F492903

General Info

Members Datasets Scaffolds Average Seq Length
1314 502 1291 324

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0048857|Ga0495652_0048857_1351_2451
Length 366
Sequence MVAAVRVHKPGGPEALIYEDVEIAAPGQGQIKIKQHACGVNFIDAYFRMGMYPSPVGMPFIAGNESAGEVMAVGPGVTDVKVGDRVAFVGPLGGYAAERLVPADRAVKLPDNITYEQAAGMMLKGMTVQYLVNRTYKVGKGTICLVHAAAGGVGLIACQWANHLGATVIGTVGSKEKAELAKKNGCHHTILYRDEDFVAKVKEFTSGKLCDVVYDGIGKTTFPASLDCLRPLGYFVSFGSASGQIDAFNINILQTKGSLFATRPTLNHYVAKRDDLIATAADLFKVVGSGAVKIPVNQKYALKDAGKAHKDMEGRDTTGSSILMPSRSVRRCCARWRYSRSSPPRCLPAGPASRMPRCWQSCTNTA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
7 2791355199
8 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
9 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
10 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
11 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
12 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
13 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
14 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
15 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
16 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
17 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
18 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
19 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
20 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
21 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
22 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
23 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
24 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
25 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
26 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
27 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
32 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
33 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
36 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
37 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
38 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
39 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
42 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
72 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
73 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
74 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
75 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
76 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
77 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
81 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
121 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
122 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
123 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
126 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
127 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
128 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
131 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
132 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
137 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
146 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
147 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
148 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
152 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
165 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
166 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
176 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
177 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
178 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
179 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
182 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
183 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
184 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
264 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
268 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
269 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
270 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
271 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
274 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
275 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
276 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
277 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
278 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
283 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
284 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
285 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
286 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
287 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
288 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
289 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
290 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
291 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
292 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
293 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
294 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
295 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
296 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
297 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
298 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
299 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
300 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
301 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
302 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
303 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
304 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
305 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
306 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
307 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
308 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
310 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
311 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
312 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
313 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
314 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
315 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
316 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
317 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
318 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
319 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
320 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
321 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
322 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
323 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
324 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
325 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
326 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
327 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
328 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
329 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
331 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
332 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
333 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
334 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
337 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
338 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
339 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
340 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
341 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
342 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
343 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
344 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
345 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
367 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
368 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
369 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
370 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
371 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
372 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
376 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
377 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
378 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
379 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
380 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
383 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
384 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
385 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
386 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
387 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
388 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
389 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
390 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
391 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
392 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
424 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
440 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
441 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
442 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
443 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
444 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
445 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
446 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
447 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
448 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
456 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
459 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
460 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
461 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
462 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
463 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
464 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
465 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
466 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
467 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
468 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
469 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
470 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
471 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
472 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
473 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
474 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
475 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
476 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
477 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
478 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
479 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
480 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
481 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
482 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
483 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
484 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
485 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
486 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
487 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
488 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
489 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
490 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
491 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
492 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
493 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
494 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
495 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
498 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
499 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
500 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
501 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
502 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.23
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.02
Nodule 1.22
Rhizoplane 6.16
Rhizosphere 84.63
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772983 2209111006 Bacteria 12374
2 ARcpr5oldR_c000140 3300000041 Bacteria 12413
3 ARSoilYngRDRAFT_c00234 3300000042 Bacteria 8859
4 ARcpr5yngRDRAFT_c000872 3300000043 Bacteria 3563
5 ARSoilOldRDRAFT_c000126 3300000044 Bacteria 13655
6 ARCol0oldRDRAFT_c00368 3300000045 Bacteria 4373
7 ARCol0yngRDRAFT_1000665 3300000652 Bacteria 3543
8 JGI24746J21847_1001655 3300001977 Bacteria 3569
9 JGI24747J21853_1000133 3300001978 Bacteria 3534
10 JGI24739J22299_10014140 3300001989 Bacteria 2905
11 JGI24737J22298_10000960 3300001990 Bacteria 10240
12 JGI24737J22298_10007118 3300001990 Bacteria 3790
13 JGI24737J22298_10021016 3300001990 Bacteria 2081
14 JGI24735J21928_10042458 3300002067 Bacteria 1324
15 JGI24750J21931_1000601 3300002070 Bacteria 5453
16 JGI24750J21931_1005810 3300002070 Bacteria 1522
17 JGI24745J21846_1000099 3300002073 Bacteria 6492
18 JGI24748J21848_1000721 3300002074 Bacteria 3573
19 JGI24738J21930_10000223 3300002075 Bacteria 15332
20 JGI24749J21850_1003197 3300002076 Bacteria 2287
21 JGI24749J21850_1010025 3300002076 Bacteria 1326
22 JGI24744J21845_10000129 3300002077 Bacteria 10529
23 JGI24744J21845_10003963 3300002077 Bacteria 3054
24 JGI24034J26672_10000557 3300002239 Bacteria 4762
25 JGI24034J26672_10003132 3300002239 Bacteria 2301
26 JGI24742J22300_10000255 3300002244 Bacteria 7925
27 JGI24742J22300_10000264 3300002244 Bacteria 7810
28 JGI24742J22300_10000524 3300002244 Bacteria 5729
29 JGI25406J46586_10000004 3300003203 Bacteria 149772
30 JGI25404J52841_10007800 3300003659 Bacteria 2271
31 Ga0065717_1002284 3300005276 Bacteria 2253
32 Ga0065716_1001992 3300005277 Bacteria 2501
33 Ga0065704_10074561 3300005289 Bacteria 6184
34 Ga0065712_10009760 3300005290 Bacteria 2276
35 Ga0065712_10070835 3300005290 Bacteria 5657
36 Ga0065715_10089377 3300005293 Bacteria 10721
37 Ga0070676_10000012 3300005328 Bacteria 58061
38 Ga0070683_100000139 3300005329 Bacteria 46987
39 Ga0070683_100091253 3300005329 Bacteria 2860
40 Ga0070690_100005164 3300005330 Bacteria 7309
41 Ga0070690_100005412 3300005330 Bacteria 7168
42 Ga0070690_100062958 3300005330 Bacteria 2393
43 Ga0070670_100002014 3300005331 Bacteria 16615
44 Ga0070670_100021801 3300005331 Bacteria 5509
45 Ga0070670_100086294 3300005331 Bacteria 2697
46 Ga0070677_10000125 3300005333 Bacteria 25491
47 Ga0068869_100000605 3300005334 Bacteria 20215
48 Ga0068869_100021090 3300005334 Bacteria 4478
49 Ga0068869_100091153 3300005334 Bacteria 2292
50 Ga0070666_10017025 3300005335 Bacteria 4656
51 Ga0070666_10038295 3300005335 Bacteria 3190
52 Ga0070680_100000179 3300005336 Bacteria 40975
53 Ga0070680_100010716 3300005336 Bacteria 7077
54 Ga0070680_100014505 3300005336 Bacteria 6165
55 Ga0070682_100000319 3300005337 Bacteria 33197
56 Ga0070682_100016170 3300005337 Bacteria 4335
57 Ga0068868_100000593 3300005338 Bacteria 24375
58 Ga0068868_100004938 3300005338 Bacteria 9370
59 Ga0068868_100060491 3300005338 Bacteria 2999
60 Ga0070660_100001605 3300005339 Bacteria 15534
61 Ga0070660_100086796 3300005339 Bacteria 2462
62 Ga0070689_100004685 3300005340 Bacteria 9267
63 Ga0070689_100062016 3300005340 Bacteria 2908
64 Ga0070689_100079168 3300005340 Bacteria 2577
65 Ga0070689_100210076 3300005340 Bacteria 1593
66 Ga0070691_10001565 3300005341 Bacteria 9871
67 Ga0070691_10040470 3300005341 Bacteria 2203
68 Ga0070687_100118710 3300005343 Bacteria 1509
69 Ga0070661_100001455 3300005344 Bacteria 16432
70 Ga0070661_100089918 3300005344 Bacteria 2273
71 Ga0070692_10000434 3300005345 Bacteria 12695
72 Ga0070692_10002195 3300005345 Bacteria 7472
73 Ga0070692_10024353 3300005345 Bacteria 2974
74 Ga0070668_100004423 3300005347 Bacteria 10433
75 Ga0070668_100407758 3300005347 Bacteria 1162
76 Ga0070669_100000409 3300005353 Bacteria 32911
77 Ga0070669_100058741 3300005353 Bacteria 2823
78 Ga0070669_100133693 3300005353 Bacteria 1906
79 Ga0070675_100000166 3300005354 Bacteria 40573
80 Ga0070675_100047183 3300005354 Bacteria 3529
81 Ga0070675_100346017 3300005354 Bacteria 1318
82 Ga0070671_100005674 3300005355 Bacteria 9934
83 Ga0070671_100005938 3300005355 Bacteria 9730
84 Ga0070671_100006280 3300005355 Bacteria 9470
85 Ga0070671_100051098 3300005355 Bacteria 3438
86 Ga0070671_100094656 3300005355 Bacteria 2504
87 Ga0070671_100206327 3300005355 Bacteria 1667
88 Ga0070674_100000644 3300005356 Bacteria 17586
89 Ga0070674_100002605 3300005356 Bacteria 9979
90 Ga0070673_100000041 3300005364 Bacteria 54096
91 Ga0070673_100089493 3300005364 Bacteria 2513
92 Ga0070673_100116580 3300005364 Bacteria 2222
93 Ga0070688_100000180 3300005365 Bacteria 33887
94 Ga0070688_100011831 3300005365 Bacteria 4866
95 Ga0070688_100026530 3300005365 Bacteria 3443
96 Ga0070688_100036302 3300005365 Bacteria 2997
97 Ga0070688_100049523 3300005365 Bacteria 2615
98 Ga0070688_100124822 3300005365 Bacteria 1729
99 Ga0070659_100000752 3300005366 Bacteria 23551
100 Ga0070659_100143341 3300005366 Bacteria 1945
101 Ga0070659_100224223 3300005366 Bacteria 1552
102 Ga0070659_100229856 3300005366 Bacteria 1533
103 Ga0070667_100000365 3300005367 Bacteria 49335
104 Ga0070667_100019077 3300005367 Bacteria 5687
105 Ga0070703_10003914 3300005406 Bacteria 4219
106 Ga0070709_10000981 3300005434 Bacteria 15828
107 Ga0070709_10003137 3300005434 Bacteria 8867
108 Ga0070709_10019500 3300005434 Bacteria 3922
109 Ga0070714_100007967 3300005435 Bacteria 8255
110 Ga0070714_100057992 3300005435 Bacteria 3316
111 Ga0070714_100088110 3300005435 Bacteria 2715
112 Ga0070714_100098674 3300005435 Bacteria 2570
113 Ga0070714_100110282 3300005435 Bacteria 2436
114 Ga0070714_100398998 3300005435 Bacteria 1299
115 Ga0070713_100009246 3300005436 Bacteria 7040
116 Ga0070713_100063078 3300005436 Bacteria 3105
117 Ga0070713_100135262 3300005436 Bacteria 2177
118 Ga0070713_100195422 3300005436 Bacteria 1825
119 Ga0070710_10000179 3300005437 Bacteria 29185
120 Ga0070710_10005022 3300005437 Bacteria 6261
121 Ga0070710_10011315 3300005437 Bacteria 4408
122 Ga0070710_10083431 3300005437 Bacteria 1870
123 Ga0070710_10095965 3300005437 Bacteria 1757
124 Ga0070710_10102081 3300005437 Bacteria 1710
125 Ga0070701_10000493 3300005438 Bacteria 13517
126 Ga0070701_10012908 3300005438 Bacteria 3784
127 Ga0070711_100013883 3300005439 Bacteria 5067
128 Ga0070711_100015744 3300005439 Bacteria 4789
129 Ga0070711_100030851 3300005439 Bacteria 3553
130 Ga0070711_100185604 3300005439 Bacteria 1594
131 Ga0070711_100224195 3300005439 Bacteria 1463
132 Ga0070705_100002314 3300005440 Bacteria 9618
133 Ga0070705_100044262 3300005440 Bacteria 2556
134 Ga0070700_100000467 3300005441 Bacteria 20231
135 Ga0070700_100169928 3300005441 Bacteria 1509
136 Ga0070694_100000065 3300005444 Bacteria 49515
137 Ga0070694_100029375 3300005444 Bacteria 3587
138 Ga0070694_100165982 3300005444 Bacteria 1623
139 Ga0070708_100286274 3300005445 Bacteria 1551
140 Ga0070663_100000473 3300005455 Bacteria 21137
141 Ga0070663_100138607 3300005455 Bacteria 1855
142 Ga0070663_100233791 3300005455 Bacteria 1448
143 Ga0070663_100268938 3300005455 Bacteria 1354
144 Ga0070678_100000091 3300005456 Bacteria 34559
145 Ga0070678_100007141 3300005456 Bacteria 6603
146 Ga0070678_100010348 3300005456 Bacteria 5694
147 Ga0070678_100034927 3300005456 Bacteria 3505
148 Ga0070678_100062680 3300005456 Bacteria 2747
149 Ga0070662_100006535 3300005457 Bacteria 7521
150 Ga0070662_100043231 3300005457 Bacteria 3222
151 Ga0070662_100057442 3300005457 Bacteria 2827
152 Ga0070662_100241111 3300005457 Bacteria 1450
153 Ga0070681_10010003 3300005458 Bacteria 9350
154 Ga0070681_10032494 3300005458 Bacteria 5237
155 Ga0070681_10092484 3300005458 Bacteria 2973
156 Ga0070681_10191610 3300005458 Bacteria 1964
157 Ga0070681_10223913 3300005458 Bacteria 1796
158 Ga0068867_100000859 3300005459 Bacteria 20487
159 Ga0068867_100007691 3300005459 Bacteria 7624
160 Ga0068867_100119168 3300005459 Bacteria 2037
161 Ga0070685_10001731 3300005466 Bacteria 11442
162 Ga0070685_10015115 3300005466 Bacteria 4096
163 Ga0070685_10018921 3300005466 Bacteria 3711
164 Ga0070685_10041755 3300005466 Bacteria 2615
165 Ga0070707_100072359 3300005468 Bacteria 3322
166 Ga0070707_100236520 3300005468 Bacteria 1778
167 Ga0070698_100004430 3300005471 Bacteria 15431
168 Ga0070698_100103675 3300005471 Bacteria 2814
169 Ga0070679_100006957 3300005530 Bacteria 10555
170 Ga0070679_100012754 3300005530 Bacteria 8038
171 Ga0070679_100067689 3300005530 Bacteria 3561
172 Ga0070684_100000219 3300005535 Bacteria 39995
173 Ga0070684_100112216 3300005535 Bacteria 2445
174 Ga0070684_100264601 3300005535 Bacteria 1573
175 Ga0068853_100000600 3300005539 Bacteria 24713
176 Ga0068853_100161577 3300005539 Bacteria 2022
177 Ga0068853_100441788 3300005539 Bacteria 1223
178 Ga0070672_100000019 3300005543 Bacteria 69855
179 Ga0070672_100005606 3300005543 Bacteria 8349
180 Ga0070672_100091597 3300005543 Bacteria 2453
181 Ga0070672_100131022 3300005543 Bacteria 2061
182 Ga0070686_100007875 3300005544 Bacteria 5955
183 Ga0070686_100013361 3300005544 Bacteria 4699
184 Ga0070686_100084027 3300005544 Bacteria 2115
185 Ga0070686_100106911 3300005544 Bacteria 1900
186 Ga0070695_100000474 3300005545 Bacteria 20848
187 Ga0070695_100157083 3300005545 Bacteria 1593
188 Ga0070696_100003100 3300005546 Bacteria 11055
189 Ga0070696_100101172 3300005546 Bacteria 2065
190 Ga0070696_100126973 3300005546 Bacteria 1852
191 Ga0070693_100001868 3300005547 Bacteria 9623
192 Ga0070693_100080784 3300005547 Bacteria 1938
193 Ga0070693_100165525 3300005547 Bacteria 1412
194 Ga0070665_100010015 3300005548 Bacteria 9588
195 Ga0070665_100071433 3300005548 Bacteria 3477
196 Ga0070665_100367333 3300005548 Bacteria 1445
197 Ga0070704_100000252 3300005549 Bacteria 23218
198 Ga0070704_100001606 3300005549 Bacteria 12238
199 Ga0070704_100103247 3300005549 Bacteria 2153
200 Ga0068855_100018421 3300005563 Bacteria 8389
201 Ga0068855_100019721 3300005563 Bacteria 8099
202 Ga0068855_100063129 3300005563 Bacteria 4323
203 Ga0068855_100094398 3300005563 Bacteria 3449
204 Ga0068855_100180896 3300005563 Bacteria 2383
205 Ga0070664_100000819 3300005564 Bacteria 23927
206 Ga0070664_100022255 3300005564 Bacteria 5227
207 Ga0070664_100152816 3300005564 Bacteria 2039
208 Ga0068857_100000768 3300005577 Bacteria 23872
209 Ga0068854_100001736 3300005578 Bacteria 13299
210 Ga0068854_100074701 3300005578 Bacteria 2487
211 Ga0068854_100112791 3300005578 Bacteria 2053
212 Ga0068856_100002295 3300005614 Bacteria 19718
213 Ga0068856_100144924 3300005614 Bacteria 2383
214 Ga0068856_100266791 3300005614 Bacteria 1728
215 Ga0070702_100000898 3300005615 Bacteria 11591
216 Ga0070702_100057764 3300005615 Bacteria 2245
217 Ga0068852_100001992 3300005616 Bacteria 13920
218 Ga0068852_100118580 3300005616 Bacteria 2418
219 Ga0068852_100174225 3300005616 Bacteria 2019
220 Ga0068859_100030288 3300005617 Bacteria 5430
221 Ga0068859_100032313 3300005617 Bacteria 5257
222 Ga0068859_100281836 3300005617 Bacteria 1755
223 Ga0068864_100005938 3300005618 Bacteria 10014
224 Ga0068864_100009491 3300005618 Bacteria 8028
225 Ga0068864_100029150 3300005618 Bacteria 4670
226 Ga0068866_10001028 3300005718 Bacteria 12272
227 Ga0068866_10013621 3300005718 Bacteria 3574
228 Ga0068866_10154896 3300005718 Bacteria 1331
229 Ga0068861_100000169 3300005719 Bacteria 34559
230 Ga0068861_100190783 3300005719 Bacteria 1713
231 Ga0068851_10024424 3300005834 Bacteria 2959
232 Ga0068870_10000586 3300005840 Bacteria 13817
233 Ga0068870_10003342 3300005840 Bacteria 6783
234 Ga0068863_100000381 3300005841 Bacteria 45003
235 Ga0068863_100014411 3300005841 Bacteria 7614
236 Ga0068863_100110951 3300005841 Bacteria 2612
237 Ga0068858_100009197 3300005842 Bacteria 9441
238 Ga0068858_100016225 3300005842 Bacteria 6997
239 Ga0068858_100385313 3300005842 Bacteria 1345
240 Ga0068858_100511731 3300005842 Bacteria 1160
241 Ga0068860_100000448 3300005843 Bacteria 52034
242 Ga0068860_100001472 3300005843 Bacteria 25432
243 Ga0068860_100007428 3300005843 Bacteria 10961
244 Ga0068860_100081520 3300005843 Bacteria 3077
245 Ga0068862_100001886 3300005844 Bacteria 19006
246 Ga0068862_100021781 3300005844 Bacteria 5359
247 Ga0068862_100065508 3300005844 Bacteria 3129
248 Ga0081455_10000036 3300005937 Bacteria 136303
249 Ga0081455_10000356 3300005937 Bacteria 60378
250 Ga0081455_10004173 3300005937 Bacteria 16295
251 Ga0081455_10012017 3300005937 Bacteria 8664
252 Ga0081455_10037370 3300005937 Bacteria 4314
253 Ga0081538_10007089 3300005981 Bacteria 9740
254 Ga0081538_10023585 3300005981 Bacteria 4418
255 Ga0081540_1000060 3300005983 Bacteria 119707
256 Ga0081540_1000257 3300005983 Bacteria 55989
257 Ga0081540_1009400 3300005983 Bacteria 6740
258 Ga0081540_1032775 3300005983 Bacteria 2831
259 Ga0081540_1060985 3300005983 Bacteria 1801
260 Ga0081539_10000080 3300005985 Bacteria 222745
261 Ga0081539_10015884 3300005985 Bacteria 5429
262 Ga0081539_10052157 3300005985 Bacteria 2299
263 Ga0070717_10000199 3300006028 Bacteria 41940
264 Ga0070717_10002977 3300006028 Bacteria 12053
265 Ga0070717_10016717 3300006028 Bacteria 5695
266 Ga0070717_10199428 3300006028 Bacteria 1752
267 Ga0075365_10019169 3300006038 Bacteria 4218
268 Ga0075365_10023303 3300006038 Bacteria 3892
269 Ga0075365_10063525 3300006038 Bacteria 2472
270 Ga0075365_10067595 3300006038 Bacteria 2399
271 Ga0075365_10095195 3300006038 Bacteria 2033
272 Ga0075368_10041807 3300006042 Bacteria 1801
273 Ga0075363_100010016 3300006048 Bacteria 4479
274 Ga0075363_100019886 3300006048 Bacteria 3362
275 Ga0075363_100061414 3300006048 Bacteria 2025
276 Ga0075363_100091630 3300006048 Bacteria 1673
277 Ga0075363_100133856 3300006048 Bacteria 1392
278 Ga0070715_10000085 3300006163 Bacteria 24765
279 Ga0070716_100001988 3300006173 Bacteria 9316
280 Ga0070716_100002448 3300006173 Bacteria 8559
281 Ga0070716_100100739 3300006173 Bacteria 1770
282 Ga0070712_100002527 3300006175 Bacteria 11292
283 Ga0070712_100014196 3300006175 Bacteria 5112
284 Ga0070712_100017680 3300006175 Bacteria 4619
285 Ga0070712_100019271 3300006175 Bacteria 4447
286 Ga0070712_100086512 3300006175 Bacteria 2284
287 Ga0075362_10000796 3300006177 Bacteria 9412
288 Ga0075367_10053786 3300006178 Bacteria 2386
289 Ga0075367_10116702 3300006178 Bacteria 1642
290 Ga0075369_10031469 3300006186 Bacteria 2240
291 Ga0075369_10051679 3300006186 Bacteria 1780
292 Ga0075427_10001399 3300006194 Bacteria 3091
293 Ga0075366_10016027 3300006195 Bacteria 4303
294 Ga0075366_10036158 3300006195 Bacteria 2911
295 Ga0097621_100001234 3300006237 Bacteria 17707
296 Ga0097621_100025864 3300006237 Bacteria 4597
297 Ga0097621_100043421 3300006237 Bacteria 3623
298 Ga0075370_10008478 3300006353 Bacteria 5291
299 Ga0075370_10057643 3300006353 Bacteria 2208
300 Ga0068871_100000068 3300006358 Bacteria 57531
301 Ga0068871_100009351 3300006358 Bacteria 7097
302 Ga0068871_100012500 3300006358 Bacteria 6262
303 Ga0068871_100025352 3300006358 Bacteria 4612
304 Ga0075428_100035558 3300006844 Bacteria 5491
305 Ga0075428_100174934 3300006844 Bacteria 2325
306 Ga0075428_100214665 3300006844 Bacteria 2079
307 Ga0075430_100004696 3300006846 Bacteria 11490
308 Ga0075431_100006639 3300006847 Bacteria 11490
309 Ga0075433_10001599 3300006852 Bacteria 16784
310 Ga0075433_10403539 3300006852 Bacteria 1206
311 Ga0075434_100000576 3300006871 Bacteria 28251
312 Ga0075434_100001666 3300006871 Bacteria 18944
313 Ga0075434_100073539 3300006871 Bacteria 3410
314 Ga0075434_100113294 3300006871 Bacteria 2724
315 Ga0075434_100208693 3300006871 Bacteria 1974
316 Ga0075434_100468579 3300006871 Bacteria 1281
317 Ga0075429_100060828 3300006880 Bacteria 3289
318 Ga0075429_100064559 3300006880 Bacteria 3188
319 Ga0068865_100005133 3300006881 Bacteria 7927
320 Ga0068865_100103925 3300006881 Bacteria 2084
321 Ga0075436_100070922 3300006914 Bacteria 2409
322 Ga0097620_100030290 3300006931 Bacteria 5430
323 Ga0097620_100032314 3300006931 Bacteria 5257
324 Ga0097620_100281806 3300006931 Bacteria 1755
325 Ga0075435_100002716 3300007076 Bacteria 11816
326 Ga0075435_100009255 3300007076 Bacteria 7117
327 Ga0075435_100010036 3300007076 Bacteria 6904
328 Ga0075435_100153065 3300007076 Bacteria 1940
329 Ga0099794_10104084 3300007265 Bacteria 1418
330 Ga0099795_10003566 3300007788 Bacteria 3875
331 Ga0105250_10017722 3300009092 Bacteria 2893
332 Ga0105240_10068510 3300009093 Bacteria 4394
333 Ga0105240_10153475 3300009093 Bacteria 2741
334 Ga0111539_10000082 3300009094 Bacteria 96811
335 Ga0111539_10000503 3300009094 Bacteria 49808
336 Ga0111539_10003417 3300009094 Bacteria 20918
337 Ga0111539_10217427 3300009094 Bacteria 2226
338 Ga0105245_10000780 3300009098 Bacteria 28901
339 Ga0105245_10091423 3300009098 Bacteria 2801
340 Ga0105245_10098843 3300009098 Bacteria 2697
341 Ga0105245_10244517 3300009098 Bacteria 1741
342 Ga0105245_10322101 3300009098 Bacteria 1523
343 Ga0105245_10328630 3300009098 Bacteria 1508
344 Ga0105247_10002726 3300009101 Bacteria 11844
345 Ga0105247_10005459 3300009101 Bacteria 8011
346 Ga0105247_10017791 3300009101 Bacteria 4261
347 Ga0105247_10036356 3300009101 Bacteria 3002
348 Ga0105247_10149201 3300009101 Bacteria 1539
349 Ga0114129_10009008 3300009147 Bacteria 14232
350 Ga0114129_10013874 3300009147 Bacteria 11481
351 Ga0114129_10987483 3300009147 Bacteria 1061
352 Ga0105243_10001083 3300009148 Bacteria 24917
353 Ga0105243_10032306 3300009148 Bacteria 4043
354 Ga0105243_10033088 3300009148 Bacteria 3996
355 Ga0105241_10000760 3300009174 Bacteria 24503
356 Ga0105241_10037962 3300009174 Bacteria 3631
357 Ga0105241_10083372 3300009174 Bacteria 2508
358 Ga0105241_10095627 3300009174 Bacteria 2352
359 Ga0105242_10004818 3300009176 Bacteria 10443
360 Ga0105242_10019812 3300009176 Bacteria 5270
361 Ga0105242_10043456 3300009176 Bacteria 3635
362 Ga0105248_10011305 3300009177 Bacteria 9844
363 Ga0105248_10031416 3300009177 Bacteria 5936
364 Ga0105248_10043099 3300009177 Bacteria 5061
365 Ga0105248_10076338 3300009177 Bacteria 3766
366 Ga0105248_10333411 3300009177 Bacteria 1708
367 Ga0105237_10006171 3300009545 Bacteria 13387
368 Ga0105237_10023639 3300009545 Bacteria 6294
369 Ga0105237_10024205 3300009545 Bacteria 6213
370 Ga0105237_10040193 3300009545 Bacteria 4718
371 Ga0105238_10013907 3300009551 Bacteria 8139
372 Ga0105238_10050560 3300009551 Bacteria 4184
373 Ga0105238_10062496 3300009551 Bacteria 3725
374 Ga0105238_10180828 3300009551 Bacteria 2086
375 Ga0105249_10002196 3300009553 Bacteria 16907
376 Ga0105249_10448538 3300009553 Bacteria 1328
377 Ga0099796_10003100 3300010159 Bacteria 3790
378 Ga0105239_10002791 3300010375 Bacteria 21868
379 Ga0105239_10005450 3300010375 Bacteria 14930
380 Ga0105239_10049106 3300010375 Bacteria 4627
381 Ga0105239_10228125 3300010375 Bacteria 2089
382 Ga0105246_10001585 3300011119 Bacteria 13535
383 Ga0105246_10270441 3300011119 Bacteria 1358
384 Ga0105246_10404033 3300011119 Bacteria 1135
385 Ga0157341_1001083 3300012494 Bacteria 1561
386 Ga0157338_1000167 3300012515 Bacteria 3282
387 Ga0157373_10006240 3300013100 Bacteria 8908
388 Ga0157373_10145122 3300013100 Bacteria 1669
389 Ga0157371_10047027 3300013102 Bacteria 3067
390 Ga0157371_10155413 3300013102 Bacteria 1632
391 Ga0157370_10030489 3300013104 Bacteria 5283
392 Ga0157370_10208804 3300013104 Bacteria 1810
393 Ga0157369_10160600 3300013105 Bacteria 2372
394 Ga0157374_10001691 3300013296 Bacteria 18474
395 Ga0157374_10398584 3300013296 Bacteria 1373
396 Ga0157378_10001445 3300013297 Bacteria 21386
397 Ga0157378_10049325 3300013297 Bacteria 3745
398 Ga0157378_10052925 3300013297 Bacteria 3612
399 Ga0157378_10510714 3300013297 Bacteria 1202
400 Ga0163162_10000790 3300013306 Bacteria 29412
401 Ga0157372_10009037 3300013307 Bacteria 10590
402 Ga0157372_10419820 3300013307 Bacteria 1559
403 Ga0157375_10000468 3300013308 Bacteria 36848
404 Ga0157375_10048514 3300013308 Bacteria 4154
405 Ga0157375_10182541 3300013308 Bacteria 2250
406 Ga0163163_10003322 3300014325 Bacteria 13641
407 Ga0163163_10020189 3300014325 Bacteria 6270
408 Ga0163163_10061676 3300014325 Bacteria 3715
409 Ga0163163_10111016 3300014325 Bacteria 2771
410 Ga0163163_10398212 3300014325 Bacteria 1435
411 Ga0157380_10002913 3300014326 Bacteria 11638
412 Ga0157380_10043495 3300014326 Bacteria 3517
413 Ga0157377_10000276 3300014745 Bacteria 24762
414 Ga0157377_10038382 3300014745 Bacteria 2643
415 Ga0157379_10002285 3300014968 Bacteria 15975
416 Ga0157379_10031389 3300014968 Bacteria 4732
417 Ga0157376_10000692 3300014969 Bacteria 21811
418 Ga0157376_10042226 3300014969 Bacteria 3737
419 Ga0163161_10000384 3300017792 Bacteria 37040
420 Ga0163161_10039131 3300017792 Bacteria 3403
421 Ga0163161_10047076 3300017792 Bacteria 3114
422 Ga0213872_10022015 3300021361 Bacteria 2936
423 Ga0213876_10012755 3300021384 Bacteria 4468
424 Ga0224572_1010337 3300024225 Bacteria 1753
425 Ga0207666_1000097 3300025271 Bacteria 13853
426 Ga0207673_1000201 3300025290 Bacteria 5994
427 Ga0209758_1000638 3300025297 Bacteria 53416
428 Ga0209758_1030349 3300025297 Bacteria 2241
429 Ga0207426_1034655 3300025302 Bacteria 1618
430 Ga0207697_10000550 3300025315 Bacteria 21243
431 Ga0207656_10104678 3300025321 Bacteria 1301
432 Ga0207682_10000088 3300025893 Bacteria 41732
433 Ga0207682_10081589 3300025893 Bacteria 1387
434 Ga0207692_10000876 3300025898 Bacteria 10871
435 Ga0207692_10001204 3300025898 Bacteria 9606
436 Ga0207692_10001966 3300025898 Bacteria 7840
437 Ga0207642_10000381 3300025899 Bacteria 13280
438 Ga0207642_10020631 3300025899 Bacteria 2577
439 Ga0207710_10001324 3300025900 Bacteria 12473
440 Ga0207710_10001609 3300025900 Bacteria 11050
441 Ga0207710_10006390 3300025900 Bacteria 5037
442 Ga0207710_10144383 3300025900 Bacteria 1151
443 Ga0207688_10001203 3300025901 Bacteria 13390
444 Ga0207688_10002655 3300025901 Bacteria 9680
445 Ga0207688_10059462 3300025901 Bacteria 2153
446 Ga0207680_10009047 3300025903 Bacteria 4921
447 Ga0207680_10132841 3300025903 Bacteria 1642
448 Ga0207680_10148619 3300025903 Bacteria 1560
449 Ga0207647_10002714 3300025904 Bacteria 13370
450 Ga0207647_10019352 3300025904 Bacteria 4580
451 Ga0207647_10075399 3300025904 Bacteria 2030
452 Ga0207685_10154206 3300025905 Bacteria 1043
453 Ga0207699_10000531 3300025906 Bacteria 18820
454 Ga0207699_10002088 3300025906 Bacteria 9440
455 Ga0207699_10328147 3300025906 Bacteria 1075
456 Ga0207645_10000140 3300025907 Bacteria 55845
457 Ga0207645_10034330 3300025907 Bacteria 3259
458 Ga0207645_10035558 3300025907 Bacteria 3198
459 Ga0207645_10059966 3300025907 Bacteria 2430
460 Ga0207643_10000083 3300025908 Bacteria 62116
461 Ga0207643_10001883 3300025908 Bacteria 11586
462 Ga0207705_10098196 3300025909 Bacteria 2151
463 Ga0207684_10075371 3300025910 Bacteria 2867
464 Ga0207684_10173160 3300025910 Bacteria 1861
465 Ga0207654_10002699 3300025911 Bacteria 9011
466 Ga0207707_10020854 3300025912 Bacteria 5724
467 Ga0207707_10160248 3300025912 Bacteria 1967
468 Ga0207707_10220579 3300025912 Bacteria 1650
469 Ga0207695_10167547 3300025913 Bacteria 2124
470 Ga0207695_10371047 3300025913 Bacteria 1317
471 Ga0207695_10416759 3300025913 Bacteria 1227
472 Ga0207671_10004533 3300025914 Bacteria 13203
473 Ga0207671_10022987 3300025914 Bacteria 4707
474 Ga0207671_10046170 3300025914 Bacteria 3222
475 Ga0207671_10065535 3300025914 Bacteria 2702
476 Ga0207693_10004067 3300025915 Bacteria 12427
477 Ga0207693_10007304 3300025915 Bacteria 9091
478 Ga0207693_10009632 3300025915 Bacteria 7866
479 Ga0207693_10015829 3300025915 Bacteria 6041
480 Ga0207693_10021626 3300025915 Bacteria 5112
481 Ga0207693_10021894 3300025915 Bacteria 5083
482 Ga0207693_10078050 3300025915 Bacteria 2592
483 Ga0207663_10001909 3300025916 Bacteria 9867
484 Ga0207663_10021132 3300025916 Bacteria 3700
485 Ga0207663_10029176 3300025916 Bacteria 3237
486 Ga0207660_10000073 3300025917 Bacteria 51871
487 Ga0207660_10101848 3300025917 Bacteria 2146
488 Ga0207662_10000964 3300025918 Bacteria 13368
489 Ga0207662_10001013 3300025918 Bacteria 13138
490 Ga0207662_10019591 3300025918 Bacteria 3853
491 Ga0207662_10199088 3300025918 Bacteria 1296
492 Ga0207657_10005395 3300025919 Bacteria 13362
493 Ga0207657_10009757 3300025919 Bacteria 9625
494 Ga0207657_10020125 3300025919 Bacteria 6315
495 Ga0207657_10033571 3300025919 Bacteria 4624
496 Ga0207657_10068436 3300025919 Bacteria 3016
497 Ga0207649_10000450 3300025920 Bacteria 29604
498 Ga0207649_10013956 3300025920 Bacteria 4494
499 Ga0207649_10020627 3300025920 Bacteria 3781
500 Ga0207652_10008726 3300025921 Bacteria 8158
501 Ga0207652_10028066 3300025921 Bacteria 4693
502 Ga0207652_10088727 3300025921 Bacteria 2714
503 Ga0207652_10341105 3300025921 Bacteria 1352
504 Ga0207652_10408231 3300025921 Bacteria 1225
505 Ga0207646_10070925 3300025922 Bacteria 3112
506 Ga0207681_10000097 3300025923 Bacteria 73836
507 Ga0207694_10024241 3300025924 Bacteria 4606
508 Ga0207694_10041733 3300025924 Bacteria 3536
509 Ga0207694_10126736 3300025924 Bacteria 2043
510 Ga0207650_10002648 3300025925 Bacteria 12388
511 Ga0207650_10020241 3300025925 Bacteria 4690
512 Ga0207650_10042894 3300025925 Bacteria 3319
513 Ga0207659_10000092 3300025926 Bacteria 52642
514 Ga0207659_10006748 3300025926 Bacteria 7053
515 Ga0207659_10020865 3300025926 Bacteria 4338
516 Ga0207687_10000219 3300025927 Bacteria 38995
517 Ga0207687_10029871 3300025927 Bacteria 3669
518 Ga0207687_10219639 3300025927 Bacteria 1496
519 Ga0207700_10002485 3300025928 Bacteria 10567
520 Ga0207700_10018036 3300025928 Bacteria 4730
521 Ga0207664_10005574 3300025929 Bacteria 8618
522 Ga0207664_10014579 3300025929 Bacteria 5681
523 Ga0207664_10309524 3300025929 Bacteria 1391
524 Ga0207644_10021419 3300025931 Bacteria 4403
525 Ga0207644_10091736 3300025931 Bacteria 2265
526 Ga0207644_10119158 3300025931 Bacteria 2007
527 Ga0207690_10003312 3300025932 Bacteria 9636
528 Ga0207690_10104156 3300025932 Bacteria 2032
529 Ga0207706_10004310 3300025933 Bacteria 13370
530 Ga0207706_10005901 3300025933 Bacteria 11393
531 Ga0207706_10008823 3300025933 Bacteria 9280
532 Ga0207706_10035694 3300025933 Bacteria 4419
533 Ga0207706_10285828 3300025933 Bacteria 1438
534 Ga0207706_10306745 3300025933 Bacteria 1382
535 Ga0207686_10000796 3300025934 Bacteria 19364
536 Ga0207686_10007990 3300025934 Bacteria 5703
537 Ga0207686_10219760 3300025934 Bacteria 1371
538 Ga0207709_10000362 3300025935 Bacteria 45886
539 Ga0207709_10222423 3300025935 Bacteria 1362
540 Ga0207670_10002375 3300025936 Bacteria 9862
541 Ga0207670_10061867 3300025936 Bacteria 2556
542 Ga0207670_10097107 3300025936 Bacteria 2097
543 Ga0207670_10361239 3300025936 Bacteria 1152
544 Ga0207669_10000350 3300025937 Bacteria 20966
545 Ga0207669_10014842 3300025937 Bacteria 3915
546 Ga0207669_10132331 3300025937 Bacteria 1716
547 Ga0207704_10000479 3300025938 Bacteria 17812
548 Ga0207704_10012862 3300025938 Bacteria 4167
549 Ga0207665_10000577 3300025939 Bacteria 24683
550 Ga0207665_10001702 3300025939 Bacteria 14793
551 Ga0207665_10025177 3300025939 Bacteria 3925
552 Ga0207665_10144615 3300025939 Bacteria 1698
553 Ga0207691_10000283 3300025940 Bacteria 50040
554 Ga0207691_10040853 3300025940 Bacteria 4285
555 Ga0207691_10070775 3300025940 Bacteria 3149
556 Ga0207691_10097671 3300025940 Bacteria 2625
557 Ga0207711_10009170 3300025941 Bacteria 8267
558 Ga0207711_10076028 3300025941 Bacteria 2923
559 Ga0207711_10087463 3300025941 Bacteria 2734
560 Ga0207711_10102644 3300025941 Bacteria 2532
561 Ga0207711_10221806 3300025941 Bacteria 1729
562 Ga0207689_10000085 3300025942 Bacteria 75467
563 Ga0207689_10002370 3300025942 Bacteria 17597
564 Ga0207689_10044422 3300025942 Bacteria 3674
565 Ga0207661_10000464 3300025944 Bacteria 26194
566 Ga0207661_10009753 3300025944 Bacteria 6897
567 Ga0207679_10000030 3300025945 Bacteria 169351
568 Ga0207679_10006772 3300025945 Bacteria 7259
569 Ga0207679_10279643 3300025945 Bacteria 1431
570 Ga0207667_10028631 3300025949 Bacteria 6049
571 Ga0207667_10047002 3300025949 Bacteria 4570
572 Ga0207667_10077756 3300025949 Bacteria 3440
573 Ga0207667_10105591 3300025949 Bacteria 2906
574 Ga0207667_10129105 3300025949 Bacteria 2603
575 Ga0207651_10000422 3300025960 Bacteria 18024
576 Ga0207651_10032933 3300025960 Bacteria 3335
577 Ga0207712_10004682 3300025961 Bacteria 8649
578 Ga0207712_10026073 3300025961 Bacteria 3891
579 Ga0207712_10123332 3300025961 Bacteria 1964
580 Ga0207668_10000114 3300025972 Bacteria 57323
581 Ga0207668_10108475 3300025972 Bacteria 2078
582 Ga0207640_10000141 3300025981 Bacteria 52638
583 Ga0207658_10007681 3300025986 Bacteria 7343
584 Ga0207658_10024116 3300025986 Bacteria 4252
585 Ga0207658_10261028 3300025986 Bacteria 1476
586 Ga0207677_10001776 3300026023 Bacteria 11384
587 Ga0207677_10013991 3300026023 Bacteria 4669
588 Ga0207677_10201482 3300026023 Bacteria 1582
589 Ga0207703_10000983 3300026035 Bacteria 27443
590 Ga0207703_10010486 3300026035 Bacteria 7244
591 Ga0207703_10091348 3300026035 Bacteria 2561
592 Ga0207703_10331244 3300026035 Bacteria 1397
593 Ga0207639_10000305 3300026041 Bacteria 34869
594 Ga0207639_10320401 3300026041 Bacteria 1376
595 Ga0207639_10325978 3300026041 Bacteria 1365
596 Ga0207678_10000125 3300026067 Bacteria 63817
597 Ga0207678_10026095 3300026067 Bacteria 5097
598 Ga0207678_10118507 3300026067 Bacteria 2259
599 Ga0207678_10121814 3300026067 Bacteria 2226
600 Ga0207678_10303421 3300026067 Bacteria 1372
601 Ga0207708_10000187 3300026075 Bacteria 48792
602 Ga0207708_10000256 3300026075 Bacteria 41918
603 Ga0207708_10014918 3300026075 Bacteria 5818
604 Ga0207708_10140412 3300026075 Bacteria 1894
605 Ga0207708_10204175 3300026075 Bacteria 1577
606 Ga0207702_10005437 3300026078 Bacteria 11146
607 Ga0207702_10025565 3300026078 Bacteria 4902
608 Ga0207702_10128627 3300026078 Bacteria 2276
609 Ga0207702_10363703 3300026078 Bacteria 1387
610 Ga0207641_10003649 3300026088 Bacteria 13575
611 Ga0207641_10055119 3300026088 Bacteria 3376
612 Ga0207648_10002168 3300026089 Bacteria 21342
613 Ga0207648_10004949 3300026089 Bacteria 13558
614 Ga0207648_10304255 3300026089 Bacteria 1430
615 Ga0207648_10383293 3300026089 Bacteria 1271
616 Ga0207676_10000074 3300026095 Bacteria 101208
617 Ga0207676_10007288 3300026095 Bacteria 7840
618 Ga0207676_10019580 3300026095 Bacteria 4939
619 Ga0207676_10240398 3300026095 Bacteria 1624
620 Ga0207676_10513292 3300026095 Bacteria 1140
621 Ga0207674_10002501 3300026116 Bacteria 23186
622 Ga0207675_100002373 3300026118 Bacteria 18649
623 Ga0207675_100004556 3300026118 Bacteria 13370
624 Ga0207675_100109415 3300026118 Bacteria 2607
625 Ga0207675_100492846 3300026118 Bacteria 1219
626 Ga0207683_10000014 3300026121 Bacteria 128817
627 Ga0207683_10003999 3300026121 Bacteria 12769
628 Ga0207683_10005254 3300026121 Bacteria 11113
629 Ga0207683_10009094 3300026121 Bacteria 8467
630 Ga0207683_10045519 3300026121 Bacteria 3838
631 Ga0207698_10001242 3300026142 Bacteria 14899
632 Ga0207698_10054980 3300026142 Bacteria 3065
633 Ga0207698_10070852 3300026142 Bacteria 2764
634 Ga0207698_10230441 3300026142 Bacteria 1681
635 Ga0207698_10324819 3300026142 Bacteria 1443
636 Ga0209371_1002632 3300027312 Bacteria 9810
637 Ga0209999_1007609 3300027543 Bacteria 1949
638 Ga0210002_1003004 3300027617 Bacteria 2475
639 Ga0209588_1025585 3300027671 Bacteria 1868
640 Ga0209971_1016252 3300027682 Bacteria 1765
641 Ga0209966_1004843 3300027695 Bacteria 2295
642 Ga0209966_1006091 3300027695 Bacteria 2087
643 Ga0209998_10000361 3300027717 Bacteria 13355
644 Ga0209998_10001516 3300027717 Bacteria 5583
645 Ga0209974_10012895 3300027876 Bacteria 2790
646 Ga0209974_10050653 3300027876 Bacteria 1395
647 Ga0207428_10000114 3300027907 Bacteria 109533
648 Ga0207428_10000467 3300027907 Bacteria 48756
649 Ga0207428_10011322 3300027907 Bacteria 7891
650 Ga0268266_10000857 3300028379 Bacteria 39606
651 Ga0268266_10004080 3300028379 Bacteria 14118
652 Ga0268266_10341602 3300028379 Bacteria 1405
653 Ga0268265_10009966 3300028380 Bacteria 6417
654 Ga0268265_10129476 3300028380 Bacteria 2095
655 Ga0268265_10280135 3300028380 Bacteria 1491
656 Ga0268264_10000162 3300028381 Bacteria 148472
657 Ga0268264_10000469 3300028381 Bacteria 54801
658 Ga0268264_10102270 3300028381 Bacteria 2493
659 Ga0265337_1001464 3300028556 Bacteria 11576
660 Ga0265338_10068822 3300028800 Bacteria 3046
661 Ga0268256_1003412 3300030500 Bacteria 7165
662 Ga0307511_10059052 3300030521 Bacteria 2955
663 Ga0265763_1000156 3300030763 Bacteria 3478
664 Ga0265760_10055801 3300031090 Bacteria 1195
665 Ga0265332_10000801 3300031238 Bacteria 19094
666 Ga0265325_10000423 3300031241 Bacteria 30296
667 Ga0265325_10025904 3300031241 Bacteria 3181
668 Ga0265325_10077594 3300031241 Bacteria 1656
669 Ga0265329_10046196 3300031242 Bacteria 1391
670 Ga0265339_10001378 3300031249 Bacteria 18132
671 Ga0265339_10003373 3300031249 Bacteria 11182
672 Ga0265331_10016240 3300031250 Bacteria 3913
673 Ga0265331_10025748 3300031250 Bacteria 2966
674 Ga0265316_10048508 3300031344 Bacteria 3351
675 Ga0307513_10100118 3300031456 Bacteria 2925
676 Ga0307509_10170661 3300031507 Bacteria 2055
677 Ga0307509_10184029 3300031507 Unclassified 1950
678 Ga0307509_10193454 3300031507 Bacteria 1881
679 Ga0307408_100257788 3300031548 Bacteria 1442
680 Ga0265313_10000115 3300031595 Bacteria 81365
681 Ga0265313_10002944 3300031595 Bacteria 14219
682 Ga0265313_10034290 3300031595 Bacteria 2568
683 Ga0307508_10000001 3300031616 Bacteria 553635
684 Ga0307508_10042265 3300031616 Bacteria 4090
685 Ga0307508_10057284 3300031616 Bacteria 3448
686 Ga0307508_10064279 3300031616 Bacteria 3234
687 Ga0265314_10005122 3300031711 Bacteria 11925
688 Ga0265314_10120472 3300031711 Bacteria 1653
689 Ga0265342_10000011 3300031712 Bacteria 208435
690 Ga0265342_10000763 3300031712 Bacteria 32827
691 Ga0316576_10001056 3300031727 Bacteria 14298
692 Ga0307516_10012533 3300031730 Bacteria 9129
693 Ga0307516_10198555 3300031730 Bacteria 1727
694 Ga0307405_10358939 3300031731 Bacteria 1127
695 Ga0307410_10160269 3300031852 Bacteria 1685
696 Ga0307416_100543646 3300032002 Bacteria 1234
697 Ga0316583_10005398 3300032133 Bacteria 4588
698 Ga0307507_10123347 3300033179 Bacteria 2062
699 Ga0307510_10068958 3300033180 Bacteria 3545
700 Ga0307510_10093546 3300033180 Bacteria 2837
701 Ga0316215_1001492 3300033544 Bacteria 2244
702 Ga0373930_0000150 3300034816 Bacteria 7874
703 Ga0373930_0001117 3300034816 Bacteria 3901
704 Ga0373948_0000307 3300034817 Bacteria 5896
705 Ga0373948_0002698 3300034817 Bacteria 2652
706 Ga0373959_0001657 3300034820 Bacteria 3542
707 Ga0373938_0010297 3300034957 Bacteria 1715
708 Ga0373926_0027180 3300035083 Bacteria 2003
709 Ga0373928_0000222 3300035084 Bacteria 11055
710 Ga0373929_0002112 3300035085 Bacteria 3692
711 Ga0373934_0005831 3300035086 Bacteria 4559
712 Ga0373934_0027921 3300035086 Bacteria 2196
713 Ga0373944_0001828 3300035089 Bacteria 5375
714 Ga0373949_0001450 3300035090 Bacteria 6781
715 Ga0373951_0000721 3300035091 Bacteria 9071
716 Ga0373951_0001245 3300035091 Bacteria 6752
717 Ga0373951_0011607 3300035091 Bacteria 1979
718 Ga0373952_0000029 3300035092 Bacteria 16517
719 Ga0373952_0000148 3300035092 Bacteria 10384
720 Ga0373952_0011726 3300035092 Bacteria 1714
721 Ga0373952_0017850 3300035092 Bacteria 1461
722 Ga0373932_0001251 3300035112 Bacteria 7218
723 Ga0373932_0004135 3300035112 Bacteria 3447
724 Ga0373936_0006326 3300035113 Bacteria 4461
725 Ga0373939_0000339 3300035114 Bacteria 11943
726 Ga0373939_0002855 3300035114 Bacteria 4058
727 Ga0373939_0007617 3300035114 Bacteria 2632
728 Ga0373939_0052100 3300035114 Bacteria 1274
729 Ga0373941_0000835 3300035115 Bacteria 6328
730 Ga0373941_0002285 3300035115 Bacteria 4194
731 Ga0373941_0036460 3300035115 Bacteria 1496
732 Ga0373945_0089477 3300035116 Bacteria 1190
733 Ga0373953_0006310 3300035117 Bacteria 3900
734 Ga0373953_0019732 3300035117 Bacteria 2511
735 Ga0373953_0023666 3300035117 Bacteria 2327
736 Ga0373954_0024463 3300035118 Bacteria 2754
737 Ga0373954_0024781 3300035118 Bacteria 2738
738 Ga0373956_0045734 3300035119 Bacteria 1954
739 Ga0373956_0115125 3300035119 Bacteria 1253
740 Ga0373960_0000372 3300035121 Bacteria 8658
741 Ga0373960_0025992 3300035121 Bacteria 1596
742 Ga0373960_0064146 3300035121 Bacteria 1121
743 Ga0373943_0016793 3300035170 Bacteria 3344
744 Ga0373943_0209439 3300035170 Bacteria 1082
745 Ga0373946_0006340 3300035171 Bacteria 4288
746 Ga0373946_0009821 3300035171 Bacteria 3534
747 Ga0373946_0041237 3300035171 Bacteria 1892
748 Ga0373955_0001269 3300035172 Bacteria 10731
749 Ga0373955_0001523 3300035172 Bacteria 9899
750 Ga0373955_0004969 3300035172 Bacteria 5934
751 Ga0373955_0011500 3300035172 Bacteria 4221
752 Ga0373955_0043425 3300035172 Bacteria 2418
753 Ga0373942_0000767 3300035207 Bacteria 8832
754 Ga0373961_0001835 3300035241 Bacteria 5803
755 Ga0373961_0003896 3300035241 Bacteria 3641
756 Ga0373961_0019391 3300035241 Bacteria 1786
757 Ga0373961_0054588 3300035241 Bacteria 1195
758 Ga0373962_0005133 3300035242 Bacteria 3164
759 Ga0373962_0005930 3300035242 Bacteria 2950
760 Ga0373962_0006682 3300035242 Bacteria 2798
761 Ga0373931_0000169 3300035691 Bacteria 28308
762 Ga0373931_0006379 3300035691 Bacteria 5507
763 Ga0373931_0088502 3300035691 Bacteria 1721
764 Ga0373935_0020667 3300035692 Bacteria 4024
765 Ga0373935_0057410 3300035692 Bacteria 2483
766 Ga0373927_0016232 3300035695 Bacteria 4914
767 Ga0373927_0050616 3300035695 Bacteria 2686
768 Ga0373927_0210555 3300035695 Bacteria 1277
769 Ga0373933_0005311 3300035724 Bacteria 7020
770 Ga0373933_0014389 3300035724 Bacteria 4400
771 Ga0373933_0017906 3300035724 Bacteria 3978
772 Ga0373947_0007521 3300035725 Bacteria 6302
773 Ga0373947_0157465 3300035725 Bacteria 1467
774 Ga0373947_0193019 3300035725 Bacteria 1329
775 Ga0373937_0001052 3300036401 Bacteria 23314
776 Ga0373937_0007509 3300036401 Bacteria 9436
777 Ga0373937_0038298 3300036401 Bacteria 4369
778 Ga0373937_0049021 3300036401 Bacteria 3867
779 Ga0373937_0055079 3300036401 Bacteria 3650
780 Ga0373937_0110823 3300036401 Bacteria 2553
781 Ga0373937_0537414 3300036401 Bacteria 1110
782 Ga0372808_000887 3300036459 Bacteria 2781
783 Ga0373925_0022589 3300037068 Bacteria 4590
784 Ga0373925_0032152 3300037068 Bacteria 3860
785 Ga0373925_0165210 3300037068 Bacteria 1745
786 Ga0395899_0113398 3300037312 Bacteria 1947
787 Ga0395899_0158714 3300037312 Bacteria 1599
788 Ga0395900_0000917 3300037418 Bacteria 38740
789 Ga0395900_0005265 3300037418 Bacteria 13568
790 Ga0395900_0006751 3300037418 Bacteria 11909
791 Ga0395900_0208698 3300037418 Bacteria 1973
792 Ga0395898_0014510 3300037466 Bacteria 8090
793 Ga0395898_0022478 3300037466 Bacteria 6387
794 Ga0395898_0029930 3300037466 Bacteria 5451
795 Ga0395898_0098943 3300037466 Bacteria 2801
796 Ga0395898_0319420 3300037466 Bacteria 1481
797 Ga0395905_0271090 3300037471 Bacteria 1583
798 Ga0436364_0761681 3300037853 Bacteria 2241
799 Ga0395901_0019066 3300038443 Bacteria 7015
800 Ga0395901_0111106 3300038443 Bacteria 2878
801 Ga0395901_0409119 3300038443 Bacteria 1393
802 Ga0400489_28166 3300039093 Bacteria 38746
803 Ga0436365_0193033 3300039437 Bacteria 10822
804 Ga0436361_0291544 3300039447 Bacteria 2948
805 Ga0436361_0425913 3300039447 Bacteria 2212
806 Ga0436361_0452981 3300039447 Bacteria 2456
807 Ga0436363_0379375 3300039450 Bacteria 8518
808 Ga0439450_008705 3300042008 Bacteria 1902
809 Ga0466966_0082720 3300044684 Bacteria 1997
810 Ga0466963_0180802 3300044694 Bacteria 1472
811 Ga0453684_0037028 3300044712 Bacteria 6705
812 Ga0495592_0024186 3300046454 Bacteria 4617
813 Ga0495592_0032431 3300046454 Bacteria 3940
814 Ga0495592_0040848 3300046454 Bacteria 3479
815 Ga0495592_0096600 3300046454 Bacteria 2112
816 Ga0495592_0131419 3300046454 Bacteria 1750
817 Ga0495603_0008030 3300046455 Bacteria 6373
818 Ga0495603_0097985 3300046455 Bacteria 1712
819 Ga0495629_0000535 3300046459 Bacteria 31312
820 Ga0495629_0038335 3300046459 Bacteria 3376
821 Ga0495629_0081599 3300046459 Bacteria 2257
822 Ga0495629_0107782 3300046459 Bacteria 1943
823 Ga0495638_0016637 3300046460 Bacteria 4921
824 Ga0495638_0102310 3300046460 Bacteria 1712
825 Ga0495641_0019259 3300046461 Bacteria 3497
826 Ga0495651_0000606 3300046462 Bacteria 27884
827 Ga0495651_0011021 3300046462 Bacteria 6956
828 Ga0495651_0011844 3300046462 Bacteria 6706
829 Ga0495651_0020645 3300046462 Bacteria 5114
830 Ga0495651_0023992 3300046462 Bacteria 4746
831 Ga0495651_0113072 3300046462 Bacteria 2005
832 Ga0495653_0002673 3300046463 Bacteria 14197
833 Ga0495653_0012564 3300046463 Bacteria 6915
834 Ga0495653_0093751 3300046463 Bacteria 2189
835 Ga0495580_0023721 3300046472 Bacteria 4499
836 Ga0495580_0028270 3300046472 Bacteria 4077
837 Ga0495582_0039312 3300046473 Bacteria 2604
838 Ga0495582_0074369 3300046473 Bacteria 1881
839 Ga0495662_0010283 3300046476 Bacteria 4586
840 Ga0495662_0066440 3300046476 Bacteria 1744
841 Ga0495664_0027493 3300046477 Bacteria 3316
842 Ga0495664_0033931 3300046477 Bacteria 3000
843 Ga0495664_0050337 3300046477 Bacteria 2474
844 Ga0495584_0097244 3300046491 Unclassified 1487
845 Ga0495585_0008366 3300046492 Bacteria 6274
846 Ga0495594_0043598 3300046499 Bacteria 2459
847 Ga0495594_0071026 3300046499 Bacteria 1936
848 Ga0495607_0048620 3300046501 Bacteria 2479
849 Ga0495606_0001220 3300046507 Bacteria 36013
850 Ga0495606_0142136 3300046507 Bacteria 1416
851 Ga0495608_0000591 3300046511 Bacteria 24964
852 Ga0495608_0001474 3300046511 Bacteria 16724
853 Ga0495608_0039849 3300046511 Bacteria 3148
854 Ga0495608_0055452 3300046511 Bacteria 2619
855 Ga0495618_0001466 3300046514 Bacteria 15809
856 Ga0495618_0004984 3300046514 Bacteria 8114
857 Ga0495618_0132206 3300046514 Bacteria 1596
858 Ga0495628_0001927 3300046516 Bacteria 18830
859 Ga0495628_0023873 3300046516 Bacteria 5015
860 Ga0495628_0026853 3300046516 Bacteria 4686
861 Ga0495628_0144414 3300046516 Bacteria 1814
862 Ga0495628_0221416 3300046516 Bacteria 1421
863 Ga0495630_0081198 3300046517 Bacteria 2447
864 Ga0495630_0176249 3300046517 Bacteria 1630
865 Ga0495631_0024362 3300046518 Bacteria 2794
866 Ga0495632_0062790 3300046519 Bacteria 1800
867 Ga0495644_0002701 3300046523 Bacteria 7045
868 Ga0495644_0097729 3300046523 Bacteria 1110
869 Ga0495666_0012992 3300046526 Bacteria 4150
870 Ga0495666_0123226 3300046526 Bacteria 1213
871 Ga0495652_0003497 3300046529 Bacteria 15467
872 Ga0495652_0022449 3300046529 Bacteria 5599
873 Ga0495652_0048857 3300046529 Bacteria 3624
874 Ga0495652_0121480 3300046529 Bacteria 2082
875 Ga0495665_0023481 3300046531 Bacteria 3312
876 Ga0495640_0002454 3300046533 Bacteria 14898
877 Ga0495640_0054384 3300046533 Bacteria 2742
878 Ga0495640_0056745 3300046533 Bacteria 2674
879 Ga0495586_0036479 3300046535 Bacteria 2639
880 Ga0495587_0002240 3300046536 Bacteria 12923
881 Ga0495587_0011870 3300046536 Bacteria 5506
882 Ga0495587_0027093 3300046536 Bacteria 3490
883 Ga0495587_0029413 3300046536 Bacteria 3335
884 Ga0495587_0047875 3300046536 Bacteria 2534
885 Ga0495645_0002539 3300046543 Bacteria 12383
886 Ga0495645_0019854 3300046543 Bacteria 4842
887 Ga0495645_0056174 3300046543 Bacteria 2858
888 Ga0495645_0100340 3300046543 Bacteria 2059
889 Ga0495622_0015565 3300046557 Bacteria 3535
890 Ga0495622_0043586 3300046557 Bacteria 2086
891 Ga0495633_0002969 3300046558 Bacteria 11596
892 Ga0495667_0005199 3300046559 Bacteria 8796
893 Ga0495667_0026523 3300046559 Bacteria 3905
894 Ga0495667_0029602 3300046559 Bacteria 3686
895 Ga0495667_0040819 3300046559 Bacteria 3079
896 Ga0495667_0088464 3300046559 Bacteria 2007
897 Ga0495656_0002822 3300046615 Bacteria 5812
898 Ga0495656_0004061 3300046615 Bacteria 4982
899 Ga0495668_0013965 3300046616 Bacteria 4722
900 Ga0495634_0002842 3300046642 Bacteria 14216
901 Ga0495635_0003751 3300046663 Bacteria 10547
902 Ga0495635_0003881 3300046663 Bacteria 10388
903 Ga0495635_0021401 3300046663 Bacteria 4506
904 Ga0495635_0126093 3300046663 Bacteria 1746
905 Ga0495635_0287356 3300046663 Bacteria 1104
906 Ga0495661_0044928 3300046665 Bacteria 2705
907 Ga0495588_0045221 3300046674 Bacteria 2256
908 Ga0495588_0169779 3300046674 Bacteria 1153
909 Ga0495657_0003270 3300046675 Bacteria 13307
910 Ga0495657_0010946 3300046675 Bacteria 6803
911 Ga0495599_0000564 3300046678 Bacteria 21162
912 Ga0495599_0004481 3300046678 Bacteria 8275
913 Ga0495599_0017530 3300046678 Bacteria 4451
914 Ga0495599_0073266 3300046678 Bacteria 2138
915 Ga0495623_0007330 3300046679 Bacteria 7157
916 Ga0495623_0119469 3300046679 Bacteria 1588
917 Ga0495646_0020687 3300046680 Bacteria 4163
918 Ga0495646_0054563 3300046680 Bacteria 2403
919 Ga0495646_0058838 3300046680 Bacteria 2296
920 Ga0495647_0024629 3300046681 Bacteria 2192
921 Ga0495647_0045345 3300046681 Bacteria 1688
922 Ga0495647_0045645 3300046681 Bacteria 1684
923 Ga0495658_0000788 3300046683 Bacteria 17050
924 Ga0495658_0006062 3300046683 Bacteria 5938
925 Ga0495658_0009215 3300046683 Bacteria 4909
926 Ga0495669_0024391 3300046684 Bacteria 2634
927 Ga0495669_0114672 3300046684 Bacteria 1260
928 Ga0495613_0024361 3300046689 Bacteria 4510
929 Ga0495613_0072271 3300046689 Bacteria 2514
930 Ga0495613_0213481 3300046689 Bacteria 1356
931 Ga0495624_0016249 3300046690 Bacteria 5011
932 Ga0495670_0000291 3300046691 Bacteria 23680
933 Ga0495600_0001326 3300046809 Bacteria 13661
934 Ga0495600_0004060 3300046809 Bacteria 8704
935 Ga0495600_0011214 3300046809 Bacteria 5584
936 Ga0495600_0017893 3300046809 Bacteria 4510
937 Ga0495600_0055606 3300046809 Bacteria 2585
938 Ga0495600_0137385 3300046809 Bacteria 1587
939 Ga0495581_0081264 3300047315 Bacteria 1876
940 Ga0495581_0102123 3300047315 Bacteria 1666
941 Ga0495604_0003818 3300047317 Bacteria 11995
942 Ga0495604_0003891 3300047317 Bacteria 11887
943 Ga0495604_0009082 3300047317 Bacteria 7865
944 Ga0495604_0015025 3300047317 Bacteria 6176
945 Ga0495604_0028398 3300047317 Bacteria 4451
946 Ga0495604_0052923 3300047317 Bacteria 3141
947 Ga0495674_0015363 3300047319 Bacteria 7160
948 Ga0495674_0024339 3300047319 Bacteria 5564
949 Ga0495674_0027169 3300047319 Bacteria 5232
950 Ga0495674_0197387 3300047319 Bacteria 1670
951 Ga0495674_0354222 3300047319 Bacteria 1191
952 Ga0495672_0067708 3300047320 Bacteria 2033
953 Ga0495676_0021794 3300047321 Bacteria 5588
954 Ga0495676_0054077 3300047321 Bacteria 3194
955 Ga0495676_0184784 3300047321 Bacteria 1458
956 Ga0495680_0001686 3300047322 Bacteria 23465
957 Ga0495680_0011254 3300047322 Bacteria 7932
958 Ga0495680_0012959 3300047322 Bacteria 7301
959 Ga0495680_0043116 3300047322 Bacteria 3575
960 Ga0495680_0044687 3300047322 Bacteria 3502
961 Ga0495680_0205372 3300047322 Bacteria 1412
962 Ga0495675_0001544 3300047444 Bacteria 13904
963 Ga0495675_0002669 3300047444 Bacteria 10688
964 Ga0495675_0061543 3300047444 Bacteria 2378
965 Ga0495675_0063085 3300047444 Bacteria 2345
966 Ga0495675_0120623 3300047444 Bacteria 1633
967 Ga0495684_0002087 3300047471 Bacteria 16070
968 Ga0495684_0003625 3300047471 Bacteria 12034
969 Ga0495684_0038790 3300047471 Bacteria 3652
970 Ga0495684_0147563 3300047471 Bacteria 1760
971 Ga0495593_0004626 3300047673 Bacteria 8180
972 Ga0495593_0014724 3300047673 Bacteria 4445
973 Ga0495593_0047243 3300047673 Bacteria 2290
974 Ga0495602_0000740 3300048088 Bacteria 30918
975 Ga0495602_0005526 3300048088 Bacteria 13262
976 Ga0495602_0132217 3300048088 Bacteria 1988
977 Ga0495602_0144903 3300048088 Bacteria 1875
978 Ga0495614_0030039 3300048089 Bacteria 2338
979 Ga0496100_0000106 3300048903 Bacteria 48123
980 Ga0496100_0000499 3300048903 Bacteria 18860
981 Ga0496100_0002951 3300048903 Bacteria 8748
982 Ga0496100_0003648 3300048903 Bacteria 8050
983 Ga0496100_0027659 3300048903 Bacteria 3489
984 Ga0496100_0256274 3300048903 Bacteria 1296
985 Ga0496100_0449331 3300048903 Bacteria 988
986 Ga0496101_0000992 3300048904 Bacteria 16792
987 Ga0496101_0002929 3300048904 Bacteria 10493
988 Ga0496101_0003940 3300048904 Bacteria 9281
989 Ga0496101_0020995 3300048904 Bacteria 4481
990 Ga0496101_0023715 3300048904 Bacteria 4241
991 Ga0496101_0228639 3300048904 Bacteria 1445
992 Ga0496101_0279117 3300048904 Bacteria 1305
993 Ga0496102_0011236 3300048905 Bacteria 7715
994 Ga0496102_0019045 3300048905 Bacteria 6041
995 Ga0496102_0039093 3300048905 Bacteria 4285
996 Ga0496102_0372135 3300048905 Bacteria 1344
997 Ga0496103_0003647 3300048906 Bacteria 9374
998 Ga0496103_0006368 3300048906 Bacteria 7051
999 Ga0496103_0014587 3300048906 Bacteria 4667
1000 Ga0496103_0022038 3300048906 Bacteria 3834
1001 Ga0496104_0000090 3300048907 Bacteria 87877
1002 Ga0496104_0000506 3300048907 Bacteria 33454
1003 Ga0496104_0005547 3300048907 Bacteria 11050
1004 Ga0496104_0035462 3300048907 Bacteria 4657
1005 Ga0496104_0122840 3300048907 Bacteria 2493
1006 Ga0496105_0001574 3300048908 Bacteria 16176
1007 Ga0496105_0003533 3300048908 Bacteria 11591
1008 Ga0496105_0108687 3300048908 Bacteria 2290
1009 Ga0496105_0161028 3300048908 Bacteria 1842
1010 Ga0496106_0002499 3300048909 Bacteria 13684
1011 Ga0496106_0002626 3300048909 Bacteria 13365
1012 Ga0496106_0005418 3300048909 Bacteria 9437
1013 Ga0496106_0012172 3300048909 Bacteria 6349
1014 Ga0496106_0013964 3300048909 Bacteria 5939
1015 Ga0496106_0019052 3300048909 Bacteria 5087
1016 Ga0496106_0024338 3300048909 Bacteria 4500
1017 Ga0496106_0173682 3300048909 Bacteria 1709
1018 Ga0496107_0000223 3300048910 Bacteria 30018
1019 Ga0496107_0015336 3300048910 Bacteria 5369
1020 Ga0496107_0030108 3300048910 Bacteria 3867
1021 Ga0496107_0034213 3300048910 Bacteria 3639
1022 Ga0496107_0041516 3300048910 Bacteria 3303
1023 Ga0496107_0044051 3300048910 Bacteria 3207
1024 Ga0496108_0003914 3300048911 Bacteria 11960
1025 Ga0496108_0007392 3300048911 Bacteria 8908
1026 Ga0496108_0024579 3300048911 Bacteria 4961
1027 Ga0496109_0002315 3300048912 Bacteria 15857
1028 Ga0496109_0014846 3300048912 Bacteria 6778
1029 Ga0496109_0039401 3300048912 Bacteria 4276
1030 Ga0496109_0041676 3300048912 Bacteria 4158
1031 Ga0496109_0052216 3300048912 Bacteria 3725
1032 Ga0496109_0227777 3300048912 Bacteria 1753
1033 Ga0496110_0003039 3300048913 Bacteria 12728
1034 Ga0496110_0091854 3300048913 Bacteria 2716
1035 Ga0496110_0234585 3300048913 Bacteria 1669
1036 Ga0496110_0568629 3300048913 Bacteria 1029
1037 Ga0496111_0064475 3300048914 Bacteria 2657
1038 Ga0496112_0000009 3300048915 Bacteria 299708
1039 Ga0496112_0035958 3300048915 Bacteria 4827
1040 Ga0496112_0075543 3300048915 Bacteria 3332
1041 Ga0496112_0089540 3300048915 Bacteria 3045
1042 Ga0496112_0153498 3300048915 Bacteria 2270
1043 Ga0496112_0283160 3300048915 Bacteria 1604
1044 Ga0496112_0324574 3300048915 Bacteria 1483
1045 Ga0496113_0000068 3300048916 Bacteria 45065
1046 Ga0496113_0006216 3300048916 Bacteria 7545
1047 Ga0496113_0010789 3300048916 Bacteria 6060
1048 Ga0496114_0006516 3300048917 Bacteria 9201
1049 Ga0496114_0006841 3300048917 Bacteria 8982
1050 Ga0496114_0010582 3300048917 Bacteria 7339
1051 Ga0496115_0016939 3300048918 Bacteria 5559
1052 Ga0496115_0017044 3300048918 Bacteria 5541
1053 Ga0496115_0021146 3300048918 Bacteria 5022
1054 Ga0496115_0021880 3300048918 Bacteria 4945
1055 Ga0496115_0070184 3300048918 Bacteria 2840
1056 Ga0496115_0073152 3300048918 Bacteria 2781
1057 Ga0496115_0092475 3300048918 Bacteria 2473
1058 Ga0496115_0101293 3300048918 Bacteria 2361
1059 Ga0496115_0152757 3300048918 Bacteria 1907
1060 Ga0496116_0148251 3300048919 Bacteria 1308
1061 Ga0496117_0097463 3300048920 Bacteria 1873
1062 Ga0496118_0002370 3300048921 Bacteria 25500
1063 Ga0496121_0000110 3300048924 Bacteria 186482
1064 Ga0496121_0029635 3300048924 Bacteria 5052
1065 Ga0496121_0053287 3300048924 Bacteria 3390
1066 Ga0496124_0009400 3300048927 Bacteria 10072
1067 Ga0496124_0081079 3300048927 Bacteria 2668
1068 Ga0496126_0007157 3300048929 Bacteria 12282
1069 Ga0496126_0077579 3300048929 Bacteria 2945
1070 Ga0496126_0082735 3300048929 Bacteria 2835
1071 Ga0501031_0065472 3300049568 Bacteria 2368
1072 Ga0501031_0117126 3300049568 Bacteria 1740
1073 Ga0501032_0000054 3300049569 Bacteria 100621
1074 Ga0501032_0018083 3300049569 Bacteria 4944
1075 Ga0501033_0000025 3300049570 Bacteria 173634
1076 Ga0501033_0023027 3300049570 Bacteria 4695
1077 Ga0501033_0028631 3300049570 Bacteria 4185
1078 Ga0501033_0079600 3300049570 Bacteria 2404
1079 Ga0501034_0000177 3300049571 Bacteria 118966
1080 Ga0501034_0000852 3300049571 Bacteria 45151
1081 Ga0501034_0002201 3300049571 Bacteria 24114
1082 Ga0501034_0019869 3300049571 Bacteria 6863
1083 Ga0501034_0050663 3300049571 Bacteria 4187
1084 Ga0501034_0060308 3300049571 Bacteria 3811
1085 Ga0501034_0091389 3300049571 Bacteria 3041
1086 Ga0501034_0105422 3300049571 Bacteria 2812
1087 Ga0501034_0162958 3300049571 Bacteria 2200
1088 Ga0501034_0294162 3300049571 Bacteria 1561
1089 Ga0501034_0444425 3300049571 Bacteria 1215
1090 Ga0501034_0504993 3300049571 Bacteria 1123
1091 Ga0501036_0000025 3300049572 Bacteria 106029
1092 Ga0501036_0009246 3300049572 Bacteria 8101
1093 Ga0501036_0066423 3300049572 Bacteria 3051
1094 Ga0501036_0073792 3300049572 Bacteria 2884
1095 Ga0501036_0185044 3300049572 Bacteria 1753
1096 Ga0501037_0000169 3300049573 Bacteria 61447
1097 Ga0501037_0075246 3300049573 Bacteria 2452
1098 Ga0501037_0077130 3300049573 Bacteria 2418
1099 Ga0501038_0000029 3300049574 Bacteria 132861
1100 Ga0501038_0017001 3300049574 Bacteria 6582
1101 Ga0501038_0074200 3300049574 Bacteria 2878
1102 Ga0501038_0127566 3300049574 Bacteria 2092
1103 Ga0501038_0159315 3300049574 Bacteria 1835
1104 Ga0501039_0014669 3300049575 Bacteria 5994
1105 Ga0501039_0045614 3300049575 Bacteria 3387
1106 Ga0501039_0067453 3300049575 Bacteria 2778
1107 Ga0501039_0082471 3300049575 Bacteria 2504
1108 Ga0501039_0278275 3300049575 Bacteria 1315
1109 Ga0501043_0000067 3300049579 Bacteria 93232
1110 Ga0501043_0023705 3300049579 Bacteria 4813
1111 Ga0501043_0071008 3300049579 Bacteria 2735
1112 Ga0501043_0097871 3300049579 Bacteria 2306
1113 Ga0501043_0189269 3300049579 Bacteria 1601
1114 Ga0501046_0000479 3300049580 Bacteria 39962
1115 Ga0501046_0047106 3300049580 Bacteria 3419
1116 Ga0501046_0083647 3300049580 Bacteria 2463
1117 Ga0501046_0164904 3300049580 Bacteria 1665
1118 Ga0501047_0000010 3300049581 Bacteria 429357
1119 Ga0501047_0000061 3300049581 Bacteria 137341
1120 Ga0501047_0052348 3300049581 Bacteria 3946
1121 Ga0501047_0083522 3300049581 Bacteria 3069
1122 Ga0501047_0145268 3300049581 Bacteria 2249
1123 Ga0501047_0168967 3300049581 Bacteria 2056
1124 Ga0501047_0467833 3300049581 Bacteria 1089
1125 Ga0501048_0000081 3300049582 Bacteria 49755
1126 Ga0501048_0000592 3300049582 Bacteria 25706
1127 Ga0501067_0004093 3300049583 Bacteria 8038
1128 Ga0501067_0008059 3300049583 Bacteria 5855
1129 Ga0501067_0142442 3300049583 Bacteria 1335
1130 Ga0501068_0009234 3300049584 Bacteria 5511
1131 Ga0501068_0037047 3300049584 Bacteria 2919
1132 Ga0501068_0048922 3300049584 Bacteria 2553
1133 Ga0501068_0061949 3300049584 Bacteria 2273
1134 Ga0501068_0265072 3300049584 Bacteria 1096
1135 Ga0501069_0006408 3300049585 Bacteria 6154
1136 Ga0501069_0103112 3300049585 Bacteria 1620
1137 Ga0501070_0012320 3300049586 Bacteria 7216
1138 Ga0501070_0015707 3300049586 Bacteria 6366
1139 Ga0501070_0027632 3300049586 Bacteria 4759
1140 Ga0501070_0036608 3300049586 Bacteria 4098
1141 Ga0501070_0049872 3300049586 Bacteria 3475
1142 Ga0501070_0261127 3300049586 Bacteria 1415
1143 Ga0501070_0368536 3300049586 Bacteria 1164
1144 Ga0501071_0049887 3300049587 Bacteria 3014
1145 Ga0501071_0064801 3300049587 Bacteria 2652
1146 Ga0501072_0001324 3300049588 Bacteria 18575
1147 Ga0501072_0051754 3300049588 Bacteria 3233
1148 Ga0501072_0072650 3300049588 Bacteria 2719
1149 Ga0501072_0101546 3300049588 Bacteria 2286
1150 Ga0501072_0189609 3300049588 Bacteria 1640
1151 Ga0501073_0004672 3300049589 Bacteria 10291
1152 Ga0501073_0011255 3300049589 Bacteria 6545
1153 Ga0501073_0081895 3300049589 Bacteria 2245
1154 Ga0501073_0082488 3300049589 Bacteria 2237
1155 Ga0501074_0013180 3300049590 Bacteria 6011
1156 Ga0501074_0142131 3300049590 Bacteria 1716
1157 Ga0501074_0219597 3300049590 Bacteria 1353
1158 Ga0501075_0029716 3300049591 Bacteria 4043
1159 Ga0501076_0050177 3300049592 Bacteria 3301
1160 Ga0501079_0052135 3300049741 Bacteria 3158
1161 Ga0501080_0000314 3300049742 Bacteria 37074
1162 Ga0501080_0008717 3300049742 Bacteria 9209
1163 Ga0501080_0039603 3300049742 Bacteria 4398
1164 Ga0501080_0069440 3300049742 Bacteria 3276
1165 Ga0501080_0357233 3300049742 Bacteria 1318
1166 Ga0501083_0000544 3300049744 Bacteria 24028
1167 Ga0501083_0082807 3300049744 Bacteria 2125
1168 Ga0501083_0114245 3300049744 Bacteria 1773
1169 Ga0501035_0001202 3300049822 Bacteria 26996
1170 Ga0501035_0001359 3300049822 Bacteria 25173
1171 Ga0501035_0008723 3300049822 Bacteria 9440
1172 Ga0501035_0026602 3300049822 Bacteria 5292
1173 Ga0501035_0042124 3300049822 Bacteria 4119
1174 Ga0501035_0049713 3300049822 Bacteria 3757
1175 Ga0501035_0321787 3300049822 Bacteria 1299
1176 Ga0501035_0338074 3300049822 Bacteria 1262
1177 Ga0501044_0000028 3300049823 Bacteria 179203
1178 Ga0501044_0015194 3300049823 Bacteria 8292
1179 Ga0501044_0030272 3300049823 Bacteria 5706
1180 Ga0501044_0032946 3300049823 Bacteria 5446
1181 Ga0501044_0042616 3300049823 Bacteria 4719
1182 Ga0501044_0123366 3300049823 Bacteria 2589
1183 Ga0501044_0199019 3300049823 Bacteria 1962
1184 Ga0501044_0200222 3300049823 Bacteria 1955
1185 Ga0501044_0235340 3300049823 Bacteria 1777
1186 Ga0501045_0071853 3300049824 Bacteria 2547
1187 Ga0501045_0079940 3300049824 Bacteria 2411
1188 nmdc:mga03683_2160_c1 3300050489 Bacteria 6066
1189 nmdc:mga03683_27872_c2 3300050489 Bacteria 1581
1190 nmdc:mga03n38_1257_c1 3300050490 Bacteria 7131
1191 nmdc:mga03n38_62424_c1 3300050490 Bacteria 1700
1192 nmdc:mga0yw44_124278_c1 3300050492 Bacteria 1665
1193 nmdc:mga0yw44_30616_c1 3300050492 Bacteria 3121
1194 nmdc:mga0yw44_45328_c1 3300050492 Bacteria 2636
1195 nmdc:mga0yw44_74353_c1 3300050492 Bacteria 2117
1196 nmdc:mga0yw44_8313_c1 3300050492 Bacteria 5160
1197 nmdc:mga0k408_30724_c1 3300050493 Bacteria 3064
1198 nmdc:mga0k408_87368_c1 3300050493 Bacteria 1831
1199 nmdc:mga06z11_111956_c1 3300050494 Bacteria 1513
1200 nmdc:mga06z11_12395_c1 3300050494 Bacteria 3707
1201 nmdc:mga06z11_124247_c1 3300050494 Bacteria 1443
1202 nmdc:mga06z11_1795_c1 3300050494 Bacteria 8072
1203 nmdc:mga06z11_46174_c1 3300050494 Bacteria 2206
1204 nmdc:mga04h51_71172_c1 3300050495 Bacteria 1214
1205 nmdc:mga07m45_27930_c1 3300050496 Bacteria 3113
1206 nmdc:mga07m45_95220_c1 3300050496 Bacteria 1708
1207 nmdc:mga05p37_13519_c1 3300050507 Bacteria 9784
1208 nmdc:mga05p37_48051_c1 3300050507 Bacteria 5248
1209 nmdc:mga05p37_49294_c1 3300050507 Bacteria 5179
1210 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
1211 nmdc:mga05p37_751885_c1 3300050507 Bacteria 1074
1212 nmdc:mga09592_124051_c1 3300050508 Bacteria 2220
1213 nmdc:mga09592_976_c1 3300050508 Bacteria 22595
1214 nmdc:mga0qj67_34625_c1 3300050509 Bacteria 3946
1215 nmdc:mga0qj67_4772_c1 3300050509 Bacteria 9855
1216 nmdc:mga06r32_34244_c1 3300050510 Bacteria 4789
1217 nmdc:mga08y16_10784_c1 3300050511 Bacteria 9592
1218 nmdc:mga08y16_176438_c1 3300050511 Bacteria 2219
1219 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
1220 nmdc:mga08y16_2396_c1 3300050511 Bacteria 19256
1221 nmdc:mga0n895_126045_c1 3300050512 Bacteria 2584
1222 nmdc:mga0n895_201249_c1 3300050512 Bacteria 2022
1223 nmdc:mga0n895_2429_c1 3300050512 Bacteria 14534
1224 nmdc:mga0n895_2745_c2 3300050512 Bacteria 4921
1225 nmdc:mga0n895_51689_c1 3300050512 Bacteria 4032
1226 nmdc:mga0n895_5847_c1 3300050512 Bacteria 10340
1227 nmdc:mga0rr50_144889_c1 3300050513 Bacteria 1914
1228 nmdc:mga0rr50_46884_c1 3300050513 Bacteria 3184
1229 nmdc:mga08x19_262272_c1 3300050514 Bacteria 1195
1230 nmdc:mga0a205_11514_c1 3300050515 Bacteria 8147
1231 nmdc:mga0a205_169150_c1 3300050515 Bacteria 2081
1232 nmdc:mga0a205_375552_c1 3300050515 Bacteria 1287
1233 nmdc:mga0a205_6435_c1 3300050515 Bacteria 10616
1234 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
1235 nmdc:mga0a205_89878_c1 3300050515 Bacteria 2968
1236 Ga0495601_0000360 3300053077 Bacteria 23959
1237 Ga0495601_0001260 3300053077 Bacteria 13862
1238 Ga0495601_0007151 3300053077 Bacteria 6544
1239 Ga0495601_0009390 3300053077 Bacteria 5785
1240 Ga0495601_0020113 3300053077 Bacteria 4075
1241 Ga0495601_0029689 3300053077 Bacteria 3393
1242 Ga0495612_0000964 3300053078 Bacteria 11832
1243 Ga0495612_0002659 3300053078 Bacteria 7371
1244 Ga0495612_0005722 3300053078 Bacteria 5133
1245 Ga0495612_0008741 3300053078 Bacteria 4108
1246 Ga0495612_0009169 3300053078 Bacteria 4014
1247 Ga0495612_0054148 3300053078 Bacteria 1653
1248 Ga0495655_0002786 3300053083 Bacteria 2811
1249 Ga0495595_0000552 3300053084 Bacteria 14281
1250 Ga0495595_0001276 3300053084 Bacteria 9815
1251 Ga0495595_0001912 3300053084 Bacteria 8091
1252 Ga0495595_0003989 3300053084 Bacteria 5900
1253 Ga0495619_0000375 3300053085 Bacteria 30799
1254 Ga0495619_0000581 3300053085 Bacteria 24290
1255 Ga0495619_0000664 3300053085 Bacteria 22535
1256 Ga0495619_0001851 3300053085 Bacteria 14080
1257 Ga0495619_0002169 3300053085 Bacteria 13003
1258 Ga0495619_0080843 3300053085 Bacteria 2187
1259 Ga0495619_0085474 3300053085 Bacteria 2130
1260 Ga0495619_0094756 3300053085 Bacteria 2025
1261 Ga0495619_0264286 3300053085 Bacteria 1192
1262 Ga0500644_0008930 3300053088 Bacteria 2662
1263 Ga0500647_0166931 3300053091 Bacteria 1018
1264 Ga0500566_0000124 3300053094 Bacteria 40031
1265 Ga0500566_0024974 3300053094 Bacteria 3504
1266 Ga0500640_000336 3300053095 Bacteria 10879
1267 Ga0500641_0018612 3300053096 Bacteria 2615
1268 Ga0500572_001094 3300053111 Bacteria 7947
1269 Ga0500591_058467 3300053115 Bacteria 1786
1270 Ga0500595_000002 3300053119 Bacteria 1074388
1271 Ga0500595_020436 3300053119 Bacteria 2383
1272 Ga0500559_0004459 3300053136 Bacteria 6643
1273 Ga0500559_0008670 3300053136 Bacteria 4443
1274 Ga0500588_0017273 3300053146 Bacteria 1881
1275 Ga0500603_000189 3300053150 Bacteria 16056
1276 Ga0500616_0000002 3300053153 Bacteria 1611257
1277 Ga0500630_001137 3300053159 Bacteria 12415
1278 Ga0500639_000115 3300053163 Bacteria 38497
1279 Ga0500639_047362 3300053163 Bacteria 2246
1280 Ga0500636_0044934 3300053177 Bacteria 2605
1281 Ga0500637_0028335 3300053178 Bacteria 3097
1282 Ga0500645_000471 3300053730 Bacteria 27490
1283 Ga0500596_000790 3300053735 Bacteria 6239
1284 Ga0500596_002245 3300053735 Bacteria 3833
1285 Ga0500601_003639 3300053737 Bacteria 1673
1286 Ga0501084_0036612 3300054114 Bacteria 4099
1287 Ga0501084_0037087 3300054114 Bacteria 4073
1288 Ga0501082_0010013 3300060353 Bacteria 8173
1289 Ga0501082_0080227 3300060353 Bacteria 2815
1290 Ga0501082_0080612 3300060353 Bacteria 2809
1291 Ga0530510_0082247 3300061734 Bacteria 2345

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0449331 Ga0496100_0449331_43_969 300
2 3300048913 Ga0496110_0234585 Ga0496110_0234585_745_1659 304
3 3300038443 Ga0395901_0409119 Ga0395901_0409119_218_1171 305
4 3300039093 Ga0400489_28166 Ga0400489_28166_35002_35985 308
5 3300006880 Ga0075429_100064559 Ga0075429_1000645593 310
6 3300046516 Ga0495628_0026853 Ga0495628_0026853_3743_4675 310
7 3300049584 Ga0501068_0265072 Ga0501068_0265072_140_1072 310
8 3300050507 nmdc:mga05p37_48051_c1 nmdc:mga05p37_48051_c1_733_1710 310
9 3300050508 nmdc:mga09592_124051_c1 nmdc:mga09592_124051_c1_858_1835 310
10 3300050509 nmdc:mga0qj67_34625_c1 nmdc:mga0qj67_34625_c1_2348_3325 310
11 3300005334 Ga0068869_100091153 Ga0068869_1000911532 311
12 3300005434 Ga0070709_10000981 Ga0070709_100009813 311
13 3300005435 Ga0070714_100007967 Ga0070714_1000079673 311
14 3300005436 Ga0070713_100009246 Ga0070713_1000092465 311
15 3300005437 Ga0070710_10000179 Ga0070710_100001794 311
16 3300005439 Ga0070711_100013883 Ga0070711_1000138833 311
17 3300005455 Ga0070663_100268938 Ga0070663_1002689382 311
18 3300005548 Ga0070665_100367333 Ga0070665_1003673332 311
19 3300005617 Ga0068859_100032313 Ga0068859_1000323134 311
20 3300005841 Ga0068863_100110951 Ga0068863_1001109514 311
21 3300005842 Ga0068858_100385313 Ga0068858_1003853132 311
22 3300005981 Ga0081538_10007089 Ga0081538_100070898 311
23 3300005983 Ga0081540_1009400 Ga0081540_10094006 311
24 3300006028 Ga0070717_10002977 Ga0070717_100029779 311
25 3300006038 Ga0075365_10019169 Ga0075365_100191694 311
26 3300006163 Ga0070715_10000085 Ga0070715_1000008514 311
27 3300006173 Ga0070716_100001988 Ga0070716_1000019883 311
28 3300006175 Ga0070712_100019271 Ga0070712_1000192713 311
29 3300006178 Ga0075367_10053786 Ga0075367_100537861 311
30 3300006186 Ga0075369_10031469 Ga0075369_100314692 311
31 3300006844 Ga0075428_100214665 Ga0075428_1002146651 311
32 3300006931 Ga0097620_100032314 Ga0097620_1000323144 311
33 3300009098 Ga0105245_10328630 Ga0105245_103286302 311
34 3300025898 Ga0207692_10001204 Ga0207692_100012048 311
35 3300025906 Ga0207699_10000531 Ga0207699_100005319 311
36 3300025915 Ga0207693_10004067 Ga0207693_100040678 311
37 3300025916 Ga0207663_10001909 Ga0207663_100019099 311
38 3300025928 Ga0207700_10018036 Ga0207700_100180363 311
39 3300025929 Ga0207664_10014579 Ga0207664_100145793 311
40 3300025939 Ga0207665_10000577 Ga0207665_1000057715 311
41 3300025961 Ga0207712_10123332 Ga0207712_101233322 311
42 3300026118 Ga0207675_100492846 Ga0207675_1004928461 311
43 3300028379 Ga0268266_10000857 Ga0268266_1000085737 311
44 3300028379 Ga0268266_10341602 Ga0268266_103416022 311
45 3300028380 Ga0268265_10280135 Ga0268265_102801351 311
46 3300031548 Ga0307408_100257788 Ga0307408_1002577882 311
47 3300031730 Ga0307516_10198555 Ga0307516_101985552 311
48 3300035725 Ga0373947_0157465 Ga0373947_0157465_330_1304 311
49 3300046455 Ga0495603_0097985 Ga0495603_0097985_449_1423 311
50 3300046459 Ga0495629_0038335 Ga0495629_0038335_1749_2723 311
51 3300046507 Ga0495606_0142136 Ga0495606_0142136_16_990 311
52 3300046523 Ga0495644_0097729 Ga0495644_0097729_84_1058 311
53 3300046663 Ga0495635_0126093 Ga0495635_0126093_424_1398 311
54 3300046674 Ga0495588_0169779 Ga0495588_0169779_62_1036 311
55 3300046684 Ga0495669_0114672 Ga0495669_0114672_20_994 311
56 3300047321 Ga0495676_0184784 Ga0495676_0184784_185_1159 311
57 3300048924 Ga0496121_0053287 Ga0496121_0053287_1070_2044 311
58 3300050492 nmdc:mga0yw44_45328_c1 nmdc:mga0yw44_45328_c1_260_1234 311
59 3300050492 nmdc:mga0yw44_8313_c1 nmdc:mga0yw44_8313_c1_3221_4195 311
60 3300050494 nmdc:mga06z11_46174_c1 nmdc:mga06z11_46174_c1_1161_2135 311
61 3300050507 nmdc:mga05p37_49294_c1 nmdc:mga05p37_49294_c1_1416_2390 311
62 3300050515 nmdc:mga0a205_169150_c1 nmdc:mga0a205_169150_c1_1116_2051 311
63 3300025900 Ga0207710_10144383 Ga0207710_101443831 312
64 3300025921 Ga0207652_10028066 Ga0207652_100280665 312
65 3300031507 Ga0307509_10170661 Ga0307509_101706612 312
66 3300033180 Ga0307510_10093546 Ga0307510_100935463 312
67 3300035114 Ga0373939_0007617 Ga0373939_0007617_495_1472 312
68 3300044694 Ga0466963_0180802 Ga0466963_0180802_360_1337 312
69 3300046460 Ga0495638_0016637 Ga0495638_0016637_3237_4211 312
70 3300046499 Ga0495594_0071026 Ga0495594_0071026_722_1696 312
71 3300046519 Ga0495632_0062790 Ga0495632_0062790_774_1748 312
72 3300046616 Ga0495668_0013965 Ga0495668_0013965_861_1835 312
73 3300046684 Ga0495669_0024391 Ga0495669_0024391_597_1571 312
74 3300048924 Ga0496121_0029635 Ga0496121_0029635_1011_1985 312
75 3300048929 Ga0496126_0007157 Ga0496126_0007157_2865_3839 312
76 3300053119 Ga0500595_020436 Ga0500595_020436_786_1760 312
77 3300037418 Ga0395900_0208698 Ga0395900_0208698_847_1824 313
78 3300049571 Ga0501034_0504993 Ga0501034_0504993_47_1024 313
79 3300005435 Ga0070714_100088110 Ga0070714_1000881102 314
80 3300005437 Ga0070710_10095965 Ga0070710_100959652 314
81 3300005458 Ga0070681_10032494 Ga0070681_100324946 314
82 3300005471 Ga0070698_100103675 Ga0070698_1001036751 314
83 3300005530 Ga0070679_100067689 Ga0070679_1000676894 314
84 3300005535 Ga0070684_100112216 Ga0070684_1001122162 314
85 3300005547 Ga0070693_100165525 Ga0070693_1001655252 314
86 3300005563 Ga0068855_100180896 Ga0068855_1001808962 314
87 3300005578 Ga0068854_100074701 Ga0068854_1000747014 314
88 3300005985 Ga0081539_10052157 Ga0081539_100521573 314
89 3300006175 Ga0070712_100086512 Ga0070712_1000865123 314
90 3300009551 Ga0105238_10180828 Ga0105238_101808282 314
91 3300025906 Ga0207699_10328147 Ga0207699_103281471 314
92 3300025921 Ga0207652_10088727 Ga0207652_100887274 314
93 3300025924 Ga0207694_10126736 Ga0207694_101267362 314
94 3300025929 Ga0207664_10309524 Ga0207664_103095242 314
95 3300026078 Ga0207702_10363703 Ga0207702_103637031 314
96 3300049587 Ga0501071_0049887 Ga0501071_0049887_440_1420 314
97 3300005937 Ga0081455_10037370 Ga0081455_100373704 315
98 3300005985 Ga0081539_10015884 Ga0081539_100158841 315
99 3300006038 Ga0075365_10095195 Ga0075365_100951951 315
100 3300006048 Ga0075363_100010016 Ga0075363_1000100164 315
101 3300006178 Ga0075367_10116702 Ga0075367_101167021 315
102 3300006353 Ga0075370_10008478 Ga0075370_100084782 315
103 3300025945 Ga0207679_10279643 Ga0207679_102796431 315
104 3300026095 Ga0207676_10240398 Ga0207676_102403982 315
105 3300028379 Ga0268266_10004080 Ga0268266_100040809 315
106 3300048918 Ga0496115_0092475 Ga0496115_0092475_1099_2073 315
107 3300050490 nmdc:mga03n38_1257_c1 nmdc:mga03n38_1257_c1_2814_3788 315
108 3300050494 nmdc:mga06z11_12395_c1 nmdc:mga06z11_12395_c1_317_1291 315
109 3300053091 Ga0500647_0166931 Ga0500647_0166931_26_973 315
110 3300027312 Ga0209371_1002632 Ga0209371_100263210 316
111 3300030500 Ga0268256_1003412 Ga0268256_10034128 316
112 3300037312 Ga0395899_0113398 Ga0395899_0113398_317_1291 316
113 3300037418 Ga0395900_0000917 Ga0395900_0000917_3812_4786 316
114 3300037466 Ga0395898_0029930 Ga0395898_0029930_2351_3325 316
115 3300037471 Ga0395905_0271090 Ga0395905_0271090_405_1379 316
116 3300038443 Ga0395901_0019066 Ga0395901_0019066_3891_4865 316
117 3300046518 Ga0495631_0024362 Ga0495631_0024362_856_1806 316
118 3300049571 Ga0501034_0060308 Ga0501034_0060308_442_1419 316
119 3300049583 Ga0501067_0008059 Ga0501067_0008059_1832_2809 316
120 3300049584 Ga0501068_0048922 Ga0501068_0048922_1258_2235 316
121 3300049586 Ga0501070_0027632 Ga0501070_0027632_311_1288 316
122 3300049588 Ga0501072_0051754 Ga0501072_0051754_979_1956 316
123 3300049590 Ga0501074_0142131 Ga0501074_0142131_429_1406 316
124 3300049742 Ga0501080_0008717 Ga0501080_0008717_1156_2133 316
125 3300049823 Ga0501044_0032946 Ga0501044_0032946_1257_2234 316
126 3300003659 JGI25404J52841_10007800 JGI25404J52841_100078004 317
127 3300005983 Ga0081540_1000257 Ga0081540_100025720 317
128 3300039447 Ga0436361_0452981 Ga0436361_0452981_1327_2298 317
129 3300046472 Ga0495580_0028270 Ga0495580_0028270_2223_3179 317
130 3300005468 Ga0070707_100236520 Ga0070707_1002365201 318
131 3300009551 Ga0105238_10050560 Ga0105238_100505604 318
132 iso_pu_bacteria 2842311132 2842317079 318
133 iso_pu_bacteria 2842495871 2842501446 318
134 3300005983 Ga0081540_1032775 Ga0081540_10327752 319
135 3300037466 Ga0395898_0098943 Ga0395898_0098943_1023_2000 320
136 iso_pu_bacteria 2513237101 2513692117 320
137 iso_pu_bacteria 2513237104 2513718096 320
138 iso_pu_bacteria 2524023205 2524436868 320
139 iso_pu_bacteria 2721755755 2723845510 320
140 iso_pu_bacteria 2744054633 2745080195 320
141 iso_pu_bacteria 2791355199 2793082666 320
142 iso_pu_bacteria 2874604998 2874607597 320
143 iso_pu_bacteria 2876761206 2876763836 320
144 iso_pu_bacteria 2876808645 2876809959 320
145 iso_pu_bacteria 2879110137 2879118246 320
146 iso_pu_bacteria 2889033259 2889040284 320
147 iso_pu_bacteria 2903768456 2903775820 320
148 iso_pu_bacteria 2906626472 2906634140 320
149 iso_pu_bacteria 2922361189 2922368186 320
150 iso_pu_bacteria 2922386360 2922388339 320
151 iso_pu_bacteria 2935959822 2935960142 320
152 iso_pu_bacteria 8006964411 8006970778 320
153 iso_pu_bacteria 8006984368 8006985629 320
154 iso_pu_bacteria 8006994254 8007000179 320
155 iso_pu_bacteria 8056673599 8056674245 320
156 iso_pu_bacteria 8056681323 8056685428 320
157 3300048906 Ga0496103_0022038 Ga0496103_0022038_60_1025 321
158 3300006177 Ga0075362_10000796 Ga0075362_100007965 322
159 3300005364 Ga0070673_100116580 Ga0070673_1001165802 323
160 3300005471 Ga0070698_100004430 Ga0070698_10000443013 323
161 3300005937 Ga0081455_10000356 Ga0081455_1000035619 323
162 3300005983 Ga0081540_1000060 Ga0081540_100006045 323
163 3300026067 Ga0207678_10303421 Ga0207678_103034211 323
164 3300031507 Ga0307509_10184029 Ga0307509_101840292 323
165 3300035086 Ga0373934_0027921 Ga0373934_0027921_204_1175 323
166 3300035114 Ga0373939_0052100 Ga0373939_0052100_109_1083 323
167 3300035117 Ga0373953_0006310 Ga0373953_0006310_1322_2293 323
168 3300035119 Ga0373956_0115125 Ga0373956_0115125_93_1064 323
169 3300035172 Ga0373955_0011500 Ga0373955_0011500_1381_2352 323
170 3300035724 Ga0373933_0014389 Ga0373933_0014389_2081_3052 323
171 3300036401 Ga0373937_0007509 Ga0373937_0007509_6449_7420 323
172 3300037853 Ga0436364_0761681 Ga0436364_0761681_825_1796 323
173 3300039447 Ga0436361_0291544 Ga0436361_0291544_1338_2315 323
174 3300044684 Ga0466966_0082720 Ga0466966_0082720_689_1663 323
175 3300046454 Ga0495592_0096600 Ga0495592_0096600_123_1094 323
176 3300046462 Ga0495651_0023992 Ga0495651_0023992_3714_4685 323
177 3300046536 Ga0495587_0029413 Ga0495587_0029413_525_1496 323
178 3300046559 Ga0495667_0040819 Ga0495667_0040819_733_1704 323
179 3300046679 Ga0495623_0119469 Ga0495623_0119469_546_1517 323
180 3300046809 Ga0495600_0055606 Ga0495600_0055606_229_1200 323
181 3300047322 Ga0495680_0043116 Ga0495680_0043116_811_1782 323
182 3300047444 Ga0495675_0063085 Ga0495675_0063085_628_1599 323
183 3300050489 nmdc:mga03683_2160_c1 nmdc:mga03683_2160_c1_4044_5054 323
184 3300053077 Ga0495601_0020113 Ga0495601_0020113_701_1672 323
185 3300053085 Ga0495619_0080843 Ga0495619_0080843_564_1535 323
186 3300003203 JGI25406J46586_10000004 JGI25406J46586_10000004102 324
187 3300005366 Ga0070659_100224223 Ga0070659_1002242232 324
188 3300005539 Ga0068853_100161577 Ga0068853_1001615772 324
189 3300005548 Ga0070665_100071433 Ga0070665_1000714333 324
190 3300005843 Ga0068860_100000448 Ga0068860_10000044845 324
191 3300005985 Ga0081539_10000080 Ga0081539_1000008025 324
192 3300006028 Ga0070717_10016717 Ga0070717_100167175 324
193 3300006038 Ga0075365_10067595 Ga0075365_100675953 324
194 3300007265 Ga0099794_10104084 Ga0099794_101040841 324
195 3300007788 Ga0099795_10003566 Ga0099795_100035664 324
196 3300009098 Ga0105245_10322101 Ga0105245_103221012 324
197 3300009101 Ga0105247_10005459 Ga0105247_100054596 324
198 3300009101 Ga0105247_10036356 Ga0105247_100363562 324
199 3300009174 Ga0105241_10037962 Ga0105241_100379623 324
200 3300009545 Ga0105237_10023639 Ga0105237_100236394 324
201 3300009545 Ga0105237_10040193 Ga0105237_100401932 324
202 3300009551 Ga0105238_10062496 Ga0105238_100624963 324
203 3300010159 Ga0099796_10003100 Ga0099796_100031005 324
204 3300010375 Ga0105239_10005450 Ga0105239_100054508 324
205 3300013100 Ga0157373_10145122 Ga0157373_101451222 324
206 3300013102 Ga0157371_10047027 Ga0157371_100470273 324
207 3300025914 Ga0207671_10022987 Ga0207671_100229874 324
208 3300025914 Ga0207671_10046170 Ga0207671_100461703 324
209 3300025914 Ga0207671_10065535 Ga0207671_100655352 324
210 3300025915 Ga0207693_10021894 Ga0207693_100218945 324
211 3300025919 Ga0207657_10009757 Ga0207657_100097575 324
212 3300025921 Ga0207652_10408231 Ga0207652_104082311 324
213 3300025922 Ga0207646_10070925 Ga0207646_100709252 324
214 3300025924 Ga0207694_10041733 Ga0207694_100417332 324
215 3300025949 Ga0207667_10129105 Ga0207667_101291052 324
216 3300026035 Ga0207703_10091348 Ga0207703_100913482 324
217 3300026041 Ga0207639_10320401 Ga0207639_103204011 324
218 3300028381 Ga0268264_10000162 Ga0268264_1000016240 324
219 3300030521 Ga0307511_10059052 Ga0307511_100590522 324
220 3300031456 Ga0307513_10100118 Ga0307513_101001183 324
221 3300031507 Ga0307509_10193454 Ga0307509_101934542 324
222 3300031616 Ga0307508_10000001 Ga0307508_10000001177 324
223 3300031616 Ga0307508_10042265 Ga0307508_100422654 324
224 3300031616 Ga0307508_10057284 Ga0307508_100572843 324
225 3300031616 Ga0307508_10064279 Ga0307508_100642792 324
226 3300031727 Ga0316576_10001056 Ga0316576_100010569 324
227 3300031730 Ga0307516_10012533 Ga0307516_100125333 324
228 3300031731 Ga0307405_10358939 Ga0307405_103589391 324
229 3300032002 Ga0307416_100543646 Ga0307416_1005436462 324
230 3300033179 Ga0307507_10123347 Ga0307507_101233472 324
231 3300033180 Ga0307510_10068958 Ga0307510_100689584 324
232 3300033544 Ga0316215_1001492 Ga0316215_10014923 324
233 3300035725 Ga0373947_0193019 Ga0373947_0193019_306_1280 324
234 3300036459 Ga0372808_000887 Ga0372808_000887_1414_2388 324
235 3300037068 Ga0373925_0032152 Ga0373925_0032152_1250_2224 324
236 3300037068 Ga0373925_0165210 Ga0373925_0165210_41_1015 324
237 3300039450 Ga0436363_0379375 Ga0436363_0379375_3301_4275 324
238 3300046477 Ga0495664_0050337 Ga0495664_0050337_1155_2129 324
239 3300046507 Ga0495606_0001220 Ga0495606_0001220_23049_24023 324
240 3300046557 Ga0495622_0043586 Ga0495622_0043586_405_1379 324
241 3300046559 Ga0495667_0029602 Ga0495667_0029602_1314_2288 324
242 3300047320 Ga0495672_0067708 Ga0495672_0067708_934_1908 324
243 3300047321 Ga0495676_0054077 Ga0495676_0054077_161_1135 324
244 3300047322 Ga0495680_0205372 Ga0495680_0205372_203_1177 324
245 3300047444 Ga0495675_0061543 Ga0495675_0061543_292_1266 324
246 3300048915 Ga0496112_0000009 Ga0496112_0000009_236795_237769 324
247 3300048919 Ga0496116_0148251 Ga0496116_0148251_252_1226 324
248 3300048920 Ga0496117_0097463 Ga0496117_0097463_143_1117 324
249 3300048921 Ga0496118_0002370 Ga0496118_0002370_11350_12324 324
250 3300048924 Ga0496121_0000110 Ga0496121_0000110_178509_179483 324
251 3300048927 Ga0496124_0009400 Ga0496124_0009400_2215_3189 324
252 3300048927 Ga0496124_0081079 Ga0496124_0081079_365_1339 324
253 3300048929 Ga0496126_0077579 Ga0496126_0077579_1012_1986 324
254 3300048929 Ga0496126_0082735 Ga0496126_0082735_1441_2415 324
255 3300049568 Ga0501031_0065472 Ga0501031_0065472_112_1086 324
256 3300049569 Ga0501032_0000054 Ga0501032_0000054_6230_7204 324
257 3300049570 Ga0501033_0000025 Ga0501033_0000025_110744_111718 324
258 3300049570 Ga0501033_0028631 Ga0501033_0028631_1101_2075 324
259 3300049571 Ga0501034_0000177 Ga0501034_0000177_20407_21381 324
260 3300049571 Ga0501034_0162958 Ga0501034_0162958_1002_1976 324
261 3300049572 Ga0501036_0000025 Ga0501036_0000025_93642_94616 324
262 3300049572 Ga0501036_0185044 Ga0501036_0185044_723_1697 324
263 3300049573 Ga0501037_0000169 Ga0501037_0000169_56682_57656 324
264 3300049574 Ga0501038_0000029 Ga0501038_0000029_37283_38257 324
265 3300049574 Ga0501038_0159315 Ga0501038_0159315_252_1226 324
266 3300049575 Ga0501039_0014669 Ga0501039_0014669_20_994 324
267 3300049579 Ga0501043_0000067 Ga0501043_0000067_38977_39951 324
268 3300049579 Ga0501043_0097871 Ga0501043_0097871_583_1557 324
269 3300049579 Ga0501043_0189269 Ga0501043_0189269_604_1578 324
270 3300049580 Ga0501046_0000479 Ga0501046_0000479_28818_29792 324
271 3300049581 Ga0501047_0000061 Ga0501047_0000061_84979_85953 324
272 3300049581 Ga0501047_0467833 Ga0501047_0467833_71_1045 324
273 3300049582 Ga0501048_0000081 Ga0501048_0000081_39651_40625 324
274 3300049583 Ga0501067_0004093 Ga0501067_0004093_6661_7635 324
275 3300049583 Ga0501067_0142442 Ga0501067_0142442_251_1225 324
276 3300049584 Ga0501068_0009234 Ga0501068_0009234_3981_4955 324
277 3300049585 Ga0501069_0006408 Ga0501069_0006408_4956_5930 324
278 3300049586 Ga0501070_0012320 Ga0501070_0012320_5057_6031 324
279 3300049587 Ga0501071_0064801 Ga0501071_0064801_449_1423 324
280 3300049588 Ga0501072_0001324 Ga0501072_0001324_13077_14051 324
281 3300049589 Ga0501073_0004672 Ga0501073_0004672_6368_7342 324
282 3300049589 Ga0501073_0081895 Ga0501073_0081895_115_1089 324
283 3300049589 Ga0501073_0082488 Ga0501073_0082488_530_1504 324
284 3300049590 Ga0501074_0013180 Ga0501074_0013180_2801_3775 324
285 3300049741 Ga0501079_0052135 Ga0501079_0052135_823_1797 324
286 3300049742 Ga0501080_0039603 Ga0501080_0039603_2222_3196 324
287 3300049744 Ga0501083_0000544 Ga0501083_0000544_9867_10841 324
288 3300049822 Ga0501035_0001202 Ga0501035_0001202_21136_22110 324
289 3300049822 Ga0501035_0042124 Ga0501035_0042124_1964_2938 324
290 3300049823 Ga0501044_0000028 Ga0501044_0000028_113220_114194 324
291 3300049823 Ga0501044_0199019 Ga0501044_0199019_353_1327 324
292 3300049824 Ga0501045_0071853 Ga0501045_0071853_1368_2342 324
293 3300053094 Ga0500566_0000124 Ga0500566_0000124_12045_13019 324
294 3300053095 Ga0500640_000336 Ga0500640_000336_3711_4685 324
295 3300053111 Ga0500572_001094 Ga0500572_001094_6213_7187 324
296 3300053115 Ga0500591_058467 Ga0500591_058467_296_1270 324
297 3300053136 Ga0500559_0004459 Ga0500559_0004459_5512_6486 324
298 3300053136 Ga0500559_0008670 Ga0500559_0008670_1432_2406 324
299 3300053150 Ga0500603_000189 Ga0500603_000189_12553_13527 324
300 3300053159 Ga0500630_001137 Ga0500630_001137_8361_9335 324
301 3300053163 Ga0500639_000115 Ga0500639_000115_11193_12167 324
302 3300053163 Ga0500639_047362 Ga0500639_047362_176_1150 324
303 3300053177 Ga0500636_0044934 Ga0500636_0044934_870_1844 324
304 3300053178 Ga0500637_0028335 Ga0500637_0028335_1850_2824 324
305 3300053735 Ga0500596_000790 Ga0500596_000790_3880_4854 324
306 3300053735 Ga0500596_002245 Ga0500596_002245_1130_2104 324
307 3300053737 Ga0500601_003639 Ga0500601_003639_612_1586 324
308 3300054114 Ga0501084_0036612 Ga0501084_0036612_236_1210 324
309 3300060353 Ga0501082_0010013 Ga0501082_0010013_4015_4989 324
310 2209111006 2214772983 2213792886 325
311 3300000041 ARcpr5oldR_c000140 ARcpr5oldR_0001406 325
312 3300000042 ARSoilYngRDRAFT_c00234 ARSoilYngRDRAFT_002346 325
313 3300000043 ARcpr5yngRDRAFT_c000872 ARcpr5yngRDRAFT_0008722 325
314 3300000044 ARSoilOldRDRAFT_c000126 ARSoilOldRDRAFT_00012612 325
315 3300000045 ARCol0oldRDRAFT_c00368 ARCol0oldRDRAFT_003685 325
316 3300000652 ARCol0yngRDRAFT_1000665 ARCol0yngRDRAFT_10006652 325
317 3300001977 JGI24746J21847_1001655 JGI24746J21847_10016553 325
318 3300001978 JGI24747J21853_1000133 JGI24747J21853_10001334 325
319 3300001989 JGI24739J22299_10014140 JGI24739J22299_100141402 325
320 3300001990 JGI24737J22298_10000960 JGI24737J22298_100009609 325
321 3300001990 JGI24737J22298_10007118 JGI24737J22298_100071182 325
322 3300001990 JGI24737J22298_10021016 JGI24737J22298_100210162 325
323 3300002067 JGI24735J21928_10042458 JGI24735J21928_100424583 325
324 3300002070 JGI24750J21931_1000601 JGI24750J21931_10006016 325
325 3300002070 JGI24750J21931_1005810 JGI24750J21931_10058102 325
326 3300002073 JGI24745J21846_1000099 JGI24745J21846_10000996 325
327 3300002074 JGI24748J21848_1000721 JGI24748J21848_10007213 325
328 3300002075 JGI24738J21930_10000223 JGI24738J21930_100002235 325
329 3300002076 JGI24749J21850_1003197 JGI24749J21850_10031973 325
330 3300002076 JGI24749J21850_1010025 JGI24749J21850_10100252 325
331 3300002077 JGI24744J21845_10000129 JGI24744J21845_1000012910 325
332 3300002077 JGI24744J21845_10003963 JGI24744J21845_100039634 325
333 3300002239 JGI24034J26672_10000557 JGI24034J26672_100005576 325
334 3300002239 JGI24034J26672_10003132 JGI24034J26672_100031323 325
335 3300002244 JGI24742J22300_10000255 JGI24742J22300_100002558 325
336 3300002244 JGI24742J22300_10000264 JGI24742J22300_100002648 325
337 3300002244 JGI24742J22300_10000524 JGI24742J22300_100005245 325
338 3300005276 Ga0065717_1002284 Ga0065717_10022842 325
339 3300005277 Ga0065716_1001992 Ga0065716_10019922 325
340 3300005289 Ga0065704_10074561 Ga0065704_100745615 325
341 3300005290 Ga0065712_10009760 Ga0065712_100097603 325
342 3300005290 Ga0065712_10070835 Ga0065712_100708352 325
343 3300005293 Ga0065715_10089377 Ga0065715_100893772 325
344 3300005328 Ga0070676_10000012 Ga0070676_1000001251 325
345 3300005329 Ga0070683_100000139 Ga0070683_10000013914 325
346 3300005329 Ga0070683_100091253 Ga0070683_1000912533 325
347 3300005330 Ga0070690_100005164 Ga0070690_1000051648 325
348 3300005330 Ga0070690_100005412 Ga0070690_1000054127 325
349 3300005330 Ga0070690_100062958 Ga0070690_1000629582 325
350 3300005331 Ga0070670_100002014 Ga0070670_1000020148 325
351 3300005331 Ga0070670_100021801 Ga0070670_1000218016 325
352 3300005331 Ga0070670_100086294 Ga0070670_1000862941 325
353 3300005333 Ga0070677_10000125 Ga0070677_100001256 325
354 3300005334 Ga0068869_100000605 Ga0068869_10000060512 325
355 3300005334 Ga0068869_100021090 Ga0068869_1000210904 325
356 3300005335 Ga0070666_10017025 Ga0070666_100170254 325
357 3300005335 Ga0070666_10038295 Ga0070666_100382951 325
358 3300005336 Ga0070680_100000179 Ga0070680_10000017911 325
359 3300005336 Ga0070680_100010716 Ga0070680_1000107161 325
360 3300005336 Ga0070680_100014505 Ga0070680_1000145053 325
361 3300005337 Ga0070682_100000319 Ga0070682_1000003199 325
362 3300005337 Ga0070682_100016170 Ga0070682_1000161705 325
363 3300005338 Ga0068868_100000593 Ga0068868_1000005934 325
364 3300005338 Ga0068868_100004938 Ga0068868_1000049386 325
365 3300005338 Ga0068868_100060491 Ga0068868_1000604913 325
366 3300005339 Ga0070660_100001605 Ga0070660_1000016055 325
367 3300005339 Ga0070660_100086796 Ga0070660_1000867962 325
368 3300005340 Ga0070689_100004685 Ga0070689_1000046859 325
369 3300005340 Ga0070689_100062016 Ga0070689_1000620162 325
370 3300005340 Ga0070689_100079168 Ga0070689_1000791682 325
371 3300005340 Ga0070689_100210076 Ga0070689_1002100762 325
372 3300005341 Ga0070691_10001565 Ga0070691_100015655 325
373 3300005341 Ga0070691_10040470 Ga0070691_100404703 325
374 3300005343 Ga0070687_100118710 Ga0070687_1001187102 325
375 3300005344 Ga0070661_100001455 Ga0070661_10000145513 325
376 3300005344 Ga0070661_100089918 Ga0070661_1000899182 325
377 3300005345 Ga0070692_10000434 Ga0070692_100004343 325
378 3300005345 Ga0070692_10002195 Ga0070692_100021956 325
379 3300005345 Ga0070692_10024353 Ga0070692_100243533 325
380 3300005347 Ga0070668_100004423 Ga0070668_1000044236 325
381 3300005347 Ga0070668_100407758 Ga0070668_1004077581 325
382 3300005353 Ga0070669_100000409 Ga0070669_1000004095 325
383 3300005353 Ga0070669_100058741 Ga0070669_1000587413 325
384 3300005353 Ga0070669_100133693 Ga0070669_1001336932 325
385 3300005354 Ga0070675_100000166 Ga0070675_10000016633 325
386 3300005354 Ga0070675_100047183 Ga0070675_1000471834 325
387 3300005354 Ga0070675_100346017 Ga0070675_1003460172 325
388 3300005355 Ga0070671_100005674 Ga0070671_10000567410 325
389 3300005355 Ga0070671_100005938 Ga0070671_1000059387 325
390 3300005355 Ga0070671_100006280 Ga0070671_1000062805 325
391 3300005355 Ga0070671_100051098 Ga0070671_1000510982 325
392 3300005355 Ga0070671_100094656 Ga0070671_1000946562 325
393 3300005355 Ga0070671_100206327 Ga0070671_1002063272 325
394 3300005356 Ga0070674_100000644 Ga0070674_10000064413 325
395 3300005356 Ga0070674_100002605 Ga0070674_1000026059 325
396 3300005364 Ga0070673_100000041 Ga0070673_10000004114 325
397 3300005364 Ga0070673_100089493 Ga0070673_1000894933 325
398 3300005365 Ga0070688_100000180 Ga0070688_10000018017 325
399 3300005365 Ga0070688_100011831 Ga0070688_1000118316 325
400 3300005365 Ga0070688_100026530 Ga0070688_1000265304 325
401 3300005365 Ga0070688_100036302 Ga0070688_1000363024 325
402 3300005365 Ga0070688_100049523 Ga0070688_1000495233 325
403 3300005365 Ga0070688_100124822 Ga0070688_1001248221 325
404 3300005366 Ga0070659_100000752 Ga0070659_10000075214 325
405 3300005366 Ga0070659_100143341 Ga0070659_1001433412 325
406 3300005366 Ga0070659_100229856 Ga0070659_1002298561 325
407 3300005367 Ga0070667_100000365 Ga0070667_1000003654 325
408 3300005367 Ga0070667_100019077 Ga0070667_1000190774 325
409 3300005406 Ga0070703_10003914 Ga0070703_100039144 325
410 3300005434 Ga0070709_10003137 Ga0070709_100031371 325
411 3300005434 Ga0070709_10019500 Ga0070709_100195003 325
412 3300005435 Ga0070714_100057992 Ga0070714_1000579922 325
413 3300005435 Ga0070714_100098674 Ga0070714_1000986743 325
414 3300005435 Ga0070714_100110282 Ga0070714_1001102821 325
415 3300005435 Ga0070714_100398998 Ga0070714_1003989981 325
416 3300005436 Ga0070713_100063078 Ga0070713_1000630782 325
417 3300005436 Ga0070713_100135262 Ga0070713_1001352622 325
418 3300005436 Ga0070713_100195422 Ga0070713_1001954222 325
419 3300005437 Ga0070710_10005022 Ga0070710_100050222 325
420 3300005437 Ga0070710_10011315 Ga0070710_100113155 325
421 3300005437 Ga0070710_10083431 Ga0070710_100834312 325
422 3300005437 Ga0070710_10102081 Ga0070710_101020812 325
423 3300005438 Ga0070701_10000493 Ga0070701_1000049313 325
424 3300005438 Ga0070701_10012908 Ga0070701_100129083 325
425 3300005439 Ga0070711_100015744 Ga0070711_1000157446 325
426 3300005439 Ga0070711_100030851 Ga0070711_1000308513 325
427 3300005439 Ga0070711_100185604 Ga0070711_1001856042 325
428 3300005439 Ga0070711_100224195 Ga0070711_1002241951 325
429 3300005440 Ga0070705_100002314 Ga0070705_1000023147 325
430 3300005440 Ga0070705_100044262 Ga0070705_1000442622 325
431 3300005441 Ga0070700_100000467 Ga0070700_10000046715 325
432 3300005441 Ga0070700_100169928 Ga0070700_1001699282 325
433 3300005444 Ga0070694_100000065 Ga0070694_10000006547 325
434 3300005444 Ga0070694_100029375 Ga0070694_1000293752 325
435 3300005444 Ga0070694_100165982 Ga0070694_1001659822 325
436 3300005445 Ga0070708_100286274 Ga0070708_1002862742 325
437 3300005455 Ga0070663_100000473 Ga0070663_10000047313 325
438 3300005455 Ga0070663_100138607 Ga0070663_1001386072 325
439 3300005455 Ga0070663_100233791 Ga0070663_1002337911 325
440 3300005456 Ga0070678_100000091 Ga0070678_1000000915 325
441 3300005456 Ga0070678_100007141 Ga0070678_1000071412 325
442 3300005456 Ga0070678_100010348 Ga0070678_1000103484 325
443 3300005456 Ga0070678_100034927 Ga0070678_1000349271 325
444 3300005456 Ga0070678_100062680 Ga0070678_1000626801 325
445 3300005457 Ga0070662_100006535 Ga0070662_1000065355 325
446 3300005457 Ga0070662_100043231 Ga0070662_1000432314 325
447 3300005457 Ga0070662_100057442 Ga0070662_1000574424 325
448 3300005457 Ga0070662_100241111 Ga0070662_1002411112 325
449 3300005458 Ga0070681_10010003 Ga0070681_100100038 325
450 3300005458 Ga0070681_10092484 Ga0070681_100924842 325
451 3300005458 Ga0070681_10191610 Ga0070681_101916102 325
452 3300005458 Ga0070681_10223913 Ga0070681_102239132 325
453 3300005459 Ga0068867_100000859 Ga0068867_10000085921 325
454 3300005459 Ga0068867_100007691 Ga0068867_1000076914 325
455 3300005459 Ga0068867_100119168 Ga0068867_1001191683 325
456 3300005466 Ga0070685_10001731 Ga0070685_100017313 325
457 3300005466 Ga0070685_10015115 Ga0070685_100151154 325
458 3300005466 Ga0070685_10018921 Ga0070685_100189214 325
459 3300005466 Ga0070685_10041755 Ga0070685_100417553 325
460 3300005468 Ga0070707_100072359 Ga0070707_1000723591 325
461 3300005530 Ga0070679_100006957 Ga0070679_1000069575 325
462 3300005530 Ga0070679_100012754 Ga0070679_1000127545 325
463 3300005535 Ga0070684_100000219 Ga0070684_1000002195 325
464 3300005535 Ga0070684_100264601 Ga0070684_1002646012 325
465 3300005539 Ga0068853_100000600 Ga0068853_10000060020 325
466 3300005539 Ga0068853_100441788 Ga0068853_1004417881 325
467 3300005543 Ga0070672_100000019 Ga0070672_10000001913 325
468 3300005543 Ga0070672_100005606 Ga0070672_1000056064 325
469 3300005543 Ga0070672_100091597 Ga0070672_1000915972 325
470 3300005543 Ga0070672_100131022 Ga0070672_1001310222 325
471 3300005544 Ga0070686_100007875 Ga0070686_1000078754 325
472 3300005544 Ga0070686_100013361 Ga0070686_1000133615 325
473 3300005544 Ga0070686_100084027 Ga0070686_1000840272 325
474 3300005544 Ga0070686_100106911 Ga0070686_1001069113 325
475 3300005545 Ga0070695_100000474 Ga0070695_10000047415 325
476 3300005545 Ga0070695_100157083 Ga0070695_1001570832 325
477 3300005546 Ga0070696_100003100 Ga0070696_10000310011 325
478 3300005546 Ga0070696_100101172 Ga0070696_1001011723 325
479 3300005546 Ga0070696_100126973 Ga0070696_1001269733 325
480 3300005547 Ga0070693_100001868 Ga0070693_1000018686 325
481 3300005547 Ga0070693_100080784 Ga0070693_1000807842 325
482 3300005548 Ga0070665_100010015 Ga0070665_1000100157 325
483 3300005549 Ga0070704_100000252 Ga0070704_10000025219 325
484 3300005549 Ga0070704_100001606 Ga0070704_10000160612 325
485 3300005549 Ga0070704_100103247 Ga0070704_1001032472 325
486 3300005563 Ga0068855_100018421 Ga0068855_1000184216 325
487 3300005563 Ga0068855_100019721 Ga0068855_1000197216 325
488 3300005563 Ga0068855_100063129 Ga0068855_1000631292 325
489 3300005563 Ga0068855_100094398 Ga0068855_1000943984 325
490 3300005564 Ga0070664_100000819 Ga0070664_10000081911 325
491 3300005564 Ga0070664_100022255 Ga0070664_1000222553 325
492 3300005564 Ga0070664_100152816 Ga0070664_1001528162 325
493 3300005577 Ga0068857_100000768 Ga0068857_1000007685 325
494 3300005578 Ga0068854_100001736 Ga0068854_1000017365 325
495 3300005578 Ga0068854_100112791 Ga0068854_1001127912 325
496 3300005614 Ga0068856_100002295 Ga0068856_10000229517 325
497 3300005614 Ga0068856_100144924 Ga0068856_1001449244 325
498 3300005614 Ga0068856_100266791 Ga0068856_1002667912 325
499 3300005615 Ga0070702_100000898 Ga0070702_1000008985 325
500 3300005615 Ga0070702_100057764 Ga0070702_1000577643 325
501 3300005616 Ga0068852_100001992 Ga0068852_10000199210 325
502 3300005616 Ga0068852_100118580 Ga0068852_1001185802 325
503 3300005616 Ga0068852_100174225 Ga0068852_1001742253 325
504 3300005617 Ga0068859_100030288 Ga0068859_1000302882 325
505 3300005617 Ga0068859_100281836 Ga0068859_1002818363 325
506 3300005618 Ga0068864_100005938 Ga0068864_10000593811 325
507 3300005618 Ga0068864_100009491 Ga0068864_1000094918 325
508 3300005618 Ga0068864_100029150 Ga0068864_1000291501 325
509 3300005718 Ga0068866_10001028 Ga0068866_100010285 325
510 3300005718 Ga0068866_10013621 Ga0068866_100136212 325
511 3300005718 Ga0068866_10154896 Ga0068866_101548961 325
512 3300005719 Ga0068861_100000169 Ga0068861_1000001695 325
513 3300005719 Ga0068861_100190783 Ga0068861_1001907832 325
514 3300005834 Ga0068851_10024424 Ga0068851_100244241 325
515 3300005840 Ga0068870_10000586 Ga0068870_100005864 325
516 3300005840 Ga0068870_10003342 Ga0068870_100033427 325
517 3300005841 Ga0068863_100000381 Ga0068863_10000038130 325
518 3300005841 Ga0068863_100014411 Ga0068863_1000144111 325
519 3300005842 Ga0068858_100009197 Ga0068858_1000091979 325
520 3300005842 Ga0068858_100016225 Ga0068858_1000162252 325
521 3300005842 Ga0068858_100511731 Ga0068858_1005117311 325
522 3300005843 Ga0068860_100001472 Ga0068860_10000147220 325
523 3300005843 Ga0068860_100007428 Ga0068860_1000074289 325
524 3300005843 Ga0068860_100081520 Ga0068860_1000815203 325
525 3300005844 Ga0068862_100001886 Ga0068862_1000018865 325
526 3300005844 Ga0068862_100021781 Ga0068862_1000217813 325
527 3300005844 Ga0068862_100065508 Ga0068862_1000655084 325
528 3300005937 Ga0081455_10000036 Ga0081455_10000036127 325
529 3300005937 Ga0081455_10004173 Ga0081455_1000417320 325
530 3300005937 Ga0081455_10012017 Ga0081455_100120175 325
531 3300005981 Ga0081538_10023585 Ga0081538_100235852 325
532 3300005983 Ga0081540_1060985 Ga0081540_10609852 325
533 3300006028 Ga0070717_10000199 Ga0070717_1000019916 325
534 3300006028 Ga0070717_10199428 Ga0070717_101994282 325
535 3300006038 Ga0075365_10023303 Ga0075365_100233032 325
536 3300006038 Ga0075365_10063525 Ga0075365_100635254 325
537 3300006042 Ga0075368_10041807 Ga0075368_100418071 325
538 3300006048 Ga0075363_100019886 Ga0075363_1000198861 325
539 3300006048 Ga0075363_100061414 Ga0075363_1000614142 325
540 3300006048 Ga0075363_100091630 Ga0075363_1000916302 325
541 3300006048 Ga0075363_100133856 Ga0075363_1001338562 325
542 3300006173 Ga0070716_100002448 Ga0070716_1000024486 325
543 3300006173 Ga0070716_100100739 Ga0070716_1001007393 325
544 3300006175 Ga0070712_100002527 Ga0070712_1000025277 325
545 3300006175 Ga0070712_100014196 Ga0070712_1000141964 325
546 3300006175 Ga0070712_100017680 Ga0070712_1000176804 325
547 3300006186 Ga0075369_10051679 Ga0075369_100516792 325
548 3300006194 Ga0075427_10001399 Ga0075427_100013992 325
549 3300006195 Ga0075366_10016027 Ga0075366_100160274 325
550 3300006195 Ga0075366_10036158 Ga0075366_100361583 325
551 3300006237 Ga0097621_100001234 Ga0097621_1000012345 325
552 3300006237 Ga0097621_100025864 Ga0097621_1000258642 325
553 3300006237 Ga0097621_100043421 Ga0097621_1000434214 325
554 3300006353 Ga0075370_10057643 Ga0075370_100576433 325
555 3300006358 Ga0068871_100000068 Ga0068871_10000006853 325
556 3300006358 Ga0068871_100009351 Ga0068871_1000093514 325
557 3300006358 Ga0068871_100012500 Ga0068871_1000125005 325
558 3300006358 Ga0068871_100025352 Ga0068871_1000253524 325
559 3300006844 Ga0075428_100035558 Ga0075428_1000355581 325
560 3300006844 Ga0075428_100174934 Ga0075428_1001749344 325
561 3300006846 Ga0075430_100004696 Ga0075430_1000046961 325
562 3300006847 Ga0075431_100006639 Ga0075431_1000066391 325
563 3300006852 Ga0075433_10001599 Ga0075433_1000159911 325
564 3300006852 Ga0075433_10403539 Ga0075433_104035392 325
565 3300006871 Ga0075434_100000576 Ga0075434_10000057618 325
566 3300006871 Ga0075434_100001666 Ga0075434_10000166611 325
567 3300006871 Ga0075434_100073539 Ga0075434_1000735395 325
568 3300006871 Ga0075434_100113294 Ga0075434_1001132942 325
569 3300006871 Ga0075434_100208693 Ga0075434_1002086931 325
570 3300006871 Ga0075434_100468579 Ga0075434_1004685791 325
571 3300006880 Ga0075429_100060828 Ga0075429_1000608281 325
572 3300006881 Ga0068865_100005133 Ga0068865_1000051336 325
573 3300006881 Ga0068865_100103925 Ga0068865_1001039252 325
574 3300006914 Ga0075436_100070922 Ga0075436_1000709223 325
575 3300006931 Ga0097620_100030290 Ga0097620_1000302902 325
576 3300006931 Ga0097620_100281806 Ga0097620_1002818063 325
577 3300007076 Ga0075435_100002716 Ga0075435_1000027165 325
578 3300007076 Ga0075435_100009255 Ga0075435_1000092558 325
579 3300007076 Ga0075435_100010036 Ga0075435_1000100366 325
580 3300007076 Ga0075435_100153065 Ga0075435_1001530653 325
581 3300009092 Ga0105250_10017722 Ga0105250_100177223 325
582 3300009093 Ga0105240_10068510 Ga0105240_100685102 325
583 3300009093 Ga0105240_10153475 Ga0105240_101534752 325
584 3300009094 Ga0111539_10000082 Ga0111539_1000008214 325
585 3300009094 Ga0111539_10000503 Ga0111539_1000050333 325
586 3300009094 Ga0111539_10003417 Ga0111539_1000341712 325
587 3300009094 Ga0111539_10217427 Ga0111539_102174272 325
588 3300009098 Ga0105245_10000780 Ga0105245_1000078013 325
589 3300009098 Ga0105245_10091423 Ga0105245_100914233 325
590 3300009098 Ga0105245_10098843 Ga0105245_100988432 325
591 3300009098 Ga0105245_10244517 Ga0105245_102445172 325
592 3300009101 Ga0105247_10002726 Ga0105247_100027266 325
593 3300009101 Ga0105247_10017791 Ga0105247_100177914 325
594 3300009101 Ga0105247_10149201 Ga0105247_101492012 325
595 3300009147 Ga0114129_10009008 Ga0114129_1000900813 325
596 3300009147 Ga0114129_10013874 Ga0114129_1001387411 325
597 3300009147 Ga0114129_10987483 Ga0114129_109874831 325
598 3300009148 Ga0105243_10001083 Ga0105243_1000108314 325
599 3300009148 Ga0105243_10032306 Ga0105243_100323065 325
600 3300009148 Ga0105243_10033088 Ga0105243_100330884 325
601 3300009174 Ga0105241_10000760 Ga0105241_1000076013 325
602 3300009174 Ga0105241_10083372 Ga0105241_100833724 325
603 3300009174 Ga0105241_10095627 Ga0105241_100956273 325
604 3300009176 Ga0105242_10004818 Ga0105242_1000481813 325
605 3300009176 Ga0105242_10019812 Ga0105242_100198126 325
606 3300009176 Ga0105242_10043456 Ga0105242_100434562 325
607 3300009177 Ga0105248_10011305 Ga0105248_100113053 325
608 3300009177 Ga0105248_10031416 Ga0105248_100314164 325
609 3300009177 Ga0105248_10043099 Ga0105248_100430992 325
610 3300009177 Ga0105248_10076338 Ga0105248_100763385 325
611 3300009177 Ga0105248_10333411 Ga0105248_103334112 325
612 3300009545 Ga0105237_10006171 Ga0105237_1000617112 325
613 3300009545 Ga0105237_10024205 Ga0105237_100242054 325
614 3300009551 Ga0105238_10013907 Ga0105238_100139074 325
615 3300009553 Ga0105249_10002196 Ga0105249_100021968 325
616 3300009553 Ga0105249_10448538 Ga0105249_104485382 325
617 3300010375 Ga0105239_10002791 Ga0105239_1000279112 325
618 3300010375 Ga0105239_10049106 Ga0105239_100491065 325
619 3300010375 Ga0105239_10228125 Ga0105239_102281252 325
620 3300011119 Ga0105246_10001585 Ga0105246_1000158514 325
621 3300011119 Ga0105246_10270441 Ga0105246_102704412 325
622 3300011119 Ga0105246_10404033 Ga0105246_104040331 325
623 3300012494 Ga0157341_1001083 Ga0157341_10010832 325
624 3300012515 Ga0157338_1000167 Ga0157338_10001674 325
625 3300013100 Ga0157373_10006240 Ga0157373_100062406 325
626 3300013102 Ga0157371_10155413 Ga0157371_101554133 325
627 3300013104 Ga0157370_10030489 Ga0157370_100304892 325
628 3300013104 Ga0157370_10208804 Ga0157370_102088042 325
629 3300013105 Ga0157369_10160600 Ga0157369_101606002 325
630 3300013296 Ga0157374_10001691 Ga0157374_1000169114 325
631 3300013296 Ga0157374_10398584 Ga0157374_103985842 325
632 3300013297 Ga0157378_10001445 Ga0157378_1000144513 325
633 3300013297 Ga0157378_10049325 Ga0157378_100493254 325
634 3300013297 Ga0157378_10052925 Ga0157378_100529254 325
635 3300013297 Ga0157378_10510714 Ga0157378_105107141 325
636 3300013306 Ga0163162_10000790 Ga0163162_1000079013 325
637 3300013307 Ga0157372_10009037 Ga0157372_100090378 325
638 3300013307 Ga0157372_10419820 Ga0157372_104198203 325
639 3300013308 Ga0157375_10000468 Ga0157375_1000046824 325
640 3300013308 Ga0157375_10048514 Ga0157375_100485144 325
641 3300013308 Ga0157375_10182541 Ga0157375_101825413 325
642 3300014325 Ga0163163_10003322 Ga0163163_1000332217 325
643 3300014325 Ga0163163_10020189 Ga0163163_100201896 325
644 3300014325 Ga0163163_10061676 Ga0163163_100616764 325
645 3300014325 Ga0163163_10111016 Ga0163163_101110163 325
646 3300014325 Ga0163163_10398212 Ga0163163_103982122 325
647 3300014326 Ga0157380_10002913 Ga0157380_1000291310 325
648 3300014326 Ga0157380_10043495 Ga0157380_100434952 325
649 3300014745 Ga0157377_10000276 Ga0157377_1000027614 325
650 3300014745 Ga0157377_10038382 Ga0157377_100383823 325
651 3300014968 Ga0157379_10002285 Ga0157379_1000228510 325
652 3300014968 Ga0157379_10031389 Ga0157379_100313894 325
653 3300014969 Ga0157376_10000692 Ga0157376_100006923 325
654 3300014969 Ga0157376_10042226 Ga0157376_100422264 325
655 3300017792 Ga0163161_10000384 Ga0163161_1000038413 325
656 3300017792 Ga0163161_10039131 Ga0163161_100391312 325
657 3300017792 Ga0163161_10047076 Ga0163161_100470762 325
658 3300021361 Ga0213872_10022015 Ga0213872_100220152 325
659 3300021384 Ga0213876_10012755 Ga0213876_100127553 325
660 3300024225 Ga0224572_1010337 Ga0224572_10103372 325
661 3300025271 Ga0207666_1000097 Ga0207666_100009713 325
662 3300025290 Ga0207673_1000201 Ga0207673_10002016 325
663 3300025297 Ga0209758_1000638 Ga0209758_100063829 325
664 3300025297 Ga0209758_1030349 Ga0209758_10303492 325
665 3300025302 Ga0207426_1034655 Ga0207426_10346552 325
666 3300025315 Ga0207697_10000550 Ga0207697_1000055013 325
667 3300025321 Ga0207656_10104678 Ga0207656_101046781 325
668 3300025893 Ga0207682_10000088 Ga0207682_1000008814 325
669 3300025893 Ga0207682_10081589 Ga0207682_100815892 325
670 3300025898 Ga0207692_10000876 Ga0207692_100008769 325
671 3300025898 Ga0207692_10001966 Ga0207692_100019664 325
672 3300025899 Ga0207642_10000381 Ga0207642_1000038114 325
673 3300025899 Ga0207642_10020631 Ga0207642_100206312 325
674 3300025900 Ga0207710_10001324 Ga0207710_100013246 325
675 3300025900 Ga0207710_10001609 Ga0207710_100016096 325
676 3300025900 Ga0207710_10006390 Ga0207710_100063905 325
677 3300025901 Ga0207688_10001203 Ga0207688_100012034 325
678 3300025901 Ga0207688_10002655 Ga0207688_100026558 325
679 3300025901 Ga0207688_10059462 Ga0207688_100594623 325
680 3300025903 Ga0207680_10009047 Ga0207680_100090474 325
681 3300025903 Ga0207680_10132841 Ga0207680_101328412 325
682 3300025903 Ga0207680_10148619 Ga0207680_101486191 325
683 3300025904 Ga0207647_10002714 Ga0207647_100027144 325
684 3300025904 Ga0207647_10019352 Ga0207647_100193524 325
685 3300025904 Ga0207647_10075399 Ga0207647_100753993 325
686 3300025905 Ga0207685_10154206 Ga0207685_101542061 325
687 3300025906 Ga0207699_10002088 Ga0207699_100020889 325
688 3300025907 Ga0207645_10000140 Ga0207645_100001404 325
689 3300025907 Ga0207645_10034330 Ga0207645_100343302 325
690 3300025907 Ga0207645_10035558 Ga0207645_100355584 325
691 3300025907 Ga0207645_10059966 Ga0207645_100599661 325
692 3300025908 Ga0207643_10000083 Ga0207643_100000834 325
693 3300025908 Ga0207643_10001883 Ga0207643_100018838 325
694 3300025909 Ga0207705_10098196 Ga0207705_100981962 325
695 3300025910 Ga0207684_10075371 Ga0207684_100753712 325
696 3300025910 Ga0207684_10173160 Ga0207684_101731602 325
697 3300025911 Ga0207654_10002699 Ga0207654_100026998 325
698 3300025912 Ga0207707_10020854 Ga0207707_100208546 325
699 3300025912 Ga0207707_10160248 Ga0207707_101602481 325
700 3300025912 Ga0207707_10220579 Ga0207707_102205792 325
701 3300025913 Ga0207695_10167547 Ga0207695_101675472 325
702 3300025913 Ga0207695_10371047 Ga0207695_103710472 325
703 3300025913 Ga0207695_10416759 Ga0207695_104167592 325
704 3300025914 Ga0207671_10004533 Ga0207671_100045336 325
705 3300025915 Ga0207693_10007304 Ga0207693_100073048 325
706 3300025915 Ga0207693_10009632 Ga0207693_100096325 325
707 3300025915 Ga0207693_10015829 Ga0207693_100158295 325
708 3300025915 Ga0207693_10021626 Ga0207693_100216262 325
709 3300025915 Ga0207693_10078050 Ga0207693_100780501 325
710 3300025916 Ga0207663_10021132 Ga0207663_100211323 325
711 3300025916 Ga0207663_10029176 Ga0207663_100291762 325
712 3300025917 Ga0207660_10000073 Ga0207660_1000007320 325
713 3300025917 Ga0207660_10101848 Ga0207660_101018482 325
714 3300025918 Ga0207662_10000964 Ga0207662_1000096413 325
715 3300025918 Ga0207662_10001013 Ga0207662_100010136 325
716 3300025918 Ga0207662_10019591 Ga0207662_100195914 325
717 3300025918 Ga0207662_10199088 Ga0207662_101990881 325
718 3300025919 Ga0207657_10005395 Ga0207657_1000539513 325
719 3300025919 Ga0207657_10020125 Ga0207657_100201257 325
720 3300025919 Ga0207657_10033571 Ga0207657_100335715 325
721 3300025919 Ga0207657_10068436 Ga0207657_100684363 325
722 3300025920 Ga0207649_10000450 Ga0207649_1000045019 325
723 3300025920 Ga0207649_10013956 Ga0207649_100139561 325
724 3300025920 Ga0207649_10020627 Ga0207649_100206271 325
725 3300025921 Ga0207652_10008726 Ga0207652_100087266 325
726 3300025921 Ga0207652_10341105 Ga0207652_103411052 325
727 3300025923 Ga0207681_10000097 Ga0207681_1000009732 325
728 3300025924 Ga0207694_10024241 Ga0207694_100242414 325
729 3300025925 Ga0207650_10002648 Ga0207650_100026482 325
730 3300025925 Ga0207650_10020241 Ga0207650_100202413 325
731 3300025925 Ga0207650_10042894 Ga0207650_100428944 325
732 3300025926 Ga0207659_10000092 Ga0207659_1000009246 325
733 3300025926 Ga0207659_10006748 Ga0207659_100067487 325
734 3300025926 Ga0207659_10020865 Ga0207659_100208654 325
735 3300025927 Ga0207687_10000219 Ga0207687_100002195 325
736 3300025927 Ga0207687_10029871 Ga0207687_100298714 325
737 3300025927 Ga0207687_10219639 Ga0207687_102196391 325
738 3300025928 Ga0207700_10002485 Ga0207700_100024857 325
739 3300025929 Ga0207664_10005574 Ga0207664_100055744 325
740 3300025931 Ga0207644_10021419 Ga0207644_100214192 325
741 3300025931 Ga0207644_10091736 Ga0207644_100917362 325
742 3300025931 Ga0207644_10119158 Ga0207644_101191582 325
743 3300025932 Ga0207690_10003312 Ga0207690_100033125 325
744 3300025932 Ga0207690_10104156 Ga0207690_101041562 325
745 3300025933 Ga0207706_10004310 Ga0207706_100043104 325
746 3300025933 Ga0207706_10005901 Ga0207706_100059013 325
747 3300025933 Ga0207706_10008823 Ga0207706_100088234 325
748 3300025933 Ga0207706_10035694 Ga0207706_100356941 325
749 3300025933 Ga0207706_10285828 Ga0207706_102858282 325
750 3300025933 Ga0207706_10306745 Ga0207706_103067451 325
751 3300025934 Ga0207686_10000796 Ga0207686_100007965 325
752 3300025934 Ga0207686_10007990 Ga0207686_100079903 325
753 3300025934 Ga0207686_10219760 Ga0207686_102197602 325
754 3300025935 Ga0207709_10000362 Ga0207709_1000036230 325
755 3300025935 Ga0207709_10222423 Ga0207709_102224232 325
756 3300025936 Ga0207670_10002375 Ga0207670_100023758 325
757 3300025936 Ga0207670_10061867 Ga0207670_100618673 325
758 3300025936 Ga0207670_10097107 Ga0207670_100971073 325
759 3300025936 Ga0207670_10361239 Ga0207670_103612391 325
760 3300025937 Ga0207669_10000350 Ga0207669_1000035011 325
761 3300025937 Ga0207669_10014842 Ga0207669_100148422 325
762 3300025937 Ga0207669_10132331 Ga0207669_101323312 325
763 3300025938 Ga0207704_10000479 Ga0207704_1000047910 325
764 3300025938 Ga0207704_10012862 Ga0207704_100128624 325
765 3300025939 Ga0207665_10001702 Ga0207665_1000170210 325
766 3300025939 Ga0207665_10025177 Ga0207665_100251775 325
767 3300025939 Ga0207665_10144615 Ga0207665_101446152 325
768 3300025940 Ga0207691_10000283 Ga0207691_1000028346 325
769 3300025940 Ga0207691_10040853 Ga0207691_100408534 325
770 3300025940 Ga0207691_10070775 Ga0207691_100707753 325
771 3300025940 Ga0207691_10097671 Ga0207691_100976712 325
772 3300025941 Ga0207711_10009170 Ga0207711_100091705 325
773 3300025941 Ga0207711_10076028 Ga0207711_100760283 325
774 3300025941 Ga0207711_10087463 Ga0207711_100874633 325
775 3300025941 Ga0207711_10102644 Ga0207711_101026442 325
776 3300025941 Ga0207711_10221806 Ga0207711_102218062 325
777 3300025942 Ga0207689_10000085 Ga0207689_1000008564 325
778 3300025942 Ga0207689_10002370 Ga0207689_100023706 325
779 3300025942 Ga0207689_10044422 Ga0207689_100444222 325
780 3300025944 Ga0207661_10000464 Ga0207661_1000046414 325
781 3300025944 Ga0207661_10009753 Ga0207661_100097537 325
782 3300025945 Ga0207679_10000030 Ga0207679_10000030153 325
783 3300025945 Ga0207679_10006772 Ga0207679_100067725 325
784 3300025949 Ga0207667_10028631 Ga0207667_100286317 325
785 3300025949 Ga0207667_10047002 Ga0207667_100470022 325
786 3300025949 Ga0207667_10077756 Ga0207667_100777564 325
787 3300025949 Ga0207667_10105591 Ga0207667_101055913 325
788 3300025960 Ga0207651_10000422 Ga0207651_100004226 325
789 3300025960 Ga0207651_10032933 Ga0207651_100329332 325
790 3300025961 Ga0207712_10004682 Ga0207712_100046826 325
791 3300025961 Ga0207712_10026073 Ga0207712_100260732 325
792 3300025972 Ga0207668_10000114 Ga0207668_1000011446 325
793 3300025972 Ga0207668_10108475 Ga0207668_101084752 325
794 3300025981 Ga0207640_10000141 Ga0207640_1000014151 325
795 3300025986 Ga0207658_10007681 Ga0207658_100076813 325
796 3300025986 Ga0207658_10024116 Ga0207658_100241162 325
797 3300025986 Ga0207658_10261028 Ga0207658_102610282 325
798 3300026023 Ga0207677_10001776 Ga0207677_100017765 325
799 3300026023 Ga0207677_10013991 Ga0207677_100139915 325
800 3300026023 Ga0207677_10201482 Ga0207677_102014821 325
801 3300026035 Ga0207703_10000983 Ga0207703_100009837 325
802 3300026035 Ga0207703_10010486 Ga0207703_100104862 325
803 3300026035 Ga0207703_10331244 Ga0207703_103312442 325
804 3300026041 Ga0207639_10000305 Ga0207639_1000030519 325
805 3300026041 Ga0207639_10325978 Ga0207639_103259783 325
806 3300026067 Ga0207678_10000125 Ga0207678_1000012553 325
807 3300026067 Ga0207678_10026095 Ga0207678_100260955 325
808 3300026067 Ga0207678_10118507 Ga0207678_101185073 325
809 3300026067 Ga0207678_10121814 Ga0207678_101218142 325
810 3300026075 Ga0207708_10000187 Ga0207708_1000018712 325
811 3300026075 Ga0207708_10000256 Ga0207708_1000025629 325
812 3300026075 Ga0207708_10014918 Ga0207708_100149187 325
813 3300026075 Ga0207708_10140412 Ga0207708_101404123 325
814 3300026075 Ga0207708_10204175 Ga0207708_102041752 325
815 3300026078 Ga0207702_10005437 Ga0207702_1000543710 325
816 3300026078 Ga0207702_10025565 Ga0207702_100255651 325
817 3300026078 Ga0207702_10128627 Ga0207702_101286274 325
818 3300026088 Ga0207641_10003649 Ga0207641_1000364914 325
819 3300026088 Ga0207641_10055119 Ga0207641_100551195 325
820 3300026089 Ga0207648_10002168 Ga0207648_1000216814 325
821 3300026089 Ga0207648_10004949 Ga0207648_100049496 325
822 3300026089 Ga0207648_10304255 Ga0207648_103042551 325
823 3300026089 Ga0207648_10383293 Ga0207648_103832931 325
824 3300026095 Ga0207676_10000074 Ga0207676_1000007413 325
825 3300026095 Ga0207676_10007288 Ga0207676_100072882 325
826 3300026095 Ga0207676_10019580 Ga0207676_100195806 325
827 3300026095 Ga0207676_10513292 Ga0207676_105132921 325
828 3300026116 Ga0207674_10002501 Ga0207674_1000250112 325
829 3300026118 Ga0207675_100002373 Ga0207675_10000237311 325
830 3300026118 Ga0207675_100004556 Ga0207675_10000455613 325
831 3300026118 Ga0207675_100109415 Ga0207675_1001094154 325
832 3300026121 Ga0207683_10000014 Ga0207683_1000001446 325
833 3300026121 Ga0207683_10003999 Ga0207683_100039998 325
834 3300026121 Ga0207683_10005254 Ga0207683_100052547 325
835 3300026121 Ga0207683_10009094 Ga0207683_100090949 325
836 3300026121 Ga0207683_10045519 Ga0207683_100455194 325
837 3300026142 Ga0207698_10001242 Ga0207698_1000124210 325
838 3300026142 Ga0207698_10054980 Ga0207698_100549803 325
839 3300026142 Ga0207698_10070852 Ga0207698_100708523 325
840 3300026142 Ga0207698_10230441 Ga0207698_102304412 325
841 3300026142 Ga0207698_10324819 Ga0207698_103248192 325
842 3300027543 Ga0209999_1007609 Ga0209999_10076093 325
843 3300027617 Ga0210002_1003004 Ga0210002_10030044 325
844 3300027671 Ga0209588_1025585 Ga0209588_10255852 325
845 3300027682 Ga0209971_1016252 Ga0209971_10162522 325
846 3300027695 Ga0209966_1004843 Ga0209966_10048433 325
847 3300027695 Ga0209966_1006091 Ga0209966_10060912 325
848 3300027717 Ga0209998_10000361 Ga0209998_1000036113 325
849 3300027717 Ga0209998_10001516 Ga0209998_100015166 325
850 3300027876 Ga0209974_10012895 Ga0209974_100128952 325
851 3300027876 Ga0209974_10050653 Ga0209974_100506532 325
852 3300027907 Ga0207428_10000114 Ga0207428_1000011469 325
853 3300027907 Ga0207428_10000467 Ga0207428_1000046735 325
854 3300027907 Ga0207428_10011322 Ga0207428_100113226 325
855 3300028380 Ga0268265_10009966 Ga0268265_100099664 325
856 3300028380 Ga0268265_10129476 Ga0268265_101294761 325
857 3300028381 Ga0268264_10000469 Ga0268264_1000046912 325
858 3300028381 Ga0268264_10102270 Ga0268264_101022703 325
859 3300028556 Ga0265337_1001464 Ga0265337_10014643 325
860 3300028800 Ga0265338_10068822 Ga0265338_100688224 325
861 3300030763 Ga0265763_1000156 Ga0265763_10001562 325
862 3300031090 Ga0265760_10055801 Ga0265760_100558011 325
863 3300031238 Ga0265332_10000801 Ga0265332_1000080116 325
864 3300031241 Ga0265325_10000423 Ga0265325_1000042325 325
865 3300031241 Ga0265325_10025904 Ga0265325_100259042 325
866 3300031241 Ga0265325_10077594 Ga0265325_100775942 325
867 3300031242 Ga0265329_10046196 Ga0265329_100461962 325
868 3300031249 Ga0265339_10001378 Ga0265339_100013788 325
869 3300031249 Ga0265339_10003373 Ga0265339_100033735 325
870 3300031250 Ga0265331_10016240 Ga0265331_100162401 325
871 3300031250 Ga0265331_10025748 Ga0265331_100257482 325
872 3300031344 Ga0265316_10048508 Ga0265316_100485082 325
873 3300031595 Ga0265313_10000115 Ga0265313_1000011545 325
874 3300031595 Ga0265313_10002944 Ga0265313_100029449 325
875 3300031595 Ga0265313_10034290 Ga0265313_100342902 325
876 3300031711 Ga0265314_10005122 Ga0265314_100051223 325
877 3300031711 Ga0265314_10120472 Ga0265314_101204722 325
878 3300031712 Ga0265342_10000011 Ga0265342_100000119 325
879 3300031712 Ga0265342_10000763 Ga0265342_1000076334 325
880 3300031852 Ga0307410_10160269 Ga0307410_101602692 325
881 3300032133 Ga0316583_10005398 Ga0316583_100053985 325
882 3300034816 Ga0373930_0000150 Ga0373930_0000150_3714_4691 325
883 3300034816 Ga0373930_0001117 Ga0373930_0001117_324_1301 325
884 3300034817 Ga0373948_0000307 Ga0373948_0000307_4901_5878 325
885 3300034817 Ga0373948_0002698 Ga0373948_0002698_1288_2265 325
886 3300034820 Ga0373959_0001657 Ga0373959_0001657_1344_2321 325
887 3300034957 Ga0373938_0010297 Ga0373938_0010297_47_1024 325
888 3300035083 Ga0373926_0027180 Ga0373926_0027180_188_1165 325
889 3300035084 Ga0373928_0000222 Ga0373928_0000222_7546_8523 325
890 3300035085 Ga0373929_0002112 Ga0373929_0002112_1764_2741 325
891 3300035086 Ga0373934_0005831 Ga0373934_0005831_382_1359 325
892 3300035089 Ga0373944_0001828 Ga0373944_0001828_2487_3464 325
893 3300035090 Ga0373949_0001450 Ga0373949_0001450_5146_6123 325
894 3300035091 Ga0373951_0000721 Ga0373951_0000721_630_1607 325
895 3300035091 Ga0373951_0001245 Ga0373951_0001245_5415_6392 325
896 3300035091 Ga0373951_0011607 Ga0373951_0011607_982_1959 325
897 3300035092 Ga0373952_0000029 Ga0373952_0000029_2072_3049 325
898 3300035092 Ga0373952_0000148 Ga0373952_0000148_8993_9970 325
899 3300035092 Ga0373952_0011726 Ga0373952_0011726_205_1182 325
900 3300035092 Ga0373952_0017850 Ga0373952_0017850_31_1008 325
901 3300035112 Ga0373932_0001251 Ga0373932_0001251_3808_4785 325
902 3300035112 Ga0373932_0004135 Ga0373932_0004135_2330_3307 325
903 3300035113 Ga0373936_0006326 Ga0373936_0006326_1897_2874 325
904 3300035114 Ga0373939_0000339 Ga0373939_0000339_1641_2618 325
905 3300035114 Ga0373939_0002855 Ga0373939_0002855_1799_2776 325
906 3300035115 Ga0373941_0000835 Ga0373941_0000835_4823_5800 325
907 3300035115 Ga0373941_0002285 Ga0373941_0002285_2235_3212 325
908 3300035115 Ga0373941_0036460 Ga0373941_0036460_421_1398 325
909 3300035116 Ga0373945_0089477 Ga0373945_0089477_203_1180 325
910 3300035117 Ga0373953_0019732 Ga0373953_0019732_738_1715 325
911 3300035117 Ga0373953_0023666 Ga0373953_0023666_507_1484 325
912 3300035118 Ga0373954_0024463 Ga0373954_0024463_566_1543 325
913 3300035118 Ga0373954_0024781 Ga0373954_0024781_1563_2540 325
914 3300035119 Ga0373956_0045734 Ga0373956_0045734_330_1307 325
915 3300035121 Ga0373960_0000372 Ga0373960_0000372_3046_4023 325
916 3300035121 Ga0373960_0025992 Ga0373960_0025992_135_1112 325
917 3300035121 Ga0373960_0064146 Ga0373960_0064146_98_1075 325
918 3300035170 Ga0373943_0016793 Ga0373943_0016793_618_1595 325
919 3300035170 Ga0373943_0209439 Ga0373943_0209439_77_1054 325
920 3300035171 Ga0373946_0006340 Ga0373946_0006340_1854_2831 325
921 3300035171 Ga0373946_0009821 Ga0373946_0009821_373_1350 325
922 3300035171 Ga0373946_0041237 Ga0373946_0041237_298_1275 325
923 3300035172 Ga0373955_0001269 Ga0373955_0001269_7101_8078 325
924 3300035172 Ga0373955_0001523 Ga0373955_0001523_2245_3222 325
925 3300035172 Ga0373955_0004969 Ga0373955_0004969_3105_4082 325
926 3300035172 Ga0373955_0043425 Ga0373955_0043425_959_1936 325
927 3300035207 Ga0373942_0000767 Ga0373942_0000767_4632_5609 325
928 3300035241 Ga0373961_0001835 Ga0373961_0001835_689_1666 325
929 3300035241 Ga0373961_0003896 Ga0373961_0003896_2131_3108 325
930 3300035241 Ga0373961_0019391 Ga0373961_0019391_725_1702 325
931 3300035241 Ga0373961_0054588 Ga0373961_0054588_43_1020 325
932 3300035242 Ga0373962_0005133 Ga0373962_0005133_1426_2403 325
933 3300035242 Ga0373962_0005930 Ga0373962_0005930_304_1281 325
934 3300035242 Ga0373962_0006682 Ga0373962_0006682_1248_2225 325
935 3300035691 Ga0373931_0000169 Ga0373931_0000169_18939_19916 325
936 3300035691 Ga0373931_0006379 Ga0373931_0006379_3851_4828 325
937 3300035691 Ga0373931_0088502 Ga0373931_0088502_107_1084 325
938 3300035692 Ga0373935_0020667 Ga0373935_0020667_1486_2463 325
939 3300035692 Ga0373935_0057410 Ga0373935_0057410_855_1832 325
940 3300035695 Ga0373927_0016232 Ga0373927_0016232_969_1946 325
941 3300035695 Ga0373927_0050616 Ga0373927_0050616_970_1947 325
942 3300035695 Ga0373927_0210555 Ga0373927_0210555_21_998 325
943 3300035724 Ga0373933_0005311 Ga0373933_0005311_5469_6446 325
944 3300035724 Ga0373933_0017906 Ga0373933_0017906_1018_1995 325
945 3300035725 Ga0373947_0007521 Ga0373947_0007521_5204_6181 325
946 3300036401 Ga0373937_0001052 Ga0373937_0001052_12417_13394 325
947 3300036401 Ga0373937_0038298 Ga0373937_0038298_2674_3651 325
948 3300036401 Ga0373937_0049021 Ga0373937_0049021_2238_3215 325
949 3300036401 Ga0373937_0055079 Ga0373937_0055079_837_1814 325
950 3300036401 Ga0373937_0110823 Ga0373937_0110823_858_1835 325
951 3300036401 Ga0373937_0537414 Ga0373937_0537414_55_1032 325
952 3300037068 Ga0373925_0022589 Ga0373925_0022589_603_1580 325
953 3300037312 Ga0395899_0158714 Ga0395899_0158714_229_1206 325
954 3300037418 Ga0395900_0005265 Ga0395900_0005265_11803_12813 325
955 3300037418 Ga0395900_0006751 Ga0395900_0006751_317_1342 325
956 3300037466 Ga0395898_0014510 Ga0395898_0014510_2605_3615 325
957 3300037466 Ga0395898_0022478 Ga0395898_0022478_2512_3537 325
958 3300037466 Ga0395898_0319420 Ga0395898_0319420_211_1188 325
959 3300038443 Ga0395901_0111106 Ga0395901_0111106_34_1059 325
960 3300039437 Ga0436365_0193033 Ga0436365_0193033_4256_5233 325
961 3300039447 Ga0436361_0425913 Ga0436361_0425913_720_1697 325
962 3300042008 Ga0439450_008705 Ga0439450_008705_141_1118 325
963 3300044712 Ga0453684_0037028 Ga0453684_0037028_3476_4453 325
964 3300046454 Ga0495592_0024186 Ga0495592_0024186_2183_3160 325
965 3300046454 Ga0495592_0032431 Ga0495592_0032431_2945_3922 325
966 3300046454 Ga0495592_0040848 Ga0495592_0040848_972_1949 325
967 3300046454 Ga0495592_0131419 Ga0495592_0131419_497_1474 325
968 3300046455 Ga0495603_0008030 Ga0495603_0008030_238_1215 325
969 3300046459 Ga0495629_0000535 Ga0495629_0000535_15226_16203 325
970 3300046459 Ga0495629_0081599 Ga0495629_0081599_906_1883 325
971 3300046459 Ga0495629_0107782 Ga0495629_0107782_372_1349 325
972 3300046460 Ga0495638_0102310 Ga0495638_0102310_569_1546 325
973 3300046461 Ga0495641_0019259 Ga0495641_0019259_1079_2056 325
974 3300046462 Ga0495651_0000606 Ga0495651_0000606_13435_14412 325
975 3300046462 Ga0495651_0011021 Ga0495651_0011021_3863_4840 325
976 3300046462 Ga0495651_0011844 Ga0495651_0011844_4633_5610 325
977 3300046462 Ga0495651_0020645 Ga0495651_0020645_1064_2041 325
978 3300046462 Ga0495651_0113072 Ga0495651_0113072_769_1746 325
979 3300046463 Ga0495653_0002673 Ga0495653_0002673_9563_10540 325
980 3300046463 Ga0495653_0012564 Ga0495653_0012564_3189_4166 325
981 3300046463 Ga0495653_0093751 Ga0495653_0093751_1007_1984 325
982 3300046472 Ga0495580_0023721 Ga0495580_0023721_2584_3561 325
983 3300046473 Ga0495582_0039312 Ga0495582_0039312_562_1539 325
984 3300046473 Ga0495582_0074369 Ga0495582_0074369_716_1693 325
985 3300046476 Ga0495662_0010283 Ga0495662_0010283_1895_2872 325
986 3300046476 Ga0495662_0066440 Ga0495662_0066440_235_1212 325
987 3300046477 Ga0495664_0027493 Ga0495664_0027493_1879_2856 325
988 3300046477 Ga0495664_0033931 Ga0495664_0033931_1774_2751 325
989 3300046491 Ga0495584_0097244 Ga0495584_0097244_468_1445 325
990 3300046492 Ga0495585_0008366 Ga0495585_0008366_3114_4091 325
991 3300046499 Ga0495594_0043598 Ga0495594_0043598_1381_2358 325
992 3300046501 Ga0495607_0048620 Ga0495607_0048620_333_1310 325
993 3300046511 Ga0495608_0000591 Ga0495608_0000591_13181_14158 325
994 3300046511 Ga0495608_0001474 Ga0495608_0001474_160_1137 325
995 3300046511 Ga0495608_0039849 Ga0495608_0039849_1736_2713 325
996 3300046511 Ga0495608_0055452 Ga0495608_0055452_1164_2141 325
997 3300046514 Ga0495618_0001466 Ga0495618_0001466_7003_7980 325
998 3300046514 Ga0495618_0004984 Ga0495618_0004984_4336_5313 325
999 3300046514 Ga0495618_0132206 Ga0495618_0132206_334_1311 325
1000 3300046516 Ga0495628_0001927 Ga0495628_0001927_6957_7934 325
1001 3300046516 Ga0495628_0023873 Ga0495628_0023873_481_1458 325
1002 3300046516 Ga0495628_0144414 Ga0495628_0144414_793_1770 325
1003 3300046516 Ga0495628_0221416 Ga0495628_0221416_17_994 325
1004 3300046517 Ga0495630_0081198 Ga0495630_0081198_1201_2178 325
1005 3300046517 Ga0495630_0176249 Ga0495630_0176249_182_1159 325
1006 3300046523 Ga0495644_0002701 Ga0495644_0002701_3122_4099 325
1007 3300046526 Ga0495666_0012992 Ga0495666_0012992_645_1622 325
1008 3300046526 Ga0495666_0123226 Ga0495666_0123226_95_1072 325
1009 3300046529 Ga0495652_0003497 Ga0495652_0003497_10000_10977 325
1010 3300046529 Ga0495652_0022449 Ga0495652_0022449_4338_5315 325
1011 3300046529 Ga0495652_0048857 Ga0495652_0048857_1351_2451 325
1012 3300046529 Ga0495652_0121480 Ga0495652_0121480_732_1709 325
1013 3300046531 Ga0495665_0023481 Ga0495665_0023481_857_1834 325
1014 3300046533 Ga0495640_0002454 Ga0495640_0002454_8432_9409 325
1015 3300046533 Ga0495640_0054384 Ga0495640_0054384_1158_2135 325
1016 3300046533 Ga0495640_0056745 Ga0495640_0056745_1252_2229 325
1017 3300046535 Ga0495586_0036479 Ga0495586_0036479_933_1910 325
1018 3300046536 Ga0495587_0002240 Ga0495587_0002240_10287_11264 325
1019 3300046536 Ga0495587_0011870 Ga0495587_0011870_984_1961 325
1020 3300046536 Ga0495587_0027093 Ga0495587_0027093_1548_2525 325
1021 3300046536 Ga0495587_0047875 Ga0495587_0047875_594_1571 325
1022 3300046543 Ga0495645_0002539 Ga0495645_0002539_9915_10892 325
1023 3300046543 Ga0495645_0019854 Ga0495645_0019854_17_994 325
1024 3300046543 Ga0495645_0056174 Ga0495645_0056174_1131_2108 325
1025 3300046543 Ga0495645_0100340 Ga0495645_0100340_26_1003 325
1026 3300046557 Ga0495622_0015565 Ga0495622_0015565_444_1421 325
1027 3300046558 Ga0495633_0002969 Ga0495633_0002969_8613_9590 325
1028 3300046559 Ga0495667_0005199 Ga0495667_0005199_5496_6473 325
1029 3300046559 Ga0495667_0026523 Ga0495667_0026523_1279_2256 325
1030 3300046559 Ga0495667_0088464 Ga0495667_0088464_520_1497 325
1031 3300046615 Ga0495656_0002822 Ga0495656_0002822_3050_4027 325
1032 3300046615 Ga0495656_0004061 Ga0495656_0004061_2194_3171 325
1033 3300046642 Ga0495634_0002842 Ga0495634_0002842_13223_14200 325
1034 3300046663 Ga0495635_0003751 Ga0495635_0003751_1076_2053 325
1035 3300046663 Ga0495635_0003881 Ga0495635_0003881_713_1690 325
1036 3300046663 Ga0495635_0021401 Ga0495635_0021401_3244_4221 325
1037 3300046663 Ga0495635_0287356 Ga0495635_0287356_41_1018 325
1038 3300046665 Ga0495661_0044928 Ga0495661_0044928_1361_2338 325
1039 3300046674 Ga0495588_0045221 Ga0495588_0045221_226_1203 325
1040 3300046675 Ga0495657_0003270 Ga0495657_0003270_7721_8698 325
1041 3300046675 Ga0495657_0010946 Ga0495657_0010946_1379_2356 325
1042 3300046678 Ga0495599_0000564 Ga0495599_0000564_9423_10400 325
1043 3300046678 Ga0495599_0004481 Ga0495599_0004481_2119_3096 325
1044 3300046678 Ga0495599_0017530 Ga0495599_0017530_554_1531 325
1045 3300046678 Ga0495599_0073266 Ga0495599_0073266_422_1399 325
1046 3300046679 Ga0495623_0007330 Ga0495623_0007330_1664_2641 325
1047 3300046680 Ga0495646_0020687 Ga0495646_0020687_1697_2674 325
1048 3300046680 Ga0495646_0054563 Ga0495646_0054563_377_1354 325
1049 3300046680 Ga0495646_0058838 Ga0495646_0058838_648_1625 325
1050 3300046681 Ga0495647_0024629 Ga0495647_0024629_64_1041 325
1051 3300046681 Ga0495647_0045345 Ga0495647_0045345_62_1039 325
1052 3300046681 Ga0495647_0045645 Ga0495647_0045645_548_1525 325
1053 3300046683 Ga0495658_0000788 Ga0495658_0000788_3469_4446 325
1054 3300046683 Ga0495658_0006062 Ga0495658_0006062_2010_2987 325
1055 3300046683 Ga0495658_0009215 Ga0495658_0009215_3445_4422 325
1056 3300046689 Ga0495613_0024361 Ga0495613_0024361_2954_3931 325
1057 3300046689 Ga0495613_0072271 Ga0495613_0072271_12_989 325
1058 3300046689 Ga0495613_0213481 Ga0495613_0213481_285_1262 325
1059 3300046690 Ga0495624_0016249 Ga0495624_0016249_260_1237 325
1060 3300046691 Ga0495670_0000291 Ga0495670_0000291_14048_15025 325
1061 3300046809 Ga0495600_0001326 Ga0495600_0001326_648_1625 325
1062 3300046809 Ga0495600_0004060 Ga0495600_0004060_6920_7897 325
1063 3300046809 Ga0495600_0011214 Ga0495600_0011214_1159_2136 325
1064 3300046809 Ga0495600_0017893 Ga0495600_0017893_3378_4355 325
1065 3300046809 Ga0495600_0137385 Ga0495600_0137385_320_1297 325
1066 3300047315 Ga0495581_0081264 Ga0495581_0081264_788_1765 325
1067 3300047315 Ga0495581_0102123 Ga0495581_0102123_358_1335 325
1068 3300047317 Ga0495604_0003818 Ga0495604_0003818_8397_9374 325
1069 3300047317 Ga0495604_0003891 Ga0495604_0003891_8665_9642 325
1070 3300047317 Ga0495604_0009082 Ga0495604_0009082_2398_3375 325
1071 3300047317 Ga0495604_0015025 Ga0495604_0015025_4003_4980 325
1072 3300047317 Ga0495604_0028398 Ga0495604_0028398_1478_2455 325
1073 3300047317 Ga0495604_0052923 Ga0495604_0052923_1479_2456 325
1074 3300047319 Ga0495674_0015363 Ga0495674_0015363_814_1791 325
1075 3300047319 Ga0495674_0024339 Ga0495674_0024339_4313_5290 325
1076 3300047319 Ga0495674_0027169 Ga0495674_0027169_130_1107 325
1077 3300047319 Ga0495674_0197387 Ga0495674_0197387_599_1576 325
1078 3300047319 Ga0495674_0354222 Ga0495674_0354222_33_1010 325
1079 3300047321 Ga0495676_0021794 Ga0495676_0021794_3464_4441 325
1080 3300047322 Ga0495680_0001686 Ga0495680_0001686_12316_13293 325
1081 3300047322 Ga0495680_0011254 Ga0495680_0011254_5687_6664 325
1082 3300047322 Ga0495680_0012959 Ga0495680_0012959_909_1886 325
1083 3300047322 Ga0495680_0044687 Ga0495680_0044687_1479_2456 325
1084 3300047444 Ga0495675_0001544 Ga0495675_0001544_10827_11804 325
1085 3300047444 Ga0495675_0002669 Ga0495675_0002669_98_1075 325
1086 3300047444 Ga0495675_0120623 Ga0495675_0120623_525_1502 325
1087 3300047471 Ga0495684_0002087 Ga0495684_0002087_8679_9656 325
1088 3300047471 Ga0495684_0003625 Ga0495684_0003625_272_1249 325
1089 3300047471 Ga0495684_0038790 Ga0495684_0038790_439_1416 325
1090 3300047471 Ga0495684_0147563 Ga0495684_0147563_710_1687 325
1091 3300047673 Ga0495593_0004626 Ga0495593_0004626_5688_6665 325
1092 3300047673 Ga0495593_0014724 Ga0495593_0014724_83_1060 325
1093 3300047673 Ga0495593_0047243 Ga0495593_0047243_667_1644 325
1094 3300048088 Ga0495602_0000740 Ga0495602_0000740_24699_25676 325
1095 3300048088 Ga0495602_0005526 Ga0495602_0005526_10922_11899 325
1096 3300048088 Ga0495602_0132217 Ga0495602_0132217_89_1066 325
1097 3300048088 Ga0495602_0144903 Ga0495602_0144903_752_1729 325
1098 3300048089 Ga0495614_0030039 Ga0495614_0030039_1078_2055 325
1099 3300048903 Ga0496100_0000106 Ga0496100_0000106_34922_35899 325
1100 3300048903 Ga0496100_0000499 Ga0496100_0000499_12574_13551 325
1101 3300048903 Ga0496100_0002951 Ga0496100_0002951_2330_3307 325
1102 3300048903 Ga0496100_0003648 Ga0496100_0003648_4059_5036 325
1103 3300048903 Ga0496100_0027659 Ga0496100_0027659_312_1289 325
1104 3300048903 Ga0496100_0256274 Ga0496100_0256274_270_1247 325
1105 3300048904 Ga0496101_0000992 Ga0496101_0000992_8338_9315 325
1106 3300048904 Ga0496101_0002929 Ga0496101_0002929_7851_8828 325
1107 3300048904 Ga0496101_0003940 Ga0496101_0003940_3933_4910 325
1108 3300048904 Ga0496101_0020995 Ga0496101_0020995_1660_2637 325
1109 3300048904 Ga0496101_0023715 Ga0496101_0023715_1524_2501 325
1110 3300048904 Ga0496101_0228639 Ga0496101_0228639_225_1202 325
1111 3300048904 Ga0496101_0279117 Ga0496101_0279117_70_1047 325
1112 3300048905 Ga0496102_0011236 Ga0496102_0011236_3625_4602 325
1113 3300048905 Ga0496102_0019045 Ga0496102_0019045_1994_2971 325
1114 3300048905 Ga0496102_0039093 Ga0496102_0039093_325_1302 325
1115 3300048905 Ga0496102_0372135 Ga0496102_0372135_145_1122 325
1116 3300048906 Ga0496103_0003647 Ga0496103_0003647_745_1722 325
1117 3300048906 Ga0496103_0006368 Ga0496103_0006368_3030_4007 325
1118 3300048906 Ga0496103_0014587 Ga0496103_0014587_215_1192 325
1119 3300048907 Ga0496104_0000090 Ga0496104_0000090_75669_76646 325
1120 3300048907 Ga0496104_0000506 Ga0496104_0000506_26779_27756 325
1121 3300048907 Ga0496104_0005547 Ga0496104_0005547_1049_2026 325
1122 3300048907 Ga0496104_0035462 Ga0496104_0035462_3455_4432 325
1123 3300048907 Ga0496104_0122840 Ga0496104_0122840_1223_2200 325
1124 3300048908 Ga0496105_0001574 Ga0496105_0001574_5001_5978 325
1125 3300048908 Ga0496105_0003533 Ga0496105_0003533_2383_3360 325
1126 3300048908 Ga0496105_0108687 Ga0496105_0108687_983_1960 325
1127 3300048908 Ga0496105_0161028 Ga0496105_0161028_834_1811 325
1128 3300048909 Ga0496106_0002499 Ga0496106_0002499_8566_9543 325
1129 3300048909 Ga0496106_0002626 Ga0496106_0002626_8865_9842 325
1130 3300048909 Ga0496106_0005418 Ga0496106_0005418_4975_5952 325
1131 3300048909 Ga0496106_0012172 Ga0496106_0012172_2776_3753 325
1132 3300048909 Ga0496106_0013964 Ga0496106_0013964_318_1295 325
1133 3300048909 Ga0496106_0019052 Ga0496106_0019052_361_1338 325
1134 3300048909 Ga0496106_0024338 Ga0496106_0024338_3015_3992 325
1135 3300048909 Ga0496106_0173682 Ga0496106_0173682_353_1330 325
1136 3300048910 Ga0496107_0000223 Ga0496107_0000223_8365_9342 325
1137 3300048910 Ga0496107_0015336 Ga0496107_0015336_251_1228 325
1138 3300048910 Ga0496107_0030108 Ga0496107_0030108_1662_2639 325
1139 3300048910 Ga0496107_0034213 Ga0496107_0034213_1073_2050 325
1140 3300048910 Ga0496107_0041516 Ga0496107_0041516_1878_2855 325
1141 3300048910 Ga0496107_0044051 Ga0496107_0044051_1659_2636 325
1142 3300048911 Ga0496108_0003914 Ga0496108_0003914_906_1883 325
1143 3300048911 Ga0496108_0007392 Ga0496108_0007392_7700_8677 325
1144 3300048911 Ga0496108_0024579 Ga0496108_0024579_509_1486 325
1145 3300048912 Ga0496109_0002315 Ga0496109_0002315_14393_15370 325
1146 3300048912 Ga0496109_0014846 Ga0496109_0014846_3071_4048 325
1147 3300048912 Ga0496109_0039401 Ga0496109_0039401_3151_4128 325
1148 3300048912 Ga0496109_0041676 Ga0496109_0041676_3030_4007 325
1149 3300048912 Ga0496109_0052216 Ga0496109_0052216_2166_3143 325
1150 3300048912 Ga0496109_0227777 Ga0496109_0227777_498_1475 325
1151 3300048913 Ga0496110_0003039 Ga0496110_0003039_4178_5155 325
1152 3300048913 Ga0496110_0091854 Ga0496110_0091854_1294_2271 325
1153 3300048913 Ga0496110_0568629 Ga0496110_0568629_35_1012 325
1154 3300048914 Ga0496111_0064475 Ga0496111_0064475_1659_2636 325
1155 3300048915 Ga0496112_0035958 Ga0496112_0035958_2141_3118 325
1156 3300048915 Ga0496112_0075543 Ga0496112_0075543_644_1621 325
1157 3300048915 Ga0496112_0089540 Ga0496112_0089540_584_1561 325
1158 3300048915 Ga0496112_0153498 Ga0496112_0153498_211_1188 325
1159 3300048915 Ga0496112_0283160 Ga0496112_0283160_35_1012 325
1160 3300048915 Ga0496112_0324574 Ga0496112_0324574_50_1027 325
1161 3300048916 Ga0496113_0000068 Ga0496113_0000068_14075_15052 325
1162 3300048916 Ga0496113_0006216 Ga0496113_0006216_4310_5287 325
1163 3300048916 Ga0496113_0010789 Ga0496113_0010789_3836_4813 325
1164 3300048917 Ga0496114_0006516 Ga0496114_0006516_6996_7973 325
1165 3300048917 Ga0496114_0006841 Ga0496114_0006841_7156_8133 325
1166 3300048917 Ga0496114_0010582 Ga0496114_0010582_251_1228 325
1167 3300048918 Ga0496115_0016939 Ga0496115_0016939_1710_2687 325
1168 3300048918 Ga0496115_0017044 Ga0496115_0017044_3287_4264 325
1169 3300048918 Ga0496115_0021146 Ga0496115_0021146_2999_3976 325
1170 3300048918 Ga0496115_0021880 Ga0496115_0021880_1780_2757 325
1171 3300048918 Ga0496115_0070184 Ga0496115_0070184_1214_2191 325
1172 3300048918 Ga0496115_0073152 Ga0496115_0073152_1574_2551 325
1173 3300048918 Ga0496115_0101293 Ga0496115_0101293_1367_2344 325
1174 3300048918 Ga0496115_0152757 Ga0496115_0152757_153_1130 325
1175 3300049568 Ga0501031_0117126 Ga0501031_0117126_12_989 325
1176 3300049569 Ga0501032_0018083 Ga0501032_0018083_2228_3205 325
1177 3300049570 Ga0501033_0023027 Ga0501033_0023027_932_1909 325
1178 3300049570 Ga0501033_0079600 Ga0501033_0079600_1129_2106 325
1179 3300049571 Ga0501034_0000852 Ga0501034_0000852_3382_4359 325
1180 3300049571 Ga0501034_0002201 Ga0501034_0002201_16961_17938 325
1181 3300049571 Ga0501034_0019869 Ga0501034_0019869_5864_6841 325
1182 3300049571 Ga0501034_0050663 Ga0501034_0050663_607_1584 325
1183 3300049571 Ga0501034_0091389 Ga0501034_0091389_1022_1999 325
1184 3300049571 Ga0501034_0105422 Ga0501034_0105422_41_1018 325
1185 3300049571 Ga0501034_0294162 Ga0501034_0294162_283_1260 325
1186 3300049571 Ga0501034_0444425 Ga0501034_0444425_140_1117 325
1187 3300049572 Ga0501036_0009246 Ga0501036_0009246_3363_4340 325
1188 3300049572 Ga0501036_0066423 Ga0501036_0066423_454_1431 325
1189 3300049572 Ga0501036_0073792 Ga0501036_0073792_1796_2773 325
1190 3300049573 Ga0501037_0075246 Ga0501037_0075246_1241_2218 325
1191 3300049573 Ga0501037_0077130 Ga0501037_0077130_410_1387 325
1192 3300049574 Ga0501038_0017001 Ga0501038_0017001_5029_6006 325
1193 3300049574 Ga0501038_0074200 Ga0501038_0074200_1824_2801 325
1194 3300049574 Ga0501038_0127566 Ga0501038_0127566_183_1160 325
1195 3300049575 Ga0501039_0045614 Ga0501039_0045614_1088_2065 325
1196 3300049575 Ga0501039_0067453 Ga0501039_0067453_1131_2108 325
1197 3300049575 Ga0501039_0082471 Ga0501039_0082471_1175_2152 325
1198 3300049575 Ga0501039_0278275 Ga0501039_0278275_272_1249 325
1199 3300049579 Ga0501043_0023705 Ga0501043_0023705_2889_3866 325
1200 3300049579 Ga0501043_0071008 Ga0501043_0071008_1630_2607 325
1201 3300049580 Ga0501046_0047106 Ga0501046_0047106_1511_2488 325
1202 3300049580 Ga0501046_0083647 Ga0501046_0083647_1233_2210 325
1203 3300049580 Ga0501046_0164904 Ga0501046_0164904_552_1529 325
1204 3300049581 Ga0501047_0000010 Ga0501047_0000010_71080_72057 325
1205 3300049581 Ga0501047_0052348 Ga0501047_0052348_1153_2130 325
1206 3300049581 Ga0501047_0083522 Ga0501047_0083522_355_1332 325
1207 3300049581 Ga0501047_0145268 Ga0501047_0145268_1262_2239 325
1208 3300049581 Ga0501047_0168967 Ga0501047_0168967_402_1379 325
1209 3300049582 Ga0501048_0000592 Ga0501048_0000592_22655_23632 325
1210 3300049584 Ga0501068_0037047 Ga0501068_0037047_149_1126 325
1211 3300049584 Ga0501068_0061949 Ga0501068_0061949_1061_2038 325
1212 3300049585 Ga0501069_0103112 Ga0501069_0103112_87_1064 325
1213 3300049586 Ga0501070_0015707 Ga0501070_0015707_4422_5399 325
1214 3300049586 Ga0501070_0036608 Ga0501070_0036608_1542_2519 325
1215 3300049586 Ga0501070_0049872 Ga0501070_0049872_231_1208 325
1216 3300049586 Ga0501070_0261127 Ga0501070_0261127_84_1061 325
1217 3300049586 Ga0501070_0368536 Ga0501070_0368536_84_1061 325
1218 3300049588 Ga0501072_0072650 Ga0501072_0072650_1630_2607 325
1219 3300049588 Ga0501072_0101546 Ga0501072_0101546_1174_2151 325
1220 3300049588 Ga0501072_0189609 Ga0501072_0189609_147_1124 325
1221 3300049589 Ga0501073_0011255 Ga0501073_0011255_2159_3136 325
1222 3300049590 Ga0501074_0219597 Ga0501074_0219597_84_1061 325
1223 3300049591 Ga0501075_0029716 Ga0501075_0029716_140_1117 325
1224 3300049592 Ga0501076_0050177 Ga0501076_0050177_850_1827 325
1225 3300049742 Ga0501080_0000314 Ga0501080_0000314_14439_15416 325
1226 3300049742 Ga0501080_0069440 Ga0501080_0069440_1585_2562 325
1227 3300049742 Ga0501080_0357233 Ga0501080_0357233_84_1061 325
1228 3300049744 Ga0501083_0082807 Ga0501083_0082807_155_1132 325
1229 3300049744 Ga0501083_0114245 Ga0501083_0114245_80_1057 325
1230 3300049822 Ga0501035_0001359 Ga0501035_0001359_1716_2693 325
1231 3300049822 Ga0501035_0008723 Ga0501035_0008723_550_1527 325
1232 3300049822 Ga0501035_0026602 Ga0501035_0026602_3615_4592 325
1233 3300049822 Ga0501035_0049713 Ga0501035_0049713_1539_2516 325
1234 3300049822 Ga0501035_0321787 Ga0501035_0321787_184_1161 325
1235 3300049822 Ga0501035_0338074 Ga0501035_0338074_46_1023 325
1236 3300049823 Ga0501044_0015194 Ga0501044_0015194_5231_6208 325
1237 3300049823 Ga0501044_0030272 Ga0501044_0030272_4249_5226 325
1238 3300049823 Ga0501044_0042616 Ga0501044_0042616_1502_2479 325
1239 3300049823 Ga0501044_0123366 Ga0501044_0123366_1280_2257 325
1240 3300049823 Ga0501044_0200222 Ga0501044_0200222_739_1716 325
1241 3300049823 Ga0501044_0235340 Ga0501044_0235340_135_1112 325
1242 3300049824 Ga0501045_0079940 Ga0501045_0079940_836_1813 325
1243 3300050489 nmdc:mga03683_27872_c2 nmdc:mga03683_27872_c2_409_1386 325
1244 3300050490 nmdc:mga03n38_62424_c1 nmdc:mga03n38_62424_c1_664_1641 325
1245 3300050492 nmdc:mga0yw44_124278_c1 nmdc:mga0yw44_124278_c1_525_1502 325
1246 3300050492 nmdc:mga0yw44_30616_c1 nmdc:mga0yw44_30616_c1_296_1273 325
1247 3300050492 nmdc:mga0yw44_74353_c1 nmdc:mga0yw44_74353_c1_139_1116 325
1248 3300050493 nmdc:mga0k408_30724_c1 nmdc:mga0k408_30724_c1_88_1065 325
1249 3300050493 nmdc:mga0k408_87368_c1 nmdc:mga0k408_87368_c1_486_1463 325
1250 3300050494 nmdc:mga06z11_111956_c1 nmdc:mga06z11_111956_c1_154_1137 325
1251 3300050494 nmdc:mga06z11_124247_c1 nmdc:mga06z11_124247_c1_43_1020 325
1252 3300050494 nmdc:mga06z11_1795_c1 nmdc:mga06z11_1795_c1_3346_4323 325
1253 3300050495 nmdc:mga04h51_71172_c1 nmdc:mga04h51_71172_c1_76_1053 325
1254 3300050496 nmdc:mga07m45_27930_c1 nmdc:mga07m45_27930_c1_2042_3019 325
1255 3300050496 nmdc:mga07m45_95220_c1 nmdc:mga07m45_95220_c1_550_1527 325
1256 3300050507 nmdc:mga05p37_13519_c1 nmdc:mga05p37_13519_c1_2771_3748 325
1257 3300050507 nmdc:mga05p37_56_c3 nmdc:mga05p37_56_c3_34567_35544 325
1258 3300050507 nmdc:mga05p37_751885_c1 nmdc:mga05p37_751885_c1_69_1046 325
1259 3300050508 nmdc:mga09592_976_c1 nmdc:mga09592_976_c1_7832_8809 325
1260 3300050509 nmdc:mga0qj67_4772_c1 nmdc:mga0qj67_4772_c1_1979_2956 325
1261 3300050510 nmdc:mga06r32_34244_c1 nmdc:mga06r32_34244_c1_185_1162 325
1262 3300050511 nmdc:mga08y16_10784_c1 nmdc:mga08y16_10784_c1_4869_5846 325
1263 3300050511 nmdc:mga08y16_176438_c1 nmdc:mga08y16_176438_c1_599_1576 325
1264 3300050511 nmdc:mga08y16_206_c1 nmdc:mga08y16_206_c1_10496_11473 325
1265 3300050511 nmdc:mga08y16_2396_c1 nmdc:mga08y16_2396_c1_9180_10157 325
1266 3300050512 nmdc:mga0n895_126045_c1 nmdc:mga0n895_126045_c1_924_1901 325
1267 3300050512 nmdc:mga0n895_201249_c1 nmdc:mga0n895_201249_c1_178_1155 325
1268 3300050512 nmdc:mga0n895_2429_c1 nmdc:mga0n895_2429_c1_12071_13048 325
1269 3300050512 nmdc:mga0n895_2745_c2 nmdc:mga0n895_2745_c2_188_1165 325
1270 3300050512 nmdc:mga0n895_51689_c1 nmdc:mga0n895_51689_c1_1205_2182 325
1271 3300050512 nmdc:mga0n895_5847_c1 nmdc:mga0n895_5847_c1_6414_7391 325
1272 3300050513 nmdc:mga0rr50_144889_c1 nmdc:mga0rr50_144889_c1_626_1603 325
1273 3300050513 nmdc:mga0rr50_46884_c1 nmdc:mga0rr50_46884_c1_612_1589 325
1274 3300050514 nmdc:mga08x19_262272_c1 nmdc:mga08x19_262272_c1_123_1100 325
1275 3300050515 nmdc:mga0a205_11514_c1 nmdc:mga0a205_11514_c1_3053_4030 325
1276 3300050515 nmdc:mga0a205_375552_c1 nmdc:mga0a205_375552_c1_193_1170 325
1277 3300050515 nmdc:mga0a205_6435_c1 nmdc:mga0a205_6435_c1_9362_10339 325
1278 3300050515 nmdc:mga0a205_80_c1 nmdc:mga0a205_80_c1_41535_42512 325
1279 3300050515 nmdc:mga0a205_89878_c1 nmdc:mga0a205_89878_c1_445_1422 325
1280 3300053077 Ga0495601_0000360 Ga0495601_0000360_16114_17091 325
1281 3300053077 Ga0495601_0001260 Ga0495601_0001260_649_1626 325
1282 3300053077 Ga0495601_0007151 Ga0495601_0007151_3314_4291 325
1283 3300053077 Ga0495601_0009390 Ga0495601_0009390_752_1729 325
1284 3300053077 Ga0495601_0029689 Ga0495601_0029689_1291_2268 325
1285 3300053078 Ga0495612_0000964 Ga0495612_0000964_468_1445 325
1286 3300053078 Ga0495612_0002659 Ga0495612_0002659_4749_5726 325
1287 3300053078 Ga0495612_0005722 Ga0495612_0005722_1941_2918 325
1288 3300053078 Ga0495612_0008741 Ga0495612_0008741_1766_2743 325
1289 3300053078 Ga0495612_0009169 Ga0495612_0009169_1140_2117 325
1290 3300053078 Ga0495612_0054148 Ga0495612_0054148_174_1151 325
1291 3300053083 Ga0495655_0002786 Ga0495655_0002786_1321_2298 325
1292 3300053084 Ga0495595_0000552 Ga0495595_0000552_9744_10721 325
1293 3300053084 Ga0495595_0001276 Ga0495595_0001276_5431_6408 325
1294 3300053084 Ga0495595_0001912 Ga0495595_0001912_7004_7981 325
1295 3300053084 Ga0495595_0003989 Ga0495595_0003989_992_1969 325
1296 3300053085 Ga0495619_0000375 Ga0495619_0000375_11413_12390 325
1297 3300053085 Ga0495619_0000581 Ga0495619_0000581_10266_11243 325
1298 3300053085 Ga0495619_0000664 Ga0495619_0000664_48_1025 325
1299 3300053085 Ga0495619_0001851 Ga0495619_0001851_11543_12520 325
1300 3300053085 Ga0495619_0002169 Ga0495619_0002169_6301_7278 325
1301 3300053085 Ga0495619_0085474 Ga0495619_0085474_354_1331 325
1302 3300053085 Ga0495619_0094756 Ga0495619_0094756_492_1469 325
1303 3300053085 Ga0495619_0264286 Ga0495619_0264286_138_1115 325
1304 3300053088 Ga0500644_0008930 Ga0500644_0008930_928_1905 325
1305 3300053094 Ga0500566_0024974 Ga0500566_0024974_10_987 325
1306 3300053096 Ga0500641_0018612 Ga0500641_0018612_1568_2545 325
1307 3300053119 Ga0500595_000002 Ga0500595_000002_46900_47877 325
1308 3300053146 Ga0500588_0017273 Ga0500588_0017273_890_1867 325
1309 3300053153 Ga0500616_0000002 Ga0500616_0000002_61744_62721 325
1310 3300053730 Ga0500645_000471 Ga0500645_000471_23154_24131 325
1311 3300054114 Ga0501084_0037087 Ga0501084_0037087_1455_2432 325
1312 3300060353 Ga0501082_0080227 Ga0501082_0080227_975_1952 325
1313 3300060353 Ga0501082_0080612 Ga0501082_0080612_943_1920 325
1314 3300061734 Ga0530510_0082247 Ga0530510_0082247_1300_2277 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

27

111

0.95

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

152

284

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

184

323

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.981 3 325
3jyl-assembly1.cif.gz_A crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase 0.9747 1 325
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.9721 3 325
4rvu-assembly1.cif.gz_D the native structure of mycobacterial rv1454c complexed with nadph 0.9713 1 325
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9703 3 325
ID Description Score Start End Superfamily
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9915 125 269 3.40.50.720
af_Q336S6_1_326_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9861 2 325 3.90.180.10
af_P28304_2_327_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.98 3 325 2.170.150.20
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.978 125 269 3.40.50.720
af_O74489_1_324_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9764 2 324 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A528FI11-F1-model_v4 Quinone oxidoreductase 0.9939 109 325 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A4V1TF63-F1-model_v4 Quinone oxidoreductase 0.9933 144 325 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A126NTD3-F1-model_v4 Quinone oxidoreductase 0.993 1 325 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A699GSK4-F1-model_v4 GroES-like zinc-binding alcohol dehydrogenase family protein 0.9922 124 325 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A5B7AB61-F1-model_v4 Putative quinone oxidoreductase isoform X2 (EC 1.6.5.5) 0.992 124 325 GO:0003960
GO:0005829
GO:0035925
GO:0070402

Feature Viewer

pLDDT pTM Quality
97.11 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map