria 1296
257 Ga0068857_100008882 3300005577 Bacteria 8703
258 Ga0068857_100010553 3300005577 Bacteria 8031
259 Ga0068857_100012268 3300005577 Bacteria 7455
260 Ga0068857_100012447 3300005577 Bacteria 7407
261 Ga0068857_100098099 3300005577 Bacteria 2628
262 Ga0068857_100104333 3300005577 Bacteria 2545
263 Ga0068854_100001279 3300005578 Bacteria 15134
264 Ga0068854_100021685 3300005578 Bacteria 4362
265 Ga0068854_100041517 3300005578 Bacteria 3250
266 Ga0068854_100045901 3300005578 Bacteria 3109
267 Ga0068854_100104596 3300005578 Bacteria 2127
268 Ga0068854_100281018 3300005578 Bacteria 1340
269 Ga0068856_100001375 3300005614 Bacteria 25577
270 Ga0068856_100002127 3300005614 Bacteria 20559
271 Ga0068856_100010508 3300005614 Bacteria 8986
272 Ga0068856_100026987 3300005614 Bacteria 5602
273 Ga0068856_100068405 3300005614 Unclassified 3510
274 Ga0068856_100116610 3300005614 Bacteria 2671
275 Ga0070702_100004315 3300005615 Bacteria 6483
276 Ga0068852_100000078 3300005616 Bacteria 68720
277 Ga0068852_100000115 3300005616 Bacteria 54428
278 Ga0068852_100008157 3300005616 Bacteria 7691
279 Ga0068852_100025704 3300005616 Bacteria 4775
280 Ga0068852_100035861 3300005616 Bacteria 4143
281 Ga0068852_100172114 3300005616 Unclassified 2031
282 Ga0068859_100000577 3300005617 Bacteria 36570
283 Ga0068859_100001475 3300005617 Bacteria 23925
284 Ga0068859_100003113 3300005617 Bacteria 16848
285 Ga0068859_100006029 3300005617 Bacteria 12311
286 Ga0068859_100008971 3300005617 Bacteria 10099
287 Ga0068859_100014348 3300005617 Bacteria 7947
288 Ga0068859_100014432 3300005617 Bacteria 7928
289 Ga0068859_100019911 3300005617 Bacteria 6736
290 Ga0068859_100020137 3300005617 Bacteria 6698
291 Ga0068859_100021360 3300005617 Bacteria 6496
292 Ga0068859_100034802 3300005617 Bacteria 5054
293 Ga0068859_100057598 3300005617 Bacteria 3914
294 Ga0068859_100080645 3300005617 Bacteria 3295
295 Ga0068859_100096484 3300005617 Bacteria 3009
296 Ga0068859_100112244 3300005617 Bacteria 2789
297 Ga0068859_100172310 3300005617 Unclassified 2245
298 Ga0068859_100187661 3300005617 Unclassified 2151
299 Ga0068859_100368080 3300005617 Bacteria 1533
300 Ga0068864_100009469 3300005618 Bacteria 8038
301 Ga0068864_100011351 3300005618 Bacteria 7361
302 Ga0068864_100028764 3300005618 Bacteria 4701
303 Ga0068864_100044023 3300005618 Bacteria 3824
304 Ga0068864_100069777 3300005618 Bacteria 3056
305 Ga0068864_100218747 3300005618 Bacteria 1757
306 Ga0068864_100228445 3300005618 Unclassified 1720
307 Ga0068864_100300740 3300005618 Bacteria 1502
308 Ga0068866_10000082 3300005718 Bacteria 38611
309 Ga0068861_100000185 3300005719 Bacteria 33242
310 Ga0068861_100019842 3300005719 Bacteria 4805
311 Ga0068861_100029619 3300005719 Unclassified 4006
312 Ga0068861_100034463 3300005719 Bacteria 3744
313 Ga0068861_100247585 3300005719 Bacteria 1519
314 Ga0068851_10003547 3300005834 Bacteria 6947
315 Ga0068851_10004209 3300005834 Bacteria 6480
316 Ga0068851_10008901 3300005834 Bacteria 4656
317 Ga0068851_10117853 3300005834 Bacteria 1424
318 Ga0068870_10033170 3300005840 Bacteria 2633
319 Ga0068863_100005375 3300005841 Bacteria 12630
320 Ga0068863_100032114 3300005841 Bacteria 5006
321 Ga0068863_100071479 3300005841 Bacteria 3282
322 Ga0068863_100099569 3300005841 Bacteria 2762
323 Ga0068863_100126254 3300005841 Bacteria 2441
324 Ga0068863_100262617 3300005841 Unclassified 1669
325 Ga0068858_100025815 3300005842 Bacteria 5464
326 Ga0068858_100080069 3300005842 Bacteria 3035
327 Ga0068858_100091109 3300005842 Bacteria 2838
328 Ga0068858_100093468 3300005842 Bacteria 2799
329 Ga0068858_100156416 3300005842 Unclassified 2145
330 Ga0068858_100243831 3300005842 Bacteria 1705
331 Ga0068860_100008828 3300005843 Bacteria 10042
332 Ga0068860_100019485 3300005843 Bacteria 6577
333 Ga0068860_100031492 3300005843 Bacteria 5098
334 Ga0068860_100045952 3300005843 Bacteria 4164
335 Ga0068860_100055574 3300005843 Unclassified 3764
336 Ga0068860_100062841 3300005843 Bacteria 3528
337 Ga0068860_100110848 3300005843 Unclassified 2623
338 Ga0068860_100111516 3300005843 Bacteria 2615
339 Ga0068860_100174359 3300005843 Bacteria 2078
340 Ga0068860_100188746 3300005843 Bacteria 1994
341 Ga0068860_100212446 3300005843 Unclassified 1877
342 Ga0068860_100391034 3300005843 Bacteria 1374
343 Ga0068862_100011311 3300005844 Bacteria 7369
344 Ga0068862_100020962 3300005844 Bacteria 5461
345 Ga0068862_100040644 3300005844 Bacteria 3953
346 Ga0068862_100047635 3300005844 Bacteria 3659
347 Ga0068862_100082393 3300005844 Bacteria 2792
348 Ga0068862_100082808 3300005844 Unclassified 2785
349 Ga0068862_100144653 3300005844 Bacteria 2112
350 Ga0068862_100189705 3300005844 Bacteria 1849
351 Ga0081455_10002244 3300005937 Bacteria 23006
352 Ga0081455_10137035 3300005937 Bacteria 1906
353 Ga0081455_10238655 3300005937 Eukaryota 1337
354 Ga0081538_10001985 3300005981 Bacteria 20431
355 Ga0081540_1017194 3300005983 Bacteria 4485
356 Ga0081539_10000307 3300005985 Bacteria 109928
357 Ga0081539_10001567 3300005985 Bacteria 37931
358 Ga0081539_10010720 3300005985 Bacteria 7387
359 Ga0081539_10019484 3300005985 Bacteria 4640
360 Ga0070717_10006957 3300006028 Bacteria 8361
361 Ga0070717_10015206 3300006028 Bacteria 5939
362 Ga0075367_10104213 3300006178 Bacteria 1736
363 Ga0097621_100030665 3300006237 Bacteria 4259
364 Ga0097621_100053001 3300006237 Bacteria 3306
365 Ga0097621_100055551 3300006237 Bacteria 3234
366 Ga0097621_100082386 3300006237 Bacteria 2679
367 Ga0097621_100106753 3300006237 Bacteria 2362
368 Ga0097621_100168847 3300006237 Bacteria 1885
369 Ga0068871_100003452 3300006358 Bacteria 10863
370 Ga0068871_100014588 3300006358 Bacteria 5861
371 Ga0068871_100019371 3300006358 Bacteria 5196
372 Ga0068871_100068113 3300006358 Unclassified 2922
373 Ga0075428_100002518 3300006844 Bacteria 19913
374 Ga0075428_100014111 3300006844 Bacteria 8890
375 Ga0075428_100068259 3300006844 Bacteria 3889
376 Ga0075428_100078891 3300006844 Bacteria 3594
377 Ga0075428_100248033 3300006844 Bacteria 1919
378 Ga0075428_100473274 3300006844 Bacteria 1341
379 Ga0075430_100000375 3300006846 Bacteria 32808
380 Ga0075430_100008995 3300006846 Bacteria 8440
381 Ga0075430_100012483 3300006846 Bacteria 7230
382 Ga0075431_100030736 3300006847 Bacteria 5533
383 Ga0075431_100041012 3300006847 Bacteria 4772
384 Ga0075431_100061259 3300006847 Bacteria 3882
385 Ga0075431_100143234 3300006847 Unclassified 2463
386 Ga0075431_100204556 3300006847 Bacteria 2019
387 Ga0075431_100389444 3300006847 Bacteria 1396
388 Ga0075433_10014212 3300006852 Bacteria 6499
389 Ga0075433_10114057 3300006852 Bacteria 2397
390 Ga0075433_10143119 3300006852 Bacteria 2125
391 Ga0075433_10228255 3300006852 Bacteria 1654
392 Ga0075433_10259398 3300006852 Bacteria 1541
393 Ga0075434_100000441 3300006871 Bacteria 30825
394 Ga0075434_100027765 3300006871 Bacteria 5558
395 Ga0075434_100040210 3300006871 Bacteria 4631
396 Ga0075429_100002520 3300006880 Bacteria 15428
397 Ga0075429_100009297 3300006880 Bacteria 8532
398 Ga0075429_100026821 3300006880 Bacteria 5002
399 Ga0075429_100158669 3300006880 Bacteria 1981
400 Ga0075429_100181685 3300006880 Bacteria 1843
401 Ga0075429_100194234 3300006880 Bacteria 1778
402 Ga0075429_100204383 3300006880 Bacteria 1731
403 Ga0068865_100003404 3300006881 Bacteria 9519
404 Ga0068865_100015488 3300006881 Bacteria 4864
405 Ga0068865_100071048 3300006881 Bacteria 2468
406 Ga0068865_100079570 3300006881 Bacteria 2348
407 Ga0075436_100008926 3300006914 Bacteria 6863
408 Ga0075436_100044229 3300006914 Unclassified 3070
409 Ga0075436_100080576 3300006914 Bacteria 2256
410 Ga0075436_100112466 3300006914 Bacteria 1901
411 Ga0097620_100000577 3300006931 Bacteria 36570
412 Ga0097620_100001475 3300006931 Bacteria 23925
413 Ga0097620_100003112 3300006931 Bacteria 16848
414 Ga0097620_100006029 3300006931 Bacteria 12311
415 Ga0097620_100008971 3300006931 Bacteria 10099
416 Ga0097620_100014348 3300006931 Bacteria 7947
417 Ga0097620_100014432 3300006931 Bacteria 7928
418 Ga0097620_100019911 3300006931 Bacteria 6736
419 Ga0097620_100020137 3300006931 Bacteria 6698
420 Ga0097620_100021361 3300006931 Bacteria 6496
421 Ga0097620_100034802 3300006931 Bacteria 5054
422 Ga0097620_100057605 3300006931 Bacteria 3914
423 Ga0097620_100080648 3300006931 Bacteria 3295
424 Ga0097620_100096478 3300006931 Bacteria 3009
425 Ga0097620_100112238 3300006931 Bacteria 2789
426 Ga0097620_100172310 3300006931 Unclassified 2245
427 Ga0097620_100187652 3300006931 Unclassified 2151
428 Ga0097620_100368084 3300006931 Bacteria 1533
429 Ga0075435_100057388 3300007076 Bacteria 3149
430 Ga0075435_100060000 3300007076 Bacteria 3084
431 Ga0075435_100075773 3300007076 Bacteria 2756
432 Ga0075435_100183299 3300007076 Bacteria 1770
433 Ga0075435_100222723 3300007076 Bacteria 1602
434 Ga0105240_10000065 3300009093 Bacteria 213992
435 Ga0105240_10001944 3300009093 Bacteria 34235
436 Ga0105240_10004329 3300009093 Bacteria 21676
437 Ga0105240_10012168 3300009093 Bacteria 11912
438 Ga0105240_10044951 3300009093 Bacteria 5605
439 Ga0105240_10069811 3300009093 Bacteria 4348
440 Ga0105240_10077055 3300009093 Bacteria 4109
441 Ga0105240_10187999 3300009093 Bacteria 2431
442 Ga0105240_10359232 3300009093 Bacteria 1650
443 Ga0111539_10000388 3300009094 Bacteria 54349
444 Ga0111539_10000639 3300009094 Bacteria 45247
445 Ga0111539_10011285 3300009094 Bacteria 11224
446 Ga0111539_10013205 3300009094 Bacteria 10326
447 Ga0111539_10024116 3300009094 Bacteria 7471
448 Ga0111539_10029060 3300009094 Bacteria 6740
449 Ga0111539_10061355 3300009094 Bacteria 4455
450 Ga0111539_10307217 3300009094 Bacteria 1846
451 Ga0111539_10307601 3300009094 Bacteria 1844
452 Ga0105245_10007874 3300009098 Bacteria 9320
453 Ga0105245_10038945 3300009098 Bacteria 4230
454 Ga0105247_10003178 3300009101 Bacteria 10827
455 Ga0105247_10017711 3300009101 Bacteria 4272
456 Ga0105247_10029047 3300009101 Unclassified 3348
457 Ga0114129_10012045 3300009147 Bacteria 12301
458 Ga0114129_10013218 3300009147 Bacteria 11758
459 Ga0114129_10024316 3300009147 Bacteria 8583
460 Ga0114129_10027646 3300009147 Bacteria 8032
461 Ga0114129_10043058 3300009147 Bacteria 6354
462 Ga0114129_10050670 3300009147 Bacteria 5832
463 Ga0114129_10109310 3300009147 Unclassified 3817
464 Ga0114129_10175465 3300009147 Bacteria 2919
465 Ga0114129_10255996 3300009147 Bacteria 2348
466 Ga0114129_10416922 3300009147 Bacteria 1767
467 Ga0114129_10475036 3300009147 Bacteria 1637
468 Ga0105243_10001325 3300009148 Bacteria 22076
469 Ga0105243_10003523 3300009148 Bacteria 12650
470 Ga0105243_10170660 3300009148 Bacteria 1883
471 Ga0105241_10003539 3300009174 Bacteria 11619
472 Ga0105241_10008905 3300009174 Bacteria 7381
473 Ga0105241_10021446 3300009174 Unclassified 4774
474 Ga0105242_10000510 3300009176 Bacteria 30672
475 Ga0105242_10071159 3300009176 Bacteria 2886
476 Ga0105242_10078202 3300009176 Bacteria 2761
477 Ga0105242_10117023 3300009176 Bacteria 2281
478 Ga0105248_10001549 3300009177 Bacteria 25595
479 Ga0105248_10003156 3300009177 Bacteria 18244
480 Ga0105248_10003227 3300009177 Bacteria 18083
481 Ga0105248_10022647 3300009177 Bacteria 6972
482 Ga0105248_10033114 3300009177 Bacteria 5772
483 Ga0105248_10067092 3300009177 Bacteria 4028
484 Ga0105248_10099534 3300009177 Bacteria 3276
485 Ga0105248_10103024 3300009177 Bacteria 3217
486 Ga0105248_10104101 3300009177 Bacteria 3199
487 Ga0105248_10248953 3300009177 Unclassified 2000
488 Ga0105248_10252994 3300009177 Bacteria 1983
489 Ga0105237_10001357 3300009545 Bacteria 32399
490 Ga0105237_10003279 3300009545 Bacteria 19320
491 Ga0105237_10027016 3300009545 Bacteria 5861
492 Ga0105237_10028333 3300009545 Bacteria 5706
493 Ga0105237_10041398 3300009545 Bacteria 4646
494 Ga0105237_10072843 3300009545 Unclassified 3429
495 Ga0105237_10209489 3300009545 Bacteria 1949
496 Ga0105237_10349758 3300009545 Bacteria 1482
497 Ga0105238_10000026 3300009551 Bacteria 195584
498 Ga0105238_10000383 3300009551 Bacteria 47415
499 Ga0105238_10003867 3300009551 Bacteria 14874
500 Ga0105238_10006224 3300009551 Bacteria 11856
501 Ga0105238_10012433 3300009551 Bacteria 8585
502 Ga0105238_10126461 3300009551 Bacteria 2534
503 Ga0105238_10270192 3300009551 Bacteria 1681
504 Ga0105249_10003384 3300009553 Bacteria 13812
505 Ga0105249_10018961 3300009553 Bacteria 6133
506 Ga0105249_10034297 3300009553 Bacteria 4599
507 Ga0105249_10053540 3300009553 Bacteria 3689
508 Ga0105249_10260717 3300009553 Unclassified 1722
509 Ga0105249_10289085 3300009553 Bacteria 1640
510 Ga0105249_10291589 3300009553 Bacteria 1633
511 Ga0105239_10001172 3300010375 Bacteria 36021
512 Ga0105239_10030177 3300010375 Bacteria 5961
513 Ga0105239_10047356 3300010375 Bacteria 4712
514 Ga0105239_10054001 3300010375 Unclassified 4406
515 Ga0105239_10074505 3300010375 Bacteria 3732
516 Ga0105239_10494653 3300010375 Bacteria 1390
517 Ga0105239_10608650 3300010375 Bacteria 1246
518 Ga0105246_10034737 3300011119 Bacteria 3362
519 Ga0157373_10001239 3300013100 Bacteria 19501
520 Ga0157373_10025473 3300013100 Bacteria 4278
521 Ga0157373_10063725 3300013100 Bacteria 2610
522 Ga0157373_10074582 3300013100 Bacteria 2393
523 Ga0157373_10103058 3300013100 Bacteria 2007
524 Ga0157370_10000009 3300013104 Bacteria 231270
525 Ga0157370_10094228 3300013104 Bacteria 2809
526 Ga0157370_10115707 3300013104 Bacteria 2505
527 Ga0157369_10000022 3300013105 Bacteria 233081
528 Ga0157369_10000182 3300013105 Bacteria 87266
529 Ga0157369_10000736 3300013105 Bacteria 42226
530 Ga0157369_10001143 3300013105 Bacteria 33113
531 Ga0157369_10002547 3300013105 Bacteria 21804
532 Ga0157369_10007234 3300013105 Bacteria 12786
533 Ga0157369_10016432 3300013105 Bacteria 8323
534 Ga0157369_10024421 3300013105 Bacteria 6724
535 Ga0157369_10032097 3300013105 Bacteria 5776
536 Ga0157374_10000840 3300013296 Bacteria 26836
537 Ga0157374_10047498 3300013296 Bacteria 3981
538 Ga0157374_10064495 3300013296 Bacteria 3437
539 Ga0157374_10075531 3300013296 Bacteria 3184
540 Ga0157374_10206073 3300013296 Bacteria 1927
541 Ga0157378_10000139 3300013297 Bacteria 68304
542 Ga0157378_10004092 3300013297 Bacteria 12882
543 Ga0157378_10020221 3300013297 Bacteria 5856
544 Ga0157378_10037501 3300013297 Bacteria 4293
545 Ga0157378_10088134 3300013297 Bacteria 2816
546 Ga0157378_10105557 3300013297 Bacteria 2576
547 Ga0157378_10177938 3300013297 Bacteria 1999
548 Ga0157378_10208192 3300013297 Bacteria 1853
549 Ga0157378_10255954 3300013297 Bacteria 1678
550 Ga0163162_10003865 3300013306 Bacteria 14371
551 Ga0163162_10004681 3300013306 Bacteria 13193
552 Ga0163162_10005200 3300013306 Bacteria 12549
553 Ga0163162_10006709 3300013306 Bacteria 11160
554 Ga0163162_10007386 3300013306 Bacteria 10687
555 Ga0163162_10008625 3300013306 Bacteria 9932
556 Ga0163162_10016838 3300013306 Bacteria 7146
557 Ga0163162_10071353 3300013306 Bacteria 3526
558 Ga0163162_10097565 3300013306 Bacteria 3027
559 Ga0157372_10000192 3300013307 Bacteria 67358
560 Ga0157372_10010259 3300013307 Bacteria 9950
561 Ga0157372_10010433 3300013307 Bacteria 9880
562 Ga0157372_10020033 3300013307 Bacteria 7212
563 Ga0157372_10020682 3300013307 Bacteria 7102
564 Ga0157372_10426303 3300013307 Bacteria 1546
565 Ga0157375_10032521 3300013308 Bacteria 4949
566 Ga0157375_10154751 3300013308 Bacteria 2431
567 Ga0157375_10170298 3300013308 Unclassified 2325
568 Ga0157375_10176668 3300013308 Bacteria 2285
569 Ga0163163_10003111 3300014325 Bacteria 14066
570 Ga0163163_10004709 3300014325 Bacteria 11685
571 Ga0163163_10008091 3300014325 Bacteria 9316
572 Ga0163163_10022262 3300014325 Bacteria 5997
573 Ga0163163_10023181 3300014325 Bacteria 5889
574 Ga0163163_10035193 3300014325 Bacteria 4856
575 Ga0163163_10051589 3300014325 Unclassified 4055
576 Ga0163163_10054848 3300014325 Unclassified 3939
577 Ga0163163_10059753 3300014325 Bacteria 3772
578 Ga0163163_10100962 3300014325 Bacteria 2907
579 Ga0163163_10206179 3300014325 Bacteria 2014
580 Ga0163163_10246882 3300014325 Bacteria 1835
581 Ga0163163_10324747 3300014325 Unclassified 1593
582 Ga0163163_10524759 3300014325 Bacteria 1247
583 Ga0157380_10000235 3300014326 Bacteria 33292
584 Ga0157380_10002344 3300014326 Bacteria 12728
585 Ga0157380_10010623 3300014326 Bacteria 6626
586 Ga0157380_10010831 3300014326 Bacteria 6573
587 Ga0157380_10014492 3300014326 Bacteria 5768
588 Ga0157380_10025236 3300014326 Bacteria 4505
589 Ga0157380_10028806 3300014326 Bacteria 4239
590 Ga0157380_10039539 3300014326 Bacteria 3669
591 Ga0157380_10050185 3300014326 Bacteria 3295
592 Ga0157380_10058723 3300014326 Bacteria 3067
593 Ga0157380_10092581 3300014326 Bacteria 2498
594 Ga0157380_10104525 3300014326 Bacteria 2365
595 Ga0157380_10129415 3300014326 Bacteria 2151
596 Ga0157377_10033854 3300014745 Unclassified 2792
597 Ga0157377_10069635 3300014745 Bacteria 2030
598 Ga0157379_10013112 3300014968 Bacteria 7256
599 Ga0157379_10016412 3300014968 Bacteria 6515
600 Ga0157379_10020055 3300014968 Bacteria 5908
601 Ga0157379_10025878 3300014968 Bacteria 5217
602 Ga0157379_10062835 3300014968 Bacteria 3320
603 Ga0157379_10082922 3300014968 Unclassified 2873
604 Ga0157379_10097113 3300014968 Bacteria 2644
605 Ga0157376_10011777 3300014969 Bacteria 6461
606 Ga0157376_10015437 3300014969 Bacteria 5770
607 Ga0157376_10035676 3300014969 Unclassified 4024
608 Ga0157376_10249171 3300014969 Bacteria 1658
609 Ga0157376_10372524 3300014969 Unclassified 1373
610 Ga0163161_10003958 3300017792 Bacteria 10397
611 Ga0163161_10005427 3300017792 Bacteria 8851
612 Ga0163161_10173788 3300017792 Unclassified 1648
613 Ga0213872_10004718 3300021361 Bacteria 7153
614 Ga0213876_10000060 3300021384 Bacteria 131803
615 Ga0213876_10000672 3300021384 Bacteria 24372
616 Ga0213875_10010805 3300021388 Bacteria 4563
617 Ga0224570_100762 3300022730 Bacteria 2565
618 Ga0224569_100573 3300022732 Bacteria 3163
619 Ga0228598_1001301 3300024227 Bacteria 5487
620 Ga0207697_10011127 3300025315 Bacteria 3814
621 Ga0207697_10017280 3300025315 Bacteria 2965
622 Ga0207656_10092079 3300025321 Bacteria 1377
623 Ga0207692_10051049 3300025898 Unclassified 2095
624 Ga0207642_10000577 3300025899 Bacteria 11292
625 Ga0207642_10007455 3300025899 Bacteria 3699
626 Ga0207710_10023444 3300025900 Unclassified 2653
627 Ga0207680_10045714 3300025903 Bacteria 2583
628 Ga0207647_10005644 3300025904 Bacteria 9138
629 Ga0207647_10046121 3300025904 Bacteria 2716
630 Ga0207647_10056800 3300025904 Unclassified 2401
631 Ga0207699_10029239 3300025906 Bacteria 3071
632 Ga0207645_10001386 3300025907 Bacteria 19878
633 Ga0207645_10017279 3300025907 Bacteria 4765
634 Ga0207645_10070079 3300025907 Bacteria 2243
635 Ga0207643_10006159 3300025908 Bacteria 6420
636 Ga0207705_10000064 3300025909 Bacteria 141200
637 Ga0207684_10000358 3300025910 Bacteria 62368
638 Ga0207684_10005157 3300025910 Bacteria 12161
639 Ga0207684_10016528 3300025910 Bacteria 6334
640 Ga0207684_10112028 3300025910 Bacteria 2336
641 Ga0207684_10253264 3300025910 Bacteria 1519
642 Ga0207684_10253364 3300025910 Bacteria 1519
643 Ga0207654_10000019 3300025911 Bacteria 171031
644 Ga0207654_10000101 3300025911 Bacteria 56442
645 Ga0207654_10002290 3300025911 Bacteria 9813
646 Ga0207654_10002353 3300025911 Bacteria 9697
647 Ga0207654_10126183 3300025911 Bacteria 1614
648 Ga0207654_10127927 3300025911 Bacteria 1604
649 Ga0207707_10000072 3300025912 Bacteria 102454
650 Ga0207707_10005477 3300025912 Bacteria 11096
651 Ga0207707_10009250 3300025912 Bacteria 8549
652 Ga0207707_10013835 3300025912 Bacteria 7036
653 Ga0207707_10018468 3300025912 Bacteria 6080
654 Ga0207707_10184002 3300025912 Bacteria 1823
655 Ga0207707_10288814 3300025912 Bacteria 1419
656 Ga0207695_10000052 3300025913 Bacteria 398089
657 Ga0207695_10000332 3300025913 Bacteria 112161
658 Ga0207695_10000989 3300025913 Bacteria 50393
659 Ga0207695_10001611 3300025913 Bacteria 36602
660 Ga0207695_10004346 3300025913 Bacteria 19408
661 Ga0207695_10139053 3300025913 Bacteria 2379
662 Ga0207671_10000449 3300025914 Bacteria 56932
663 Ga0207671_10022135 3300025914 Bacteria 4810
664 Ga0207671_10064414 3300025914 Bacteria 2725
665 Ga0207671_10068308 3300025914 Bacteria 2648
666 Ga0207671_10075503 3300025914 Bacteria 2521
667 Ga0207693_10052855 3300025915 Bacteria 3187
668 Ga0207663_10008569 3300025916 Bacteria 5358
669 Ga0207660_10000141 3300025917 Bacteria 43491
670 Ga0207660_10011488 3300025917 Bacteria 5767
671 Ga0207660_10011939 3300025917 Bacteria 5670
672 Ga0207660_10032315 3300025917 Bacteria 3612
673 Ga0207660_10232523 3300025917 Bacteria 1450
674 Ga0207660_10299047 3300025917 Bacteria 1281
675 Ga0207662_10005860 3300025918 Bacteria 6590
676 Ga0207662_10018192 3300025918 Bacteria 3983
677 Ga0207662_10037983 3300025918 Bacteria 2821
678 Ga0207662_10122440 3300025918 Unclassified 1632
679 Ga0207662_10206341 3300025918 Bacteria 1274
680 Ga0207657_10003930 3300025919 Bacteria 15779
681 Ga0207657_10151163 3300025919 Bacteria 1891
682 Ga0207657_10240320 3300025919 Bacteria 1446
683 Ga0207649_10000971 3300025920 Bacteria 17772
684 Ga0207649_10040917 3300025920 Bacteria 2820
685 Ga0207649_10076417 3300025920 Bacteria 2155
686 Ga0207652_10000083 3300025921 Bacteria 101957
687 Ga0207652_10003945 3300025921 Bacteria 12132
688 Ga0207652_10008058 3300025921 Bacteria 8457
689 Ga0207652_10022875 3300025921 Bacteria 5176
690 Ga0207646_10000492 3300025922 Bacteria 52898
691 Ga0207646_10001643 3300025922 Bacteria 27324
692 Ga0207646_10011752 3300025922 Bacteria 8459
693 Ga0207646_10110409 3300025922 Bacteria 2467
694 Ga0207646_10162658 3300025922 Unclassified 2014
695 Ga0207681_10001297 3300025923 Bacteria 16131
696 Ga0207681_10008623 3300025923 Bacteria 6226
697 Ga0207681_10068510 3300025923 Bacteria 2465
698 Ga0207681_10124560 3300025923 Unclassified 1895
699 Ga0207694_10000034 3300025924 Bacteria 197650
700 Ga0207694_10000102 3300025924 Bacteria 94003
701 Ga0207694_10004376 3300025924 Bacteria 11029
702 Ga0207694_10039179 3300025924 Bacteria 3646
703 Ga0207650_10000001 3300025925 Bacteria 1545726
704 Ga0207650_10011922 3300025925 Bacteria 5992
705 Ga0207650_10012292 3300025925 Bacteria 5908
706 Ga0207650_10108389 3300025925 Bacteria 2147
707 Ga0207650_10274215 3300025925 Bacteria 1372
708 Ga0207659_10000965 3300025926 Bacteria 17172
709 Ga0207659_10002716 3300025926 Bacteria 10547
710 Ga0207659_10002981 3300025926 Bacteria 10086
711 Ga0207659_10008202 3300025926 Bacteria 6473
712 Ga0207659_10054245 3300025926 Bacteria 2862
713 Ga0207659_10279343 3300025926 Bacteria 1365
714 Ga0207687_10048695 3300025927 Bacteria 2944
715 Ga0207687_10061616 3300025927 Bacteria 2650
716 Ga0207687_10195644 3300025927 Bacteria 1577
717 Ga0207700_10014993 3300025928 Bacteria 5095
718 Ga0207700_10185958 3300025928 Bacteria 1743
719 Ga0207664_10052138 3300025929 Bacteria 3234
720 Ga0207664_10129688 3300025929 Bacteria 2121
721 Ga0207644_10012524 3300025931 Bacteria 5636
722 Ga0207644_10084711 3300025931 Bacteria 2350
723 Ga0207644_10091327 3300025931 Bacteria 2270
724 Ga0207644_10237227 3300025931 Bacteria 1451
725 Ga0207706_10000011 3300025933 Bacteria 196033
726 Ga0207706_10002673 3300025933 Bacteria 17368
727 Ga0207706_10076640 3300025933 Bacteria 2941
728 Ga0207706_10090581 3300025933 Bacteria 2689
729 Ga0207706_10100402 3300025933 Bacteria 2546
730 Ga0207686_10000010 3300025934 Bacteria 227471
731 Ga0207686_10000158 3300025934 Bacteria 51385
732 Ga0207709_10000052 3300025935 Bacteria 227471
733 Ga0207709_10001838 3300025935 Bacteria 14144
734 Ga0207670_10000357 3300025936 Bacteria 26785
735 Ga0207670_10040730 3300025936 Bacteria 3050
736 Ga0207669_10001441 3300025937 Bacteria 10141
737 Ga0207704_10000600 3300025938 Bacteria 15939
738 Ga0207665_10068415 3300025939 Bacteria 2420
739 Ga0207665_10102589 3300025939 Bacteria 1999
740 Ga0207691_10001935 3300025940 Bacteria 20209
741 Ga0207691_10010521 3300025940 Bacteria 8878
742 Ga0207691_10011274 3300025940 Bacteria 8576
743 Ga0207691_10031568 3300025940 Bacteria 4942
744 Ga0207691_10145821 3300025940 Bacteria 2084
745 Ga0207691_10161044 3300025940 Bacteria 1969
746 Ga0207691_10161484 3300025940 Bacteria 1966
747 Ga0207711_10002253 3300025941 Bacteria 17302
748 Ga0207711_10026917 3300025941 Bacteria 4828
749 Ga0207711_10163836 3300025941 Bacteria 2014
750 Ga0207711_10215616 3300025941 Unclassified 1754
751 Ga0207689_10005347 3300025942 Bacteria 11498
752 Ga0207689_10007287 3300025942 Bacteria 9710
753 Ga0207689_10011472 3300025942 Bacteria 7595
754 Ga0207689_10015475 3300025942 Bacteria 6459
755 Ga0207689_10105601 3300025942 Bacteria 2314
756 Ga0207689_10260256 3300025942 Unclassified 1435
757 Ga0207661_10016192 3300025944 Bacteria 5496
758 Ga0207661_10017753 3300025944 Bacteria 5272
759 Ga0207661_10036051 3300025944 Bacteria 3859
760 Ga0207661_10037999 3300025944 Bacteria 3770
761 Ga0207661_10152861 3300025944 Bacteria 1996
762 Ga0207679_10002408 3300025945 Bacteria 11531
763 Ga0207679_10003455 3300025945 Bacteria 9753
764 Ga0207679_10053218 3300025945 Bacteria 2973
765 Ga0207679_10144816 3300025945 Bacteria 1926
766 Ga0207679_10171899 3300025945 Bacteria 1785
767 Ga0207679_10211776 3300025945 Bacteria 1626
768 Ga0207679_10239804 3300025945 Bacteria 1536
769 Ga0207679_10245944 3300025945 Bacteria 1518
770 Ga0207667_10000442 3300025949 Bacteria 55598
771 Ga0207667_10002869 3300025949 Bacteria 21396
772 Ga0207667_10003434 3300025949 Bacteria 19555
773 Ga0207667_10003920 3300025949 Bacteria 18309
774 Ga0207667_10019339 3300025949 Bacteria 7606
775 Ga0207667_10032497 3300025949 Bacteria 5622
776 Ga0207667_10088195 3300025949 Bacteria 3209
777 Ga0207651_10003518 3300025960 Bacteria 7699
778 Ga0207651_10029234 3300025960 Bacteria 3489
779 Ga0207651_10191242 3300025960 Bacteria 1633
780 Ga0207712_10000459 3300025961 Bacteria 34572
781 Ga0207712_10017079 3300025961 Bacteria 4709
782 Ga0207712_10157862 3300025961 Bacteria 1759
783 Ga0207712_10189488 3300025961 Bacteria 1622
784 Ga0207712_10208596 3300025961 Unclassified 1554
785 Ga0207712_10245558 3300025961 Bacteria 1444
786 Ga0207668_10017222 3300025972 Bacteria 4523
787 Ga0207668_10044335 3300025972 Bacteria 3025
788 Ga0207640_10000975 3300025981 Bacteria 15887
789 Ga0207640_10014020 3300025981 Bacteria 4605
790 Ga0207640_10069416 3300025981 Unclassified 2366
791 Ga0207677_10000337 3300026023 Bacteria 33617
792 Ga0207677_10052413 3300026023 Bacteria 2772
793 Ga0207703_10003909 3300026035 Bacteria 12371
794 Ga0207703_10005484 3300026035 Bacteria 10197
795 Ga0207703_10060918 3300026035 Bacteria 3088
796 Ga0207703_10101243 3300026035 Bacteria 2442
797 Ga0207639_10000027 3300026041 Bacteria 197829
798 Ga0207639_10002185 3300026041 Bacteria 13163
799 Ga0207639_10026974 3300026041 Bacteria 4179
800 Ga0207639_10084723 3300026041 Bacteria 2518
801 Ga0207678_10014636 3300026067 Bacteria 6904
802 Ga0207678_10036384 3300026067 Bacteria 4285
803 Ga0207678_10065798 3300026067 Bacteria 3112
804 Ga0207708_10007856 3300026075 Bacteria 7901
805 Ga0207708_10135733 3300026075 Bacteria 1927
806 Ga0207708_10191696 3300026075 Bacteria 1627
807 Ga0207708_10251432 3300026075 Bacteria 1424
808 Ga0207702_10000307 3300026078 Bacteria 55978
809 Ga0207702_10026079 3300026078 Bacteria 4852
810 Ga0207702_10030742 3300026078 Bacteria 4473
811 Ga0207702_10031754 3300026078 Bacteria 4403
812 Ga0207702_10102536 3300026078 Bacteria 2529
813 Ga0207702_10172746 3300026078 Bacteria 1983
814 Ga0207641_10013955 3300026088 Bacteria 6587
815 Ga0207641_10084749 3300026088 Bacteria 2759
816 Ga0207641_10097985 3300026088 Bacteria 2578
817 Ga0207641_10158218 3300026088 Bacteria 2057
818 Ga0207641_10351344 3300026088 Bacteria 1405
819 Ga0207648_10000011 3300026089 Bacteria 182284
820 Ga0207648_10013377 3300026089 Bacteria 7636
821 Ga0207648_10016996 3300026089 Bacteria 6630
822 Ga0207648_10025347 3300026089 Bacteria 5285
823 Ga0207648_10050894 3300026089 Bacteria 3621
824 Ga0207648_10073490 3300026089 Bacteria 2980
825 Ga0207648_10091783 3300026089 Bacteria 2655
826 Ga0207648_10323568 3300026089 Bacteria 1386
827 Ga0207676_10000852 3300026095 Bacteria 23666
828 Ga0207676_10006484 3300026095 Bacteria 8266
829 Ga0207676_10016501 3300026095 Bacteria 5347
830 Ga0207676_10105966 3300026095 Bacteria 2342
831 Ga0207676_10106153 3300026095 Bacteria 2340
832 Ga0207676_10108340 3300026095 Bacteria 2319
833 Ga0207676_10117078 3300026095 Bacteria 2240
834 Ga0207676_10120767 3300026095 Bacteria 2209
835 Ga0207676_10137896 3300026095 Unclassified 2084
836 Ga0207676_10188074 3300026095 Unclassified 1815
837 Ga0207676_10215856 3300026095 Bacteria 1705
838 Ga0207674_10001937 3300026116 Bacteria 26286
839 Ga0207674_10001941 3300026116 Bacteria 26256
840 Ga0207674_10004407 3300026116 Bacteria 16958
841 Ga0207674_10005416 3300026116 Bacteria 15173
842 Ga0207674_10040197 3300026116 Bacteria 4847
843 Ga0207674_10256076 3300026116 Bacteria 1697
844 Ga0207675_100014186 3300026118 Bacteria 7431
845 Ga0207675_100014932 3300026118 Bacteria 7250
846 Ga0207675_100016144 3300026118 Bacteria 6973
847 Ga0207675_100042140 3300026118 Bacteria 4261
848 Ga0207675_100051906 3300026118 Bacteria 3827
849 Ga0207675_100065402 3300026118 Bacteria 3398
850 Ga0207675_100080723 3300026118 Bacteria 3049
851 Ga0207675_100244350 3300026118 Bacteria 1735
852 Ga0207683_10001588 3300026121 Bacteria 20508
853 Ga0207683_10129296 3300026121 Bacteria 2271
854 Ga0207683_10163411 3300026121 Bacteria 2014
855 Ga0207683_10205573 3300026121 Bacteria 1791
856 Ga0207683_10233287 3300026121 Bacteria 1678
857 Ga0207698_10000007 3300026142 Bacteria 289457
858 Ga0207698_10000123 3300026142 Bacteria 48520
859 Ga0207698_10173391 3300026142 Bacteria 1902
860 Ga0209974_10005742 3300027876 Bacteria 4353
861 Ga0207428_10003571 3300027907 Bacteria 15018
862 Ga0207428_10021446 3300027907 Bacteria 5470
863 Ga0207428_10050952 3300027907 Bacteria 3310
864 Ga0265356_1000493 3300028017 Bacteria 7129
865 Ga0268266_10031596 3300028379 Bacteria 4497
866 Ga0268266_10035303 3300028379 Bacteria 4253
867 Ga0268266_10130400 3300028379 Bacteria 2248
868 Ga0268266_10385114 3300028379 Bacteria 1323
869 Ga0268265_10015262 3300028380 Bacteria 5252
870 Ga0268265_10024548 3300028380 Unclassified 4266
871 Ga0268265_10049378 3300028380 Bacteria 3164
872 Ga0268265_10113942 3300028380 Unclassified 2213
873 Ga0268264_10000765 3300028381 Bacteria 35738
874 Ga0268264_10002589 3300028381 Bacteria 15820
875 Ga0268264_10022855 3300028381 Bacteria 5101
876 Ga0268264_10028324 3300028381 Bacteria 4581
877 Ga0268264_10105019 3300028381 Bacteria 2463
878 Ga0268264_10121887 3300028381 Bacteria 2299
879 Ga0268264_10153662 3300028381 Bacteria 2066
880 Ga0268264_10244046 3300028381 Unclassified 1665
881 Ga0268264_10389149 3300028381 Bacteria 1337
882 Ga0265338_10000188 3300028800 Bacteria 116010
883 Ga0265338_10047899 3300028800 Bacteria 3896
884 Ga0265762_1001275 3300030760 Bacteria 4587
885 Ga0265760_10008863 3300031090 Bacteria 2874
886 Ga0265330_10002757 3300031235 Bacteria 9441
887 Ga0265332_10000038 3300031238 Bacteria 133265
888 Ga0265332_10051228 3300031238 Bacteria 1773
889 Ga0265328_10001845 3300031239 Bacteria 9632
890 Ga0265328_10010439 3300031239 Bacteria 3738
891 Ga0265320_10003876 3300031240 Bacteria 9904
892 Ga0265320_10008934 3300031240 Bacteria 6087
893 Ga0265325_10000485 3300031241 Bacteria 28808
894 Ga0265329_10010167 3300031242 Bacteria 3471
895 Ga0265340_10001919 3300031247 Bacteria 11878
896 Ga0265340_10007853 3300031247 Bacteria 5787
897 Ga0265339_10000170 3300031249 Bacteria 55127
898 Ga0265339_10003219 3300031249 Bacteria 11462
899 Ga0265331_10000126 3300031250 Bacteria 101034
900 Ga0265331_10008206 3300031250 Bacteria 5954
901 Ga0265331_10008455 3300031250 Bacteria 5854
902 Ga0265331_10041495 3300031250 Bacteria 2236
903 Ga0265331_10079382 3300031250 Bacteria 1527
904 Ga0265327_10021337 3300031251 Bacteria 3911
905 Ga0265316_10000031 3300031344 Bacteria 161451
906 Ga0265316_10004921 3300031344 Bacteria 13140
907 Ga0265316_10026333 3300031344 Bacteria 4839
908 Ga0265316_10028271 3300031344 Bacteria 4628
909 Ga0265316_10120238 3300031344 Bacteria 1984
910 Ga0265316_10152107 3300031344 Bacteria 1733
911 Ga0265316_10211721 3300031344 Bacteria 1433
912 Ga0307513_10011098 3300031456 Bacteria 11231
913 Ga0307408_100001905 3300031548 Bacteria 15160
914 Ga0307408_100007180 3300031548 Bacteria 7375
915 Ga0307408_100019139 3300031548 Bacteria 4607
916 Ga0307408_100036951 3300031548 Bacteria 3436
917 Ga0307408_100047313 3300031548 Bacteria 3080
918 Ga0307408_100053326 3300031548 Bacteria 2919
919 Ga0307408_100171699 3300031548 Bacteria 1732
920 Ga0265313_10006481 3300031595 Bacteria 8270
921 Ga0265313_10036105 3300031595 Bacteria 2483
922 Ga0316579_10038084 3300031691 Bacteria 2222
923 Ga0265314_10000003 3300031711 Bacteria 1653386
924 Ga0265314_10000201 3300031711 Bacteria 88062
925 Ga0265314_10001899 3300031711 Bacteria 22362
926 Ga0265314_10002909 3300031711 Bacteria 16989
927 Ga0265314_10007393 3300031711 Bacteria 9527
928 Ga0265314_10087753 3300031711 Bacteria 2033
929 Ga0265314_10090609 3300031711 Bacteria 1991
930 Ga0265314_10134164 3300031711 Bacteria 1540
931 Ga0265342_10006600 3300031712 Bacteria 8622
932 Ga0316576_10001063 3300031727 Bacteria 14270
933 Ga0316576_10002477 3300031727 Bacteria 10508
934 Ga0316576_10170411 3300031727 Bacteria 1643
935 Ga0316578_10074924 3300031728 Bacteria 2007
936 Ga0307405_10000599 3300031731 Bacteria 13852
937 Ga0307405_10005843 3300031731 Bacteria 5990
938 Ga0307405_10007830 3300031731 Bacteria 5378
939 Ga0307405_10022762 3300031731 Bacteria 3549
940 Ga0307405_10022866 3300031731 Bacteria 3542
941 Ga0307405_10048439 3300031731 Bacteria 2620
942 Ga0307405_10133647 3300031731 Bacteria 1719
943 Ga0307405_10162121 3300031731 Bacteria 1585
944 Ga0307405_10177582 3300031731 Bacteria 1525
945 Ga0316577_10001430 3300031733 Bacteria 11292
946 Ga0316577_10005051 3300031733 Bacteria 6880
947 Ga0307413_10004155 3300031824 Bacteria 6249
948 Ga0307413_10005802 3300031824 Bacteria 5560
949 Ga0307413_10007893 3300031824 Bacteria 4980
950 Ga0307413_10015108 3300031824 Bacteria 3947
951 Ga0307413_10027187 3300031824 Bacteria 3166
952 Ga0307410_10001442 3300031852 Bacteria 10717
953 Ga0307410_10005716 3300031852 Bacteria 6625
954 Ga0307410_10050030 3300031852 Bacteria 2808
955 Ga0307410_10070069 3300031852 Bacteria 2427
956 Ga0307410_10071693 3300031852 Unclassified 2403
957 Ga0307410_10221570 3300031852 Bacteria 1455
958 Ga0307406_10001658 3300031901 Bacteria 12248
959 Ga0307406_10002023 3300031901 Bacteria 11069
960 Ga0307406_10002210 3300031901 Bacteria 10588
961 Ga0307406_10007574 3300031901 Bacteria 6028
962 Ga0307406_10011219 3300031901 Bacteria 5079
963 Ga0307406_10014912 3300031901 Unclassified 4481
964 Ga0307406_10037736 3300031901 Bacteria 2986
965 Ga0307406_10149162 3300031901 Bacteria 1666
966 Ga0307406_10192155 3300031901 Bacteria 1495
967 Ga0307407_10003823 3300031903 Bacteria 6270
968 Ga0307407_10039288 3300031903 Bacteria 2630
969 Ga0307407_10067167 3300031903 Unclassified 2118
970 Ga0307407_10069859 3300031903 Bacteria 2086
971 Ga0307412_10002823 3300031911 Bacteria 9640
972 Ga0307412_10007997 3300031911 Bacteria 6029
973 Ga0307412_10011010 3300031911 Bacteria 5225
974 Ga0307412_10029534 3300031911 Unclassified 3441
975 Ga0307412_10044450 3300031911 Bacteria 2897
976 Ga0307412_10066717 3300031911 Bacteria 2440
977 Ga0307412_10189161 3300031911 Bacteria 1555
978 Ga0307409_100000291 3300031995 Bacteria 20304
979 Ga0307409_100008890 3300031995 Bacteria 6131
980 Ga0307409_100126362 3300031995 Bacteria 2176
981 Ga0307409_100143421 3300031995 Bacteria 2062
982 Ga0307409_100181486 3300031995 Bacteria 1864
983 Ga0307409_100308132 3300031995 Unclassified 1476
984 Ga0307416_100000935 3300032002 Bacteria 15453
985 Ga0307416_100008383 3300032002 Bacteria 6663
986 Ga0307416_100009834 3300032002 Bacteria 6287
987 Ga0307416_100065371 3300032002 Bacteria 2988
988 Ga0307416_100066966 3300032002 Bacteria 2959
989 Ga0307416_100340630 3300032002 Bacteria 1512
990 Ga0307414_10001198 3300032004 Bacteria 13342
991 Ga0307414_10038061 3300032004 Bacteria 3226
992 Ga0307414_10100436 3300032004 Unclassified 2176
993 Ga0307414_10205742 3300032004 Unclassified 1605
994 Ga0307411_10000400 3300032005 Bacteria 14840
995 Ga0307411_10000868 3300032005 Bacteria 11397
996 Ga0307411_10002073 3300032005 Bacteria 8623
997 Ga0307411_10002441 3300032005 Bacteria 8218
998 Ga0307411_10151956 3300032005 Bacteria 1721
999 Ga0307415_100000755 3300032126 Bacteria 14568
1000 Ga0307415_100043039 3300032126 Bacteria 3010
1001 Ga0307415_100065835 3300032126 Bacteria 2527
1002 Ga0307415_100118319 3300032126 Bacteria 1981
1003 Ga0307415_100184895 3300032126 Unclassified 1639
1004 Ga0307415_100274333 3300032126 Bacteria 1383
1005 Ga0316583_10000012 3300032133 Bacteria 36422
1006 Ga0307510_10090245 3300033180 Bacteria 2912
1007 Ga0373934_0042908 3300035086 Bacteria 1787
1008 Ga0373951_0001961 3300035091 Bacteria 5287
1009 Ga0373923_0035463 3300035111 Bacteria 2031
1010 Ga0373954_0021213 3300035118 Bacteria 2940
1011 Ga0373956_0076854 3300035119 Bacteria 1528
1012 Ga0373957_0033363 3300035120 Bacteria 1901
1013 Ga0316574_0002086 3300035398 Bacteria 9890
1014 Ga0316574_0066926 3300035398 Bacteria 2265
1015 Ga0316574_0075827 3300035398 Bacteria 2130
1016 Ga0373931_0056222 3300035691 Bacteria 2108
1017 Ga0373927_0016041 3300035695 Bacteria 4945
1018 Ga0373933_0006397 3300035724 Bacteria 6412
1019 Ga0373933_0018930 3300035724 Bacteria 3879
1020 Ga0373933_0030360 3300035724 Bacteria 3129
1021 Ga0373937_0002343 3300036401 Bacteria 15788
1022 Ga0373937_0011017 3300036401 Bacteria 7926
1023 Ga0373937_0026739 3300036401 Bacteria 5214
1024 Ga0373937_0179795 3300036401 Bacteria 1986
1025 Ga0316582_0144471 3300036647 Bacteria 1605
1026 Ga0316584_0127002 3300036712 Bacteria 1904
1027 Ga0395900_0332879 3300037418 Bacteria 1496
1028 Ga0395898_0046207 3300037466 Bacteria 4277
1029 Ga0395905_0000099 3300037471 Bacteria 144776
1030 Ga0395905_0009429 3300037471 Bacteria 9538
1031 Ga0395905_0013377 3300037471 Bacteria 7863
1032 Ga0395905_0020960 3300037471 Bacteria 6189
1033 Ga0395905_0028561 3300037471 Bacteria 5258
1034 Ga0395905_0054962 3300037471 Bacteria 3726
1035 Ga0395905_0144644 3300037471 Unclassified 2237
1036 Ga0316581_0007014 3300037588 Bacteria 3004
1037 Ga0436364_0865140 3300037853 Bacteria 14776
1038 Ga0395901_0007357 3300038443 Bacteria 11114
1039 Ga0395901_0024217 3300038443 Bacteria 6229
1040 Ga0395901_0119390 3300038443 Bacteria 2771
1041 Ga0436365_0706054 3300039437 Bacteria 124498
1042 Ga0436365_1344587 3300039437 Bacteria 210334
1043 Ga0436360_0421972 3300039438 Bacteria 13816
1044 Ga0436361_0669362 3300039447 Bacteria 30067
1045 Ga0451797_0019243 3300041453 Bacteria 5203
1046 Ga0451853_0517244 3300041512 Bacteria 6844
1047 Ga0450894_003553 3300042131 Bacteria 2037
1048 Ga0450899_007275 3300042135 Bacteria 1204
1049 Ga0439446_0005738 3300042156 Bacteria 3206
1050 Ga0450908_001422 3300042184 Bacteria 4649
1051 Ga0450918_016186 3300042531 Bacteria 1295
1052 Ga0451577_0011169 3300042876 Bacteria 8518
1053 Ga0451577_0023748 3300042876 Bacteria 5587
1054 Ga0451577_0078179 3300042876 Bacteria 2950
1055 Ga0451577_0412716 3300042876 Bacteria 1226
1056 Ga0453683_0013212 3300044673 Bacteria 5397
1057 Ga0453683_0040831 3300044673 Bacteria 2913
1058 Ga0466961_0005259 3300044693 Bacteria 8147
1059 Ga0466963_0006600 3300044694 Bacteria 6882
1060 Ga0466963_0096799 3300044694 Bacteria 2016
1061 Ga0453684_0012922 3300044712 Bacteria 13676
1062 Ga0453684_0208497 3300044712 Bacteria 2273
1063 Ga0466960_0054090 3300044901 Bacteria 1948
1064 Ga0451576_0017428 3300045051 Bacteria 7898
1065 Ga0451576_0017613 3300045051 Bacteria 7850
1066 Ga0451576_0044022 3300045051 Bacteria 4708
1067 Ga0451576_0060521 3300045051 Bacteria 3950
1068 Ga0451576_0173501 3300045051 Bacteria 2251
1069 Ga0451576_0293419 3300045051 Bacteria 1700
1070 Ga0466958_0036455 3300045836 Bacteria 2944
1071 Ga0466967_0001653 3300045976 Bacteria 13205
1072 Ga0495592_0165836 3300046454 Bacteria 1516
1073 Ga0495603_0008883 3300046455 Bacteria 6076
1074 Ga0495641_0030914 3300046461 Bacteria 2563
1075 Ga0495651_0010649 3300046462 Bacteria 7075
1076 Ga0495651_0148292 3300046462 Bacteria 1694
1077 Ga0495653_0022790 3300046463 Bacteria 5065
1078 Ga0495650_0003016 3300046471 Bacteria 12706
1079 Ga0495580_0009857 3300046472 Bacteria 7488
1080 Ga0495580_0018995 3300046472 Bacteria 5111
1081 Ga0495580_0048576 3300046472 Bacteria 3004
1082 Ga0495582_0015929 3300046473 Bacteria 4121
1083 Ga0495662_0138567 3300046476 Bacteria 1197
1084 Ga0495664_0030424 3300046477 Bacteria 3162
1085 Ga0495585_0044605 3300046492 Bacteria 2477
1086 Ga0495594_0012264 3300046499 Bacteria 4463
1087 Ga0495594_0025567 3300046499 Bacteria 3174
1088 Ga0495606_0022368 3300046507 Bacteria 4608
1089 Ga0495628_0028709 3300046516 Bacteria 4518
1090 Ga0495628_0065277 3300046516 Bacteria 2848
1091 Ga0495632_0008298 3300046519 Bacteria 6396
1092 Ga0495643_0000133 3300046522 Bacteria 119563
1093 Ga0495652_0160287 3300046529 Bacteria 1748
1094 Ga0495586_0004158 3300046535 Bacteria 7758
1095 Ga0495587_0006760 3300046536 Bacteria 7468
1096 Ga0495587_0043028 3300046536 Unclassified 2691
1097 Ga0495598_0000387 3300046537 Bacteria 7910
1098 Ga0495621_0052109 3300046539 Bacteria 1466
1099 Ga0495645_0001749 3300046543 Bacteria 14757
1100 Ga0495645_0011424 3300046543 Bacteria 6249
1101 Ga0495645_0027128 3300046543 Bacteria 4160
1102 Ga0495645_0027366 3300046543 Bacteria 4143
1103 Ga0495645_0111121 3300046543 Bacteria 1939
1104 Ga0495656_0042426 3300046615 Bacteria 1905
1105 Ga0495668_0084587 3300046616 Bacteria 1740
1106 Ga0495625_0047474 3300046660 Bacteria 3096
1107 Ga0495599_0004656 3300046678 Bacteria 8134
1108 Ga0495599_0012333 3300046678 Bacteria 5263
1109 Ga0495599_0023002 3300046678 Bacteria 3893
1110 Ga0495599_0027851 3300046678 Bacteria 3540
1111 Ga0495623_0033297 3300046679 Bacteria 3307
1112 Ga0495623_0045769 3300046679 Bacteria 2778
1113 Ga0495658_0009378 3300046683 Bacteria 4877
1114 Ga0495658_0019343 3300046683 Bacteria 3553
1115 Ga0495669_0005270 3300046684 Bacteria 5387
1116 Ga0495624_0087521 3300046690 Unclassified 1924
1117 Ga0495600_0076128 3300046809 Bacteria 2191
1118 Ga0495604_0027540 3300047317 Bacteria 4519
1119 Ga0495672_0018186 3300047320 Bacteria 4677
1120 Ga0495684_0002032 3300047471 Bacteria 16287
1121 Ga0495684_0165061 3300047471 Bacteria 1650
1122 Ga0496100_0017245 3300048903 Bacteria 4259
1123 Ga0496100_0079324 3300048903 Bacteria 2212
1124 Ga0496101_0006359 3300048904 Bacteria 7605
1125 Ga0496102_0003161 3300048905 Bacteria 13966
1126 Ga0496102_0090232 3300048905 Bacteria 2836
1127 Ga0496102_0122763 3300048905 Bacteria 2427
1128 Ga0496103_0013645 3300048906 Bacteria 4819
1129 Ga0496103_0111926 3300048906 Bacteria 1735
1130 Ga0496104_0008713 3300048907 Bacteria 9021
1131 Ga0496104_0044356 3300048907 Bacteria 4178
1132 Ga0496104_0046423 3300048907 Bacteria 4091
1133 Ga0496105_0033195 3300048908 Bacteria 4237
1134 Ga0496105_0074062 3300048908 Bacteria 2813
1135 Ga0496106_0010826 3300048909 Bacteria 6740
1136 Ga0496106_0018360 3300048909 Bacteria 5168
1137 Ga0496106_0076753 3300048909 Bacteria 2561
1138 Ga0496106_0168688 3300048909 Bacteria 1734
1139 Ga0496107_0091046 3300048910 Bacteria 2229
1140 Ga0496107_0154206 3300048910 Bacteria 1700
1141 Ga0496107_0214678 3300048910 Bacteria 1431
1142 Ga0496108_0002035 3300048911 Bacteria 16202
1143 Ga0496108_0122202 3300048911 Bacteria 2234
1144 Ga0496108_0228766 3300048911 Bacteria 1617
1145 Ga0496108_0313523 3300048911 Unclassified 1367
1146 Ga0496109_0020400 3300048912 Bacteria 5853
1147 Ga0496109_0038901 3300048912 Bacteria 4303
1148 Ga0496109_0069179 3300048912 Bacteria 3237
1149 Ga0496109_0098797 3300048912 Bacteria 2707
1150 Ga0496109_0262427 3300048912 Bacteria 1627
1151 Ga0496110_0003571 3300048913 Bacteria 11949
1152 Ga0496110_0041768 3300048913 Bacteria 4002
1153 Ga0496110_0077737 3300048913 Bacteria 2953
1154 Ga0496111_0116317 3300048914 Bacteria 1972
1155 Ga0496112_0038556 3300048915 Bacteria 4666
1156 Ga0496112_0041709 3300048915 Bacteria 4490
1157 Ga0496112_0079027 3300048915 Bacteria 3253
1158 Ga0496112_0098420 3300048915 Unclassified 2895
1159 Ga0496112_0118810 3300048915 Bacteria 2614
1160 Ga0496113_0001047 3300048916 Bacteria 14916
1161 Ga0496113_0050819 3300048916 Bacteria 3092
1162 Ga0496113_0123509 3300048916 Bacteria 2026
1163 Ga0496114_0002532 3300048917 Bacteria 13959
1164 Ga0496115_0069341 3300048918 Bacteria 2856
1165 Ga0496115_0141928 3300048918 Bacteria 1982
1166 Ga0496115_0152172 3300048918 Bacteria 1911
1167 Ga0496126_0152189 3300048929 Bacteria 1982
1168 Ga0501298_000833 3300049521 Bacteria 4347
1169 Ga0501298_005247 3300049521 Unclassified 2071
1170 Ga0501031_0041335 3300049568 Bacteria 3011
1171 Ga0501032_0215091 3300049569 Bacteria 1252
1172 Ga0501034_0005392 3300049571 Bacteria 13986
1173 Ga0501034_0185025 3300049571 Bacteria 2047
1174 Ga0501036_0144905 3300049572 Bacteria 2004
1175 Ga0501036_0335409 3300049572 Bacteria 1263
1176 Ga0501037_0082415 3300049573 Bacteria 2331
1177 Ga0501038_0005530 3300049574 Bacteria 11735
1178 Ga0501038_0065739 3300049574 Bacteria 3089
1179 Ga0501038_0188612 3300049574 Bacteria 1660
1180 Ga0501039_0069885 3300049575 Bacteria 2728
1181 Ga0501040_0020609 3300049576 Bacteria 4395
1182 Ga0501040_0048409 3300049576 Bacteria 2905
1183 Ga0501041_0086664 3300049577 Bacteria 1932
1184 Ga0501043_0086994 3300049579 Bacteria 2456
1185 Ga0501047_0023393 3300049581 Bacteria 5932
1186 Ga0501047_0030224 3300049581 Bacteria 5223
1187 Ga0501048_0117614 3300049582 Bacteria 1877
1188 Ga0501067_0000289 3300049583 Bacteria 27505
1189 Ga0501068_0001115 3300049584 Bacteria 14210
1190 Ga0501069_0000618 3300049585 Bacteria 16399
1191 Ga0501070_0007904 3300049586 Bacteria 9009
1192 Ga0501070_0208789 3300049586 Bacteria 1603
1193 Ga0501070_0299769 3300049586 Bacteria 1309
1194 Ga0501071_0002168 3300049587 Bacteria 11796
1195 Ga0501071_0006429 3300049587 Bacteria 7626
1196 Ga0501071_0031635 3300049587 Bacteria 3753
1197 Ga0501071_0183139 3300049587 Unclassified 1570
1198 Ga0501071_0238860 3300049587 Unclassified 1370
1199 Ga0501072_0005375 3300049588 Bacteria 9750
1200 Ga0501072_0033643 3300049588 Bacteria 4017
1201 Ga0501073_0002687 3300049589 Bacteria 13313
1202 Ga0501073_0042543 3300049589 Bacteria 3206
1203 Ga0501074_0002870 3300049590 Bacteria 12074
1204 Ga0501074_0014913 3300049590 Bacteria 5654
1205 Ga0501074_0100620 3300049590 Bacteria 2069
1206 Ga0501075_0024751 3300049591 Bacteria 4407
1207 Ga0501075_0047592 3300049591 Bacteria 3222
1208 Ga0501075_0048167 3300049591 Bacteria 3203
1209 Ga0501076_0032641 3300049592 Bacteria 4064
1210 Ga0501077_0011892 3300049593 Bacteria 5445
1211 Ga0501198_000659 3300049649 Unclassified 4295
1212 Ga0501202_000146 3300049652 Bacteria 8372
1213 Ga0501202_003503 3300049652 Unclassified 2692
1214 Ga0501217_003007 3300049661 Bacteria 3378
1215 Ga0501217_004632 3300049661 Bacteria 2834
1216 Ga0501223_001160 3300049663 Bacteria 6213
1217 Ga0501224_000886 3300049664 Bacteria 3858
1218 Ga0501227_000114 3300049665 Bacteria 13866
1219 Ga0501235_006199 3300049669 Unclassified 2605
1220 Ga0501235_006247 3300049669 Bacteria 2596
1221 Ga0501235_007439 3300049669 Unclassified 2386
1222 Ga0501240_001784 3300049673 Unclassified 2170
1223 Ga0501242_003078 3300049674 Unclassified 1788
1224 Ga0501259_008198 3300049688 Unclassified 1680
1225 Ga0501260_002044 3300049689 Bacteria 1718
1226 Ga0501260_003165 3300049689 Bacteria 1466
1227 Ga0501221_000764 3300049704 Bacteria 5211
1228 Ga0501225_0000554 3300049705 Bacteria 11667
1229 Ga0501225_0019599 3300049705 Unclassified 1872
1230 Ga0501225_0020783 3300049705 Bacteria 1814
1231 Ga0501225_0022626 3300049705 Bacteria 1735
1232 Ga0501079_0066213 3300049741 Bacteria 2788
1233 Ga0501079_0087839 3300049741 Bacteria 2407
1234 Ga0501079_0150475 3300049741 Bacteria 1814
1235 Ga0501080_0017879 3300049742 Bacteria 6562
1236 Ga0501080_0221298 3300049742 Bacteria 1732
1237 Ga0501081_0012744 3300049743 Bacteria 5530
1238 Ga0501081_0027136 3300049743 Bacteria 3864
1239 Ga0501081_0079260 3300049743 Bacteria 2297
1240 Ga0501083_0001443 3300049744 Bacteria 16226
1241 Ga0501083_0007042 3300049744 Bacteria 7984
1242 Ga0501083_0171775 3300049744 Bacteria 1417
1243 Ga0501272_006448 3300049769 Bacteria 1254
1244 Ga0501283_001130 3300049779 Bacteria 3509
1245 Ga0501035_0000675 3300049822 Bacteria 37350
1246 Ga0501035_0255033 3300049822 Bacteria 1488
1247 Ga0501044_0001796 3300049823 Bacteria 25071
1248 Ga0501044_0091841 3300049823 Bacteria 3062
1249 Ga0501045_0016732 3300049824 Bacteria 5209
1250 Ga0501045_0035431 3300049824 Bacteria 3623
1251 nmdc:mga06z11_110413_c1 3300050494 Bacteria 1522
1252 nmdc:mga05p37_119881_c1 3300050507 Bacteria 3232
1253 nmdc:mga05p37_1569_c3 3300050507 Bacteria 13444
1254 nmdc:mga05p37_163307_c1 3300050507 Bacteria 2719
1255 nmdc:mga05p37_176639_c1 3300050507 Bacteria 2601
1256 nmdc:mga05p37_23053_c1 3300050507 Bacteria 7553
1257 nmdc:mga05p37_254475_c1 3300050507 Bacteria 2105
1258 nmdc:mga05p37_28248_c1 3300050507 Bacteria 6839
1259 nmdc:mga05p37_31547_c1 3300050507 Bacteria 6473
1260 nmdc:mga05p37_322695_c1 3300050507 Bacteria 1827
1261 nmdc:mga05p37_32648_c1 3300050507 Bacteria 6368
1262 nmdc:mga05p37_40292_c1 3300050507 Bacteria 5736
1263 nmdc:mga05p37_40680_c1 3300050507 Bacteria 5708
1264 nmdc:mga05p37_49478_c1 3300050507 Bacteria 5170
1265 nmdc:mga05p37_62916_c1 3300050507 Bacteria 4567
1266 nmdc:mga05p37_88795_c1 3300050507 Unclassified 3810
1267 nmdc:mga09592_157761_c2 3300050508 Bacteria 1420
1268 nmdc:mga09592_189516_c1 3300050508 Bacteria 1780
1269 nmdc:mga09592_209987_c1 3300050508 Bacteria 1686
1270 nmdc:mga09592_234171_c1 3300050508 Bacteria 1591
1271 nmdc:mga09592_32231_c1 3300050508 Bacteria 4369
1272 nmdc:mga09592_4461_c1 3300050508 Bacteria 11320
1273 nmdc:mga0qj67_11826_c1 3300050509 Bacteria 6551
1274 nmdc:mga0qj67_47148_c1 3300050509 Bacteria 3404
1275 nmdc:mga0qj67_56859_c1 3300050509 Bacteria 3102
1276 nmdc:mga0qj67_63921_c1 3300050509 Bacteria 2926
1277 nmdc:mga06r32_325165_c1 3300050510 Bacteria 1523
1278 nmdc:mga06r32_482134_c1 3300050510 Bacteria 1218
1279 nmdc:mga06r32_63213_c1 3300050510 Bacteria 3567
1280 nmdc:mga06r32_6701_c1 3300050510 Bacteria 10351
1281 nmdc:mga08y16_111_c1 3300050511 Bacteria 69340
1282 nmdc:mga08y16_143087_c1 3300050511 Bacteria 2486
1283 nmdc:mga08y16_16216_c1 3300050511 Bacteria 7833
1284 nmdc:mga08y16_20455_c1 3300050511 Bacteria 6986
1285 nmdc:mga08y16_2423_c1 3300050511 Bacteria 16840
1286 nmdc:mga08y16_32583_c1 3300050511 Bacteria 5477
1287 nmdc:mga08y16_38796_c1 3300050511 Unclassified 4999
1288 nmdc:mga08y16_415436_c1 3300050511 Bacteria 1375
1289 nmdc:mga08y16_43973_c1 3300050511 Bacteria 4680
1290 nmdc:mga08y16_48800_c1 3300050511 Bacteria 4430
1291 nmdc:mga08y16_9821_c1 3300050511 Bacteria 10046
1292 nmdc:mga0n895_1377_c1 3300050512 Bacteria 18093
1293 nmdc:mga0n895_22240_c1 3300050512 Bacteria 5945
1294 nmdc:mga0n895_64567_c1 3300050512 Bacteria 3621
1295 nmdc:mga0n895_86516_c1 3300050512 Unclassified 3130
1296 nmdc:mga0rr50_103783_c1 3300050513 Bacteria 2238
1297 nmdc:mga0rr50_31972_c1 3300050513 Bacteria 3743
1298 nmdc:mga0rr50_46537_c1 3300050513 Unclassified 3194
1299 nmdc:mga0rr50_52492_c1 3300050513 Bacteria 3030
1300 nmdc:mga08x19_16658_c1 3300050514 Bacteria 4485
1301 nmdc:mga08x19_34037_c1 3300050514 Unclassified 3218
1302 nmdc:mga08x19_90155_c1 3300050514 Bacteria 2023
1303 nmdc:mga0a205_18537_c1 3300050515 Bacteria 6545
1304 nmdc:mga0a205_221534_c1 3300050515 Bacteria 1777
1305 nmdc:mga0a205_39258_c1 3300050515 Bacteria 4557
1306 nmdc:mga0a205_47766_c1 3300050515 Bacteria 4130
1307 nmdc:mga0a205_70792_c1 3300050515 Bacteria 3368
1308 nmdc:mga0a205_79870_c1 3300050515 Bacteria 3161
1309 Ga0495601_0102440 3300053077 Bacteria 1850
1310 Ga0495601_0156351 3300053077 Bacteria 1489
1311 Ga0495619_0133345 3300053085 Bacteria 1708
1312 Ga0500641_0000590 3300053096 Bacteria 13078
1313 Ga0500616_0002309 3300053153 Bacteria 16135
1314 Ga0501084_0000887 3300054114 Bacteria 23129
1315 Ga0501084_0337483 3300054114 Bacteria 1273
1316 Ga0590071_004752 3300059421 Bacteria 3280
1317 Ga0590077_021005 3300059426 Bacteria 1388
1318 Ga0501082_0008874 3300060353 Bacteria 8671
1319 Ga0501082_0176407 3300060353 Bacteria 1858
1320 Ga0501082_0268119 3300060353 Bacteria 1486
1321 Ga0501082_0288298 3300060353 Bacteria 1429
1322 Ga0530510_0020381 3300061734 Bacteria 4714
1323 Ga0530510_0024592 3300061734 Bacteria 4300

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10077055 Ga0105240_100770553 339
2 3300046454 Ga0495592_0165836 Ga0495592_0165836_264_1418 344
3 3300046516 Ga0495628_0065277 Ga0495628_0065277_1071_2225 344
4 3300046543 Ga0495645_0001749 Ga0495645_0001749_2057_3211 344
5 3300046678 Ga0495599_0027851 Ga0495599_0027851_2026_3192 344
6 3300046679 Ga0495623_0033297 Ga0495623_0033297_230_1384 344
7 3300053077 Ga0495601_0156351 Ga0495601_0156351_215_1369 344
8 3300009551 Ga0105238_10126461 Ga0105238_101264612 352
9 3300050510 nmdc:mga06r32_482134_c1 nmdc:mga06r32_482134_c1_12_1172 354
10 3300049592 Ga0501076_0032641 Ga0501076_0032641_2768_3970 355
11 3300006871 Ga0075434_100000441 Ga0075434_1000004416 357
12 3300006880 Ga0075429_100158669 Ga0075429_1001586692 357
13 3300050507 nmdc:mga05p37_28248_c1 nmdc:mga05p37_28248_c1_5200_6360 357
14 3300050508 nmdc:mga09592_157761_c2 nmdc:mga09592_157761_c2_58_1218 357
15 3300050512 nmdc:mga0n895_1377_c1 nmdc:mga0n895_1377_c1_5347_6507 357
16 3300050515 nmdc:mga0a205_18537_c1 nmdc:mga0a205_18537_c1_3960_5120 357
17 3300013105 Ga0157369_10024421 Ga0157369_100244216 358
18 3300013104 Ga0157370_10115707 Ga0157370_101157072 360
19 3300013307 Ga0157372_10426303 Ga0157372_104263031 360
20 3300037418 Ga0395900_0332879 Ga0395900_0332879_101_1291 360
21 3300049741 Ga0501079_0066213 Ga0501079_0066213_748_2013 361
22 3300005456 Ga0070678_100059496 Ga0070678_1000594963 363
23 3300005536 Ga0070697_100208994 Ga0070697_1002089942 363
24 3300009147 Ga0114129_10013218 Ga0114129_100132188 363
25 3300013297 Ga0157378_10177938 Ga0157378_101779381 363
26 3300014326 Ga0157380_10028806 Ga0157380_100288061 363
27 3300014326 Ga0157380_10058723 Ga0157380_100587232 363
28 3300026089 Ga0207648_10013377 Ga0207648_100133773 363
29 3300031995 Ga0307409_100181486 Ga0307409_1001814861 363
30 3300050507 nmdc:mga05p37_32648_c1 nmdc:mga05p37_32648_c1_3962_5197 363
31 3300003203 JGI25406J46586_10006504 JGI25406J46586_100065044 364
32 3300005328 Ga0070676_10074442 Ga0070676_100744422 364
33 3300005328 Ga0070676_10137230 Ga0070676_101372302 364
34 3300005329 Ga0070683_100012571 Ga0070683_1000125714 364
35 3300005340 Ga0070689_100244262 Ga0070689_1002442621 364
36 3300005344 Ga0070661_100004650 Ga0070661_1000046505 364
37 3300005345 Ga0070692_10012594 Ga0070692_100125944 364
38 3300005347 Ga0070668_100179078 Ga0070668_1001790782 364
39 3300005354 Ga0070675_100020027 Ga0070675_1000200273 364
40 3300005364 Ga0070673_100099095 Ga0070673_1000990953 364
41 3300005366 Ga0070659_100037463 Ga0070659_1000374631 364
42 3300005367 Ga0070667_100289921 Ga0070667_1002899211 364
43 3300005535 Ga0070684_100001666 Ga0070684_1000016666 364
44 3300005544 Ga0070686_100240096 Ga0070686_1002400961 364
45 3300005564 Ga0070664_100005472 Ga0070664_1000054726 364
46 3300005578 Ga0068854_100045901 Ga0068854_1000459013 364
47 3300005616 Ga0068852_100025704 Ga0068852_1000257043 364
48 3300005834 Ga0068851_10004209 Ga0068851_100042093 364
49 3300005841 Ga0068863_100071479 Ga0068863_1000714792 364
50 3300005843 Ga0068860_100045952 Ga0068860_1000459523 364
51 3300005844 Ga0068862_100040644 Ga0068862_1000406443 364
52 3300006881 Ga0068865_100079570 Ga0068865_1000795701 364
53 3300009177 Ga0105248_10103024 Ga0105248_101030243 364
54 3300013306 Ga0163162_10004681 Ga0163162_1000468111 364
55 3300014326 Ga0157380_10010623 Ga0157380_100106234 364
56 3300014326 Ga0157380_10050185 Ga0157380_100501854 364
57 3300014968 Ga0157379_10020055 Ga0157379_100200554 364
58 3300025315 Ga0207697_10017280 Ga0207697_100172802 364
59 3300025904 Ga0207647_10046121 Ga0207647_100461212 364
60 3300025907 Ga0207645_10017279 Ga0207645_100172794 364
61 3300025933 Ga0207706_10002673 Ga0207706_100026732 364
62 3300025933 Ga0207706_10100402 Ga0207706_101004022 364
63 3300025940 Ga0207691_10010521 Ga0207691_100105216 364
64 3300025944 Ga0207661_10037999 Ga0207661_100379992 364
65 3300025945 Ga0207679_10002408 Ga0207679_100024086 364
66 3300026067 Ga0207678_10036384 Ga0207678_100363842 364
67 3300026116 Ga0207674_10004407 Ga0207674_100044076 364
68 3300026118 Ga0207675_100065402 Ga0207675_1000654023 364
69 3300026121 Ga0207683_10163411 Ga0207683_101634112 364
70 3300028380 Ga0268265_10015262 Ga0268265_100152623 364
71 3300031548 Ga0307408_100001905 Ga0307408_1000019059 364
72 3300031901 Ga0307406_10002023 Ga0307406_100020234 364
73 3300045051 Ga0451576_0017428 Ga0451576_0017428_3941_5101 364
74 3300048912 Ga0496109_0098797 Ga0496109_0098797_1114_2274 364
75 3300050511 nmdc:mga08y16_43973_c1 nmdc:mga08y16_43973_c1_1962_3122 364
76 3300050515 nmdc:mga0a205_79870_c1 nmdc:mga0a205_79870_c1_57_1217 364
77 3300014968 Ga0157379_10062835 Ga0157379_100628352 365
78 3300032004 Ga0307414_10205742 Ga0307414_102057422 365
79 3300049587 Ga0501071_0183139 Ga0501071_0183139_90_1355 365
80 3300005329 Ga0070683_100047604 Ga0070683_1000476043 366
81 3300005329 Ga0070683_100149279 Ga0070683_1001492792 366
82 3300005336 Ga0070680_100015314 Ga0070680_1000153144 366
83 3300005458 Ga0070681_10055395 Ga0070681_100553953 366
84 3300005530 Ga0070679_100001702 Ga0070679_1000017023 366
85 3300005535 Ga0070684_100063995 Ga0070684_1000639952 366
86 3300025912 Ga0207707_10018468 Ga0207707_100184684 366
87 3300025917 Ga0207660_10011939 Ga0207660_100119394 366
88 3300037466 Ga0395898_0046207 Ga0395898_0046207_1754_2989 366
89 3300038443 Ga0395901_0024217 Ga0395901_0024217_2566_3801 366
90 3300006237 Ga0097621_100055551 Ga0097621_1000555514 368
91 3300006358 Ga0068871_100019371 Ga0068871_1000193714 368
92 3300048903 Ga0496100_0017245 Ga0496100_0017245_1962_3110 368
93 3300048904 Ga0496101_0006359 Ga0496101_0006359_2546_3694 368
94 3300048907 Ga0496104_0046423 Ga0496104_0046423_434_1582 368
95 3300048910 Ga0496107_0154206 Ga0496107_0154206_228_1376 368
96 3300048917 Ga0496114_0002532 Ga0496114_0002532_2160_3308 368
97 3300048918 Ga0496115_0152172 Ga0496115_0152172_551_1699 368
98 3300002074 JGI24748J21848_1000010 JGI24748J21848_100001054 369
99 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001628 369
100 3300003203 JGI25406J46586_10007606 JGI25406J46586_100076061 369
101 3300005334 Ga0068869_100140246 Ga0068869_1001402462 369
102 3300005345 Ga0070692_10001958 Ga0070692_100019582 369
103 3300005345 Ga0070692_10017661 Ga0070692_100176613 369
104 3300005353 Ga0070669_100021822 Ga0070669_1000218224 369
105 3300005406 Ga0070703_10009971 Ga0070703_100099712 369
106 3300005435 Ga0070714_100052831 Ga0070714_1000528312 369
107 3300005440 Ga0070705_100036640 Ga0070705_1000366402 369
108 3300005441 Ga0070700_100033040 Ga0070700_1000330402 369
109 3300005518 Ga0070699_100016295 Ga0070699_1000162954 369
110 3300005545 Ga0070695_100016065 Ga0070695_1000160654 369
111 3300005545 Ga0070695_100045580 Ga0070695_1000455802 369
112 3300005546 Ga0070696_100063531 Ga0070696_1000635313 369
113 3300005547 Ga0070693_100000344 Ga0070693_1000003441 369
114 3300005547 Ga0070693_100111460 Ga0070693_1001114602 369
115 3300005564 Ga0070664_100376135 Ga0070664_1003761351 369
116 3300005578 Ga0068854_100041517 Ga0068854_1000415172 369
117 3300005616 Ga0068852_100172114 Ga0068852_1001721141 369
118 3300005617 Ga0068859_100034802 Ga0068859_1000348022 369
119 3300005617 Ga0068859_100057598 Ga0068859_1000575982 369
120 3300005617 Ga0068859_100096484 Ga0068859_1000964842 369
121 3300005719 Ga0068861_100247585 Ga0068861_1002475851 369
122 3300005834 Ga0068851_10008901 Ga0068851_100089013 369
123 3300005840 Ga0068870_10033170 Ga0068870_100331702 369
124 3300005842 Ga0068858_100093468 Ga0068858_1000934682 369
125 3300005842 Ga0068858_100156416 Ga0068858_1001564163 369
126 3300005843 Ga0068860_100055574 Ga0068860_1000555741 369
127 3300005843 Ga0068860_100110848 Ga0068860_1001108482 369
128 3300005985 Ga0081539_10001567 Ga0081539_1000156730 369
129 3300005985 Ga0081539_10010720 Ga0081539_100107205 369
130 3300006914 Ga0075436_100044229 Ga0075436_1000442292 369
131 3300006931 Ga0097620_100034802 Ga0097620_1000348022 369
132 3300006931 Ga0097620_100057605 Ga0097620_1000576052 369
133 3300006931 Ga0097620_100096478 Ga0097620_1000964782 369
134 3300007076 Ga0075435_100057388 Ga0075435_1000573882 369
135 3300009094 Ga0111539_10000639 Ga0111539_100006397 369
136 3300009176 Ga0105242_10117023 Ga0105242_101170232 369
137 3300009551 Ga0105238_10003867 Ga0105238_100038676 369
138 3300013105 Ga0157369_10032097 Ga0157369_100320973 369
139 3300013296 Ga0157374_10064495 Ga0157374_100644953 369
140 3300013306 Ga0163162_10097565 Ga0163162_100975653 369
141 3300014325 Ga0163163_10059753 Ga0163163_100597533 369
142 3300014325 Ga0163163_10524759 Ga0163163_105247591 369
143 3300014969 Ga0157376_10015437 Ga0157376_100154373 369
144 3300031548 Ga0307408_100047313 Ga0307408_1000473133 369
145 3300031901 Ga0307406_10002210 Ga0307406_100022103 369
146 3300046476 Ga0495662_0138567 Ga0495662_0138567_71_1186 369
147 3300048903 Ga0496100_0079324 Ga0496100_0079324_706_1821 369
148 3300048905 Ga0496102_0090232 Ga0496102_0090232_691_1806 369
149 3300048906 Ga0496103_0111926 Ga0496103_0111926_32_1147 369
150 3300048907 Ga0496104_0044356 Ga0496104_0044356_949_2064 369
151 3300048908 Ga0496105_0074062 Ga0496105_0074062_130_1245 369
152 3300048912 Ga0496109_0038901 Ga0496109_0038901_943_2058 369
153 3300048913 Ga0496110_0077737 Ga0496110_0077737_1191_2306 369
154 3300048914 Ga0496111_0116317 Ga0496111_0116317_353_1468 369
155 3300048915 Ga0496112_0041709 Ga0496112_0041709_785_1900 369
156 3300048918 Ga0496115_0069341 Ga0496115_0069341_353_1468 369
157 3300049569 Ga0501032_0215091 Ga0501032_0215091_41_1207 369
158 3300049581 Ga0501047_0023393 Ga0501047_0023393_1295_2461 369
159 3300049822 Ga0501035_0000675 Ga0501035_0000675_4943_6109 369
160 3300049823 Ga0501044_0001796 Ga0501044_0001796_13322_14488 369
161 3300005293 Ga0065715_10142151 Ga0065715_101421512 370
162 3300009094 Ga0111539_10000388 Ga0111539_1000038826 370
163 3300027907 Ga0207428_10003571 Ga0207428_100035716 370
164 3300048929 Ga0496126_0152189 Ga0496126_0152189_502_1680 370
165 3300050511 nmdc:mga08y16_111_c1 nmdc:mga08y16_111_c1_19013_20158 370
166 3300050511 nmdc:mga08y16_143087_c1 nmdc:mga08y16_143087_c1_149_1318 370
167 3300005290 Ga0065712_10150600 Ga0065712_101506001 371
168 3300005335 Ga0070666_10279407 Ga0070666_102794071 371
169 3300005343 Ga0070687_100083974 Ga0070687_1000839742 371
170 3300005354 Ga0070675_100009611 Ga0070675_1000096114 371
171 3300005364 Ga0070673_100062058 Ga0070673_1000620582 371
172 3300005365 Ga0070688_100095408 Ga0070688_1000954082 371
173 3300005466 Ga0070685_10031745 Ga0070685_100317452 371
174 3300005544 Ga0070686_100099303 Ga0070686_1000993031 371
175 3300005617 Ga0068859_100003113 Ga0068859_10000311310 371
176 3300005843 Ga0068860_100391034 Ga0068860_1003910342 371
177 3300005844 Ga0068862_100144653 Ga0068862_1001446532 371
178 3300006931 Ga0097620_100003112 Ga0097620_10000311210 371
179 3300009094 Ga0111539_10011285 Ga0111539_100112858 371
180 3300014326 Ga0157380_10104525 Ga0157380_101045252 371
181 3300025926 Ga0207659_10002716 Ga0207659_100027162 371
182 3300026095 Ga0207676_10106153 Ga0207676_101061532 371
183 3300026121 Ga0207683_10205573 Ga0207683_102055732 371
184 3300028381 Ga0268264_10153662 Ga0268264_101536621 371
185 3300005331 Ga0070670_100007520 Ga0070670_1000075206 372
186 3300005344 Ga0070661_100157260 Ga0070661_1001572601 372
187 3300005354 Ga0070675_100000536 Ga0070675_10000053618 372
188 3300005354 Ga0070675_100015272 Ga0070675_1000152722 372
189 3300005356 Ga0070674_100041437 Ga0070674_1000414373 372
190 3300005459 Ga0068867_100021218 Ga0068867_1000212183 372
191 3300005543 Ga0070672_100088594 Ga0070672_1000885942 372
192 3300005564 Ga0070664_100093741 Ga0070664_1000937412 372
193 3300006846 Ga0075430_100000375 Ga0075430_10000037511 372
194 3300006880 Ga0075429_100194234 Ga0075429_1001942342 372
195 3300009177 Ga0105248_10067092 Ga0105248_100670924 372
196 3300014325 Ga0163163_10004709 Ga0163163_100047098 372
197 3300025925 Ga0207650_10011922 Ga0207650_100119226 372
198 3300025926 Ga0207659_10000965 Ga0207659_1000096511 372
199 3300025940 Ga0207691_10001935 Ga0207691_1000193512 372
200 3300039438 Ga0436360_0421972 Ga0436360_0421972_8067_9251 372
201 3300050508 nmdc:mga09592_189516_c1 nmdc:mga09592_189516_c1_31_1191 372
202 3300050509 nmdc:mga0qj67_11826_c1 nmdc:mga0qj67_11826_c1_3823_4983 372
203 3300005617 Ga0068859_100001475 Ga0068859_10000147519 373
204 3300006931 Ga0097620_100001475 Ga0097620_10000147519 373
205 3300009101 Ga0105247_10029047 Ga0105247_100290472 373
206 3300009177 Ga0105248_10001549 Ga0105248_1000154922 373
207 3300005344 Ga0070661_100004845 Ga0070661_1000048454 374
208 3300005535 Ga0070684_100133658 Ga0070684_1001336582 374
209 3300005539 Ga0068853_100000415 Ga0068853_1000004158 374
210 3300005563 Ga0068855_100001805 Ga0068855_1000018053 374
211 3300005614 Ga0068856_100001375 Ga0068856_10000137515 374
212 3300005616 Ga0068852_100000115 Ga0068852_10000011535 374
213 3300009093 Ga0105240_10069811 Ga0105240_100698114 374
214 3300009174 Ga0105241_10003539 Ga0105241_100035396 374
215 3300009545 Ga0105237_10001357 Ga0105237_1000135720 374
216 3300009551 Ga0105238_10000383 Ga0105238_1000038336 374
217 3300013100 Ga0157373_10103058 Ga0157373_101030581 374
218 3300013307 Ga0157372_10010433 Ga0157372_100104337 374
219 3300025911 Ga0207654_10000101 Ga0207654_100001018 374
220 3300025913 Ga0207695_10000332 Ga0207695_1000033228 374
221 3300025914 Ga0207671_10000449 Ga0207671_1000044915 374
222 3300025920 Ga0207649_10000971 Ga0207649_100009714 374
223 3300025924 Ga0207694_10000102 Ga0207694_1000010236 374
224 3300025949 Ga0207667_10002869 Ga0207667_100028699 374
225 3300026041 Ga0207639_10000027 Ga0207639_10000027122 374
226 3300026078 Ga0207702_10000307 Ga0207702_1000030735 374
227 3300026142 Ga0207698_10000123 Ga0207698_1000012332 374
228 3300031250 Ga0265331_10079382 Ga0265331_100793822 374
229 3300031344 Ga0265316_10028271 Ga0265316_100282713 374
230 3300044694 Ga0466963_0006600 Ga0466963_0006600_3300_4424 374
231 3300045976 Ga0466967_0001653 Ga0466967_0001653_1736_2860 374
232 3300009093 Ga0105240_10001944 Ga0105240_100019444 375
233 3300013306 Ga0163162_10007386 Ga0163162_100073869 375
234 3300013308 Ga0157375_10170298 Ga0157375_101702981 375
235 3300014326 Ga0157380_10010831 Ga0157380_100108313 375
236 3300014968 Ga0157379_10082922 Ga0157379_100829222 375
237 3300014969 Ga0157376_10372524 Ga0157376_103725241 375
238 3300046492 Ga0495585_0044605 Ga0495585_0044605_533_1699 375
239 3300041453 Ga0451797_0019243 Ga0451797_0019243_2668_3804 377
240 3300005337 Ga0070682_100010793 Ga0070682_1000107933 378
241 3300005354 Ga0070675_100001582 Ga0070675_10000158214 378
242 3300005435 Ga0070714_100028393 Ga0070714_1000283935 378
243 3300005436 Ga0070713_100057569 Ga0070713_1000575693 378
244 3300005535 Ga0070684_100019966 Ga0070684_1000199663 378
245 3300005543 Ga0070672_100000260 Ga0070672_1000002603 378
246 3300005563 Ga0068855_100000813 Ga0068855_10000081323 378
247 3300005563 Ga0068855_100022173 Ga0068855_1000221733 378
248 3300005614 Ga0068856_100002127 Ga0068856_1000021279 378
249 3300005616 Ga0068852_100000078 Ga0068852_10000007817 378
250 3300005841 Ga0068863_100005375 Ga0068863_1000053759 378
251 3300006237 Ga0097621_100082386 Ga0097621_1000823863 378
252 3300006358 Ga0068871_100068113 Ga0068871_1000681132 378
253 3300006844 Ga0075428_100068259 Ga0075428_1000682591 378
254 3300006847 Ga0075431_100389444 Ga0075431_1003894442 378
255 3300009093 Ga0105240_10000065 Ga0105240_10000065168 378
256 3300009094 Ga0111539_10307601 Ga0111539_103076012 378
257 3300009176 Ga0105242_10078202 Ga0105242_100782022 378
258 3300009545 Ga0105237_10041398 Ga0105237_100413982 378
259 3300009551 Ga0105238_10012433 Ga0105238_100124337 378
260 3300013100 Ga0157373_10074582 Ga0157373_100745822 378
261 3300013104 Ga0157370_10000009 Ga0157370_1000000912 378
262 3300013105 Ga0157369_10000022 Ga0157369_10000022185 378
263 3300013307 Ga0157372_10000192 Ga0157372_1000019246 378
264 3300025913 Ga0207695_10000052 Ga0207695_1000005212 378
265 3300025914 Ga0207671_10064414 Ga0207671_100644142 378
266 3300025926 Ga0207659_10008202 Ga0207659_100082022 378
267 3300025929 Ga0207664_10052138 Ga0207664_100521382 378
268 3300025940 Ga0207691_10031568 Ga0207691_100315685 378
269 3300025949 Ga0207667_10000442 Ga0207667_1000044233 378
270 3300025949 Ga0207667_10003434 Ga0207667_100034344 378
271 3300026078 Ga0207702_10026079 Ga0207702_100260794 378
272 3300026142 Ga0207698_10000007 Ga0207698_1000000712 378
273 3300032002 Ga0307416_100340630 Ga0307416_1003406302 378
274 3300033180 Ga0307510_10090245 Ga0307510_100902452 378
275 3300048915 Ga0496112_0079027 Ga0496112_0079027_1701_2885 378
276 3300050507 nmdc:mga05p37_31547_c1 nmdc:mga05p37_31547_c1_2449_3594 378
277 3300050508 nmdc:mga09592_234171_c1 nmdc:mga09592_234171_c1_274_1419 378
278 3300050510 nmdc:mga06r32_325165_c1 nmdc:mga06r32_325165_c1_28_1173 378
279 3300050513 nmdc:mga0rr50_46537_c1 nmdc:mga0rr50_46537_c1_709_1854 378
280 3300053096 Ga0500641_0000590 Ga0500641_0000590_9598_10764 378
281 3300005327 Ga0070658_10000046 Ga0070658_1000004682 379
282 3300005355 Ga0070671_100114487 Ga0070671_1001144872 379
283 3300005356 Ga0070674_100132515 Ga0070674_1001325152 379
284 3300005458 Ga0070681_10003060 Ga0070681_1000306010 379
285 3300005530 Ga0070679_100003140 Ga0070679_1000031406 379
286 3300005544 Ga0070686_100057722 Ga0070686_1000577221 379
287 3300005548 Ga0070665_100009896 Ga0070665_1000098966 379
288 3300005563 Ga0068855_100002494 Ga0068855_10000249414 379
289 3300005842 Ga0068858_100091109 Ga0068858_1000911092 379
290 3300005843 Ga0068860_100212446 Ga0068860_1002124462 379
291 3300005985 Ga0081539_10000307 Ga0081539_1000030715 379
292 3300006844 Ga0075428_100002518 Ga0075428_10000251816 379
293 3300006846 Ga0075430_100008995 Ga0075430_1000089956 379
294 3300006847 Ga0075431_100041012 Ga0075431_1000410122 379
295 3300006880 Ga0075429_100009297 Ga0075429_1000092974 379
296 3300006914 Ga0075436_100080576 Ga0075436_1000805762 379
297 3300007076 Ga0075435_100075773 Ga0075435_1000757733 379
298 3300009147 Ga0114129_10012045 Ga0114129_100120453 379
299 3300009147 Ga0114129_10027646 Ga0114129_100276463 379
300 3300009177 Ga0105248_10248953 Ga0105248_102489532 379
301 3300013104 Ga0157370_10094228 Ga0157370_100942282 379
302 3300013296 Ga0157374_10206073 Ga0157374_102060732 379
303 3300014325 Ga0163163_10100962 Ga0163163_101009622 379
304 3300014326 Ga0157380_10129415 Ga0157380_101294152 379
305 3300017792 Ga0163161_10173788 Ga0163161_101737882 379
306 3300025909 Ga0207705_10000064 Ga0207705_1000006427 379
307 3300025912 Ga0207707_10009250 Ga0207707_100092505 379
308 3300025918 Ga0207662_10206341 Ga0207662_102063411 379
309 3300025921 Ga0207652_10003945 Ga0207652_100039458 379
310 3300025927 Ga0207687_10061616 Ga0207687_100616162 379
311 3300025931 Ga0207644_10091327 Ga0207644_100913272 379
312 3300025942 Ga0207689_10105601 Ga0207689_101056013 379
313 3300025949 Ga0207667_10019339 Ga0207667_100193392 379
314 3300026023 Ga0207677_10052413 Ga0207677_100524132 379
315 3300026035 Ga0207703_10101243 Ga0207703_101012432 379
316 3300026121 Ga0207683_10233287 Ga0207683_102332872 379
317 3300028379 Ga0268266_10031596 Ga0268266_100315962 379
318 3300028800 Ga0265338_10000188 Ga0265338_1000018867 379
319 3300031711 Ga0265314_10002909 Ga0265314_1000290914 379
320 3300031731 Ga0307405_10022866 Ga0307405_100228662 379
321 3300037471 Ga0395905_0020960 Ga0395905_0020960_304_1485 379
322 3300045051 Ga0451576_0173501 Ga0451576_0173501_787_1956 379
323 3300046471 Ga0495650_0003016 Ga0495650_0003016_9971_11119 379
324 3300046499 Ga0495594_0012264 Ga0495594_0012264_2931_4079 379
325 3300046507 Ga0495606_0022368 Ga0495606_0022368_71_1231 379
326 3300046660 Ga0495625_0047474 Ga0495625_0047474_1923_3083 379
327 3300049576 Ga0501040_0048409 Ga0501040_0048409_691_1854 379
328 3300049587 Ga0501071_0031635 Ga0501071_0031635_1686_2849 379
329 3300049591 Ga0501075_0024751 Ga0501075_0024751_777_1940 379
330 3300049743 Ga0501081_0079260 Ga0501081_0079260_822_1985 379
331 3300050507 nmdc:mga05p37_119881_c1 nmdc:mga05p37_119881_c1_1902_3050 379
332 3300050507 nmdc:mga05p37_163307_c1 nmdc:mga05p37_163307_c1_432_1595 379
333 3300050507 nmdc:mga05p37_40680_c1 nmdc:mga05p37_40680_c1_2937_4097 379
334 3300050508 nmdc:mga09592_32231_c1 nmdc:mga09592_32231_c1_2305_3465 379
335 3300050509 nmdc:mga0qj67_56859_c1 nmdc:mga0qj67_56859_c1_1490_2638 379
336 3300050510 nmdc:mga06r32_63213_c1 nmdc:mga06r32_63213_c1_1130_2290 379
337 3300050511 nmdc:mga08y16_415436_c1 nmdc:mga08y16_415436_c1_202_1362 379
338 3300050513 nmdc:mga0rr50_31972_c1 nmdc:mga0rr50_31972_c1_967_2115 379
339 3300050514 nmdc:mga08x19_16658_c1 nmdc:mga08x19_16658_c1_632_1780 379
340 3300005293 Ga0065715_10151108 Ga0065715_101511081 380
341 3300005295 Ga0065707_10161456 Ga0065707_101614561 380
342 3300005330 Ga0070690_100194537 Ga0070690_1001945371 380
343 3300005406 Ga0070703_10000156 Ga0070703_1000015622 380
344 3300005444 Ga0070694_100041734 Ga0070694_1000417343 380
345 3300005445 Ga0070708_100132214 Ga0070708_1001322142 380
346 3300005458 Ga0070681_10318086 Ga0070681_103180862 380
347 3300005544 Ga0070686_100091867 Ga0070686_1000918672 380
348 3300005563 Ga0068855_100019453 Ga0068855_1000194535 380
349 3300005564 Ga0070664_100091324 Ga0070664_1000913241 380
350 3300005617 Ga0068859_100014348 Ga0068859_1000143483 380
351 3300005841 Ga0068863_100262617 Ga0068863_1002626172 380
352 3300005844 Ga0068862_100189705 Ga0068862_1001897052 380
353 3300006028 Ga0070717_10006957 Ga0070717_100069575 380
354 3300006880 Ga0075429_100026821 Ga0075429_1000268213 380
355 3300006931 Ga0097620_100014348 Ga0097620_1000143483 380
356 3300009094 Ga0111539_10307217 Ga0111539_103072172 380
357 3300013105 Ga0157369_10001143 Ga0157369_100011438 380
358 3300013296 Ga0157374_10047498 Ga0157374_100474982 380
359 3300014326 Ga0157380_10002344 Ga0157380_100023444 380
360 3300014969 Ga0157376_10249171 Ga0157376_102491712 380
361 3300025911 Ga0207654_10002353 Ga0207654_100023532 380
362 3300025912 Ga0207707_10184002 Ga0207707_101840022 380
363 3300025913 Ga0207695_10000989 Ga0207695_1000098927 380
364 3300025913 Ga0207695_10001611 Ga0207695_1000161111 380
365 3300025922 Ga0207646_10011752 Ga0207646_100117529 380
366 3300025928 Ga0207700_10014993 Ga0207700_100149934 380
367 3300025934 Ga0207686_10000010 Ga0207686_1000001028 380
368 3300025935 Ga0207709_10000052 Ga0207709_1000005228 380
369 3300025940 Ga0207691_10161044 Ga0207691_101610441 380
370 3300025942 Ga0207689_10260256 Ga0207689_102602561 380
371 3300025960 Ga0207651_10029234 Ga0207651_100292342 380
372 3300026023 Ga0207677_10000337 Ga0207677_100003372 380
373 3300026075 Ga0207708_10251432 Ga0207708_102514321 380
374 3300026089 Ga0207648_10323568 Ga0207648_103235681 380
375 3300026095 Ga0207676_10006484 Ga0207676_100064846 380
376 3300026121 Ga0207683_10129296 Ga0207683_101292962 380
377 3300028381 Ga0268264_10000765 Ga0268264_100007658 380
378 3300028381 Ga0268264_10244046 Ga0268264_102440461 380
379 3300031239 Ga0265328_10010439 Ga0265328_100104393 380
380 3300031249 Ga0265339_10000170 Ga0265339_1000017011 380
381 3300031249 Ga0265339_10003219 Ga0265339_100032199 380
382 3300031344 Ga0265316_10004921 Ga0265316_100049218 380
383 3300031691 Ga0316579_10038084 Ga0316579_100380843 380
384 3300031711 Ga0265314_10000003 Ga0265314_10000003916 380
385 3300031711 Ga0265314_10001899 Ga0265314_100018998 380
386 3300031727 Ga0316576_10170411 Ga0316576_101704112 380
387 3300031733 Ga0316577_10001430 Ga0316577_100014309 380
388 3300031733 Ga0316577_10005051 Ga0316577_100050512 380
389 3300036647 Ga0316582_0144471 Ga0316582_0144471_88_1257 380
390 3300037588 Ga0316581_0007014 Ga0316581_0007014_1247_2416 380
391 3300041512 Ga0451853_0517244 Ga0451853_0517244_1869_3026 380
392 3300042131 Ga0450894_003553 Ga0450894_003553_372_1514 380
393 3300042135 Ga0450899_007275 Ga0450899_007275_42_1184 380
394 3300042531 Ga0450918_016186 Ga0450918_016186_110_1252 380
395 3300046472 Ga0495580_0048576 Ga0495580_0048576_302_1447 380
396 3300046536 Ga0495587_0043028 Ga0495587_0043028_471_1634 380
397 3300046543 Ga0495645_0011424 Ga0495645_0011424_1488_2651 380
398 3300046543 Ga0495645_0027128 Ga0495645_0027128_2785_3930 380
399 3300046809 Ga0495600_0076128 Ga0495600_0076128_685_1845 380
400 3300049589 Ga0501073_0042543 Ga0501073_0042543_901_2058 380
401 3300050511 nmdc:mga08y16_38796_c1 nmdc:mga08y16_38796_c1_1584_2744 380
402 3300060353 Ga0501082_0268119 Ga0501082_0268119_13_1170 380
403 3300005435 Ga0070714_100038550 Ga0070714_1000385502 381
404 3300005436 Ga0070713_100088623 Ga0070713_1000886233 381
405 3300005439 Ga0070711_100022934 Ga0070711_1000229341 381
406 3300005455 Ga0070663_100017038 Ga0070663_1000170382 381
407 3300005937 Ga0081455_10137035 Ga0081455_101370351 381
408 3300009147 Ga0114129_10109310 Ga0114129_101093103 381
409 3300021388 Ga0213875_10010805 Ga0213875_100108054 381
410 3300025906 Ga0207699_10029239 Ga0207699_100292391 381
411 3300025928 Ga0207700_10185958 Ga0207700_101859582 381
412 3300025929 Ga0207664_10129688 Ga0207664_101296882 381
413 3300025939 Ga0207665_10102589 Ga0207665_101025891 381
414 3300031240 Ga0265320_10003876 Ga0265320_100038766 381
415 3300031242 Ga0265329_10010167 Ga0265329_100101672 381
416 3300031250 Ga0265331_10008455 Ga0265331_100084554 381
417 3300031344 Ga0265316_10120238 Ga0265316_101202383 381
418 3300031711 Ga0265314_10007393 Ga0265314_100073934 381
419 3300031711 Ga0265314_10134164 Ga0265314_101341642 381
420 3300032126 Ga0307415_100274333 Ga0307415_1002743331 381
421 3300037853 Ga0436364_0865140 Ga0436364_0865140_2855_4033 381
422 3300044901 Ga0466960_0054090 Ga0466960_0054090_259_1410 381
423 3300045836 Ga0466958_0036455 Ga0466958_0036455_123_1307 381
424 3300049571 Ga0501034_0005392 Ga0501034_0005392_8094_9254 381
425 3300049573 Ga0501037_0082415 Ga0501037_0082415_890_2050 381
426 3300049579 Ga0501043_0086994 Ga0501043_0086994_827_1987 381
427 3300049581 Ga0501047_0030224 Ga0501047_0030224_3895_5055 381
428 3300049744 Ga0501083_0001443 Ga0501083_0001443_8283_9437 381
429 3300049744 Ga0501083_0171775 Ga0501083_0171775_199_1359 381
430 3300049822 Ga0501035_0255033 Ga0501035_0255033_19_1179 381
431 3300049823 Ga0501044_0091841 Ga0501044_0091841_789_1949 381
432 3300050507 nmdc:mga05p37_254475_c1 nmdc:mga05p37_254475_c1_905_2062 381
433 3300005293 Ga0065715_10011578 Ga0065715_100115782 382
434 3300005327 Ga0070658_10139463 Ga0070658_101394631 382
435 3300005434 Ga0070709_10228113 Ga0070709_102281131 382
436 3300005439 Ga0070711_100043003 Ga0070711_1000430032 382
437 3300005535 Ga0070684_100092905 Ga0070684_1000929052 382
438 3300005548 Ga0070665_100145506 Ga0070665_1001455062 382
439 3300005549 Ga0070704_100141274 Ga0070704_1001412742 382
440 3300005577 Ga0068857_100012268 Ga0068857_1000122682 382
441 3300005578 Ga0068854_100104596 Ga0068854_1001045962 382
442 3300005614 Ga0068856_100010508 Ga0068856_1000105082 382
443 3300005614 Ga0068856_100026987 Ga0068856_1000269873 382
444 3300005614 Ga0068856_100068405 Ga0068856_1000684052 382
445 3300005616 Ga0068852_100008157 Ga0068852_1000081573 382
446 3300005617 Ga0068859_100014432 Ga0068859_1000144326 382
447 3300005617 Ga0068859_100172310 Ga0068859_1001723102 382
448 3300006931 Ga0097620_100014432 Ga0097620_1000144326 382
449 3300006931 Ga0097620_100172310 Ga0097620_1001723102 382
450 3300009093 Ga0105240_10004329 Ga0105240_100043293 382
451 3300009094 Ga0111539_10029060 Ga0111539_100290603 382
452 3300009098 Ga0105245_10038945 Ga0105245_100389453 382
453 3300009101 Ga0105247_10003178 Ga0105247_100031782 382
454 3300009177 Ga0105248_10099534 Ga0105248_100995342 382
455 3300009545 Ga0105237_10349758 Ga0105237_103497581 382
456 3300009551 Ga0105238_10006224 Ga0105238_100062247 382
457 3300010375 Ga0105239_10494653 Ga0105239_104946531 382
458 3300013105 Ga0157369_10000182 Ga0157369_1000018237 382
459 3300013105 Ga0157369_10007234 Ga0157369_100072348 382
460 3300013105 Ga0157369_10016432 Ga0157369_100164325 382
461 3300013296 Ga0157374_10000840 Ga0157374_100008409 382
462 3300013297 Ga0157378_10255954 Ga0157378_102559542 382
463 3300013307 Ga0157372_10020682 Ga0157372_100206823 382
464 3300025321 Ga0207656_10092079 Ga0207656_100920791 382
465 3300025900 Ga0207710_10023444 Ga0207710_100234442 382
466 3300025911 Ga0207654_10126183 Ga0207654_101261832 382
467 3300025913 Ga0207695_10139053 Ga0207695_101390532 382
468 3300025916 Ga0207663_10008569 Ga0207663_100085692 382
469 3300025924 Ga0207694_10039179 Ga0207694_100391792 382
470 3300025927 Ga0207687_10048695 Ga0207687_100486952 382
471 3300025927 Ga0207687_10195644 Ga0207687_101956441 382
472 3300025949 Ga0207667_10032497 Ga0207667_100324972 382
473 3300026041 Ga0207639_10084723 Ga0207639_100847232 382
474 3300026089 Ga0207648_10025347 Ga0207648_100253472 382
475 3300026116 Ga0207674_10001941 Ga0207674_100019418 382
476 3300026118 Ga0207675_100080723 Ga0207675_1000807232 382
477 3300028379 Ga0268266_10035303 Ga0268266_100353032 382
478 3300031901 Ga0307406_10011219 Ga0307406_100112193 382
479 3300031903 Ga0307407_10069859 Ga0307407_100698591 382
480 3300035398 Ga0316574_0075827 Ga0316574_0075827_418_1581 382
481 3300035695 Ga0373927_0016041 Ga0373927_0016041_2990_4144 382
482 3300042184 Ga0450908_001422 Ga0450908_001422_146_1324 382
483 3300046529 Ga0495652_0160287 Ga0495652_0160287_329_1486 382
484 3300046543 Ga0495645_0027366 Ga0495645_0027366_2285_3442 382
485 3300046678 Ga0495599_0023002 Ga0495599_0023002_106_1263 382
486 3300050511 nmdc:mga08y16_2423_c1 nmdc:mga08y16_2423_c1_14144_15301 382
487 3300059426 Ga0590077_021005 Ga0590077_021005_118_1281 382
488 3300005329 Ga0070683_100067488 Ga0070683_1000674882 383
489 3300005365 Ga0070688_100180552 Ga0070688_1001805522 383
490 3300005455 Ga0070663_100177259 Ga0070663_1001772591 383
491 3300005549 Ga0070704_100012406 Ga0070704_1000124062 383
492 3300005617 Ga0068859_100021360 Ga0068859_1000213605 383
493 3300005617 Ga0068859_100368080 Ga0068859_1003680802 383
494 3300005618 Ga0068864_100069777 Ga0068864_1000697772 383
495 3300005841 Ga0068863_100032114 Ga0068863_1000321142 383
496 3300005843 Ga0068860_100174359 Ga0068860_1001743592 383
497 3300006178 Ga0075367_10104213 Ga0075367_101042132 383
498 3300006844 Ga0075428_100473274 Ga0075428_1004732741 383
499 3300006847 Ga0075431_100204556 Ga0075431_1002045561 383
500 3300006931 Ga0097620_100021361 Ga0097620_1000213615 383
501 3300006931 Ga0097620_100368084 Ga0097620_1003680841 383
502 3300009101 Ga0105247_10017711 Ga0105247_100177113 383
503 3300009174 Ga0105241_10021446 Ga0105241_100214463 383
504 3300014326 Ga0157380_10092581 Ga0157380_100925812 383
505 3300025911 Ga0207654_10000019 Ga0207654_10000019103 383
506 3300025931 Ga0207644_10084711 Ga0207644_100847112 383
507 3300025936 Ga0207670_10040730 Ga0207670_100407301 383
508 3300025940 Ga0207691_10161484 Ga0207691_101614842 383
509 3300025944 Ga0207661_10017753 Ga0207661_100177532 383
510 3300025961 Ga0207712_10245558 Ga0207712_102455582 383
511 3300025972 Ga0207668_10044335 Ga0207668_100443352 383
512 3300026067 Ga0207678_10014636 Ga0207678_100146362 383
513 3300028381 Ga0268264_10105019 Ga0268264_101050192 383
514 3300031235 Ga0265330_10002757 Ga0265330_100027577 383
515 3300031238 Ga0265332_10000038 Ga0265332_1000003866 383
516 3300031238 Ga0265332_10051228 Ga0265332_100512282 383
517 3300031239 Ga0265328_10001845 Ga0265328_100018456 383
518 3300031250 Ga0265331_10000126 Ga0265331_1000012658 383
519 3300031250 Ga0265331_10041495 Ga0265331_100414953 383
520 3300031251 Ga0265327_10021337 Ga0265327_100213372 383
521 3300031344 Ga0265316_10000031 Ga0265316_1000003125 383
522 3300031711 Ga0265314_10000201 Ga0265314_1000020158 383
523 3300031711 Ga0265314_10090609 Ga0265314_100906092 383
524 3300031712 Ga0265342_10006600 Ga0265342_100066008 383
525 3300031731 Ga0307405_10022762 Ga0307405_100227623 383
526 3300031731 Ga0307405_10162121 Ga0307405_101621212 383
527 3300031852 Ga0307410_10221570 Ga0307410_102215701 383
528 3300031995 Ga0307409_100126362 Ga0307409_1001263622 383
529 3300032004 Ga0307414_10038061 Ga0307414_100380613 383
530 3300046543 Ga0495645_0111121 Ga0495645_0111121_335_1495 383
531 3300049574 Ga0501038_0188612 Ga0501038_0188612_384_1550 383
532 3300049586 Ga0501070_0208789 Ga0501070_0208789_242_1408 383
533 3300049652 Ga0501202_003503 Ga0501202_003503_863_2038 383
534 3300049674 Ga0501242_003078 Ga0501242_003078_254_1426 383
535 3300049769 Ga0501272_006448 Ga0501272_006448_51_1226 383
536 3300050494 nmdc:mga06z11_110413_c1 nmdc:mga06z11_110413_c1_338_1504 383
537 3300050507 nmdc:mga05p37_1569_c3 nmdc:mga05p37_1569_c3_1110_2276 383
538 3300050508 nmdc:mga09592_4461_c1 nmdc:mga09592_4461_c1_9634_10800 383
539 3300050509 nmdc:mga0qj67_63921_c1 nmdc:mga0qj67_63921_c1_1007_2173 383
540 3300005293 Ga0065715_10100780 Ga0065715_101007802 384
541 3300005329 Ga0070683_100006709 Ga0070683_1000067096 384
542 3300005329 Ga0070683_100023637 Ga0070683_1000236376 384
543 3300005330 Ga0070690_100004379 Ga0070690_1000043793 384
544 3300005330 Ga0070690_100047583 Ga0070690_1000475832 384
545 3300005334 Ga0068869_100000075 Ga0068869_1000000752 384
546 3300005336 Ga0070680_100003737 Ga0070680_1000037374 384
547 3300005337 Ga0070682_100002309 Ga0070682_1000023096 384
548 3300005338 Ga0068868_100027182 Ga0068868_1000271823 384
549 3300005343 Ga0070687_100003842 Ga0070687_1000038421 384
550 3300005344 Ga0070661_100019425 Ga0070661_1000194253 384
551 3300005353 Ga0070669_100132463 Ga0070669_1001324631 384
552 3300005355 Ga0070671_100090127 Ga0070671_1000901274 384
553 3300005367 Ga0070667_100057510 Ga0070667_1000575103 384
554 3300005437 Ga0070710_10068198 Ga0070710_100681981 384
555 3300005444 Ga0070694_100045846 Ga0070694_1000458463 384
556 3300005444 Ga0070694_100062659 Ga0070694_1000626592 384
557 3300005455 Ga0070663_100032742 Ga0070663_1000327423 384
558 3300005458 Ga0070681_10004349 Ga0070681_100043496 384
559 3300005458 Ga0070681_10005084 Ga0070681_100050843 384
560 3300005458 Ga0070681_10041987 Ga0070681_100419875 384
561 3300005467 Ga0070706_100076465 Ga0070706_1000764655 384
562 3300005468 Ga0070707_100035627 Ga0070707_1000356275 384
563 3300005468 Ga0070707_100037853 Ga0070707_1000378536 384
564 3300005471 Ga0070698_100004867 Ga0070698_1000048672 384
565 3300005518 Ga0070699_100005300 Ga0070699_1000053006 384
566 3300005518 Ga0070699_100055683 Ga0070699_1000556834 384
567 3300005530 Ga0070679_100001158 Ga0070679_1000011586 384
568 3300005530 Ga0070679_100018797 Ga0070679_1000187973 384
569 3300005530 Ga0070679_100047521 Ga0070679_1000475212 384
570 3300005530 Ga0070679_100102158 Ga0070679_1001021582 384
571 3300005535 Ga0070684_100000156 Ga0070684_10000015625 384
572 3300005544 Ga0070686_100000024 Ga0070686_10000002426 384
573 3300005546 Ga0070696_100011419 Ga0070696_1000114192 384
574 3300005548 Ga0070665_100215601 Ga0070665_1002156012 384
575 3300005549 Ga0070704_100009245 Ga0070704_1000092452 384
576 3300005563 Ga0068855_100021927 Ga0068855_1000219275 384
577 3300005564 Ga0070664_100016432 Ga0070664_1000164324 384
578 3300005577 Ga0068857_100008882 Ga0068857_1000088822 384
579 3300005577 Ga0068857_100098099 Ga0068857_1000980993 384
580 3300005614 Ga0068856_100116610 Ga0068856_1001166101 384
581 3300005617 Ga0068859_100019911 Ga0068859_1000199114 384
582 3300005618 Ga0068864_100011351 Ga0068864_1000113515 384
583 3300005618 Ga0068864_100044023 Ga0068864_1000440232 384
584 3300005719 Ga0068861_100034463 Ga0068861_1000344634 384
585 3300005834 Ga0068851_10003547 Ga0068851_100035473 384
586 3300005834 Ga0068851_10117853 Ga0068851_101178532 384
587 3300005843 Ga0068860_100062841 Ga0068860_1000628412 384
588 3300005844 Ga0068862_100047635 Ga0068862_1000476354 384
589 3300006028 Ga0070717_10015206 Ga0070717_100152062 384
590 3300006237 Ga0097621_100106753 Ga0097621_1001067532 384
591 3300006844 Ga0075428_100248033 Ga0075428_1002480332 384
592 3300006852 Ga0075433_10259398 Ga0075433_102593982 384
593 3300006871 Ga0075434_100027765 Ga0075434_1000277655 384
594 3300006880 Ga0075429_100002520 Ga0075429_10000252014 384
595 3300006880 Ga0075429_100181685 Ga0075429_1001816852 384
596 3300006914 Ga0075436_100008926 Ga0075436_1000089266 384
597 3300006914 Ga0075436_100112466 Ga0075436_1001124662 384
598 3300006931 Ga0097620_100019911 Ga0097620_1000199114 384
599 3300007076 Ga0075435_100183299 Ga0075435_1001832992 384
600 3300007076 Ga0075435_100222723 Ga0075435_1002227232 384
601 3300009093 Ga0105240_10359232 Ga0105240_103592322 384
602 3300009094 Ga0111539_10024116 Ga0111539_100241162 384
603 3300009094 Ga0111539_10061355 Ga0111539_100613552 384
604 3300009147 Ga0114129_10475036 Ga0114129_104750362 384
605 3300009177 Ga0105248_10033114 Ga0105248_100331144 384
606 3300009177 Ga0105248_10252994 Ga0105248_102529943 384
607 3300009545 Ga0105237_10003279 Ga0105237_100032797 384
608 3300009545 Ga0105237_10209489 Ga0105237_102094892 384
609 3300009551 Ga0105238_10000026 Ga0105238_1000002648 384
610 3300009551 Ga0105238_10270192 Ga0105238_102701922 384
611 3300010375 Ga0105239_10030177 Ga0105239_100301772 384
612 3300010375 Ga0105239_10047356 Ga0105239_100473564 384
613 3300010375 Ga0105239_10608650 Ga0105239_106086501 384
614 3300013100 Ga0157373_10025473 Ga0157373_100254732 384
615 3300013100 Ga0157373_10063725 Ga0157373_100637252 384
616 3300013105 Ga0157369_10000736 Ga0157369_1000073621 384
617 3300014325 Ga0163163_10008091 Ga0163163_100080916 384
618 3300014326 Ga0157380_10014492 Ga0157380_100144926 384
619 3300014968 Ga0157379_10097113 Ga0157379_100971132 384
620 3300021361 Ga0213872_10004718 Ga0213872_100047182 384
621 3300022730 Ga0224570_100762 Ga0224570_1007621 384
622 3300022732 Ga0224569_100573 Ga0224569_1005733 384
623 3300024227 Ga0228598_1001301 Ga0228598_10013016 384
624 3300025898 Ga0207692_10051049 Ga0207692_100510492 384
625 3300025904 Ga0207647_10005644 Ga0207647_100056445 384
626 3300025907 Ga0207645_10070079 Ga0207645_100700792 384
627 3300025910 Ga0207684_10005157 Ga0207684_100051575 384
628 3300025912 Ga0207707_10005477 Ga0207707_100054776 384
629 3300025912 Ga0207707_10013835 Ga0207707_100138352 384
630 3300025912 Ga0207707_10288814 Ga0207707_102888141 384
631 3300025914 Ga0207671_10068308 Ga0207671_100683081 384
632 3300025915 Ga0207693_10052855 Ga0207693_100528553 384
633 3300025917 Ga0207660_10011488 Ga0207660_100114882 384
634 3300025917 Ga0207660_10032315 Ga0207660_100323154 384
635 3300025917 Ga0207660_10299047 Ga0207660_102990471 384
636 3300025918 Ga0207662_10037983 Ga0207662_100379833 384
637 3300025918 Ga0207662_10122440 Ga0207662_101224401 384
638 3300025921 Ga0207652_10008058 Ga0207652_100080584 384
639 3300025921 Ga0207652_10022875 Ga0207652_100228751 384
640 3300025922 Ga0207646_10001643 Ga0207646_1000164311 384
641 3300025922 Ga0207646_10110409 Ga0207646_101104092 384
642 3300025923 Ga0207681_10124560 Ga0207681_101245602 384
643 3300025924 Ga0207694_10000034 Ga0207694_1000003448 384
644 3300025924 Ga0207694_10004376 Ga0207694_100043762 384
645 3300025925 Ga0207650_10012292 Ga0207650_100122924 384
646 3300025925 Ga0207650_10108389 Ga0207650_101083891 384
647 3300025925 Ga0207650_10274215 Ga0207650_102742151 384
648 3300025926 Ga0207659_10002981 Ga0207659_100029815 384
649 3300025931 Ga0207644_10012524 Ga0207644_100125241 384
650 3300025931 Ga0207644_10237227 Ga0207644_102372271 384
651 3300025933 Ga0207706_10076640 Ga0207706_100766403 384
652 3300025941 Ga0207711_10163836 Ga0207711_101638362 384
653 3300025941 Ga0207711_10215616 Ga0207711_102156161 384
654 3300025944 Ga0207661_10016192 Ga0207661_100161922 384
655 3300025944 Ga0207661_10036051 Ga0207661_100360512 384
656 3300025944 Ga0207661_10152861 Ga0207661_101528611 384
657 3300025945 Ga0207679_10003455 Ga0207679_100034556 384
658 3300025945 Ga0207679_10144816 Ga0207679_101448162 384
659 3300025945 Ga0207679_10171899 Ga0207679_101718991 384
660 3300025945 Ga0207679_10245944 Ga0207679_102459441 384
661 3300026035 Ga0207703_10005484 Ga0207703_100054844 384
662 3300026067 Ga0207678_10065798 Ga0207678_100657983 384
663 3300026075 Ga0207708_10191696 Ga0207708_101916961 384
664 3300026078 Ga0207702_10102536 Ga0207702_101025362 384
665 3300026078 Ga0207702_10172746 Ga0207702_101727463 384
666 3300026088 Ga0207641_10084749 Ga0207641_100847492 384
667 3300026089 Ga0207648_10050894 Ga0207648_100508942 384
668 3300026089 Ga0207648_10091783 Ga0207648_100917833 384
669 3300026095 Ga0207676_10105966 Ga0207676_101059662 384
670 3300026095 Ga0207676_10108340 Ga0207676_101083402 384
671 3300026095 Ga0207676_10117078 Ga0207676_101170782 384
672 3300026116 Ga0207674_10005416 Ga0207674_100054164 384
673 3300026116 Ga0207674_10040197 Ga0207674_100401972 384
674 3300026118 Ga0207675_100244350 Ga0207675_1002443502 384
675 3300026142 Ga0207698_10173391 Ga0207698_101733912 384
676 3300027907 Ga0207428_10021446 Ga0207428_100214462 384
677 3300027907 Ga0207428_10050952 Ga0207428_100509524 384
678 3300028017 Ga0265356_1000493 Ga0265356_10004935 384
679 3300028379 Ga0268266_10385114 Ga0268266_103851141 384
680 3300028380 Ga0268265_10113942 Ga0268265_101139421 384
681 3300028381 Ga0268264_10121887 Ga0268264_101218872 384
682 3300028800 Ga0265338_10047899 Ga0265338_100478992 384
683 3300030760 Ga0265762_1001275 Ga0265762_10012756 384
684 3300031241 Ga0265325_10000485 Ga0265325_100004858 384
685 3300031247 Ga0265340_10001919 Ga0265340_100019199 384
686 3300031247 Ga0265340_10007853 Ga0265340_100078532 384
687 3300031250 Ga0265331_10008206 Ga0265331_100082065 384
688 3300031344 Ga0265316_10026333 Ga0265316_100263334 384
689 3300031548 Ga0307408_100036951 Ga0307408_1000369512 384
690 3300031548 Ga0307408_100171699 Ga0307408_1001716992 384
691 3300031595 Ga0265313_10006481 Ga0265313_100064814 384
692 3300031711 Ga0265314_10087753 Ga0265314_100877532 384
693 3300031727 Ga0316576_10001063 Ga0316576_100010631 384
694 3300031727 Ga0316576_10002477 Ga0316576_100024777 384
695 3300031728 Ga0316578_10074924 Ga0316578_100749241 384
696 3300031731 Ga0307405_10007830 Ga0307405_100078302 384
697 3300031731 Ga0307405_10048439 Ga0307405_100484392 384
698 3300031731 Ga0307405_10133647 Ga0307405_101336472 384
699 3300031824 Ga0307413_10004155 Ga0307413_100041555 384
700 3300031824 Ga0307413_10005802 Ga0307413_100058022 384
701 3300031824 Ga0307413_10007893 Ga0307413_100078936 384
702 3300031824 Ga0307413_10027187 Ga0307413_100271872 384
703 3300031852 Ga0307410_10001442 Ga0307410_100014424 384
704 3300031852 Ga0307410_10005716 Ga0307410_100057166 384
705 3300031852 Ga0307410_10050030 Ga0307410_100500302 384
706 3300031852 Ga0307410_10070069 Ga0307410_100700692 384
707 3300031901 Ga0307406_10001658 Ga0307406_1000165811 384
708 3300031901 Ga0307406_10192155 Ga0307406_101921551 384
709 3300031903 Ga0307407_10003823 Ga0307407_100038235 384
710 3300031903 Ga0307407_10039288 Ga0307407_100392882 384
711 3300031911 Ga0307412_10007997 Ga0307412_100079976 384
712 3300031911 Ga0307412_10029534 Ga0307412_100295343 384
713 3300031911 Ga0307412_10044450 Ga0307412_100444501 384
714 3300031911 Ga0307412_10189161 Ga0307412_101891611 384
715 3300031995 Ga0307409_100008890 Ga0307409_1000088903 384
716 3300031995 Ga0307409_100143421 Ga0307409_1001434212 384
717 3300032002 Ga0307416_100000935 Ga0307416_1000009356 384
718 3300032004 Ga0307414_10100436 Ga0307414_101004362 384
719 3300032005 Ga0307411_10000868 Ga0307411_100008683 384
720 3300032005 Ga0307411_10002073 Ga0307411_100020735 384
721 3300032126 Ga0307415_100043039 Ga0307415_1000430392 384
722 3300032126 Ga0307415_100118319 Ga0307415_1001183192 384
723 3300032126 Ga0307415_100184895 Ga0307415_1001848952 384
724 3300032133 Ga0316583_10000012 Ga0316583_100000124 384
725 3300035398 Ga0316574_0002086 Ga0316574_0002086_3315_4484 384
726 3300035398 Ga0316574_0066926 Ga0316574_0066926_448_1617 384
727 3300035691 Ga0373931_0056222 Ga0373931_0056222_180_1343 384
728 3300035724 Ga0373933_0030360 Ga0373933_0030360_434_1597 384
729 3300036401 Ga0373937_0026739 Ga0373937_0026739_3319_4482 384
730 3300036712 Ga0316584_0127002 Ga0316584_0127002_69_1235 384
731 3300038443 Ga0395901_0007357 Ga0395901_0007357_8965_10134 384
732 3300038443 Ga0395901_0119390 Ga0395901_0119390_748_1926 384
733 3300039447 Ga0436361_0669362 Ga0436361_0669362_2622_3806 384
734 3300042156 Ga0439446_0005738 Ga0439446_0005738_459_1637 384
735 3300042876 Ga0451577_0023748 Ga0451577_0023748_3667_4830 384
736 3300042876 Ga0451577_0412716 Ga0451577_0412716_26_1186 384
737 3300044693 Ga0466961_0005259 Ga0466961_0005259_4764_5933 384
738 3300045051 Ga0451576_0044022 Ga0451576_0044022_1387_2550 384
739 3300045051 Ga0451576_0060521 Ga0451576_0060521_299_1456 384
740 3300046455 Ga0495603_0008883 Ga0495603_0008883_1246_2409 384
741 3300046461 Ga0495641_0030914 Ga0495641_0030914_1136_2299 384
742 3300046462 Ga0495651_0010649 Ga0495651_0010649_2735_3898 384
743 3300046463 Ga0495653_0022790 Ga0495653_0022790_185_1348 384
744 3300046473 Ga0495582_0015929 Ga0495582_0015929_2651_3814 384
745 3300046477 Ga0495664_0030424 Ga0495664_0030424_1100_2263 384
746 3300046499 Ga0495594_0025567 Ga0495594_0025567_101_1264 384
747 3300046516 Ga0495628_0028709 Ga0495628_0028709_499_1662 384
748 3300046522 Ga0495643_0000133 Ga0495643_0000133_112027_113196 384
749 3300046536 Ga0495587_0006760 Ga0495587_0006760_3697_4860 384
750 3300046678 Ga0495599_0012333 Ga0495599_0012333_584_1747 384
751 3300046679 Ga0495623_0045769 Ga0495623_0045769_897_2060 384
752 3300046683 Ga0495658_0009378 Ga0495658_0009378_139_1302 384
753 3300046684 Ga0495669_0005270 Ga0495669_0005270_1695_2858 384
754 3300047317 Ga0495604_0027540 Ga0495604_0027540_2449_3612 384
755 3300047471 Ga0495684_0002032 Ga0495684_0002032_12499_13662 384
756 3300048905 Ga0496102_0003161 Ga0496102_0003161_2695_3858 384
757 3300048906 Ga0496103_0013645 Ga0496103_0013645_2944_4107 384
758 3300048907 Ga0496104_0008713 Ga0496104_0008713_5976_7139 384
759 3300048908 Ga0496105_0033195 Ga0496105_0033195_2046_3209 384
760 3300048909 Ga0496106_0010826 Ga0496106_0010826_890_2053 384
761 3300048909 Ga0496106_0168688 Ga0496106_0168688_38_1201 384
762 3300048910 Ga0496107_0091046 Ga0496107_0091046_186_1349 384
763 3300048911 Ga0496108_0002035 Ga0496108_0002035_902_2065 384
764 3300048911 Ga0496108_0122202 Ga0496108_0122202_475_1638 384
765 3300048912 Ga0496109_0020400 Ga0496109_0020400_3950_5113 384
766 3300048912 Ga0496109_0069179 Ga0496109_0069179_1072_2235 384
767 3300048912 Ga0496109_0262427 Ga0496109_0262427_25_1188 384
768 3300048913 Ga0496110_0041768 Ga0496110_0041768_2115_3278 384
769 3300048915 Ga0496112_0038556 Ga0496112_0038556_861_2024 384
770 3300048916 Ga0496113_0001047 Ga0496113_0001047_459_1622 384
771 3300048918 Ga0496115_0141928 Ga0496115_0141928_60_1238 384
772 3300049572 Ga0501036_0335409 Ga0501036_0335409_60_1223 384
773 3300049583 Ga0501067_0000289 Ga0501067_0000289_8820_9983 384
774 3300049584 Ga0501068_0001115 Ga0501068_0001115_1754_2917 384
775 3300049585 Ga0501069_0000618 Ga0501069_0000618_9010_10173 384
776 3300049586 Ga0501070_0007904 Ga0501070_0007904_6144_7307 384
777 3300049587 Ga0501071_0002168 Ga0501071_0002168_8762_9925 384
778 3300049587 Ga0501071_0006429 Ga0501071_0006429_2431_3594 384
779 3300049588 Ga0501072_0005375 Ga0501072_0005375_4033_5196 384
780 3300049589 Ga0501073_0002687 Ga0501073_0002687_8833_9996 384
781 3300049590 Ga0501074_0002870 Ga0501074_0002870_2095_3258 384
782 3300049669 Ga0501235_006199 Ga0501235_006199_164_1339 384
783 3300049669 Ga0501235_006247 Ga0501235_006247_1059_2237 384
784 3300049688 Ga0501259_008198 Ga0501259_008198_145_1320 384
785 3300049705 Ga0501225_0019599 Ga0501225_0019599_345_1520 384
786 3300049705 Ga0501225_0020783 Ga0501225_0020783_576_1754 384
787 3300049741 Ga0501079_0087839 Ga0501079_0087839_162_1322 384
788 3300049741 Ga0501079_0150475 Ga0501079_0150475_477_1640 384
789 3300049742 Ga0501080_0017879 Ga0501080_0017879_1495_2658 384
790 3300049744 Ga0501083_0007042 Ga0501083_0007042_3617_4780 384
791 3300049824 Ga0501045_0035431 Ga0501045_0035431_2236_3411 384
792 3300050507 nmdc:mga05p37_40292_c1 nmdc:mga05p37_40292_c1_344_1519 384
793 3300050508 nmdc:mga09592_209987_c1 nmdc:mga09592_209987_c1_440_1618 384
794 3300050511 nmdc:mga08y16_16216_c1 nmdc:mga08y16_16216_c1_1661_2839 384
795 3300050511 nmdc:mga08y16_20455_c1 nmdc:mga08y16_20455_c1_1917_3104 384
796 3300050511 nmdc:mga08y16_48800_c1 nmdc:mga08y16_48800_c1_1278_2435 384
797 3300050511 nmdc:mga08y16_9821_c1 nmdc:mga08y16_9821_c1_7007_8173 384
798 3300050512 nmdc:mga0n895_22240_c1 nmdc:mga0n895_22240_c1_3906_5069 384
799 3300050512 nmdc:mga0n895_64567_c1 nmdc:mga0n895_64567_c1_2276_3454 384
800 3300050514 nmdc:mga08x19_90155_c1 nmdc:mga08x19_90155_c1_347_1522 384
801 3300050515 nmdc:mga0a205_221534_c1 nmdc:mga0a205_221534_c1_352_1515 384
802 3300053077 Ga0495601_0102440 Ga0495601_0102440_552_1733 384
803 3300054114 Ga0501084_0000887 Ga0501084_0000887_20161_21324 384
804 3300060353 Ga0501082_0008874 Ga0501082_0008874_6016_7179 384
805 3300060353 Ga0501082_0288298 Ga0501082_0288298_84_1259 384
806 3300061734 Ga0530510_0024592 Ga0530510_0024592_312_1475 384
807 3300000532 CNAas_1000470 CNAas_10004703 385
808 3300002459 JGI24751J29686_10000056 JGI24751J29686_1000005616 385
809 3300005288 Ga0065714_10002185 Ga0065714_10002185126 385
810 3300005289 Ga0065704_10116876 Ga0065704_101168762 385
811 3300005290 Ga0065712_10067734 Ga0065712_1006773435 385
812 3300005290 Ga0065712_10072647 Ga0065712_100726471 385
813 3300005290 Ga0065712_10156460 Ga0065712_101564601 385
814 3300005293 Ga0065715_10089344 Ga0065715_100893447 385
815 3300005293 Ga0065715_10093745 Ga0065715_100937454 385
816 3300005293 Ga0065715_10099294 Ga0065715_100992943 385
817 3300005293 Ga0065715_10109473 Ga0065715_101094733 385
818 3300005295 Ga0065707_10000832 Ga0065707_100008322 385
819 3300005295 Ga0065707_10097283 Ga0065707_100972832 385
820 3300005295 Ga0065707_10098409 Ga0065707_100984092 385
821 3300005295 Ga0065707_10134448 Ga0065707_101344481 385
822 3300005295 Ga0065707_10142920 Ga0065707_101429201 385
823 3300005295 Ga0065707_10149468 Ga0065707_101494682 385
824 3300005328 Ga0070676_10149469 Ga0070676_101494691 385
825 3300005329 Ga0070683_100067085 Ga0070683_1000670852 385
826 3300005330 Ga0070690_100003475 Ga0070690_1000034755 385
827 3300005330 Ga0070690_100013034 Ga0070690_1000130343 385
828 3300005330 Ga0070690_100020111 Ga0070690_1000201112 385
829 3300005330 Ga0070690_100060039 Ga0070690_1000600393 385
830 3300005331 Ga0070670_100000889 Ga0070670_10000088911 385
831 3300005334 Ga0068869_100003334 Ga0068869_1000033343 385
832 3300005334 Ga0068869_100010708 Ga0068869_1000107082 385
833 3300005334 Ga0068869_100151286 Ga0068869_1001512862 385
834 3300005335 Ga0070666_10101582 Ga0070666_101015822 385
835 3300005336 Ga0070680_100000437 Ga0070680_1000004374 385
836 3300005336 Ga0070680_100231308 Ga0070680_1002313081 385
837 3300005338 Ga0068868_100027426 Ga0068868_1000274263 385
838 3300005339 Ga0070660_100210128 Ga0070660_1002101281 385
839 3300005339 Ga0070660_100254451 Ga0070660_1002544511 385
840 3300005340 Ga0070689_100000856 Ga0070689_10000085615 385
841 3300005340 Ga0070689_100047275 Ga0070689_1000472753 385
842 3300005340 Ga0070689_100184288 Ga0070689_1001842882 385
843 3300005343 Ga0070687_100001466 Ga0070687_1000014662 385
844 3300005347 Ga0070668_100029411 Ga0070668_1000294112 385
845 3300005347 Ga0070668_100120559 Ga0070668_1001205592 385
846 3300005353 Ga0070669_100003717 Ga0070669_1000037174 385
847 3300005353 Ga0070669_100006696 Ga0070669_1000066962 385
848 3300005354 Ga0070675_100014027 Ga0070675_1000140273 385
849 3300005355 Ga0070671_100003022 Ga0070671_1000030224 385
850 3300005355 Ga0070671_100106348 Ga0070671_1001063482 385
851 3300005356 Ga0070674_100000037 Ga0070674_1000000379 385
852 3300005356 Ga0070674_100012898 Ga0070674_1000128981 385
853 3300005364 Ga0070673_100010550 Ga0070673_1000105501 385
854 3300005364 Ga0070673_100236907 Ga0070673_1002369072 385
855 3300005365 Ga0070688_100078593 Ga0070688_1000785933 385
856 3300005366 Ga0070659_100025513 Ga0070659_1000255133 385
857 3300005367 Ga0070667_100121496 Ga0070667_1001214962 385
858 3300005438 Ga0070701_10035842 Ga0070701_100358422 385
859 3300005440 Ga0070705_100001046 Ga0070705_1000010468 385
860 3300005440 Ga0070705_100007548 Ga0070705_1000075483 385
861 3300005440 Ga0070705_100141095 Ga0070705_1001410952 385
862 3300005441 Ga0070700_100001938 Ga0070700_1000019382 385
863 3300005441 Ga0070700_100009192 Ga0070700_1000091922 385
864 3300005444 Ga0070694_100004087 Ga0070694_1000040873 385
865 3300005444 Ga0070694_100025213 Ga0070694_1000252132 385
866 3300005445 Ga0070708_100087193 Ga0070708_1000871932 385
867 3300005456 Ga0070678_100001127 Ga0070678_1000011275 385
868 3300005456 Ga0070678_100077113 Ga0070678_1000771132 385
869 3300005457 Ga0070662_100000166 Ga0070662_1000001667 385
870 3300005457 Ga0070662_100027395 Ga0070662_1000273952 385
871 3300005458 Ga0070681_10008029 Ga0070681_100080298 385
872 3300005459 Ga0068867_100000549 Ga0068867_10000054917 385
873 3300005467 Ga0070706_100000398 Ga0070706_10000039834 385
874 3300005467 Ga0070706_100006309 Ga0070706_10000630912 385
875 3300005467 Ga0070706_100118654 Ga0070706_1001186542 385
876 3300005467 Ga0070706_100236204 Ga0070706_1002362041 385
877 3300005468 Ga0070707_100000116 Ga0070707_10000011620 385
878 3300005468 Ga0070707_100042070 Ga0070707_1000420701 385
879 3300005468 Ga0070707_100238081 Ga0070707_1002380812 385
880 3300005471 Ga0070698_100000618 Ga0070698_10000061823 385
881 3300005471 Ga0070698_100000709 Ga0070698_1000007099 385
882 3300005471 Ga0070698_100004914 Ga0070698_10000491414 385
883 3300005471 Ga0070698_100007013 Ga0070698_1000070134 385
884 3300005471 Ga0070698_100020931 Ga0070698_1000209313 385
885 3300005471 Ga0070698_100166533 Ga0070698_1001665332 385
886 3300005471 Ga0070698_100244942 Ga0070698_1002449422 385
887 3300005518 Ga0070699_100000017 Ga0070699_10000001755 385
888 3300005518 Ga0070699_100000218 Ga0070699_10000021810 385
889 3300005518 Ga0070699_100013455 Ga0070699_1000134553 385
890 3300005518 Ga0070699_100034944 Ga0070699_1000349443 385
891 3300005530 Ga0070679_100000891 Ga0070679_1000008911 385
892 3300005535 Ga0070684_100255889 Ga0070684_1002558893 385
893 3300005536 Ga0070697_100000740 Ga0070697_10000074014 385
894 3300005536 Ga0070697_100003833 Ga0070697_10000383311 385
895 3300005536 Ga0070697_100005751 Ga0070697_1000057514 385
896 3300005536 Ga0070697_100017334 Ga0070697_1000173344 385
897 3300005536 Ga0070697_100268105 Ga0070697_1002681051 385
898 3300005539 Ga0068853_100002224 Ga0068853_10000222412 385
899 3300005539 Ga0068853_100039195 Ga0068853_1000391953 385
900 3300005539 Ga0068853_100133451 Ga0068853_1001334512 385
901 3300005544 Ga0070686_100001910 Ga0070686_1000019109 385
902 3300005544 Ga0070686_100017342 Ga0070686_1000173423 385
903 3300005544 Ga0070686_100048979 Ga0070686_1000489792 385
904 3300005544 Ga0070686_100182746 Ga0070686_1001827461 385
905 3300005545 Ga0070695_100010571 Ga0070695_1000105712 385
906 3300005545 Ga0070695_100083077 Ga0070695_1000830772 385
907 3300005546 Ga0070696_100001986 Ga0070696_10000198610 385
908 3300005546 Ga0070696_100034724 Ga0070696_1000347243 385
909 3300005547 Ga0070693_100004279 Ga0070693_1000042793 385
910 3300005547 Ga0070693_100007936 Ga0070693_1000079363 385
911 3300005548 Ga0070665_100203306 Ga0070665_1002033062 385
912 3300005549 Ga0070704_100000287 Ga0070704_1000002873 385
913 3300005549 Ga0070704_100021303 Ga0070704_1000213032 385
914 3300005549 Ga0070704_100035771 Ga0070704_1000357712 385
915 3300005549 Ga0070704_100142232 Ga0070704_1001422321 385
916 3300005549 Ga0070704_100219717 Ga0070704_1002197171 385
917 3300005563 Ga0068855_100108337 Ga0068855_1001083374 385
918 3300005564 Ga0070664_100005502 Ga0070664_1000055028 385
919 3300005564 Ga0070664_100199603 Ga0070664_1001996032 385
920 3300005577 Ga0068857_100010553 Ga0068857_1000105532 385
921 3300005577 Ga0068857_100012447 Ga0068857_1000124474 385
922 3300005577 Ga0068857_100104333 Ga0068857_1001043332 385
923 3300005578 Ga0068854_100001279 Ga0068854_10000127912 385
924 3300005578 Ga0068854_100021685 Ga0068854_1000216853 385
925 3300005578 Ga0068854_100281018 Ga0068854_1002810181 385
926 3300005615 Ga0070702_100004315 Ga0070702_1000043157 385
927 3300005616 Ga0068852_100035861 Ga0068852_1000358613 385
928 3300005617 Ga0068859_100000577 Ga0068859_10000057718 385
929 3300005617 Ga0068859_100006029 Ga0068859_1000060298 385
930 3300005617 Ga0068859_100008971 Ga0068859_1000089715 385
931 3300005617 Ga0068859_100020137 Ga0068859_1000201375 385
932 3300005617 Ga0068859_100080645 Ga0068859_1000806452 385
933 3300005617 Ga0068859_100112244 Ga0068859_1001122442 385
934 3300005617 Ga0068859_100187661 Ga0068859_1001876613 385
935 3300005618 Ga0068864_100009469 Ga0068864_1000094693 385
936 3300005618 Ga0068864_100028764 Ga0068864_1000287643 385
937 3300005618 Ga0068864_100218747 Ga0068864_1002187472 385
938 3300005618 Ga0068864_100228445 Ga0068864_1002284452 385
939 3300005618 Ga0068864_100300740 Ga0068864_1003007401 385
940 3300005718 Ga0068866_10000082 Ga0068866_1000008222 385
941 3300005719 Ga0068861_100000185 Ga0068861_10000018529 385
942 3300005719 Ga0068861_100019842 Ga0068861_1000198422 385
943 3300005719 Ga0068861_100029619 Ga0068861_1000296193 385
944 3300005841 Ga0068863_100099569 Ga0068863_1000995692 385
945 3300005841 Ga0068863_100126254 Ga0068863_1001262542 385
946 3300005842 Ga0068858_100025815 Ga0068858_1000258155 385
947 3300005842 Ga0068858_100080069 Ga0068858_1000800693 385
948 3300005842 Ga0068858_100243831 Ga0068858_1002438312 385
949 3300005843 Ga0068860_100008828 Ga0068860_1000088288 385
950 3300005843 Ga0068860_100019485 Ga0068860_1000194852 385
951 3300005843 Ga0068860_100031492 Ga0068860_1000314924 385
952 3300005843 Ga0068860_100111516 Ga0068860_1001115164 385
953 3300005843 Ga0068860_100188746 Ga0068860_1001887461 385
954 3300005844 Ga0068862_100011311 Ga0068862_1000113111 385
955 3300005844 Ga0068862_100020962 Ga0068862_1000209623 385
956 3300005844 Ga0068862_100082808 Ga0068862_1000828082 385
957 3300005937 Ga0081455_10238655 Ga0081455_102386551 385
958 3300005985 Ga0081539_10019484 Ga0081539_100194843 385
959 3300006237 Ga0097621_100030665 Ga0097621_1000306653 385
960 3300006237 Ga0097621_100053001 Ga0097621_1000530011 385
961 3300006237 Ga0097621_100168847 Ga0097621_1001688472 385
962 3300006358 Ga0068871_100003452 Ga0068871_1000034528 385
963 3300006358 Ga0068871_100014588 Ga0068871_1000145882 385
964 3300006844 Ga0075428_100078891 Ga0075428_1000788912 385
965 3300006846 Ga0075430_100012483 Ga0075430_1000124836 385
966 3300006847 Ga0075431_100030736 Ga0075431_1000307363 385
967 3300006847 Ga0075431_100061259 Ga0075431_1000612593 385
968 3300006847 Ga0075431_100143234 Ga0075431_1001432342 385
969 3300006852 Ga0075433_10014212 Ga0075433_100142125 385
970 3300006852 Ga0075433_10114057 Ga0075433_101140572 385
971 3300006852 Ga0075433_10143119 Ga0075433_101431192 385
972 3300006852 Ga0075433_10228255 Ga0075433_102282552 385
973 3300006871 Ga0075434_100040210 Ga0075434_1000402104 385
974 3300006880 Ga0075429_100204383 Ga0075429_1002043832 385
975 3300006881 Ga0068865_100003404 Ga0068865_1000034047 385
976 3300006881 Ga0068865_100015488 Ga0068865_1000154882 385
977 3300006881 Ga0068865_100071048 Ga0068865_1000710483 385
978 3300006931 Ga0097620_100000577 Ga0097620_10000057718 385
979 3300006931 Ga0097620_100006029 Ga0097620_1000060298 385
980 3300006931 Ga0097620_100008971 Ga0097620_1000089715 385
981 3300006931 Ga0097620_100020137 Ga0097620_1000201373 385
982 3300006931 Ga0097620_100080648 Ga0097620_1000806482 385
983 3300006931 Ga0097620_100112238 Ga0097620_1001122382 385
984 3300006931 Ga0097620_100187652 Ga0097620_1001876523 385
985 3300007076 Ga0075435_100060000 Ga0075435_1000600003 385
986 3300009093 Ga0105240_10012168 Ga0105240_100121684 385
987 3300009093 Ga0105240_10044951 Ga0105240_100449515 385
988 3300009093 Ga0105240_10187999 Ga0105240_101879992 385
989 3300009098 Ga0105245_10007874 Ga0105245_100078746 385
990 3300009147 Ga0114129_10024316 Ga0114129_100243165 385
991 3300009147 Ga0114129_10043058 Ga0114129_100430584 385
992 3300009147 Ga0114129_10050670 Ga0114129_100506703 385
993 3300009147 Ga0114129_10175465 Ga0114129_101754652 385
994 3300009147 Ga0114129_10255996 Ga0114129_102559961 385
995 3300009147 Ga0114129_10416922 Ga0114129_104169221 385
996 3300009148 Ga0105243_10001325 Ga0105243_1000132516 385
997 3300009148 Ga0105243_10003523 Ga0105243_100035238 385
998 3300009148 Ga0105243_10170660 Ga0105243_101706602 385
999 3300009174 Ga0105241_10008905 Ga0105241_100089057 385
1000 3300009176 Ga0105242_10000510 Ga0105242_1000051019 385
1001 3300009176 Ga0105242_10071159 Ga0105242_100711593 385
1002 3300009177 Ga0105248_10003156 Ga0105248_100031569 385
1003 3300009177 Ga0105248_10003227 Ga0105248_100032274 385
1004 3300009177 Ga0105248_10022647 Ga0105248_100226474 385
1005 3300009177 Ga0105248_10104101 Ga0105248_101041012 385
1006 3300009545 Ga0105237_10027016 Ga0105237_100270163 385
1007 3300009545 Ga0105237_10028333 Ga0105237_100283333 385
1008 3300009545 Ga0105237_10072843 Ga0105237_100728432 385
1009 3300009553 Ga0105249_10003384 Ga0105249_100033845 385
1010 3300009553 Ga0105249_10018961 Ga0105249_100189614 385
1011 3300009553 Ga0105249_10034297 Ga0105249_100342973 385
1012 3300009553 Ga0105249_10260717 Ga0105249_102607172 385
1013 3300009553 Ga0105249_10289085 Ga0105249_102890852 385
1014 3300009553 Ga0105249_10291589 Ga0105249_102915892 385
1015 3300010375 Ga0105239_10001172 Ga0105239_1000117229 385
1016 3300010375 Ga0105239_10054001 Ga0105239_100540013 385
1017 3300010375 Ga0105239_10074505 Ga0105239_100745052 385
1018 3300011119 Ga0105246_10034737 Ga0105246_100347372 385
1019 3300013100 Ga0157373_10001239 Ga0157373_100012394 385
1020 3300013105 Ga0157369_10002547 Ga0157369_100025479 385
1021 3300013296 Ga0157374_10075531 Ga0157374_100755313 385
1022 3300013297 Ga0157378_10000139 Ga0157378_1000013965 385
1023 3300013297 Ga0157378_10004092 Ga0157378_100040922 385
1024 3300013297 Ga0157378_10020221 Ga0157378_100202213 385
1025 3300013297 Ga0157378_10037501 Ga0157378_100375013 385
1026 3300013297 Ga0157378_10088134 Ga0157378_100881342 385
1027 3300013297 Ga0157378_10105557 Ga0157378_101055573 385
1028 3300013297 Ga0157378_10208192 Ga0157378_102081922 385
1029 3300013306 Ga0163162_10003865 Ga0163162_100038654 385
1030 3300013306 Ga0163162_10005200 Ga0163162_100052009 385
1031 3300013306 Ga0163162_10006709 Ga0163162_100067097 385
1032 3300013306 Ga0163162_10008625 Ga0163162_100086254 385
1033 3300013306 Ga0163162_10016838 Ga0163162_100168384 385
1034 3300013306 Ga0163162_10071353 Ga0163162_100713534 385
1035 3300013307 Ga0157372_10020033 Ga0157372_100200334 385
1036 3300013308 Ga0157375_10032521 Ga0157375_100325213 385
1037 3300013308 Ga0157375_10154751 Ga0157375_101547514 385
1038 3300013308 Ga0157375_10176668 Ga0157375_101766682 385
1039 3300014325 Ga0163163_10003111 Ga0163163_100031112 385
1040 3300014325 Ga0163163_10022262 Ga0163163_100222623 385
1041 3300014325 Ga0163163_10023181 Ga0163163_100231814 385
1042 3300014325 Ga0163163_10035193 Ga0163163_100351933 385
1043 3300014325 Ga0163163_10051589 Ga0163163_100515893 385
1044 3300014325 Ga0163163_10054848 Ga0163163_100548481 385
1045 3300014325 Ga0163163_10206179 Ga0163163_102061791 385
1046 3300014325 Ga0163163_10246882 Ga0163163_102468822 385
1047 3300014325 Ga0163163_10324747 Ga0163163_103247471 385
1048 3300014326 Ga0157380_10000235 Ga0157380_100002356 385
1049 3300014326 Ga0157380_10025236 Ga0157380_100252361 385
1050 3300014326 Ga0157380_10039539 Ga0157380_100395393 385
1051 3300014745 Ga0157377_10033854 Ga0157377_100338542 385
1052 3300014745 Ga0157377_10069635 Ga0157377_100696352 385
1053 3300014968 Ga0157379_10013112 Ga0157379_100131125 385
1054 3300014968 Ga0157379_10016412 Ga0157379_100164124 385
1055 3300014969 Ga0157376_10011777 Ga0157376_100117773 385
1056 3300014969 Ga0157376_10035676 Ga0157376_100356763 385
1057 3300017792 Ga0163161_10003958 Ga0163161_100039588 385
1058 3300017792 Ga0163161_10005427 Ga0163161_100054276 385
1059 3300021384 Ga0213876_10000060 Ga0213876_1000006023 385
1060 3300021384 Ga0213876_10000672 Ga0213876_1000067219 385
1061 3300025315 Ga0207697_10011127 Ga0207697_100111273 385
1062 3300025899 Ga0207642_10000577 Ga0207642_100005775 385
1063 3300025899 Ga0207642_10007455 Ga0207642_100074553 385
1064 3300025903 Ga0207680_10045714 Ga0207680_100457142 385
1065 3300025904 Ga0207647_10056800 Ga0207647_100568001 385
1066 3300025907 Ga0207645_10001386 Ga0207645_1000138615 385
1067 3300025908 Ga0207643_10006159 Ga0207643_100061594 385
1068 3300025910 Ga0207684_10000358 Ga0207684_1000035814 385
1069 3300025910 Ga0207684_10016528 Ga0207684_100165285 385
1070 3300025910 Ga0207684_10112028 Ga0207684_101120282 385
1071 3300025910 Ga0207684_10253264 Ga0207684_102532641 385
1072 3300025910 Ga0207684_10253364 Ga0207684_102533642 385
1073 3300025911 Ga0207654_10002290 Ga0207654_100022907 385
1074 3300025911 Ga0207654_10127927 Ga0207654_101279272 385
1075 3300025912 Ga0207707_10000072 Ga0207707_1000007238 385
1076 3300025913 Ga0207695_10004346 Ga0207695_1000434616 385
1077 3300025914 Ga0207671_10022135 Ga0207671_100221354 385
1078 3300025914 Ga0207671_10075503 Ga0207671_100755032 385
1079 3300025917 Ga0207660_10000141 Ga0207660_1000014138 385
1080 3300025917 Ga0207660_10232523 Ga0207660_102325231 385
1081 3300025918 Ga0207662_10005860 Ga0207662_100058605 385
1082 3300025918 Ga0207662_10018192 Ga0207662_100181922 385
1083 3300025919 Ga0207657_10151163 Ga0207657_101511631 385
1084 3300025919 Ga0207657_10240320 Ga0207657_102403201 385
1085 3300025920 Ga0207649_10076417 Ga0207649_100764173 385
1086 3300025921 Ga0207652_10000083 Ga0207652_1000008341 385
1087 3300025922 Ga0207646_10000492 Ga0207646_1000049220 385
1088 3300025922 Ga0207646_10162658 Ga0207646_101626582 385
1089 3300025923 Ga0207681_10001297 Ga0207681_100012975 385
1090 3300025923 Ga0207681_10008623 Ga0207681_100086232 385
1091 3300025923 Ga0207681_10068510 Ga0207681_100685101 385
1092 3300025925 Ga0207650_10000001 Ga0207650_10000001670 385
1093 3300025926 Ga0207659_10054245 Ga0207659_100542452 385
1094 3300025926 Ga0207659_10279343 Ga0207659_102793431 385
1095 3300025933 Ga0207706_10000011 Ga0207706_1000001154 385
1096 3300025933 Ga0207706_10090581 Ga0207706_100905812 385
1097 3300025934 Ga0207686_10000158 Ga0207686_1000015816 385
1098 3300025935 Ga0207709_10001838 Ga0207709_1000183811 385
1099 3300025936 Ga0207670_10000357 Ga0207670_100003578 385
1100 3300025937 Ga0207669_10001441 Ga0207669_100014418 385
1101 3300025938 Ga0207704_10000600 Ga0207704_100006007 385
1102 3300025939 Ga0207665_10068415 Ga0207665_100684153 385
1103 3300025940 Ga0207691_10011274 Ga0207691_100112743 385
1104 3300025940 Ga0207691_10145821 Ga0207691_101458212 385
1105 3300025941 Ga0207711_10002253 Ga0207711_100022537 385
1106 3300025941 Ga0207711_10026917 Ga0207711_100269174 385
1107 3300025942 Ga0207689_10005347 Ga0207689_100053474 385
1108 3300025942 Ga0207689_10007287 Ga0207689_100072875 385
1109 3300025942 Ga0207689_10011472 Ga0207689_100114726 385
1110 3300025942 Ga0207689_10015475 Ga0207689_100154755 385
1111 3300025945 Ga0207679_10053218 Ga0207679_100532181 385
1112 3300025945 Ga0207679_10211776 Ga0207679_102117762 385
1113 3300025945 Ga0207679_10239804 Ga0207679_102398041 385
1114 3300025949 Ga0207667_10003920 Ga0207667_1000392012 385
1115 3300025949 Ga0207667_10088195 Ga0207667_100881952 385
1116 3300025960 Ga0207651_10003518 Ga0207651_100035182 385
1117 3300025960 Ga0207651_10191242 Ga0207651_101912422 385
1118 3300025961 Ga0207712_10000459 Ga0207712_1000045913 385
1119 3300025961 Ga0207712_10017079 Ga0207712_100170792 385
1120 3300025961 Ga0207712_10157862 Ga0207712_101578621 385
1121 3300025961 Ga0207712_10189488 Ga0207712_101894882 385
1122 3300025961 Ga0207712_10208596 Ga0207712_102085962 385
1123 3300025972 Ga0207668_10017222 Ga0207668_100172225 385
1124 3300025981 Ga0207640_10000975 Ga0207640_100009757 385
1125 3300025981 Ga0207640_10014020 Ga0207640_100140202 385
1126 3300025981 Ga0207640_10069416 Ga0207640_100694161 385
1127 3300026035 Ga0207703_10003909 Ga0207703_100039091 385
1128 3300026035 Ga0207703_10060918 Ga0207703_100609183 385
1129 3300026041 Ga0207639_10002185 Ga0207639_1000218511 385
1130 3300026041 Ga0207639_10026974 Ga0207639_100269744 385
1131 3300026075 Ga0207708_10007856 Ga0207708_100078566 385
1132 3300026075 Ga0207708_10135733 Ga0207708_101357332 385
1133 3300026078 Ga0207702_10030742 Ga0207702_100307421 385
1134 3300026078 Ga0207702_10031754 Ga0207702_100317543 385
1135 3300026088 Ga0207641_10013955 Ga0207641_100139555 385
1136 3300026088 Ga0207641_10097985 Ga0207641_100979852 385
1137 3300026088 Ga0207641_10158218 Ga0207641_101582182 385
1138 3300026088 Ga0207641_10351344 Ga0207641_103513441 385
1139 3300026089 Ga0207648_10000011 Ga0207648_1000001189 385
1140 3300026089 Ga0207648_10016996 Ga0207648_100169964 385
1141 3300026095 Ga0207676_10000852 Ga0207676_1000085217 385
1142 3300026095 Ga0207676_10016501 Ga0207676_100165013 385
1143 3300026095 Ga0207676_10120767 Ga0207676_101207672 385
1144 3300026095 Ga0207676_10137896 Ga0207676_101378961 385
1145 3300026095 Ga0207676_10188074 Ga0207676_101880741 385
1146 3300026095 Ga0207676_10215856 Ga0207676_102158561 385
1147 3300026116 Ga0207674_10001937 Ga0207674_1000193724 385
1148 3300026116 Ga0207674_10256076 Ga0207674_102560761 385
1149 3300026118 Ga0207675_100014186 Ga0207675_1000141865 385
1150 3300026118 Ga0207675_100014932 Ga0207675_1000149326 385
1151 3300026118 Ga0207675_100016144 Ga0207675_1000161444 385
1152 3300026118 Ga0207675_100042140 Ga0207675_1000421402 385
1153 3300026118 Ga0207675_100051906 Ga0207675_1000519063 385
1154 3300026121 Ga0207683_10001588 Ga0207683_100015885 385
1155 3300027876 Ga0209974_10005742 Ga0209974_100057422 385
1156 3300028379 Ga0268266_10130400 Ga0268266_101304002 385
1157 3300028380 Ga0268265_10024548 Ga0268265_100245481 385
1158 3300028380 Ga0268265_10049378 Ga0268265_100493784 385
1159 3300028381 Ga0268264_10002589 Ga0268264_100025892 385
1160 3300028381 Ga0268264_10022855 Ga0268264_100228554 385
1161 3300028381 Ga0268264_10028324 Ga0268264_100283244 385
1162 3300028381 Ga0268264_10389149 Ga0268264_103891491 385
1163 3300031090 Ga0265760_10008863 Ga0265760_100088632 385
1164 3300031456 Ga0307513_10011098 Ga0307513_100110983 385
1165 3300031548 Ga0307408_100007180 Ga0307408_1000071803 385
1166 3300031548 Ga0307408_100019139 Ga0307408_1000191392 385
1167 3300031548 Ga0307408_100053326 Ga0307408_1000533261 385
1168 3300031731 Ga0307405_10000599 Ga0307405_100005997 385
1169 3300031731 Ga0307405_10005843 Ga0307405_100058434 385
1170 3300031731 Ga0307405_10177582 Ga0307405_101775822 385
1171 3300031824 Ga0307413_10015108 Ga0307413_100151082 385
1172 3300031852 Ga0307410_10071693 Ga0307410_100716932 385
1173 3300031901 Ga0307406_10007574 Ga0307406_100075744 385
1174 3300031901 Ga0307406_10014912 Ga0307406_100149122 385
1175 3300031901 Ga0307406_10037736 Ga0307406_100377363 385
1176 3300031901 Ga0307406_10149162 Ga0307406_101491622 385
1177 3300031903 Ga0307407_10067167 Ga0307407_100671672 385
1178 3300031911 Ga0307412_10002823 Ga0307412_100028238 385
1179 3300031911 Ga0307412_10011010 Ga0307412_100110103 385
1180 3300031911 Ga0307412_10066717 Ga0307412_100667173 385
1181 3300031995 Ga0307409_100000291 Ga0307409_1000002911 385
1182 3300031995 Ga0307409_100308132 Ga0307409_1003081322 385
1183 3300032002 Ga0307416_100008383 Ga0307416_1000083832 385
1184 3300032002 Ga0307416_100009834 Ga0307416_1000098342 385
1185 3300032002 Ga0307416_100065371 Ga0307416_1000653713 385
1186 3300032002 Ga0307416_100066966 Ga0307416_1000669661 385
1187 3300032004 Ga0307414_10001198 Ga0307414_100011987 385
1188 3300032005 Ga0307411_10000400 Ga0307411_100004007 385
1189 3300032005 Ga0307411_10002441 Ga0307411_100024413 385
1190 3300032005 Ga0307411_10151956 Ga0307411_101519561 385
1191 3300032126 Ga0307415_100000755 Ga0307415_1000007556 385
1192 3300032126 Ga0307415_100065835 Ga0307415_1000658351 385
1193 3300035086 Ga0373934_0042908 Ga0373934_0042908_181_1356 385
1194 3300035091 Ga0373951_0001961 Ga0373951_0001961_4004_5185 385
1195 3300035111 Ga0373923_0035463 Ga0373923_0035463_240_1415 385
1196 3300035118 Ga0373954_0021213 Ga0373954_0021213_522_1697 385
1197 3300035119 Ga0373956_0076854 Ga0373956_0076854_225_1400 385
1198 3300035120 Ga0373957_0033363 Ga0373957_0033363_17_1192 385
1199 3300035724 Ga0373933_0006397 Ga0373933_0006397_3911_5086 385
1200 3300035724 Ga0373933_0018930 Ga0373933_0018930_543_1718 385
1201 3300036401 Ga0373937_0002343 Ga0373937_0002343_11289_12464 385
1202 3300036401 Ga0373937_0011017 Ga0373937_0011017_6685_7860 385
1203 3300037471 Ga0395905_0000099 Ga0395905_0000099_110423_111580 385
1204 3300037471 Ga0395905_0009429 Ga0395905_0009429_6668_7843 385
1205 3300037471 Ga0395905_0013377 Ga0395905_0013377_3938_5119 385
1206 3300037471 Ga0395905_0028561 Ga0395905_0028561_742_1923 385
1207 3300037471 Ga0395905_0054962 Ga0395905_0054962_1042_2223 385
1208 3300039437 Ga0436365_0706054 Ga0436365_0706054_99069_100244 385
1209 3300039437 Ga0436365_1344587 Ga0436365_1344587_186647_187822 385
1210 3300042876 Ga0451577_0011169 Ga0451577_0011169_4112_5287 385
1211 3300042876 Ga0451577_0078179 Ga0451577_0078179_320_1486 385
1212 3300044673 Ga0453683_0013212 Ga0453683_0013212_2863_4029 385
1213 3300044673 Ga0453683_0040831 Ga0453683_0040831_1213_2379 385
1214 3300044694 Ga0466963_0096799 Ga0466963_0096799_230_1405 385
1215 3300044712 Ga0453684_0012922 Ga0453684_0012922_6769_7944 385
1216 3300044712 Ga0453684_0208497 Ga0453684_0208497_382_1554 385
1217 3300045051 Ga0451576_0017613 Ga0451576_0017613_2548_3714 385
1218 3300045051 Ga0451576_0293419 Ga0451576_0293419_320_1495 385
1219 3300046462 Ga0495651_0148292 Ga0495651_0148292_297_1472 385
1220 3300046472 Ga0495580_0018995 Ga0495580_0018995_71_1249 385
1221 3300046519 Ga0495632_0008298 Ga0495632_0008298_3979_5172 385
1222 3300046535 Ga0495586_0004158 Ga0495586_0004158_6246_7421 385
1223 3300046537 Ga0495598_0000387 Ga0495598_0000387_5765_6952 385
1224 3300046615 Ga0495656_0042426 Ga0495656_0042426_531_1718 385
1225 3300046616 Ga0495668_0084587 Ga0495668_0084587_248_1435 385
1226 3300046678 Ga0495599_0004656 Ga0495599_0004656_1133_2314 385
1227 3300046683 Ga0495658_0019343 Ga0495658_0019343_1864_3039 385
1228 3300046690 Ga0495624_0087521 Ga0495624_0087521_309_1490 385
1229 3300047320 Ga0495672_0018186 Ga0495672_0018186_2720_3907 385
1230 3300047471 Ga0495684_0165061 Ga0495684_0165061_81_1262 385
1231 3300048905 Ga0496102_0122763 Ga0496102_0122763_901_2064 385
1232 3300048909 Ga0496106_0018360 Ga0496106_0018360_341_1522 385
1233 3300048909 Ga0496106_0076753 Ga0496106_0076753_646_1809 385
1234 3300048910 Ga0496107_0214678 Ga0496107_0214678_26_1189 385
1235 3300048911 Ga0496108_0228766 Ga0496108_0228766_68_1252 385
1236 3300048911 Ga0496108_0313523 Ga0496108_0313523_76_1257 385
1237 3300048915 Ga0496112_0098420 Ga0496112_0098420_760_1944 385
1238 3300048915 Ga0496112_0118810 Ga0496112_0118810_747_1928 385
1239 3300048916 Ga0496113_0050819 Ga0496113_0050819_933_2114 385
1240 3300048916 Ga0496113_0123509 Ga0496113_0123509_512_1696 385
1241 3300049521 Ga0501298_000833 Ga0501298_000833_2435_3616 385
1242 3300049521 Ga0501298_005247 Ga0501298_005247_224_1405 385
1243 3300049568 Ga0501031_0041335 Ga0501031_0041335_1702_2904 385
1244 3300049571 Ga0501034_0185025 Ga0501034_0185025_682_1851 385
1245 3300049572 Ga0501036_0144905 Ga0501036_0144905_674_1876 385
1246 3300049574 Ga0501038_0005530 Ga0501038_0005530_7329_8510 385
1247 3300049574 Ga0501038_0065739 Ga0501038_0065739_934_2100 385
1248 3300049576 Ga0501040_0020609 Ga0501040_0020609_748_1914 385
1249 3300049577 Ga0501041_0086664 Ga0501041_0086664_25_1191 385
1250 3300049582 Ga0501048_0117614 Ga0501048_0117614_661_1827 385
1251 3300049586 Ga0501070_0299769 Ga0501070_0299769_115_1284 385
1252 3300049587 Ga0501071_0238860 Ga0501071_0238860_121_1302 385
1253 3300049590 Ga0501074_0014913 Ga0501074_0014913_2582_3748 385
1254 3300049590 Ga0501074_0100620 Ga0501074_0100620_762_1928 385
1255 3300049591 Ga0501075_0047592 Ga0501075_0047592_172_1338 385
1256 3300049591 Ga0501075_0048167 Ga0501075_0048167_1274_2440 385
1257 3300049593 Ga0501077_0011892 Ga0501077_0011892_2267_3433 385
1258 3300049649 Ga0501198_000659 Ga0501198_000659_2713_3894 385
1259 3300049652 Ga0501202_000146 Ga0501202_000146_7147_8328 385
1260 3300049661 Ga0501217_003007 Ga0501217_003007_1505_2686 385
1261 3300049661 Ga0501217_004632 Ga0501217_004632_113_1294 385
1262 3300049663 Ga0501223_001160 Ga0501223_001160_4490_5671 385
1263 3300049664 Ga0501224_000886 Ga0501224_000886_764_1945 385
1264 3300049665 Ga0501227_000114 Ga0501227_000114_4888_6069 385
1265 3300049669 Ga0501235_007439 Ga0501235_007439_224_1405 385
1266 3300049673 Ga0501240_001784 Ga0501240_001784_766_1947 385
1267 3300049689 Ga0501260_002044 Ga0501260_002044_361_1542 385
1268 3300049689 Ga0501260_003165 Ga0501260_003165_210_1391 385
1269 3300049704 Ga0501221_000764 Ga0501221_000764_960_2141 385
1270 3300049705 Ga0501225_0000554 Ga0501225_0000554_2904_4085 385
1271 3300049705 Ga0501225_0022626 Ga0501225_0022626_170_1351 385
1272 3300049742 Ga0501080_0221298 Ga0501080_0221298_537_1703 385
1273 3300049743 Ga0501081_0012744 Ga0501081_0012744_2810_3976 385
1274 3300049743 Ga0501081_0027136 Ga0501081_0027136_665_1831 385
1275 3300049779 Ga0501283_001130 Ga0501283_001130_1239_2420 385
1276 3300049824 Ga0501045_0016732 Ga0501045_0016732_1833_2999 385
1277 3300050507 nmdc:mga05p37_176639_c1 nmdc:mga05p37_176639_c1_307_1473 385
1278 3300050507 nmdc:mga05p37_23053_c1 nmdc:mga05p37_23053_c1_2667_3851 385
1279 3300050507 nmdc:mga05p37_322695_c1 nmdc:mga05p37_322695_c1_261_1481 385
1280 3300050507 nmdc:mga05p37_49478_c1 nmdc:mga05p37_49478_c1_2234_3400 385
1281 3300050507 nmdc:mga05p37_88795_c1 nmdc:mga05p37_88795_c1_1309_2490 385
1282 3300050509 nmdc:mga0qj67_47148_c1 nmdc:mga0qj67_47148_c1_1309_2490 385
1283 3300050510 nmdc:mga06r32_6701_c1 nmdc:mga06r32_6701_c1_1453_2637 385
1284 3300050512 nmdc:mga0n895_86516_c1 nmdc:mga0n895_86516_c1_1232_2413 385
1285 3300050513 nmdc:mga0rr50_103783_c1 nmdc:mga0rr50_103783_c1_422_1582 385
1286 3300050513 nmdc:mga0rr50_52492_c1 nmdc:mga0rr50_52492_c1_1593_2813 385
1287 3300050514 nmdc:mga08x19_34037_c1 nmdc:mga08x19_34037_c1_907_2088 385
1288 3300050515 nmdc:mga0a205_39258_c1 nmdc:mga0a205_39258_c1_3002_4183 385
1289 3300050515 nmdc:mga0a205_47766_c1 nmdc:mga0a205_47766_c1_1733_2914 385
1290 3300050515 nmdc:mga0a205_70792_c1 nmdc:mga0a205_70792_c1_759_1943 385
1291 3300053085 Ga0495619_0133345 Ga0495619_0133345_221_1396 385
1292 3300053153 Ga0500616_0002309 Ga0500616_0002309_1522_2691 385
1293 3300059421 Ga0590071_004752 Ga0590071_004752_1272_2438 385
1294 3300060353 Ga0501082_0176407 Ga0501082_0176407_503_1669 385
1295 3300061734 Ga0530510_0020381 Ga0530510_0020381_1936_3102 385
1296 3300005295 Ga0065707_10023650 Ga0065707_100236502 386
1297 3300005844 Ga0068862_100082393 Ga0068862_1000823932 386
1298 3300005937 Ga0081455_10002244 Ga0081455_1000224421 386
1299 3300005981 Ga0081538_10001985 Ga0081538_1000198510 386
1300 3300005983 Ga0081540_1017194 Ga0081540_10171942 386
1301 3300006844 Ga0075428_100014111 Ga0075428_1000141115 386
1302 3300009094 Ga0111539_10013205 Ga0111539_100132052 386
1303 3300009553 Ga0105249_10053540 Ga0105249_100535402 386
1304 3300013307 Ga0157372_10010259 Ga0157372_100102593 386
1305 3300014968 Ga0157379_10025878 Ga0157379_100258784 386
1306 3300025919 Ga0207657_10003930 Ga0207657_100039306 386
1307 3300025920 Ga0207649_10040917 Ga0207649_100409172 386
1308 3300026089 Ga0207648_10073490 Ga0207648_100734902 386
1309 3300031240 Ga0265320_10008934 Ga0265320_100089344 386
1310 3300031344 Ga0265316_10152107 Ga0265316_101521072 386
1311 3300031344 Ga0265316_10211721 Ga0265316_102117211 386
1312 3300031595 Ga0265313_10036105 Ga0265313_100361052 386
1313 3300036401 Ga0373937_0179795 Ga0373937_0179795_633_1796 386
1314 3300046472 Ga0495580_0009857 Ga0495580_0009857_5994_7169 386
1315 3300046539 Ga0495621_0052109 Ga0495621_0052109_234_1448 386
1316 3300049575 Ga0501039_0069885 Ga0501039_0069885_188_1357 386
1317 3300049588 Ga0501072_0033643 Ga0501072_0033643_2410_3579 386
1318 3300050507 nmdc:mga05p37_62916_c1 nmdc:mga05p37_62916_c1_3023_4192 386
1319 3300050511 nmdc:mga08y16_32583_c1 nmdc:mga08y16_32583_c1_1056_2225 386
1320 3300054114 Ga0501084_0337483 Ga0501084_0337483_18_1187 386
1321 3300037471 Ga0395905_0144644 Ga0395905_0144644_112_1281 387
1322 2162886007 SwRhRL2b_contig_2693654 SwRhRL2b_0752.00001100 388
1323 3300048913 Ga0496110_0003571 Ga0496110_0003571_3927_5093 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

310

459

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

88

200

0.99

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

325

448

0.98

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

203

298

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ol2-assembly2.cif.gz_F the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile 0.9834 15 386
4l1f-assembly1.cif.gz_A electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation 0.9793 12 388
2jif-assembly1.cif.gz_D structure of human short-branched chain acyl-coa dehydrogenase (acadsb) 0.9782 10 388
1jqi-assembly1.cif.gz_B crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa 0.9757 12 387
3pfd-assembly4.cif.gz_C crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr 0.9752 19 386
ID Description Score Start End Superfamily
1bucB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9959 248 386 1.20.140.10
1jqiB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9944 248 386 1.20.140.10
af_Q6AXI7_256_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9943 243 387 1.20.140.10
1jqiA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.994 248 386 1.20.140.10
af_Q9VDT1_256_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9938 243 387 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A1M4ZYU6-F1-model_v4 Acyl-CoA dehydrogenase, C-terminal domain 1.003 295 386 GO:0003995
AF-A0A3M1S4W3-F1-model_v4 Acyl-CoA dehydrogenase 0.9974 286 388 GO:0003995
GO:0006631
AF-A0A2N2FR64-F1-model_v4 Acyl-CoA dehydrogenase 0.9966 257 388 GO:0003995
AF-A0A524GWN8-F1-model_v4 Acyl-CoA dehydrogenase 0.9932 285 387 GO:0003995
AF-A0A662YB15-F1-model_v4 Acyl-CoA dehydrogenase/oxidase C-terminal domain-containing protein 0.9914 254 387 GO:0003995
GO:0033539
GO:0046359

Feature Viewer

pLDDT pTM Quality
95.1 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map