F492903
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1314 | 502 | 1291 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300046529|Ga0495652_0048857|Ga0495652_0048857_1351_2451 |
| Length | 366 |
| Sequence | MVAAVRVHKPGGPEALIYEDVEIAAPGQGQIKIKQHACGVNFIDAYFRMGMYPSPVGMPFIAGNESAGEVMAVGPGVTDVKVGDRVAFVGPLGGYAAERLVPADRAVKLPDNITYEQAAGMMLKGMTVQYLVNRTYKVGKGTICLVHAAAGGVGLIACQWANHLGATVIGTVGSKEKAELAKKNGCHHTILYRDEDFVAKVKEFTSGKLCDVVYDGIGKTTFPASLDCLRPLGYFVSFGSASGQIDAFNINILQTKGSLFATRPTLNHYVAKRDDLIATAADLFKVVGSGAVKIPVNQKYALKDAGKAHKDMEGRDTTGSSILMPSRSVRRCCARWRYSRSSPPRCLPAGPASRMPRCWQSCTNTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 4 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 5 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 6 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 7 | 2791355199 | |||
| 8 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 9 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 10 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 11 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 12 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 13 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 14 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 15 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 16 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 17 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 18 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 19 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 20 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 21 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 22 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 23 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 24 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 25 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 26 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 27 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 28 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 31 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 32 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 33 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 34 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 35 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 36 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 37 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 38 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 39 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 42 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 45 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 110 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 111 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 119 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 120 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 121 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 123 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 124 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 125 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 131 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 132 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 137 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 138 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 139 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 140 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 141 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 142 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 143 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 144 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 146 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 147 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 148 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 162 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 165 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 166 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 182 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 183 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 184 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 264 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 268 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 269 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 270 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 271 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 275 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 276 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 277 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 278 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 281 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 282 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 283 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 284 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 286 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 287 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 288 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 289 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 291 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 292 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 293 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 294 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 295 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 296 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 297 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 298 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 299 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 300 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 301 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 302 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 303 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 304 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 307 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 309 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 310 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 312 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 313 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 314 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 315 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 318 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 319 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 322 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 323 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 324 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 325 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 326 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 327 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 329 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 330 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 331 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 332 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 333 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 334 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 335 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 336 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 337 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 338 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 339 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 340 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 341 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 342 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 343 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 344 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 408 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 409 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 410 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 411 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 412 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 413 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 416 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 417 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 418 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 419 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 420 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 421 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 422 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 423 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 424 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 427 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 459 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 460 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 461 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 478 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 482 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 483 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 485 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 486 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 487 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 488 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 489 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 490 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 492 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 494 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 495 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 498 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 499 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 500 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 501 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 502 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0.23 |
| Isolates | 1.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.02 |
| Nodule | 1.22 |
| Rhizoplane | 6.16 |
| Rhizosphere | 84.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214772983 | 2209111006 | Bacteria | 12374 |
| 2 | ARcpr5oldR_c000140 | 3300000041 | Bacteria | 12413 |
| 3 | ARSoilYngRDRAFT_c00234 | 3300000042 | Bacteria | 8859 |
| 4 | ARcpr5yngRDRAFT_c000872 | 3300000043 | Bacteria | 3563 |
| 5 | ARSoilOldRDRAFT_c000126 | 3300000044 | Bacteria | 13655 |
| 6 | ARCol0oldRDRAFT_c00368 | 3300000045 | Bacteria | 4373 |
| 7 | ARCol0yngRDRAFT_1000665 | 3300000652 | Bacteria | 3543 |
| 8 | JGI24746J21847_1001655 | 3300001977 | Bacteria | 3569 |
| 9 | JGI24747J21853_1000133 | 3300001978 | Bacteria | 3534 |
| 10 | JGI24739J22299_10014140 | 3300001989 | Bacteria | 2905 |
| 11 | JGI24737J22298_10000960 | 3300001990 | Bacteria | 10240 |
| 12 | JGI24737J22298_10007118 | 3300001990 | Bacteria | 3790 |
| 13 | JGI24737J22298_10021016 | 3300001990 | Bacteria | 2081 |
| 14 | JGI24735J21928_10042458 | 3300002067 | Bacteria | 1324 |
| 15 | JGI24750J21931_1000601 | 3300002070 | Bacteria | 5453 |
| 16 | JGI24750J21931_1005810 | 3300002070 | Bacteria | 1522 |
| 17 | JGI24745J21846_1000099 | 3300002073 | Bacteria | 6492 |
| 18 | JGI24748J21848_1000721 | 3300002074 | Bacteria | 3573 |
| 19 | JGI24738J21930_10000223 | 3300002075 | Bacteria | 15332 |
| 20 | JGI24749J21850_1003197 | 3300002076 | Bacteria | 2287 |
| 21 | JGI24749J21850_1010025 | 3300002076 | Bacteria | 1326 |
| 22 | JGI24744J21845_10000129 | 3300002077 | Bacteria | 10529 |
| 23 | JGI24744J21845_10003963 | 3300002077 | Bacteria | 3054 |
| 24 | JGI24034J26672_10000557 | 3300002239 | Bacteria | 4762 |
| 25 | JGI24034J26672_10003132 | 3300002239 | Bacteria | 2301 |
| 26 | JGI24742J22300_10000255 | 3300002244 | Bacteria | 7925 |
| 27 | JGI24742J22300_10000264 | 3300002244 | Bacteria | 7810 |
| 28 | JGI24742J22300_10000524 | 3300002244 | Bacteria | 5729 |
| 29 | JGI25406J46586_10000004 | 3300003203 | Bacteria | 149772 |
| 30 | JGI25404J52841_10007800 | 3300003659 | Bacteria | 2271 |
| 31 | Ga0065717_1002284 | 3300005276 | Bacteria | 2253 |
| 32 | Ga0065716_1001992 | 3300005277 | Bacteria | 2501 |
| 33 | Ga0065704_10074561 | 3300005289 | Bacteria | 6184 |
| 34 | Ga0065712_10009760 | 3300005290 | Bacteria | 2276 |
| 35 | Ga0065712_10070835 | 3300005290 | Bacteria | 5657 |
| 36 | Ga0065715_10089377 | 3300005293 | Bacteria | 10721 |
| 37 | Ga0070676_10000012 | 3300005328 | Bacteria | 58061 |
| 38 | Ga0070683_100000139 | 3300005329 | Bacteria | 46987 |
| 39 | Ga0070683_100091253 | 3300005329 | Bacteria | 2860 |
| 40 | Ga0070690_100005164 | 3300005330 | Bacteria | 7309 |
| 41 | Ga0070690_100005412 | 3300005330 | Bacteria | 7168 |
| 42 | Ga0070690_100062958 | 3300005330 | Bacteria | 2393 |
| 43 | Ga0070670_100002014 | 3300005331 | Bacteria | 16615 |
| 44 | Ga0070670_100021801 | 3300005331 | Bacteria | 5509 |
| 45 | Ga0070670_100086294 | 3300005331 | Bacteria | 2697 |
| 46 | Ga0070677_10000125 | 3300005333 | Bacteria | 25491 |
| 47 | Ga0068869_100000605 | 3300005334 | Bacteria | 20215 |
| 48 | Ga0068869_100021090 | 3300005334 | Bacteria | 4478 |
| 49 | Ga0068869_100091153 | 3300005334 | Bacteria | 2292 |
| 50 | Ga0070666_10017025 | 3300005335 | Bacteria | 4656 |
| 51 | Ga0070666_10038295 | 3300005335 | Bacteria | 3190 |
| 52 | Ga0070680_100000179 | 3300005336 | Bacteria | 40975 |
| 53 | Ga0070680_100010716 | 3300005336 | Bacteria | 7077 |
| 54 | Ga0070680_100014505 | 3300005336 | Bacteria | 6165 |
| 55 | Ga0070682_100000319 | 3300005337 | Bacteria | 33197 |
| 56 | Ga0070682_100016170 | 3300005337 | Bacteria | 4335 |
| 57 | Ga0068868_100000593 | 3300005338 | Bacteria | 24375 |
| 58 | Ga0068868_100004938 | 3300005338 | Bacteria | 9370 |
| 59 | Ga0068868_100060491 | 3300005338 | Bacteria | 2999 |
| 60 | Ga0070660_100001605 | 3300005339 | Bacteria | 15534 |
| 61 | Ga0070660_100086796 | 3300005339 | Bacteria | 2462 |
| 62 | Ga0070689_100004685 | 3300005340 | Bacteria | 9267 |
| 63 | Ga0070689_100062016 | 3300005340 | Bacteria | 2908 |
| 64 | Ga0070689_100079168 | 3300005340 | Bacteria | 2577 |
| 65 | Ga0070689_100210076 | 3300005340 | Bacteria | 1593 |
| 66 | Ga0070691_10001565 | 3300005341 | Bacteria | 9871 |
| 67 | Ga0070691_10040470 | 3300005341 | Bacteria | 2203 |
| 68 | Ga0070687_100118710 | 3300005343 | Bacteria | 1509 |
| 69 | Ga0070661_100001455 | 3300005344 | Bacteria | 16432 |
| 70 | Ga0070661_100089918 | 3300005344 | Bacteria | 2273 |
| 71 | Ga0070692_10000434 | 3300005345 | Bacteria | 12695 |
| 72 | Ga0070692_10002195 | 3300005345 | Bacteria | 7472 |
| 73 | Ga0070692_10024353 | 3300005345 | Bacteria | 2974 |
| 74 | Ga0070668_100004423 | 3300005347 | Bacteria | 10433 |
| 75 | Ga0070668_100407758 | 3300005347 | Bacteria | 1162 |
| 76 | Ga0070669_100000409 | 3300005353 | Bacteria | 32911 |
| 77 | Ga0070669_100058741 | 3300005353 | Bacteria | 2823 |
| 78 | Ga0070669_100133693 | 3300005353 | Bacteria | 1906 |
| 79 | Ga0070675_100000166 | 3300005354 | Bacteria | 40573 |
| 80 | Ga0070675_100047183 | 3300005354 | Bacteria | 3529 |
| 81 | Ga0070675_100346017 | 3300005354 | Bacteria | 1318 |
| 82 | Ga0070671_100005674 | 3300005355 | Bacteria | 9934 |
| 83 | Ga0070671_100005938 | 3300005355 | Bacteria | 9730 |
| 84 | Ga0070671_100006280 | 3300005355 | Bacteria | 9470 |
| 85 | Ga0070671_100051098 | 3300005355 | Bacteria | 3438 |
| 86 | Ga0070671_100094656 | 3300005355 | Bacteria | 2504 |
| 87 | Ga0070671_100206327 | 3300005355 | Bacteria | 1667 |
| 88 | Ga0070674_100000644 | 3300005356 | Bacteria | 17586 |
| 89 | Ga0070674_100002605 | 3300005356 | Bacteria | 9979 |
| 90 | Ga0070673_100000041 | 3300005364 | Bacteria | 54096 |
| 91 | Ga0070673_100089493 | 3300005364 | Bacteria | 2513 |
| 92 | Ga0070673_100116580 | 3300005364 | Bacteria | 2222 |
| 93 | Ga0070688_100000180 | 3300005365 | Bacteria | 33887 |
| 94 | Ga0070688_100011831 | 3300005365 | Bacteria | 4866 |
| 95 | Ga0070688_100026530 | 3300005365 | Bacteria | 3443 |
| 96 | Ga0070688_100036302 | 3300005365 | Bacteria | 2997 |
| 97 | Ga0070688_100049523 | 3300005365 | Bacteria | 2615 |
| 98 | Ga0070688_100124822 | 3300005365 | Bacteria | 1729 |
| 99 | Ga0070659_100000752 | 3300005366 | Bacteria | 23551 |
| 100 | Ga0070659_100143341 | 3300005366 | Bacteria | 1945 |
| 101 | Ga0070659_100224223 | 3300005366 | Bacteria | 1552 |
| 102 | Ga0070659_100229856 | 3300005366 | Bacteria | 1533 |
| 103 | Ga0070667_100000365 | 3300005367 | Bacteria | 49335 |
| 104 | Ga0070667_100019077 | 3300005367 | Bacteria | 5687 |
| 105 | Ga0070703_10003914 | 3300005406 | Bacteria | 4219 |
| 106 | Ga0070709_10000981 | 3300005434 | Bacteria | 15828 |
| 107 | Ga0070709_10003137 | 3300005434 | Bacteria | 8867 |
| 108 | Ga0070709_10019500 | 3300005434 | Bacteria | 3922 |
| 109 | Ga0070714_100007967 | 3300005435 | Bacteria | 8255 |
| 110 | Ga0070714_100057992 | 3300005435 | Bacteria | 3316 |
| 111 | Ga0070714_100088110 | 3300005435 | Bacteria | 2715 |
| 112 | Ga0070714_100098674 | 3300005435 | Bacteria | 2570 |
| 113 | Ga0070714_100110282 | 3300005435 | Bacteria | 2436 |
| 114 | Ga0070714_100398998 | 3300005435 | Bacteria | 1299 |
| 115 | Ga0070713_100009246 | 3300005436 | Bacteria | 7040 |
| 116 | Ga0070713_100063078 | 3300005436 | Bacteria | 3105 |
| 117 | Ga0070713_100135262 | 3300005436 | Bacteria | 2177 |
| 118 | Ga0070713_100195422 | 3300005436 | Bacteria | 1825 |
| 119 | Ga0070710_10000179 | 3300005437 | Bacteria | 29185 |
| 120 | Ga0070710_10005022 | 3300005437 | Bacteria | 6261 |
| 121 | Ga0070710_10011315 | 3300005437 | Bacteria | 4408 |
| 122 | Ga0070710_10083431 | 3300005437 | Bacteria | 1870 |
| 123 | Ga0070710_10095965 | 3300005437 | Bacteria | 1757 |
| 124 | Ga0070710_10102081 | 3300005437 | Bacteria | 1710 |
| 125 | Ga0070701_10000493 | 3300005438 | Bacteria | 13517 |
| 126 | Ga0070701_10012908 | 3300005438 | Bacteria | 3784 |
| 127 | Ga0070711_100013883 | 3300005439 | Bacteria | 5067 |
| 128 | Ga0070711_100015744 | 3300005439 | Bacteria | 4789 |
| 129 | Ga0070711_100030851 | 3300005439 | Bacteria | 3553 |
| 130 | Ga0070711_100185604 | 3300005439 | Bacteria | 1594 |
| 131 | Ga0070711_100224195 | 3300005439 | Bacteria | 1463 |
| 132 | Ga0070705_100002314 | 3300005440 | Bacteria | 9618 |
| 133 | Ga0070705_100044262 | 3300005440 | Bacteria | 2556 |
| 134 | Ga0070700_100000467 | 3300005441 | Bacteria | 20231 |
| 135 | Ga0070700_100169928 | 3300005441 | Bacteria | 1509 |
| 136 | Ga0070694_100000065 | 3300005444 | Bacteria | 49515 |
| 137 | Ga0070694_100029375 | 3300005444 | Bacteria | 3587 |
| 138 | Ga0070694_100165982 | 3300005444 | Bacteria | 1623 |
| 139 | Ga0070708_100286274 | 3300005445 | Bacteria | 1551 |
| 140 | Ga0070663_100000473 | 3300005455 | Bacteria | 21137 |
| 141 | Ga0070663_100138607 | 3300005455 | Bacteria | 1855 |
| 142 | Ga0070663_100233791 | 3300005455 | Bacteria | 1448 |
| 143 | Ga0070663_100268938 | 3300005455 | Bacteria | 1354 |
| 144 | Ga0070678_100000091 | 3300005456 | Bacteria | 34559 |
| 145 | Ga0070678_100007141 | 3300005456 | Bacteria | 6603 |
| 146 | Ga0070678_100010348 | 3300005456 | Bacteria | 5694 |
| 147 | Ga0070678_100034927 | 3300005456 | Bacteria | 3505 |
| 148 | Ga0070678_100062680 | 3300005456 | Bacteria | 2747 |
| 149 | Ga0070662_100006535 | 3300005457 | Bacteria | 7521 |
| 150 | Ga0070662_100043231 | 3300005457 | Bacteria | 3222 |
| 151 | Ga0070662_100057442 | 3300005457 | Bacteria | 2827 |
| 152 | Ga0070662_100241111 | 3300005457 | Bacteria | 1450 |
| 153 | Ga0070681_10010003 | 3300005458 | Bacteria | 9350 |
| 154 | Ga0070681_10032494 | 3300005458 | Bacteria | 5237 |
| 155 | Ga0070681_10092484 | 3300005458 | Bacteria | 2973 |
| 156 | Ga0070681_10191610 | 3300005458 | Bacteria | 1964 |
| 157 | Ga0070681_10223913 | 3300005458 | Bacteria | 1796 |
| 158 | Ga0068867_100000859 | 3300005459 | Bacteria | 20487 |
| 159 | Ga0068867_100007691 | 3300005459 | Bacteria | 7624 |
| 160 | Ga0068867_100119168 | 3300005459 | Bacteria | 2037 |
| 161 | Ga0070685_10001731 | 3300005466 | Bacteria | 11442 |
| 162 | Ga0070685_10015115 | 3300005466 | Bacteria | 4096 |
| 163 | Ga0070685_10018921 | 3300005466 | Bacteria | 3711 |
| 164 | Ga0070685_10041755 | 3300005466 | Bacteria | 2615 |
| 165 | Ga0070707_100072359 | 3300005468 | Bacteria | 3322 |
| 166 | Ga0070707_100236520 | 3300005468 | Bacteria | 1778 |
| 167 | Ga0070698_100004430 | 3300005471 | Bacteria | 15431 |
| 168 | Ga0070698_100103675 | 3300005471 | Bacteria | 2814 |
| 169 | Ga0070679_100006957 | 3300005530 | Bacteria | 10555 |
| 170 | Ga0070679_100012754 | 3300005530 | Bacteria | 8038 |
| 171 | Ga0070679_100067689 | 3300005530 | Bacteria | 3561 |
| 172 | Ga0070684_100000219 | 3300005535 | Bacteria | 39995 |
| 173 | Ga0070684_100112216 | 3300005535 | Bacteria | 2445 |
| 174 | Ga0070684_100264601 | 3300005535 | Bacteria | 1573 |
| 175 | Ga0068853_100000600 | 3300005539 | Bacteria | 24713 |
| 176 | Ga0068853_100161577 | 3300005539 | Bacteria | 2022 |
| 177 | Ga0068853_100441788 | 3300005539 | Bacteria | 1223 |
| 178 | Ga0070672_100000019 | 3300005543 | Bacteria | 69855 |
| 179 | Ga0070672_100005606 | 3300005543 | Bacteria | 8349 |
| 180 | Ga0070672_100091597 | 3300005543 | Bacteria | 2453 |
| 181 | Ga0070672_100131022 | 3300005543 | Bacteria | 2061 |
| 182 | Ga0070686_100007875 | 3300005544 | Bacteria | 5955 |
| 183 | Ga0070686_100013361 | 3300005544 | Bacteria | 4699 |
| 184 | Ga0070686_100084027 | 3300005544 | Bacteria | 2115 |
| 185 | Ga0070686_100106911 | 3300005544 | Bacteria | 1900 |
| 186 | Ga0070695_100000474 | 3300005545 | Bacteria | 20848 |
| 187 | Ga0070695_100157083 | 3300005545 | Bacteria | 1593 |
| 188 | Ga0070696_100003100 | 3300005546 | Bacteria | 11055 |
| 189 | Ga0070696_100101172 | 3300005546 | Bacteria | 2065 |
| 190 | Ga0070696_100126973 | 3300005546 | Bacteria | 1852 |
| 191 | Ga0070693_100001868 | 3300005547 | Bacteria | 9623 |
| 192 | Ga0070693_100080784 | 3300005547 | Bacteria | 1938 |
| 193 | Ga0070693_100165525 | 3300005547 | Bacteria | 1412 |
| 194 | Ga0070665_100010015 | 3300005548 | Bacteria | 9588 |
| 195 | Ga0070665_100071433 | 3300005548 | Bacteria | 3477 |
| 196 | Ga0070665_100367333 | 3300005548 | Bacteria | 1445 |
| 197 | Ga0070704_100000252 | 3300005549 | Bacteria | 23218 |
| 198 | Ga0070704_100001606 | 3300005549 | Bacteria | 12238 |
| 199 | Ga0070704_100103247 | 3300005549 | Bacteria | 2153 |
| 200 | Ga0068855_100018421 | 3300005563 | Bacteria | 8389 |
| 201 | Ga0068855_100019721 | 3300005563 | Bacteria | 8099 |
| 202 | Ga0068855_100063129 | 3300005563 | Bacteria | 4323 |
| 203 | Ga0068855_100094398 | 3300005563 | Bacteria | 3449 |
| 204 | Ga0068855_100180896 | 3300005563 | Bacteria | 2383 |
| 205 | Ga0070664_100000819 | 3300005564 | Bacteria | 23927 |
| 206 | Ga0070664_100022255 | 3300005564 | Bacteria | 5227 |
| 207 | Ga0070664_100152816 | 3300005564 | Bacteria | 2039 |
| 208 | Ga0068857_100000768 | 3300005577 | Bacteria | 23872 |
| 209 | Ga0068854_100001736 | 3300005578 | Bacteria | 13299 |
| 210 | Ga0068854_100074701 | 3300005578 | Bacteria | 2487 |
| 211 | Ga0068854_100112791 | 3300005578 | Bacteria | 2053 |
| 212 | Ga0068856_100002295 | 3300005614 | Bacteria | 19718 |
| 213 | Ga0068856_100144924 | 3300005614 | Bacteria | 2383 |
| 214 | Ga0068856_100266791 | 3300005614 | Bacteria | 1728 |
| 215 | Ga0070702_100000898 | 3300005615 | Bacteria | 11591 |
| 216 | Ga0070702_100057764 | 3300005615 | Bacteria | 2245 |
| 217 | Ga0068852_100001992 | 3300005616 | Bacteria | 13920 |
| 218 | Ga0068852_100118580 | 3300005616 | Bacteria | 2418 |
| 219 | Ga0068852_100174225 | 3300005616 | Bacteria | 2019 |
| 220 | Ga0068859_100030288 | 3300005617 | Bacteria | 5430 |
| 221 | Ga0068859_100032313 | 3300005617 | Bacteria | 5257 |
| 222 | Ga0068859_100281836 | 3300005617 | Bacteria | 1755 |
| 223 | Ga0068864_100005938 | 3300005618 | Bacteria | 10014 |
| 224 | Ga0068864_100009491 | 3300005618 | Bacteria | 8028 |
| 225 | Ga0068864_100029150 | 3300005618 | Bacteria | 4670 |
| 226 | Ga0068866_10001028 | 3300005718 | Bacteria | 12272 |
| 227 | Ga0068866_10013621 | 3300005718 | Bacteria | 3574 |
| 228 | Ga0068866_10154896 | 3300005718 | Bacteria | 1331 |
| 229 | Ga0068861_100000169 | 3300005719 | Bacteria | 34559 |
| 230 | Ga0068861_100190783 | 3300005719 | Bacteria | 1713 |
| 231 | Ga0068851_10024424 | 3300005834 | Bacteria | 2959 |
| 232 | Ga0068870_10000586 | 3300005840 | Bacteria | 13817 |
| 233 | Ga0068870_10003342 | 3300005840 | Bacteria | 6783 |
| 234 | Ga0068863_100000381 | 3300005841 | Bacteria | 45003 |
| 235 | Ga0068863_100014411 | 3300005841 | Bacteria | 7614 |
| 236 | Ga0068863_100110951 | 3300005841 | Bacteria | 2612 |
| 237 | Ga0068858_100009197 | 3300005842 | Bacteria | 9441 |
| 238 | Ga0068858_100016225 | 3300005842 | Bacteria | 6997 |
| 239 | Ga0068858_100385313 | 3300005842 | Bacteria | 1345 |
| 240 | Ga0068858_100511731 | 3300005842 | Bacteria | 1160 |
| 241 | Ga0068860_100000448 | 3300005843 | Bacteria | 52034 |
| 242 | Ga0068860_100001472 | 3300005843 | Bacteria | 25432 |
| 243 | Ga0068860_100007428 | 3300005843 | Bacteria | 10961 |
| 244 | Ga0068860_100081520 | 3300005843 | Bacteria | 3077 |
| 245 | Ga0068862_100001886 | 3300005844 | Bacteria | 19006 |
| 246 | Ga0068862_100021781 | 3300005844 | Bacteria | 5359 |
| 247 | Ga0068862_100065508 | 3300005844 | Bacteria | 3129 |
| 248 | Ga0081455_10000036 | 3300005937 | Bacteria | 136303 |
| 249 | Ga0081455_10000356 | 3300005937 | Bacteria | 60378 |
| 250 | Ga0081455_10004173 | 3300005937 | Bacteria | 16295 |
| 251 | Ga0081455_10012017 | 3300005937 | Bacteria | 8664 |
| 252 | Ga0081455_10037370 | 3300005937 | Bacteria | 4314 |
| 253 | Ga0081538_10007089 | 3300005981 | Bacteria | 9740 |
| 254 | Ga0081538_10023585 | 3300005981 | Bacteria | 4418 |
| 255 | Ga0081540_1000060 | 3300005983 | Bacteria | 119707 |
| 256 | Ga0081540_1000257 | 3300005983 | Bacteria | 55989 |
| 257 | Ga0081540_1009400 | 3300005983 | Bacteria | 6740 |
| 258 | Ga0081540_1032775 | 3300005983 | Bacteria | 2831 |
| 259 | Ga0081540_1060985 | 3300005983 | Bacteria | 1801 |
| 260 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 261 | Ga0081539_10015884 | 3300005985 | Bacteria | 5429 |
| 262 | Ga0081539_10052157 | 3300005985 | Bacteria | 2299 |
| 263 | Ga0070717_10000199 | 3300006028 | Bacteria | 41940 |
| 264 | Ga0070717_10002977 | 3300006028 | Bacteria | 12053 |
| 265 | Ga0070717_10016717 | 3300006028 | Bacteria | 5695 |
| 266 | Ga0070717_10199428 | 3300006028 | Bacteria | 1752 |
| 267 | Ga0075365_10019169 | 3300006038 | Bacteria | 4218 |
| 268 | Ga0075365_10023303 | 3300006038 | Bacteria | 3892 |
| 269 | Ga0075365_10063525 | 3300006038 | Bacteria | 2472 |
| 270 | Ga0075365_10067595 | 3300006038 | Bacteria | 2399 |
| 271 | Ga0075365_10095195 | 3300006038 | Bacteria | 2033 |
| 272 | Ga0075368_10041807 | 3300006042 | Bacteria | 1801 |
| 273 | Ga0075363_100010016 | 3300006048 | Bacteria | 4479 |
| 274 | Ga0075363_100019886 | 3300006048 | Bacteria | 3362 |
| 275 | Ga0075363_100061414 | 3300006048 | Bacteria | 2025 |
| 276 | Ga0075363_100091630 | 3300006048 | Bacteria | 1673 |
| 277 | Ga0075363_100133856 | 3300006048 | Bacteria | 1392 |
| 278 | Ga0070715_10000085 | 3300006163 | Bacteria | 24765 |
| 279 | Ga0070716_100001988 | 3300006173 | Bacteria | 9316 |
| 280 | Ga0070716_100002448 | 3300006173 | Bacteria | 8559 |
| 281 | Ga0070716_100100739 | 3300006173 | Bacteria | 1770 |
| 282 | Ga0070712_100002527 | 3300006175 | Bacteria | 11292 |
| 283 | Ga0070712_100014196 | 3300006175 | Bacteria | 5112 |
| 284 | Ga0070712_100017680 | 3300006175 | Bacteria | 4619 |
| 285 | Ga0070712_100019271 | 3300006175 | Bacteria | 4447 |
| 286 | Ga0070712_100086512 | 3300006175 | Bacteria | 2284 |
| 287 | Ga0075362_10000796 | 3300006177 | Bacteria | 9412 |
| 288 | Ga0075367_10053786 | 3300006178 | Bacteria | 2386 |
| 289 | Ga0075367_10116702 | 3300006178 | Bacteria | 1642 |
| 290 | Ga0075369_10031469 | 3300006186 | Bacteria | 2240 |
| 291 | Ga0075369_10051679 | 3300006186 | Bacteria | 1780 |
| 292 | Ga0075427_10001399 | 3300006194 | Bacteria | 3091 |
| 293 | Ga0075366_10016027 | 3300006195 | Bacteria | 4303 |
| 294 | Ga0075366_10036158 | 3300006195 | Bacteria | 2911 |
| 295 | Ga0097621_100001234 | 3300006237 | Bacteria | 17707 |
| 296 | Ga0097621_100025864 | 3300006237 | Bacteria | 4597 |
| 297 | Ga0097621_100043421 | 3300006237 | Bacteria | 3623 |
| 298 | Ga0075370_10008478 | 3300006353 | Bacteria | 5291 |
| 299 | Ga0075370_10057643 | 3300006353 | Bacteria | 2208 |
| 300 | Ga0068871_100000068 | 3300006358 | Bacteria | 57531 |
| 301 | Ga0068871_100009351 | 3300006358 | Bacteria | 7097 |
| 302 | Ga0068871_100012500 | 3300006358 | Bacteria | 6262 |
| 303 | Ga0068871_100025352 | 3300006358 | Bacteria | 4612 |
| 304 | Ga0075428_100035558 | 3300006844 | Bacteria | 5491 |
| 305 | Ga0075428_100174934 | 3300006844 | Bacteria | 2325 |
| 306 | Ga0075428_100214665 | 3300006844 | Bacteria | 2079 |
| 307 | Ga0075430_100004696 | 3300006846 | Bacteria | 11490 |
| 308 | Ga0075431_100006639 | 3300006847 | Bacteria | 11490 |
| 309 | Ga0075433_10001599 | 3300006852 | Bacteria | 16784 |
| 310 | Ga0075433_10403539 | 3300006852 | Bacteria | 1206 |
| 311 | Ga0075434_100000576 | 3300006871 | Bacteria | 28251 |
| 312 | Ga0075434_100001666 | 3300006871 | Bacteria | 18944 |
| 313 | Ga0075434_100073539 | 3300006871 | Bacteria | 3410 |
| 314 | Ga0075434_100113294 | 3300006871 | Bacteria | 2724 |
| 315 | Ga0075434_100208693 | 3300006871 | Bacteria | 1974 |
| 316 | Ga0075434_100468579 | 3300006871 | Bacteria | 1281 |
| 317 | Ga0075429_100060828 | 3300006880 | Bacteria | 3289 |
| 318 | Ga0075429_100064559 | 3300006880 | Bacteria | 3188 |
| 319 | Ga0068865_100005133 | 3300006881 | Bacteria | 7927 |
| 320 | Ga0068865_100103925 | 3300006881 | Bacteria | 2084 |
| 321 | Ga0075436_100070922 | 3300006914 | Bacteria | 2409 |
| 322 | Ga0097620_100030290 | 3300006931 | Bacteria | 5430 |
| 323 | Ga0097620_100032314 | 3300006931 | Bacteria | 5257 |
| 324 | Ga0097620_100281806 | 3300006931 | Bacteria | 1755 |
| 325 | Ga0075435_100002716 | 3300007076 | Bacteria | 11816 |
| 326 | Ga0075435_100009255 | 3300007076 | Bacteria | 7117 |
| 327 | Ga0075435_100010036 | 3300007076 | Bacteria | 6904 |
| 328 | Ga0075435_100153065 | 3300007076 | Bacteria | 1940 |
| 329 | Ga0099794_10104084 | 3300007265 | Bacteria | 1418 |
| 330 | Ga0099795_10003566 | 3300007788 | Bacteria | 3875 |
| 331 | Ga0105250_10017722 | 3300009092 | Bacteria | 2893 |
| 332 | Ga0105240_10068510 | 3300009093 | Bacteria | 4394 |
| 333 | Ga0105240_10153475 | 3300009093 | Bacteria | 2741 |
| 334 | Ga0111539_10000082 | 3300009094 | Bacteria | 96811 |
| 335 | Ga0111539_10000503 | 3300009094 | Bacteria | 49808 |
| 336 | Ga0111539_10003417 | 3300009094 | Bacteria | 20918 |
| 337 | Ga0111539_10217427 | 3300009094 | Bacteria | 2226 |
| 338 | Ga0105245_10000780 | 3300009098 | Bacteria | 28901 |
| 339 | Ga0105245_10091423 | 3300009098 | Bacteria | 2801 |
| 340 | Ga0105245_10098843 | 3300009098 | Bacteria | 2697 |
| 341 | Ga0105245_10244517 | 3300009098 | Bacteria | 1741 |
| 342 | Ga0105245_10322101 | 3300009098 | Bacteria | 1523 |
| 343 | Ga0105245_10328630 | 3300009098 | Bacteria | 1508 |
| 344 | Ga0105247_10002726 | 3300009101 | Bacteria | 11844 |
| 345 | Ga0105247_10005459 | 3300009101 | Bacteria | 8011 |
| 346 | Ga0105247_10017791 | 3300009101 | Bacteria | 4261 |
| 347 | Ga0105247_10036356 | 3300009101 | Bacteria | 3002 |
| 348 | Ga0105247_10149201 | 3300009101 | Bacteria | 1539 |
| 349 | Ga0114129_10009008 | 3300009147 | Bacteria | 14232 |
| 350 | Ga0114129_10013874 | 3300009147 | Bacteria | 11481 |
| 351 | Ga0114129_10987483 | 3300009147 | Bacteria | 1061 |
| 352 | Ga0105243_10001083 | 3300009148 | Bacteria | 24917 |
| 353 | Ga0105243_10032306 | 3300009148 | Bacteria | 4043 |
| 354 | Ga0105243_10033088 | 3300009148 | Bacteria | 3996 |
| 355 | Ga0105241_10000760 | 3300009174 | Bacteria | 24503 |
| 356 | Ga0105241_10037962 | 3300009174 | Bacteria | 3631 |
| 357 | Ga0105241_10083372 | 3300009174 | Bacteria | 2508 |
| 358 | Ga0105241_10095627 | 3300009174 | Bacteria | 2352 |
| 359 | Ga0105242_10004818 | 3300009176 | Bacteria | 10443 |
| 360 | Ga0105242_10019812 | 3300009176 | Bacteria | 5270 |
| 361 | Ga0105242_10043456 | 3300009176 | Bacteria | 3635 |
| 362 | Ga0105248_10011305 | 3300009177 | Bacteria | 9844 |
| 363 | Ga0105248_10031416 | 3300009177 | Bacteria | 5936 |
| 364 | Ga0105248_10043099 | 3300009177 | Bacteria | 5061 |
| 365 | Ga0105248_10076338 | 3300009177 | Bacteria | 3766 |
| 366 | Ga0105248_10333411 | 3300009177 | Bacteria | 1708 |
| 367 | Ga0105237_10006171 | 3300009545 | Bacteria | 13387 |
| 368 | Ga0105237_10023639 | 3300009545 | Bacteria | 6294 |
| 369 | Ga0105237_10024205 | 3300009545 | Bacteria | 6213 |
| 370 | Ga0105237_10040193 | 3300009545 | Bacteria | 4718 |
| 371 | Ga0105238_10013907 | 3300009551 | Bacteria | 8139 |
| 372 | Ga0105238_10050560 | 3300009551 | Bacteria | 4184 |
| 373 | Ga0105238_10062496 | 3300009551 | Bacteria | 3725 |
| 374 | Ga0105238_10180828 | 3300009551 | Bacteria | 2086 |
| 375 | Ga0105249_10002196 | 3300009553 | Bacteria | 16907 |
| 376 | Ga0105249_10448538 | 3300009553 | Bacteria | 1328 |
| 377 | Ga0099796_10003100 | 3300010159 | Bacteria | 3790 |
| 378 | Ga0105239_10002791 | 3300010375 | Bacteria | 21868 |
| 379 | Ga0105239_10005450 | 3300010375 | Bacteria | 14930 |
| 380 | Ga0105239_10049106 | 3300010375 | Bacteria | 4627 |
| 381 | Ga0105239_10228125 | 3300010375 | Bacteria | 2089 |
| 382 | Ga0105246_10001585 | 3300011119 | Bacteria | 13535 |
| 383 | Ga0105246_10270441 | 3300011119 | Bacteria | 1358 |
| 384 | Ga0105246_10404033 | 3300011119 | Bacteria | 1135 |
| 385 | Ga0157341_1001083 | 3300012494 | Bacteria | 1561 |
| 386 | Ga0157338_1000167 | 3300012515 | Bacteria | 3282 |
| 387 | Ga0157373_10006240 | 3300013100 | Bacteria | 8908 |
| 388 | Ga0157373_10145122 | 3300013100 | Bacteria | 1669 |
| 389 | Ga0157371_10047027 | 3300013102 | Bacteria | 3067 |
| 390 | Ga0157371_10155413 | 3300013102 | Bacteria | 1632 |
| 391 | Ga0157370_10030489 | 3300013104 | Bacteria | 5283 |
| 392 | Ga0157370_10208804 | 3300013104 | Bacteria | 1810 |
| 393 | Ga0157369_10160600 | 3300013105 | Bacteria | 2372 |
| 394 | Ga0157374_10001691 | 3300013296 | Bacteria | 18474 |
| 395 | Ga0157374_10398584 | 3300013296 | Bacteria | 1373 |
| 396 | Ga0157378_10001445 | 3300013297 | Bacteria | 21386 |
| 397 | Ga0157378_10049325 | 3300013297 | Bacteria | 3745 |
| 398 | Ga0157378_10052925 | 3300013297 | Bacteria | 3612 |
| 399 | Ga0157378_10510714 | 3300013297 | Bacteria | 1202 |
| 400 | Ga0163162_10000790 | 3300013306 | Bacteria | 29412 |
| 401 | Ga0157372_10009037 | 3300013307 | Bacteria | 10590 |
| 402 | Ga0157372_10419820 | 3300013307 | Bacteria | 1559 |
| 403 | Ga0157375_10000468 | 3300013308 | Bacteria | 36848 |
| 404 | Ga0157375_10048514 | 3300013308 | Bacteria | 4154 |
| 405 | Ga0157375_10182541 | 3300013308 | Bacteria | 2250 |
| 406 | Ga0163163_10003322 | 3300014325 | Bacteria | 13641 |
| 407 | Ga0163163_10020189 | 3300014325 | Bacteria | 6270 |
| 408 | Ga0163163_10061676 | 3300014325 | Bacteria | 3715 |
| 409 | Ga0163163_10111016 | 3300014325 | Bacteria | 2771 |
| 410 | Ga0163163_10398212 | 3300014325 | Bacteria | 1435 |
| 411 | Ga0157380_10002913 | 3300014326 | Bacteria | 11638 |
| 412 | Ga0157380_10043495 | 3300014326 | Bacteria | 3517 |
| 413 | Ga0157377_10000276 | 3300014745 | Bacteria | 24762 |
| 414 | Ga0157377_10038382 | 3300014745 | Bacteria | 2643 |
| 415 | Ga0157379_10002285 | 3300014968 | Bacteria | 15975 |
| 416 | Ga0157379_10031389 | 3300014968 | Bacteria | 4732 |
| 417 | Ga0157376_10000692 | 3300014969 | Bacteria | 21811 |
| 418 | Ga0157376_10042226 | 3300014969 | Bacteria | 3737 |
| 419 | Ga0163161_10000384 | 3300017792 | Bacteria | 37040 |
| 420 | Ga0163161_10039131 | 3300017792 | Bacteria | 3403 |
| 421 | Ga0163161_10047076 | 3300017792 | Bacteria | 3114 |
| 422 | Ga0213872_10022015 | 3300021361 | Bacteria | 2936 |
| 423 | Ga0213876_10012755 | 3300021384 | Bacteria | 4468 |
| 424 | Ga0224572_1010337 | 3300024225 | Bacteria | 1753 |
| 425 | Ga0207666_1000097 | 3300025271 | Bacteria | 13853 |
| 426 | Ga0207673_1000201 | 3300025290 | Bacteria | 5994 |
| 427 | Ga0209758_1000638 | 3300025297 | Bacteria | 53416 |
| 428 | Ga0209758_1030349 | 3300025297 | Bacteria | 2241 |
| 429 | Ga0207426_1034655 | 3300025302 | Bacteria | 1618 |
| 430 | Ga0207697_10000550 | 3300025315 | Bacteria | 21243 |
| 431 | Ga0207656_10104678 | 3300025321 | Bacteria | 1301 |
| 432 | Ga0207682_10000088 | 3300025893 | Bacteria | 41732 |
| 433 | Ga0207682_10081589 | 3300025893 | Bacteria | 1387 |
| 434 | Ga0207692_10000876 | 3300025898 | Bacteria | 10871 |
| 435 | Ga0207692_10001204 | 3300025898 | Bacteria | 9606 |
| 436 | Ga0207692_10001966 | 3300025898 | Bacteria | 7840 |
| 437 | Ga0207642_10000381 | 3300025899 | Bacteria | 13280 |
| 438 | Ga0207642_10020631 | 3300025899 | Bacteria | 2577 |
| 439 | Ga0207710_10001324 | 3300025900 | Bacteria | 12473 |
| 440 | Ga0207710_10001609 | 3300025900 | Bacteria | 11050 |
| 441 | Ga0207710_10006390 | 3300025900 | Bacteria | 5037 |
| 442 | Ga0207710_10144383 | 3300025900 | Bacteria | 1151 |
| 443 | Ga0207688_10001203 | 3300025901 | Bacteria | 13390 |
| 444 | Ga0207688_10002655 | 3300025901 | Bacteria | 9680 |
| 445 | Ga0207688_10059462 | 3300025901 | Bacteria | 2153 |
| 446 | Ga0207680_10009047 | 3300025903 | Bacteria | 4921 |
| 447 | Ga0207680_10132841 | 3300025903 | Bacteria | 1642 |
| 448 | Ga0207680_10148619 | 3300025903 | Bacteria | 1560 |
| 449 | Ga0207647_10002714 | 3300025904 | Bacteria | 13370 |
| 450 | Ga0207647_10019352 | 3300025904 | Bacteria | 4580 |
| 451 | Ga0207647_10075399 | 3300025904 | Bacteria | 2030 |
| 452 | Ga0207685_10154206 | 3300025905 | Bacteria | 1043 |
| 453 | Ga0207699_10000531 | 3300025906 | Bacteria | 18820 |
| 454 | Ga0207699_10002088 | 3300025906 | Bacteria | 9440 |
| 455 | Ga0207699_10328147 | 3300025906 | Bacteria | 1075 |
| 456 | Ga0207645_10000140 | 3300025907 | Bacteria | 55845 |
| 457 | Ga0207645_10034330 | 3300025907 | Bacteria | 3259 |
| 458 | Ga0207645_10035558 | 3300025907 | Bacteria | 3198 |
| 459 | Ga0207645_10059966 | 3300025907 | Bacteria | 2430 |
| 460 | Ga0207643_10000083 | 3300025908 | Bacteria | 62116 |
| 461 | Ga0207643_10001883 | 3300025908 | Bacteria | 11586 |
| 462 | Ga0207705_10098196 | 3300025909 | Bacteria | 2151 |
| 463 | Ga0207684_10075371 | 3300025910 | Bacteria | 2867 |
| 464 | Ga0207684_10173160 | 3300025910 | Bacteria | 1861 |
| 465 | Ga0207654_10002699 | 3300025911 | Bacteria | 9011 |
| 466 | Ga0207707_10020854 | 3300025912 | Bacteria | 5724 |
| 467 | Ga0207707_10160248 | 3300025912 | Bacteria | 1967 |
| 468 | Ga0207707_10220579 | 3300025912 | Bacteria | 1650 |
| 469 | Ga0207695_10167547 | 3300025913 | Bacteria | 2124 |
| 470 | Ga0207695_10371047 | 3300025913 | Bacteria | 1317 |
| 471 | Ga0207695_10416759 | 3300025913 | Bacteria | 1227 |
| 472 | Ga0207671_10004533 | 3300025914 | Bacteria | 13203 |
| 473 | Ga0207671_10022987 | 3300025914 | Bacteria | 4707 |
| 474 | Ga0207671_10046170 | 3300025914 | Bacteria | 3222 |
| 475 | Ga0207671_10065535 | 3300025914 | Bacteria | 2702 |
| 476 | Ga0207693_10004067 | 3300025915 | Bacteria | 12427 |
| 477 | Ga0207693_10007304 | 3300025915 | Bacteria | 9091 |
| 478 | Ga0207693_10009632 | 3300025915 | Bacteria | 7866 |
| 479 | Ga0207693_10015829 | 3300025915 | Bacteria | 6041 |
| 480 | Ga0207693_10021626 | 3300025915 | Bacteria | 5112 |
| 481 | Ga0207693_10021894 | 3300025915 | Bacteria | 5083 |
| 482 | Ga0207693_10078050 | 3300025915 | Bacteria | 2592 |
| 483 | Ga0207663_10001909 | 3300025916 | Bacteria | 9867 |
| 484 | Ga0207663_10021132 | 3300025916 | Bacteria | 3700 |
| 485 | Ga0207663_10029176 | 3300025916 | Bacteria | 3237 |
| 486 | Ga0207660_10000073 | 3300025917 | Bacteria | 51871 |
| 487 | Ga0207660_10101848 | 3300025917 | Bacteria | 2146 |
| 488 | Ga0207662_10000964 | 3300025918 | Bacteria | 13368 |
| 489 | Ga0207662_10001013 | 3300025918 | Bacteria | 13138 |
| 490 | Ga0207662_10019591 | 3300025918 | Bacteria | 3853 |
| 491 | Ga0207662_10199088 | 3300025918 | Bacteria | 1296 |
| 492 | Ga0207657_10005395 | 3300025919 | Bacteria | 13362 |
| 493 | Ga0207657_10009757 | 3300025919 | Bacteria | 9625 |
| 494 | Ga0207657_10020125 | 3300025919 | Bacteria | 6315 |
| 495 | Ga0207657_10033571 | 3300025919 | Bacteria | 4624 |
| 496 | Ga0207657_10068436 | 3300025919 | Bacteria | 3016 |
| 497 | Ga0207649_10000450 | 3300025920 | Bacteria | 29604 |
| 498 | Ga0207649_10013956 | 3300025920 | Bacteria | 4494 |
| 499 | Ga0207649_10020627 | 3300025920 | Bacteria | 3781 |
| 500 | Ga0207652_10008726 | 3300025921 | Bacteria | 8158 |
| 501 | Ga0207652_10028066 | 3300025921 | Bacteria | 4693 |
| 502 | Ga0207652_10088727 | 3300025921 | Bacteria | 2714 |
| 503 | Ga0207652_10341105 | 3300025921 | Bacteria | 1352 |
| 504 | Ga0207652_10408231 | 3300025921 | Bacteria | 1225 |
| 505 | Ga0207646_10070925 | 3300025922 | Bacteria | 3112 |
| 506 | Ga0207681_10000097 | 3300025923 | Bacteria | 73836 |
| 507 | Ga0207694_10024241 | 3300025924 | Bacteria | 4606 |
| 508 | Ga0207694_10041733 | 3300025924 | Bacteria | 3536 |
| 509 | Ga0207694_10126736 | 3300025924 | Bacteria | 2043 |
| 510 | Ga0207650_10002648 | 3300025925 | Bacteria | 12388 |
| 511 | Ga0207650_10020241 | 3300025925 | Bacteria | 4690 |
| 512 | Ga0207650_10042894 | 3300025925 | Bacteria | 3319 |
| 513 | Ga0207659_10000092 | 3300025926 | Bacteria | 52642 |
| 514 | Ga0207659_10006748 | 3300025926 | Bacteria | 7053 |
| 515 | Ga0207659_10020865 | 3300025926 | Bacteria | 4338 |
| 516 | Ga0207687_10000219 | 3300025927 | Bacteria | 38995 |
| 517 | Ga0207687_10029871 | 3300025927 | Bacteria | 3669 |
| 518 | Ga0207687_10219639 | 3300025927 | Bacteria | 1496 |
| 519 | Ga0207700_10002485 | 3300025928 | Bacteria | 10567 |
| 520 | Ga0207700_10018036 | 3300025928 | Bacteria | 4730 |
| 521 | Ga0207664_10005574 | 3300025929 | Bacteria | 8618 |
| 522 | Ga0207664_10014579 | 3300025929 | Bacteria | 5681 |
| 523 | Ga0207664_10309524 | 3300025929 | Bacteria | 1391 |
| 524 | Ga0207644_10021419 | 3300025931 | Bacteria | 4403 |
| 525 | Ga0207644_10091736 | 3300025931 | Bacteria | 2265 |
| 526 | Ga0207644_10119158 | 3300025931 | Bacteria | 2007 |
| 527 | Ga0207690_10003312 | 3300025932 | Bacteria | 9636 |
| 528 | Ga0207690_10104156 | 3300025932 | Bacteria | 2032 |
| 529 | Ga0207706_10004310 | 3300025933 | Bacteria | 13370 |
| 530 | Ga0207706_10005901 | 3300025933 | Bacteria | 11393 |
| 531 | Ga0207706_10008823 | 3300025933 | Bacteria | 9280 |
| 532 | Ga0207706_10035694 | 3300025933 | Bacteria | 4419 |
| 533 | Ga0207706_10285828 | 3300025933 | Bacteria | 1438 |
| 534 | Ga0207706_10306745 | 3300025933 | Bacteria | 1382 |
| 535 | Ga0207686_10000796 | 3300025934 | Bacteria | 19364 |
| 536 | Ga0207686_10007990 | 3300025934 | Bacteria | 5703 |
| 537 | Ga0207686_10219760 | 3300025934 | Bacteria | 1371 |
| 538 | Ga0207709_10000362 | 3300025935 | Bacteria | 45886 |
| 539 | Ga0207709_10222423 | 3300025935 | Bacteria | 1362 |
| 540 | Ga0207670_10002375 | 3300025936 | Bacteria | 9862 |
| 541 | Ga0207670_10061867 | 3300025936 | Bacteria | 2556 |
| 542 | Ga0207670_10097107 | 3300025936 | Bacteria | 2097 |
| 543 | Ga0207670_10361239 | 3300025936 | Bacteria | 1152 |
| 544 | Ga0207669_10000350 | 3300025937 | Bacteria | 20966 |
| 545 | Ga0207669_10014842 | 3300025937 | Bacteria | 3915 |
| 546 | Ga0207669_10132331 | 3300025937 | Bacteria | 1716 |
| 547 | Ga0207704_10000479 | 3300025938 | Bacteria | 17812 |
| 548 | Ga0207704_10012862 | 3300025938 | Bacteria | 4167 |
| 549 | Ga0207665_10000577 | 3300025939 | Bacteria | 24683 |
| 550 | Ga0207665_10001702 | 3300025939 | Bacteria | 14793 |
| 551 | Ga0207665_10025177 | 3300025939 | Bacteria | 3925 |
| 552 | Ga0207665_10144615 | 3300025939 | Bacteria | 1698 |
| 553 | Ga0207691_10000283 | 3300025940 | Bacteria | 50040 |
| 554 | Ga0207691_10040853 | 3300025940 | Bacteria | 4285 |
| 555 | Ga0207691_10070775 | 3300025940 | Bacteria | 3149 |
| 556 | Ga0207691_10097671 | 3300025940 | Bacteria | 2625 |
| 557 | Ga0207711_10009170 | 3300025941 | Bacteria | 8267 |
| 558 | Ga0207711_10076028 | 3300025941 | Bacteria | 2923 |
| 559 | Ga0207711_10087463 | 3300025941 | Bacteria | 2734 |
| 560 | Ga0207711_10102644 | 3300025941 | Bacteria | 2532 |
| 561 | Ga0207711_10221806 | 3300025941 | Bacteria | 1729 |
| 562 | Ga0207689_10000085 | 3300025942 | Bacteria | 75467 |
| 563 | Ga0207689_10002370 | 3300025942 | Bacteria | 17597 |
| 564 | Ga0207689_10044422 | 3300025942 | Bacteria | 3674 |
| 565 | Ga0207661_10000464 | 3300025944 | Bacteria | 26194 |
| 566 | Ga0207661_10009753 | 3300025944 | Bacteria | 6897 |
| 567 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 568 | Ga0207679_10006772 | 3300025945 | Bacteria | 7259 |
| 569 | Ga0207679_10279643 | 3300025945 | Bacteria | 1431 |
| 570 | Ga0207667_10028631 | 3300025949 | Bacteria | 6049 |
| 571 | Ga0207667_10047002 | 3300025949 | Bacteria | 4570 |
| 572 | Ga0207667_10077756 | 3300025949 | Bacteria | 3440 |
| 573 | Ga0207667_10105591 | 3300025949 | Bacteria | 2906 |
| 574 | Ga0207667_10129105 | 3300025949 | Bacteria | 2603 |
| 575 | Ga0207651_10000422 | 3300025960 | Bacteria | 18024 |
| 576 | Ga0207651_10032933 | 3300025960 | Bacteria | 3335 |
| 577 | Ga0207712_10004682 | 3300025961 | Bacteria | 8649 |
| 578 | Ga0207712_10026073 | 3300025961 | Bacteria | 3891 |
| 579 | Ga0207712_10123332 | 3300025961 | Bacteria | 1964 |
| 580 | Ga0207668_10000114 | 3300025972 | Bacteria | 57323 |
| 581 | Ga0207668_10108475 | 3300025972 | Bacteria | 2078 |
| 582 | Ga0207640_10000141 | 3300025981 | Bacteria | 52638 |
| 583 | Ga0207658_10007681 | 3300025986 | Bacteria | 7343 |
| 584 | Ga0207658_10024116 | 3300025986 | Bacteria | 4252 |
| 585 | Ga0207658_10261028 | 3300025986 | Bacteria | 1476 |
| 586 | Ga0207677_10001776 | 3300026023 | Bacteria | 11384 |
| 587 | Ga0207677_10013991 | 3300026023 | Bacteria | 4669 |
| 588 | Ga0207677_10201482 | 3300026023 | Bacteria | 1582 |
| 589 | Ga0207703_10000983 | 3300026035 | Bacteria | 27443 |
| 590 | Ga0207703_10010486 | 3300026035 | Bacteria | 7244 |
| 591 | Ga0207703_10091348 | 3300026035 | Bacteria | 2561 |
| 592 | Ga0207703_10331244 | 3300026035 | Bacteria | 1397 |
| 593 | Ga0207639_10000305 | 3300026041 | Bacteria | 34869 |
| 594 | Ga0207639_10320401 | 3300026041 | Bacteria | 1376 |
| 595 | Ga0207639_10325978 | 3300026041 | Bacteria | 1365 |
| 596 | Ga0207678_10000125 | 3300026067 | Bacteria | 63817 |
| 597 | Ga0207678_10026095 | 3300026067 | Bacteria | 5097 |
| 598 | Ga0207678_10118507 | 3300026067 | Bacteria | 2259 |
| 599 | Ga0207678_10121814 | 3300026067 | Bacteria | 2226 |
| 600 | Ga0207678_10303421 | 3300026067 | Bacteria | 1372 |
| 601 | Ga0207708_10000187 | 3300026075 | Bacteria | 48792 |
| 602 | Ga0207708_10000256 | 3300026075 | Bacteria | 41918 |
| 603 | Ga0207708_10014918 | 3300026075 | Bacteria | 5818 |
| 604 | Ga0207708_10140412 | 3300026075 | Bacteria | 1894 |
| 605 | Ga0207708_10204175 | 3300026075 | Bacteria | 1577 |
| 606 | Ga0207702_10005437 | 3300026078 | Bacteria | 11146 |
| 607 | Ga0207702_10025565 | 3300026078 | Bacteria | 4902 |
| 608 | Ga0207702_10128627 | 3300026078 | Bacteria | 2276 |
| 609 | Ga0207702_10363703 | 3300026078 | Bacteria | 1387 |
| 610 | Ga0207641_10003649 | 3300026088 | Bacteria | 13575 |
| 611 | Ga0207641_10055119 | 3300026088 | Bacteria | 3376 |
| 612 | Ga0207648_10002168 | 3300026089 | Bacteria | 21342 |
| 613 | Ga0207648_10004949 | 3300026089 | Bacteria | 13558 |
| 614 | Ga0207648_10304255 | 3300026089 | Bacteria | 1430 |
| 615 | Ga0207648_10383293 | 3300026089 | Bacteria | 1271 |
| 616 | Ga0207676_10000074 | 3300026095 | Bacteria | 101208 |
| 617 | Ga0207676_10007288 | 3300026095 | Bacteria | 7840 |
| 618 | Ga0207676_10019580 | 3300026095 | Bacteria | 4939 |
| 619 | Ga0207676_10240398 | 3300026095 | Bacteria | 1624 |
| 620 | Ga0207676_10513292 | 3300026095 | Bacteria | 1140 |
| 621 | Ga0207674_10002501 | 3300026116 | Bacteria | 23186 |
| 622 | Ga0207675_100002373 | 3300026118 | Bacteria | 18649 |
| 623 | Ga0207675_100004556 | 3300026118 | Bacteria | 13370 |
| 624 | Ga0207675_100109415 | 3300026118 | Bacteria | 2607 |
| 625 | Ga0207675_100492846 | 3300026118 | Bacteria | 1219 |
| 626 | Ga0207683_10000014 | 3300026121 | Bacteria | 128817 |
| 627 | Ga0207683_10003999 | 3300026121 | Bacteria | 12769 |
| 628 | Ga0207683_10005254 | 3300026121 | Bacteria | 11113 |
| 629 | Ga0207683_10009094 | 3300026121 | Bacteria | 8467 |
| 630 | Ga0207683_10045519 | 3300026121 | Bacteria | 3838 |
| 631 | Ga0207698_10001242 | 3300026142 | Bacteria | 14899 |
| 632 | Ga0207698_10054980 | 3300026142 | Bacteria | 3065 |
| 633 | Ga0207698_10070852 | 3300026142 | Bacteria | 2764 |
| 634 | Ga0207698_10230441 | 3300026142 | Bacteria | 1681 |
| 635 | Ga0207698_10324819 | 3300026142 | Bacteria | 1443 |
| 636 | Ga0209371_1002632 | 3300027312 | Bacteria | 9810 |
| 637 | Ga0209999_1007609 | 3300027543 | Bacteria | 1949 |
| 638 | Ga0210002_1003004 | 3300027617 | Bacteria | 2475 |
| 639 | Ga0209588_1025585 | 3300027671 | Bacteria | 1868 |
| 640 | Ga0209971_1016252 | 3300027682 | Bacteria | 1765 |
| 641 | Ga0209966_1004843 | 3300027695 | Bacteria | 2295 |
| 642 | Ga0209966_1006091 | 3300027695 | Bacteria | 2087 |
| 643 | Ga0209998_10000361 | 3300027717 | Bacteria | 13355 |
| 644 | Ga0209998_10001516 | 3300027717 | Bacteria | 5583 |
| 645 | Ga0209974_10012895 | 3300027876 | Bacteria | 2790 |
| 646 | Ga0209974_10050653 | 3300027876 | Bacteria | 1395 |
| 647 | Ga0207428_10000114 | 3300027907 | Bacteria | 109533 |
| 648 | Ga0207428_10000467 | 3300027907 | Bacteria | 48756 |
| 649 | Ga0207428_10011322 | 3300027907 | Bacteria | 7891 |
| 650 | Ga0268266_10000857 | 3300028379 | Bacteria | 39606 |
| 651 | Ga0268266_10004080 | 3300028379 | Bacteria | 14118 |
| 652 | Ga0268266_10341602 | 3300028379 | Bacteria | 1405 |
| 653 | Ga0268265_10009966 | 3300028380 | Bacteria | 6417 |
| 654 | Ga0268265_10129476 | 3300028380 | Bacteria | 2095 |
| 655 | Ga0268265_10280135 | 3300028380 | Bacteria | 1491 |
| 656 | Ga0268264_10000162 | 3300028381 | Bacteria | 148472 |
| 657 | Ga0268264_10000469 | 3300028381 | Bacteria | 54801 |
| 658 | Ga0268264_10102270 | 3300028381 | Bacteria | 2493 |
| 659 | Ga0265337_1001464 | 3300028556 | Bacteria | 11576 |
| 660 | Ga0265338_10068822 | 3300028800 | Bacteria | 3046 |
| 661 | Ga0268256_1003412 | 3300030500 | Bacteria | 7165 |
| 662 | Ga0307511_10059052 | 3300030521 | Bacteria | 2955 |
| 663 | Ga0265763_1000156 | 3300030763 | Bacteria | 3478 |
| 664 | Ga0265760_10055801 | 3300031090 | Bacteria | 1195 |
| 665 | Ga0265332_10000801 | 3300031238 | Bacteria | 19094 |
| 666 | Ga0265325_10000423 | 3300031241 | Bacteria | 30296 |
| 667 | Ga0265325_10025904 | 3300031241 | Bacteria | 3181 |
| 668 | Ga0265325_10077594 | 3300031241 | Bacteria | 1656 |
| 669 | Ga0265329_10046196 | 3300031242 | Bacteria | 1391 |
| 670 | Ga0265339_10001378 | 3300031249 | Bacteria | 18132 |
| 671 | Ga0265339_10003373 | 3300031249 | Bacteria | 11182 |
| 672 | Ga0265331_10016240 | 3300031250 | Bacteria | 3913 |
| 673 | Ga0265331_10025748 | 3300031250 | Bacteria | 2966 |
| 674 | Ga0265316_10048508 | 3300031344 | Bacteria | 3351 |
| 675 | Ga0307513_10100118 | 3300031456 | Bacteria | 2925 |
| 676 | Ga0307509_10170661 | 3300031507 | Bacteria | 2055 |
| 677 | Ga0307509_10184029 | 3300031507 | Unclassified | 1950 |
| 678 | Ga0307509_10193454 | 3300031507 | Bacteria | 1881 |
| 679 | Ga0307408_100257788 | 3300031548 | Bacteria | 1442 |
| 680 | Ga0265313_10000115 | 3300031595 | Bacteria | 81365 |
| 681 | Ga0265313_10002944 | 3300031595 | Bacteria | 14219 |
| 682 | Ga0265313_10034290 | 3300031595 | Bacteria | 2568 |
| 683 | Ga0307508_10000001 | 3300031616 | Bacteria | 553635 |
| 684 | Ga0307508_10042265 | 3300031616 | Bacteria | 4090 |
| 685 | Ga0307508_10057284 | 3300031616 | Bacteria | 3448 |
| 686 | Ga0307508_10064279 | 3300031616 | Bacteria | 3234 |
| 687 | Ga0265314_10005122 | 3300031711 | Bacteria | 11925 |
| 688 | Ga0265314_10120472 | 3300031711 | Bacteria | 1653 |
| 689 | Ga0265342_10000011 | 3300031712 | Bacteria | 208435 |
| 690 | Ga0265342_10000763 | 3300031712 | Bacteria | 32827 |
| 691 | Ga0316576_10001056 | 3300031727 | Bacteria | 14298 |
| 692 | Ga0307516_10012533 | 3300031730 | Bacteria | 9129 |
| 693 | Ga0307516_10198555 | 3300031730 | Bacteria | 1727 |
| 694 | Ga0307405_10358939 | 3300031731 | Bacteria | 1127 |
| 695 | Ga0307410_10160269 | 3300031852 | Bacteria | 1685 |
| 696 | Ga0307416_100543646 | 3300032002 | Bacteria | 1234 |
| 697 | Ga0316583_10005398 | 3300032133 | Bacteria | 4588 |
| 698 | Ga0307507_10123347 | 3300033179 | Bacteria | 2062 |
| 699 | Ga0307510_10068958 | 3300033180 | Bacteria | 3545 |
| 700 | Ga0307510_10093546 | 3300033180 | Bacteria | 2837 |
| 701 | Ga0316215_1001492 | 3300033544 | Bacteria | 2244 |
| 702 | Ga0373930_0000150 | 3300034816 | Bacteria | 7874 |
| 703 | Ga0373930_0001117 | 3300034816 | Bacteria | 3901 |
| 704 | Ga0373948_0000307 | 3300034817 | Bacteria | 5896 |
| 705 | Ga0373948_0002698 | 3300034817 | Bacteria | 2652 |
| 706 | Ga0373959_0001657 | 3300034820 | Bacteria | 3542 |
| 707 | Ga0373938_0010297 | 3300034957 | Bacteria | 1715 |
| 708 | Ga0373926_0027180 | 3300035083 | Bacteria | 2003 |
| 709 | Ga0373928_0000222 | 3300035084 | Bacteria | 11055 |
| 710 | Ga0373929_0002112 | 3300035085 | Bacteria | 3692 |
| 711 | Ga0373934_0005831 | 3300035086 | Bacteria | 4559 |
| 712 | Ga0373934_0027921 | 3300035086 | Bacteria | 2196 |
| 713 | Ga0373944_0001828 | 3300035089 | Bacteria | 5375 |
| 714 | Ga0373949_0001450 | 3300035090 | Bacteria | 6781 |
| 715 | Ga0373951_0000721 | 3300035091 | Bacteria | 9071 |
| 716 | Ga0373951_0001245 | 3300035091 | Bacteria | 6752 |
| 717 | Ga0373951_0011607 | 3300035091 | Bacteria | 1979 |
| 718 | Ga0373952_0000029 | 3300035092 | Bacteria | 16517 |
| 719 | Ga0373952_0000148 | 3300035092 | Bacteria | 10384 |
| 720 | Ga0373952_0011726 | 3300035092 | Bacteria | 1714 |
| 721 | Ga0373952_0017850 | 3300035092 | Bacteria | 1461 |
| 722 | Ga0373932_0001251 | 3300035112 | Bacteria | 7218 |
| 723 | Ga0373932_0004135 | 3300035112 | Bacteria | 3447 |
| 724 | Ga0373936_0006326 | 3300035113 | Bacteria | 4461 |
| 725 | Ga0373939_0000339 | 3300035114 | Bacteria | 11943 |
| 726 | Ga0373939_0002855 | 3300035114 | Bacteria | 4058 |
| 727 | Ga0373939_0007617 | 3300035114 | Bacteria | 2632 |
| 728 | Ga0373939_0052100 | 3300035114 | Bacteria | 1274 |
| 729 | Ga0373941_0000835 | 3300035115 | Bacteria | 6328 |
| 730 | Ga0373941_0002285 | 3300035115 | Bacteria | 4194 |
| 731 | Ga0373941_0036460 | 3300035115 | Bacteria | 1496 |
| 732 | Ga0373945_0089477 | 3300035116 | Bacteria | 1190 |
| 733 | Ga0373953_0006310 | 3300035117 | Bacteria | 3900 |
| 734 | Ga0373953_0019732 | 3300035117 | Bacteria | 2511 |
| 735 | Ga0373953_0023666 | 3300035117 | Bacteria | 2327 |
| 736 | Ga0373954_0024463 | 3300035118 | Bacteria | 2754 |
| 737 | Ga0373954_0024781 | 3300035118 | Bacteria | 2738 |
| 738 | Ga0373956_0045734 | 3300035119 | Bacteria | 1954 |
| 739 | Ga0373956_0115125 | 3300035119 | Bacteria | 1253 |
| 740 | Ga0373960_0000372 | 3300035121 | Bacteria | 8658 |
| 741 | Ga0373960_0025992 | 3300035121 | Bacteria | 1596 |
| 742 | Ga0373960_0064146 | 3300035121 | Bacteria | 1121 |
| 743 | Ga0373943_0016793 | 3300035170 | Bacteria | 3344 |
| 744 | Ga0373943_0209439 | 3300035170 | Bacteria | 1082 |
| 745 | Ga0373946_0006340 | 3300035171 | Bacteria | 4288 |
| 746 | Ga0373946_0009821 | 3300035171 | Bacteria | 3534 |
| 747 | Ga0373946_0041237 | 3300035171 | Bacteria | 1892 |
| 748 | Ga0373955_0001269 | 3300035172 | Bacteria | 10731 |
| 749 | Ga0373955_0001523 | 3300035172 | Bacteria | 9899 |
| 750 | Ga0373955_0004969 | 3300035172 | Bacteria | 5934 |
| 751 | Ga0373955_0011500 | 3300035172 | Bacteria | 4221 |
| 752 | Ga0373955_0043425 | 3300035172 | Bacteria | 2418 |
| 753 | Ga0373942_0000767 | 3300035207 | Bacteria | 8832 |
| 754 | Ga0373961_0001835 | 3300035241 | Bacteria | 5803 |
| 755 | Ga0373961_0003896 | 3300035241 | Bacteria | 3641 |
| 756 | Ga0373961_0019391 | 3300035241 | Bacteria | 1786 |
| 757 | Ga0373961_0054588 | 3300035241 | Bacteria | 1195 |
| 758 | Ga0373962_0005133 | 3300035242 | Bacteria | 3164 |
| 759 | Ga0373962_0005930 | 3300035242 | Bacteria | 2950 |
| 760 | Ga0373962_0006682 | 3300035242 | Bacteria | 2798 |
| 761 | Ga0373931_0000169 | 3300035691 | Bacteria | 28308 |
| 762 | Ga0373931_0006379 | 3300035691 | Bacteria | 5507 |
| 763 | Ga0373931_0088502 | 3300035691 | Bacteria | 1721 |
| 764 | Ga0373935_0020667 | 3300035692 | Bacteria | 4024 |
| 765 | Ga0373935_0057410 | 3300035692 | Bacteria | 2483 |
| 766 | Ga0373927_0016232 | 3300035695 | Bacteria | 4914 |
| 767 | Ga0373927_0050616 | 3300035695 | Bacteria | 2686 |
| 768 | Ga0373927_0210555 | 3300035695 | Bacteria | 1277 |
| 769 | Ga0373933_0005311 | 3300035724 | Bacteria | 7020 |
| 770 | Ga0373933_0014389 | 3300035724 | Bacteria | 4400 |
| 771 | Ga0373933_0017906 | 3300035724 | Bacteria | 3978 |
| 772 | Ga0373947_0007521 | 3300035725 | Bacteria | 6302 |
| 773 | Ga0373947_0157465 | 3300035725 | Bacteria | 1467 |
| 774 | Ga0373947_0193019 | 3300035725 | Bacteria | 1329 |
| 775 | Ga0373937_0001052 | 3300036401 | Bacteria | 23314 |
| 776 | Ga0373937_0007509 | 3300036401 | Bacteria | 9436 |
| 777 | Ga0373937_0038298 | 3300036401 | Bacteria | 4369 |
| 778 | Ga0373937_0049021 | 3300036401 | Bacteria | 3867 |
| 779 | Ga0373937_0055079 | 3300036401 | Bacteria | 3650 |
| 780 | Ga0373937_0110823 | 3300036401 | Bacteria | 2553 |
| 781 | Ga0373937_0537414 | 3300036401 | Bacteria | 1110 |
| 782 | Ga0372808_000887 | 3300036459 | Bacteria | 2781 |
| 783 | Ga0373925_0022589 | 3300037068 | Bacteria | 4590 |
| 784 | Ga0373925_0032152 | 3300037068 | Bacteria | 3860 |
| 785 | Ga0373925_0165210 | 3300037068 | Bacteria | 1745 |
| 786 | Ga0395899_0113398 | 3300037312 | Bacteria | 1947 |
| 787 | Ga0395899_0158714 | 3300037312 | Bacteria | 1599 |
| 788 | Ga0395900_0000917 | 3300037418 | Bacteria | 38740 |
| 789 | Ga0395900_0005265 | 3300037418 | Bacteria | 13568 |
| 790 | Ga0395900_0006751 | 3300037418 | Bacteria | 11909 |
| 791 | Ga0395900_0208698 | 3300037418 | Bacteria | 1973 |
| 792 | Ga0395898_0014510 | 3300037466 | Bacteria | 8090 |
| 793 | Ga0395898_0022478 | 3300037466 | Bacteria | 6387 |
| 794 | Ga0395898_0029930 | 3300037466 | Bacteria | 5451 |
| 795 | Ga0395898_0098943 | 3300037466 | Bacteria | 2801 |
| 796 | Ga0395898_0319420 | 3300037466 | Bacteria | 1481 |
| 797 | Ga0395905_0271090 | 3300037471 | Bacteria | 1583 |
| 798 | Ga0436364_0761681 | 3300037853 | Bacteria | 2241 |
| 799 | Ga0395901_0019066 | 3300038443 | Bacteria | 7015 |
| 800 | Ga0395901_0111106 | 3300038443 | Bacteria | 2878 |
| 801 | Ga0395901_0409119 | 3300038443 | Bacteria | 1393 |
| 802 | Ga0400489_28166 | 3300039093 | Bacteria | 38746 |
| 803 | Ga0436365_0193033 | 3300039437 | Bacteria | 10822 |
| 804 | Ga0436361_0291544 | 3300039447 | Bacteria | 2948 |
| 805 | Ga0436361_0425913 | 3300039447 | Bacteria | 2212 |
| 806 | Ga0436361_0452981 | 3300039447 | Bacteria | 2456 |
| 807 | Ga0436363_0379375 | 3300039450 | Bacteria | 8518 |
| 808 | Ga0439450_008705 | 3300042008 | Bacteria | 1902 |
| 809 | Ga0466966_0082720 | 3300044684 | Bacteria | 1997 |
| 810 | Ga0466963_0180802 | 3300044694 | Bacteria | 1472 |
| 811 | Ga0453684_0037028 | 3300044712 | Bacteria | 6705 |
| 812 | Ga0495592_0024186 | 3300046454 | Bacteria | 4617 |
| 813 | Ga0495592_0032431 | 3300046454 | Bacteria | 3940 |
| 814 | Ga0495592_0040848 | 3300046454 | Bacteria | 3479 |
| 815 | Ga0495592_0096600 | 3300046454 | Bacteria | 2112 |
| 816 | Ga0495592_0131419 | 3300046454 | Bacteria | 1750 |
| 817 | Ga0495603_0008030 | 3300046455 | Bacteria | 6373 |
| 818 | Ga0495603_0097985 | 3300046455 | Bacteria | 1712 |
| 819 | Ga0495629_0000535 | 3300046459 | Bacteria | 31312 |
| 820 | Ga0495629_0038335 | 3300046459 | Bacteria | 3376 |
| 821 | Ga0495629_0081599 | 3300046459 | Bacteria | 2257 |
| 822 | Ga0495629_0107782 | 3300046459 | Bacteria | 1943 |
| 823 | Ga0495638_0016637 | 3300046460 | Bacteria | 4921 |
| 824 | Ga0495638_0102310 | 3300046460 | Bacteria | 1712 |
| 825 | Ga0495641_0019259 | 3300046461 | Bacteria | 3497 |
| 826 | Ga0495651_0000606 | 3300046462 | Bacteria | 27884 |
| 827 | Ga0495651_0011021 | 3300046462 | Bacteria | 6956 |
| 828 | Ga0495651_0011844 | 3300046462 | Bacteria | 6706 |
| 829 | Ga0495651_0020645 | 3300046462 | Bacteria | 5114 |
| 830 | Ga0495651_0023992 | 3300046462 | Bacteria | 4746 |
| 831 | Ga0495651_0113072 | 3300046462 | Bacteria | 2005 |
| 832 | Ga0495653_0002673 | 3300046463 | Bacteria | 14197 |
| 833 | Ga0495653_0012564 | 3300046463 | Bacteria | 6915 |
| 834 | Ga0495653_0093751 | 3300046463 | Bacteria | 2189 |
| 835 | Ga0495580_0023721 | 3300046472 | Bacteria | 4499 |
| 836 | Ga0495580_0028270 | 3300046472 | Bacteria | 4077 |
| 837 | Ga0495582_0039312 | 3300046473 | Bacteria | 2604 |
| 838 | Ga0495582_0074369 | 3300046473 | Bacteria | 1881 |
| 839 | Ga0495662_0010283 | 3300046476 | Bacteria | 4586 |
| 840 | Ga0495662_0066440 | 3300046476 | Bacteria | 1744 |
| 841 | Ga0495664_0027493 | 3300046477 | Bacteria | 3316 |
| 842 | Ga0495664_0033931 | 3300046477 | Bacteria | 3000 |
| 843 | Ga0495664_0050337 | 3300046477 | Bacteria | 2474 |
| 844 | Ga0495584_0097244 | 3300046491 | Unclassified | 1487 |
| 845 | Ga0495585_0008366 | 3300046492 | Bacteria | 6274 |
| 846 | Ga0495594_0043598 | 3300046499 | Bacteria | 2459 |
| 847 | Ga0495594_0071026 | 3300046499 | Bacteria | 1936 |
| 848 | Ga0495607_0048620 | 3300046501 | Bacteria | 2479 |
| 849 | Ga0495606_0001220 | 3300046507 | Bacteria | 36013 |
| 850 | Ga0495606_0142136 | 3300046507 | Bacteria | 1416 |
| 851 | Ga0495608_0000591 | 3300046511 | Bacteria | 24964 |
| 852 | Ga0495608_0001474 | 3300046511 | Bacteria | 16724 |
| 853 | Ga0495608_0039849 | 3300046511 | Bacteria | 3148 |
| 854 | Ga0495608_0055452 | 3300046511 | Bacteria | 2619 |
| 855 | Ga0495618_0001466 | 3300046514 | Bacteria | 15809 |
| 856 | Ga0495618_0004984 | 3300046514 | Bacteria | 8114 |
| 857 | Ga0495618_0132206 | 3300046514 | Bacteria | 1596 |
| 858 | Ga0495628_0001927 | 3300046516 | Bacteria | 18830 |
| 859 | Ga0495628_0023873 | 3300046516 | Bacteria | 5015 |
| 860 | Ga0495628_0026853 | 3300046516 | Bacteria | 4686 |
| 861 | Ga0495628_0144414 | 3300046516 | Bacteria | 1814 |
| 862 | Ga0495628_0221416 | 3300046516 | Bacteria | 1421 |
| 863 | Ga0495630_0081198 | 3300046517 | Bacteria | 2447 |
| 864 | Ga0495630_0176249 | 3300046517 | Bacteria | 1630 |
| 865 | Ga0495631_0024362 | 3300046518 | Bacteria | 2794 |
| 866 | Ga0495632_0062790 | 3300046519 | Bacteria | 1800 |
| 867 | Ga0495644_0002701 | 3300046523 | Bacteria | 7045 |
| 868 | Ga0495644_0097729 | 3300046523 | Bacteria | 1110 |
| 869 | Ga0495666_0012992 | 3300046526 | Bacteria | 4150 |
| 870 | Ga0495666_0123226 | 3300046526 | Bacteria | 1213 |
| 871 | Ga0495652_0003497 | 3300046529 | Bacteria | 15467 |
| 872 | Ga0495652_0022449 | 3300046529 | Bacteria | 5599 |
| 873 | Ga0495652_0048857 | 3300046529 | Bacteria | 3624 |
| 874 | Ga0495652_0121480 | 3300046529 | Bacteria | 2082 |
| 875 | Ga0495665_0023481 | 3300046531 | Bacteria | 3312 |
| 876 | Ga0495640_0002454 | 3300046533 | Bacteria | 14898 |
| 877 | Ga0495640_0054384 | 3300046533 | Bacteria | 2742 |
| 878 | Ga0495640_0056745 | 3300046533 | Bacteria | 2674 |
| 879 | Ga0495586_0036479 | 3300046535 | Bacteria | 2639 |
| 880 | Ga0495587_0002240 | 3300046536 | Bacteria | 12923 |
| 881 | Ga0495587_0011870 | 3300046536 | Bacteria | 5506 |
| 882 | Ga0495587_0027093 | 3300046536 | Bacteria | 3490 |
| 883 | Ga0495587_0029413 | 3300046536 | Bacteria | 3335 |
| 884 | Ga0495587_0047875 | 3300046536 | Bacteria | 2534 |
| 885 | Ga0495645_0002539 | 3300046543 | Bacteria | 12383 |
| 886 | Ga0495645_0019854 | 3300046543 | Bacteria | 4842 |
| 887 | Ga0495645_0056174 | 3300046543 | Bacteria | 2858 |
| 888 | Ga0495645_0100340 | 3300046543 | Bacteria | 2059 |
| 889 | Ga0495622_0015565 | 3300046557 | Bacteria | 3535 |
| 890 | Ga0495622_0043586 | 3300046557 | Bacteria | 2086 |
| 891 | Ga0495633_0002969 | 3300046558 | Bacteria | 11596 |
| 892 | Ga0495667_0005199 | 3300046559 | Bacteria | 8796 |
| 893 | Ga0495667_0026523 | 3300046559 | Bacteria | 3905 |
| 894 | Ga0495667_0029602 | 3300046559 | Bacteria | 3686 |
| 895 | Ga0495667_0040819 | 3300046559 | Bacteria | 3079 |
| 896 | Ga0495667_0088464 | 3300046559 | Bacteria | 2007 |
| 897 | Ga0495656_0002822 | 3300046615 | Bacteria | 5812 |
| 898 | Ga0495656_0004061 | 3300046615 | Bacteria | 4982 |
| 899 | Ga0495668_0013965 | 3300046616 | Bacteria | 4722 |
| 900 | Ga0495634_0002842 | 3300046642 | Bacteria | 14216 |
| 901 | Ga0495635_0003751 | 3300046663 | Bacteria | 10547 |
| 902 | Ga0495635_0003881 | 3300046663 | Bacteria | 10388 |
| 903 | Ga0495635_0021401 | 3300046663 | Bacteria | 4506 |
| 904 | Ga0495635_0126093 | 3300046663 | Bacteria | 1746 |
| 905 | Ga0495635_0287356 | 3300046663 | Bacteria | 1104 |
| 906 | Ga0495661_0044928 | 3300046665 | Bacteria | 2705 |
| 907 | Ga0495588_0045221 | 3300046674 | Bacteria | 2256 |
| 908 | Ga0495588_0169779 | 3300046674 | Bacteria | 1153 |
| 909 | Ga0495657_0003270 | 3300046675 | Bacteria | 13307 |
| 910 | Ga0495657_0010946 | 3300046675 | Bacteria | 6803 |
| 911 | Ga0495599_0000564 | 3300046678 | Bacteria | 21162 |
| 912 | Ga0495599_0004481 | 3300046678 | Bacteria | 8275 |
| 913 | Ga0495599_0017530 | 3300046678 | Bacteria | 4451 |
| 914 | Ga0495599_0073266 | 3300046678 | Bacteria | 2138 |
| 915 | Ga0495623_0007330 | 3300046679 | Bacteria | 7157 |
| 916 | Ga0495623_0119469 | 3300046679 | Bacteria | 1588 |
| 917 | Ga0495646_0020687 | 3300046680 | Bacteria | 4163 |
| 918 | Ga0495646_0054563 | 3300046680 | Bacteria | 2403 |
| 919 | Ga0495646_0058838 | 3300046680 | Bacteria | 2296 |
| 920 | Ga0495647_0024629 | 3300046681 | Bacteria | 2192 |
| 921 | Ga0495647_0045345 | 3300046681 | Bacteria | 1688 |
| 922 | Ga0495647_0045645 | 3300046681 | Bacteria | 1684 |
| 923 | Ga0495658_0000788 | 3300046683 | Bacteria | 17050 |
| 924 | Ga0495658_0006062 | 3300046683 | Bacteria | 5938 |
| 925 | Ga0495658_0009215 | 3300046683 | Bacteria | 4909 |
| 926 | Ga0495669_0024391 | 3300046684 | Bacteria | 2634 |
| 927 | Ga0495669_0114672 | 3300046684 | Bacteria | 1260 |
| 928 | Ga0495613_0024361 | 3300046689 | Bacteria | 4510 |
| 929 | Ga0495613_0072271 | 3300046689 | Bacteria | 2514 |
| 930 | Ga0495613_0213481 | 3300046689 | Bacteria | 1356 |
| 931 | Ga0495624_0016249 | 3300046690 | Bacteria | 5011 |
| 932 | Ga0495670_0000291 | 3300046691 | Bacteria | 23680 |
| 933 | Ga0495600_0001326 | 3300046809 | Bacteria | 13661 |
| 934 | Ga0495600_0004060 | 3300046809 | Bacteria | 8704 |
| 935 | Ga0495600_0011214 | 3300046809 | Bacteria | 5584 |
| 936 | Ga0495600_0017893 | 3300046809 | Bacteria | 4510 |
| 937 | Ga0495600_0055606 | 3300046809 | Bacteria | 2585 |
| 938 | Ga0495600_0137385 | 3300046809 | Bacteria | 1587 |
| 939 | Ga0495581_0081264 | 3300047315 | Bacteria | 1876 |
| 940 | Ga0495581_0102123 | 3300047315 | Bacteria | 1666 |
| 941 | Ga0495604_0003818 | 3300047317 | Bacteria | 11995 |
| 942 | Ga0495604_0003891 | 3300047317 | Bacteria | 11887 |
| 943 | Ga0495604_0009082 | 3300047317 | Bacteria | 7865 |
| 944 | Ga0495604_0015025 | 3300047317 | Bacteria | 6176 |
| 945 | Ga0495604_0028398 | 3300047317 | Bacteria | 4451 |
| 946 | Ga0495604_0052923 | 3300047317 | Bacteria | 3141 |
| 947 | Ga0495674_0015363 | 3300047319 | Bacteria | 7160 |
| 948 | Ga0495674_0024339 | 3300047319 | Bacteria | 5564 |
| 949 | Ga0495674_0027169 | 3300047319 | Bacteria | 5232 |
| 950 | Ga0495674_0197387 | 3300047319 | Bacteria | 1670 |
| 951 | Ga0495674_0354222 | 3300047319 | Bacteria | 1191 |
| 952 | Ga0495672_0067708 | 3300047320 | Bacteria | 2033 |
| 953 | Ga0495676_0021794 | 3300047321 | Bacteria | 5588 |
| 954 | Ga0495676_0054077 | 3300047321 | Bacteria | 3194 |
| 955 | Ga0495676_0184784 | 3300047321 | Bacteria | 1458 |
| 956 | Ga0495680_0001686 | 3300047322 | Bacteria | 23465 |
| 957 | Ga0495680_0011254 | 3300047322 | Bacteria | 7932 |
| 958 | Ga0495680_0012959 | 3300047322 | Bacteria | 7301 |
| 959 | Ga0495680_0043116 | 3300047322 | Bacteria | 3575 |
| 960 | Ga0495680_0044687 | 3300047322 | Bacteria | 3502 |
| 961 | Ga0495680_0205372 | 3300047322 | Bacteria | 1412 |
| 962 | Ga0495675_0001544 | 3300047444 | Bacteria | 13904 |
| 963 | Ga0495675_0002669 | 3300047444 | Bacteria | 10688 |
| 964 | Ga0495675_0061543 | 3300047444 | Bacteria | 2378 |
| 965 | Ga0495675_0063085 | 3300047444 | Bacteria | 2345 |
| 966 | Ga0495675_0120623 | 3300047444 | Bacteria | 1633 |
| 967 | Ga0495684_0002087 | 3300047471 | Bacteria | 16070 |
| 968 | Ga0495684_0003625 | 3300047471 | Bacteria | 12034 |
| 969 | Ga0495684_0038790 | 3300047471 | Bacteria | 3652 |
| 970 | Ga0495684_0147563 | 3300047471 | Bacteria | 1760 |
| 971 | Ga0495593_0004626 | 3300047673 | Bacteria | 8180 |
| 972 | Ga0495593_0014724 | 3300047673 | Bacteria | 4445 |
| 973 | Ga0495593_0047243 | 3300047673 | Bacteria | 2290 |
| 974 | Ga0495602_0000740 | 3300048088 | Bacteria | 30918 |
| 975 | Ga0495602_0005526 | 3300048088 | Bacteria | 13262 |
| 976 | Ga0495602_0132217 | 3300048088 | Bacteria | 1988 |
| 977 | Ga0495602_0144903 | 3300048088 | Bacteria | 1875 |
| 978 | Ga0495614_0030039 | 3300048089 | Bacteria | 2338 |
| 979 | Ga0496100_0000106 | 3300048903 | Bacteria | 48123 |
| 980 | Ga0496100_0000499 | 3300048903 | Bacteria | 18860 |
| 981 | Ga0496100_0002951 | 3300048903 | Bacteria | 8748 |
| 982 | Ga0496100_0003648 | 3300048903 | Bacteria | 8050 |
| 983 | Ga0496100_0027659 | 3300048903 | Bacteria | 3489 |
| 984 | Ga0496100_0256274 | 3300048903 | Bacteria | 1296 |
| 985 | Ga0496100_0449331 | 3300048903 | Bacteria | 988 |
| 986 | Ga0496101_0000992 | 3300048904 | Bacteria | 16792 |
| 987 | Ga0496101_0002929 | 3300048904 | Bacteria | 10493 |
| 988 | Ga0496101_0003940 | 3300048904 | Bacteria | 9281 |
| 989 | Ga0496101_0020995 | 3300048904 | Bacteria | 4481 |
| 990 | Ga0496101_0023715 | 3300048904 | Bacteria | 4241 |
| 991 | Ga0496101_0228639 | 3300048904 | Bacteria | 1445 |
| 992 | Ga0496101_0279117 | 3300048904 | Bacteria | 1305 |
| 993 | Ga0496102_0011236 | 3300048905 | Bacteria | 7715 |
| 994 | Ga0496102_0019045 | 3300048905 | Bacteria | 6041 |
| 995 | Ga0496102_0039093 | 3300048905 | Bacteria | 4285 |
| 996 | Ga0496102_0372135 | 3300048905 | Bacteria | 1344 |
| 997 | Ga0496103_0003647 | 3300048906 | Bacteria | 9374 |
| 998 | Ga0496103_0006368 | 3300048906 | Bacteria | 7051 |
| 999 | Ga0496103_0014587 | 3300048906 | Bacteria | 4667 |
| 1000 | Ga0496103_0022038 | 3300048906 | Bacteria | 3834 |
| 1001 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 1002 | Ga0496104_0000506 | 3300048907 | Bacteria | 33454 |
| 1003 | Ga0496104_0005547 | 3300048907 | Bacteria | 11050 |
| 1004 | Ga0496104_0035462 | 3300048907 | Bacteria | 4657 |
| 1005 | Ga0496104_0122840 | 3300048907 | Bacteria | 2493 |
| 1006 | Ga0496105_0001574 | 3300048908 | Bacteria | 16176 |
| 1007 | Ga0496105_0003533 | 3300048908 | Bacteria | 11591 |
| 1008 | Ga0496105_0108687 | 3300048908 | Bacteria | 2290 |
| 1009 | Ga0496105_0161028 | 3300048908 | Bacteria | 1842 |
| 1010 | Ga0496106_0002499 | 3300048909 | Bacteria | 13684 |
| 1011 | Ga0496106_0002626 | 3300048909 | Bacteria | 13365 |
| 1012 | Ga0496106_0005418 | 3300048909 | Bacteria | 9437 |
| 1013 | Ga0496106_0012172 | 3300048909 | Bacteria | 6349 |
| 1014 | Ga0496106_0013964 | 3300048909 | Bacteria | 5939 |
| 1015 | Ga0496106_0019052 | 3300048909 | Bacteria | 5087 |
| 1016 | Ga0496106_0024338 | 3300048909 | Bacteria | 4500 |
| 1017 | Ga0496106_0173682 | 3300048909 | Bacteria | 1709 |
| 1018 | Ga0496107_0000223 | 3300048910 | Bacteria | 30018 |
| 1019 | Ga0496107_0015336 | 3300048910 | Bacteria | 5369 |
| 1020 | Ga0496107_0030108 | 3300048910 | Bacteria | 3867 |
| 1021 | Ga0496107_0034213 | 3300048910 | Bacteria | 3639 |
| 1022 | Ga0496107_0041516 | 3300048910 | Bacteria | 3303 |
| 1023 | Ga0496107_0044051 | 3300048910 | Bacteria | 3207 |
| 1024 | Ga0496108_0003914 | 3300048911 | Bacteria | 11960 |
| 1025 | Ga0496108_0007392 | 3300048911 | Bacteria | 8908 |
| 1026 | Ga0496108_0024579 | 3300048911 | Bacteria | 4961 |
| 1027 | Ga0496109_0002315 | 3300048912 | Bacteria | 15857 |
| 1028 | Ga0496109_0014846 | 3300048912 | Bacteria | 6778 |
| 1029 | Ga0496109_0039401 | 3300048912 | Bacteria | 4276 |
| 1030 | Ga0496109_0041676 | 3300048912 | Bacteria | 4158 |
| 1031 | Ga0496109_0052216 | 3300048912 | Bacteria | 3725 |
| 1032 | Ga0496109_0227777 | 3300048912 | Bacteria | 1753 |
| 1033 | Ga0496110_0003039 | 3300048913 | Bacteria | 12728 |
| 1034 | Ga0496110_0091854 | 3300048913 | Bacteria | 2716 |
| 1035 | Ga0496110_0234585 | 3300048913 | Bacteria | 1669 |
| 1036 | Ga0496110_0568629 | 3300048913 | Bacteria | 1029 |
| 1037 | Ga0496111_0064475 | 3300048914 | Bacteria | 2657 |
| 1038 | Ga0496112_0000009 | 3300048915 | Bacteria | 299708 |
| 1039 | Ga0496112_0035958 | 3300048915 | Bacteria | 4827 |
| 1040 | Ga0496112_0075543 | 3300048915 | Bacteria | 3332 |
| 1041 | Ga0496112_0089540 | 3300048915 | Bacteria | 3045 |
| 1042 | Ga0496112_0153498 | 3300048915 | Bacteria | 2270 |
| 1043 | Ga0496112_0283160 | 3300048915 | Bacteria | 1604 |
| 1044 | Ga0496112_0324574 | 3300048915 | Bacteria | 1483 |
| 1045 | Ga0496113_0000068 | 3300048916 | Bacteria | 45065 |
| 1046 | Ga0496113_0006216 | 3300048916 | Bacteria | 7545 |
| 1047 | Ga0496113_0010789 | 3300048916 | Bacteria | 6060 |
| 1048 | Ga0496114_0006516 | 3300048917 | Bacteria | 9201 |
| 1049 | Ga0496114_0006841 | 3300048917 | Bacteria | 8982 |
| 1050 | Ga0496114_0010582 | 3300048917 | Bacteria | 7339 |
| 1051 | Ga0496115_0016939 | 3300048918 | Bacteria | 5559 |
| 1052 | Ga0496115_0017044 | 3300048918 | Bacteria | 5541 |
| 1053 | Ga0496115_0021146 | 3300048918 | Bacteria | 5022 |
| 1054 | Ga0496115_0021880 | 3300048918 | Bacteria | 4945 |
| 1055 | Ga0496115_0070184 | 3300048918 | Bacteria | 2840 |
| 1056 | Ga0496115_0073152 | 3300048918 | Bacteria | 2781 |
| 1057 | Ga0496115_0092475 | 3300048918 | Bacteria | 2473 |
| 1058 | Ga0496115_0101293 | 3300048918 | Bacteria | 2361 |
| 1059 | Ga0496115_0152757 | 3300048918 | Bacteria | 1907 |
| 1060 | Ga0496116_0148251 | 3300048919 | Bacteria | 1308 |
| 1061 | Ga0496117_0097463 | 3300048920 | Bacteria | 1873 |
| 1062 | Ga0496118_0002370 | 3300048921 | Bacteria | 25500 |
| 1063 | Ga0496121_0000110 | 3300048924 | Bacteria | 186482 |
| 1064 | Ga0496121_0029635 | 3300048924 | Bacteria | 5052 |
| 1065 | Ga0496121_0053287 | 3300048924 | Bacteria | 3390 |
| 1066 | Ga0496124_0009400 | 3300048927 | Bacteria | 10072 |
| 1067 | Ga0496124_0081079 | 3300048927 | Bacteria | 2668 |
| 1068 | Ga0496126_0007157 | 3300048929 | Bacteria | 12282 |
| 1069 | Ga0496126_0077579 | 3300048929 | Bacteria | 2945 |
| 1070 | Ga0496126_0082735 | 3300048929 | Bacteria | 2835 |
| 1071 | Ga0501031_0065472 | 3300049568 | Bacteria | 2368 |
| 1072 | Ga0501031_0117126 | 3300049568 | Bacteria | 1740 |
| 1073 | Ga0501032_0000054 | 3300049569 | Bacteria | 100621 |
| 1074 | Ga0501032_0018083 | 3300049569 | Bacteria | 4944 |
| 1075 | Ga0501033_0000025 | 3300049570 | Bacteria | 173634 |
| 1076 | Ga0501033_0023027 | 3300049570 | Bacteria | 4695 |
| 1077 | Ga0501033_0028631 | 3300049570 | Bacteria | 4185 |
| 1078 | Ga0501033_0079600 | 3300049570 | Bacteria | 2404 |
| 1079 | Ga0501034_0000177 | 3300049571 | Bacteria | 118966 |
| 1080 | Ga0501034_0000852 | 3300049571 | Bacteria | 45151 |
| 1081 | Ga0501034_0002201 | 3300049571 | Bacteria | 24114 |
| 1082 | Ga0501034_0019869 | 3300049571 | Bacteria | 6863 |
| 1083 | Ga0501034_0050663 | 3300049571 | Bacteria | 4187 |
| 1084 | Ga0501034_0060308 | 3300049571 | Bacteria | 3811 |
| 1085 | Ga0501034_0091389 | 3300049571 | Bacteria | 3041 |
| 1086 | Ga0501034_0105422 | 3300049571 | Bacteria | 2812 |
| 1087 | Ga0501034_0162958 | 3300049571 | Bacteria | 2200 |
| 1088 | Ga0501034_0294162 | 3300049571 | Bacteria | 1561 |
| 1089 | Ga0501034_0444425 | 3300049571 | Bacteria | 1215 |
| 1090 | Ga0501034_0504993 | 3300049571 | Bacteria | 1123 |
| 1091 | Ga0501036_0000025 | 3300049572 | Bacteria | 106029 |
| 1092 | Ga0501036_0009246 | 3300049572 | Bacteria | 8101 |
| 1093 | Ga0501036_0066423 | 3300049572 | Bacteria | 3051 |
| 1094 | Ga0501036_0073792 | 3300049572 | Bacteria | 2884 |
| 1095 | Ga0501036_0185044 | 3300049572 | Bacteria | 1753 |
| 1096 | Ga0501037_0000169 | 3300049573 | Bacteria | 61447 |
| 1097 | Ga0501037_0075246 | 3300049573 | Bacteria | 2452 |
| 1098 | Ga0501037_0077130 | 3300049573 | Bacteria | 2418 |
| 1099 | Ga0501038_0000029 | 3300049574 | Bacteria | 132861 |
| 1100 | Ga0501038_0017001 | 3300049574 | Bacteria | 6582 |
| 1101 | Ga0501038_0074200 | 3300049574 | Bacteria | 2878 |
| 1102 | Ga0501038_0127566 | 3300049574 | Bacteria | 2092 |
| 1103 | Ga0501038_0159315 | 3300049574 | Bacteria | 1835 |
| 1104 | Ga0501039_0014669 | 3300049575 | Bacteria | 5994 |
| 1105 | Ga0501039_0045614 | 3300049575 | Bacteria | 3387 |
| 1106 | Ga0501039_0067453 | 3300049575 | Bacteria | 2778 |
| 1107 | Ga0501039_0082471 | 3300049575 | Bacteria | 2504 |
| 1108 | Ga0501039_0278275 | 3300049575 | Bacteria | 1315 |
| 1109 | Ga0501043_0000067 | 3300049579 | Bacteria | 93232 |
| 1110 | Ga0501043_0023705 | 3300049579 | Bacteria | 4813 |
| 1111 | Ga0501043_0071008 | 3300049579 | Bacteria | 2735 |
| 1112 | Ga0501043_0097871 | 3300049579 | Bacteria | 2306 |
| 1113 | Ga0501043_0189269 | 3300049579 | Bacteria | 1601 |
| 1114 | Ga0501046_0000479 | 3300049580 | Bacteria | 39962 |
| 1115 | Ga0501046_0047106 | 3300049580 | Bacteria | 3419 |
| 1116 | Ga0501046_0083647 | 3300049580 | Bacteria | 2463 |
| 1117 | Ga0501046_0164904 | 3300049580 | Bacteria | 1665 |
| 1118 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 1119 | Ga0501047_0000061 | 3300049581 | Bacteria | 137341 |
| 1120 | Ga0501047_0052348 | 3300049581 | Bacteria | 3946 |
| 1121 | Ga0501047_0083522 | 3300049581 | Bacteria | 3069 |
| 1122 | Ga0501047_0145268 | 3300049581 | Bacteria | 2249 |
| 1123 | Ga0501047_0168967 | 3300049581 | Bacteria | 2056 |
| 1124 | Ga0501047_0467833 | 3300049581 | Bacteria | 1089 |
| 1125 | Ga0501048_0000081 | 3300049582 | Bacteria | 49755 |
| 1126 | Ga0501048_0000592 | 3300049582 | Bacteria | 25706 |
| 1127 | Ga0501067_0004093 | 3300049583 | Bacteria | 8038 |
| 1128 | Ga0501067_0008059 | 3300049583 | Bacteria | 5855 |
| 1129 | Ga0501067_0142442 | 3300049583 | Bacteria | 1335 |
| 1130 | Ga0501068_0009234 | 3300049584 | Bacteria | 5511 |
| 1131 | Ga0501068_0037047 | 3300049584 | Bacteria | 2919 |
| 1132 | Ga0501068_0048922 | 3300049584 | Bacteria | 2553 |
| 1133 | Ga0501068_0061949 | 3300049584 | Bacteria | 2273 |
| 1134 | Ga0501068_0265072 | 3300049584 | Bacteria | 1096 |
| 1135 | Ga0501069_0006408 | 3300049585 | Bacteria | 6154 |
| 1136 | Ga0501069_0103112 | 3300049585 | Bacteria | 1620 |
| 1137 | Ga0501070_0012320 | 3300049586 | Bacteria | 7216 |
| 1138 | Ga0501070_0015707 | 3300049586 | Bacteria | 6366 |
| 1139 | Ga0501070_0027632 | 3300049586 | Bacteria | 4759 |
| 1140 | Ga0501070_0036608 | 3300049586 | Bacteria | 4098 |
| 1141 | Ga0501070_0049872 | 3300049586 | Bacteria | 3475 |
| 1142 | Ga0501070_0261127 | 3300049586 | Bacteria | 1415 |
| 1143 | Ga0501070_0368536 | 3300049586 | Bacteria | 1164 |
| 1144 | Ga0501071_0049887 | 3300049587 | Bacteria | 3014 |
| 1145 | Ga0501071_0064801 | 3300049587 | Bacteria | 2652 |
| 1146 | Ga0501072_0001324 | 3300049588 | Bacteria | 18575 |
| 1147 | Ga0501072_0051754 | 3300049588 | Bacteria | 3233 |
| 1148 | Ga0501072_0072650 | 3300049588 | Bacteria | 2719 |
| 1149 | Ga0501072_0101546 | 3300049588 | Bacteria | 2286 |
| 1150 | Ga0501072_0189609 | 3300049588 | Bacteria | 1640 |
| 1151 | Ga0501073_0004672 | 3300049589 | Bacteria | 10291 |
| 1152 | Ga0501073_0011255 | 3300049589 | Bacteria | 6545 |
| 1153 | Ga0501073_0081895 | 3300049589 | Bacteria | 2245 |
| 1154 | Ga0501073_0082488 | 3300049589 | Bacteria | 2237 |
| 1155 | Ga0501074_0013180 | 3300049590 | Bacteria | 6011 |
| 1156 | Ga0501074_0142131 | 3300049590 | Bacteria | 1716 |
| 1157 | Ga0501074_0219597 | 3300049590 | Bacteria | 1353 |
| 1158 | Ga0501075_0029716 | 3300049591 | Bacteria | 4043 |
| 1159 | Ga0501076_0050177 | 3300049592 | Bacteria | 3301 |
| 1160 | Ga0501079_0052135 | 3300049741 | Bacteria | 3158 |
| 1161 | Ga0501080_0000314 | 3300049742 | Bacteria | 37074 |
| 1162 | Ga0501080_0008717 | 3300049742 | Bacteria | 9209 |
| 1163 | Ga0501080_0039603 | 3300049742 | Bacteria | 4398 |
| 1164 | Ga0501080_0069440 | 3300049742 | Bacteria | 3276 |
| 1165 | Ga0501080_0357233 | 3300049742 | Bacteria | 1318 |
| 1166 | Ga0501083_0000544 | 3300049744 | Bacteria | 24028 |
| 1167 | Ga0501083_0082807 | 3300049744 | Bacteria | 2125 |
| 1168 | Ga0501083_0114245 | 3300049744 | Bacteria | 1773 |
| 1169 | Ga0501035_0001202 | 3300049822 | Bacteria | 26996 |
| 1170 | Ga0501035_0001359 | 3300049822 | Bacteria | 25173 |
| 1171 | Ga0501035_0008723 | 3300049822 | Bacteria | 9440 |
| 1172 | Ga0501035_0026602 | 3300049822 | Bacteria | 5292 |
| 1173 | Ga0501035_0042124 | 3300049822 | Bacteria | 4119 |
| 1174 | Ga0501035_0049713 | 3300049822 | Bacteria | 3757 |
| 1175 | Ga0501035_0321787 | 3300049822 | Bacteria | 1299 |
| 1176 | Ga0501035_0338074 | 3300049822 | Bacteria | 1262 |
| 1177 | Ga0501044_0000028 | 3300049823 | Bacteria | 179203 |
| 1178 | Ga0501044_0015194 | 3300049823 | Bacteria | 8292 |
| 1179 | Ga0501044_0030272 | 3300049823 | Bacteria | 5706 |
| 1180 | Ga0501044_0032946 | 3300049823 | Bacteria | 5446 |
| 1181 | Ga0501044_0042616 | 3300049823 | Bacteria | 4719 |
| 1182 | Ga0501044_0123366 | 3300049823 | Bacteria | 2589 |
| 1183 | Ga0501044_0199019 | 3300049823 | Bacteria | 1962 |
| 1184 | Ga0501044_0200222 | 3300049823 | Bacteria | 1955 |
| 1185 | Ga0501044_0235340 | 3300049823 | Bacteria | 1777 |
| 1186 | Ga0501045_0071853 | 3300049824 | Bacteria | 2547 |
| 1187 | Ga0501045_0079940 | 3300049824 | Bacteria | 2411 |
| 1188 | nmdc:mga03683_2160_c1 | 3300050489 | Bacteria | 6066 |
| 1189 | nmdc:mga03683_27872_c2 | 3300050489 | Bacteria | 1581 |
| 1190 | nmdc:mga03n38_1257_c1 | 3300050490 | Bacteria | 7131 |
| 1191 | nmdc:mga03n38_62424_c1 | 3300050490 | Bacteria | 1700 |
| 1192 | nmdc:mga0yw44_124278_c1 | 3300050492 | Bacteria | 1665 |
| 1193 | nmdc:mga0yw44_30616_c1 | 3300050492 | Bacteria | 3121 |
| 1194 | nmdc:mga0yw44_45328_c1 | 3300050492 | Bacteria | 2636 |
| 1195 | nmdc:mga0yw44_74353_c1 | 3300050492 | Bacteria | 2117 |
| 1196 | nmdc:mga0yw44_8313_c1 | 3300050492 | Bacteria | 5160 |
| 1197 | nmdc:mga0k408_30724_c1 | 3300050493 | Bacteria | 3064 |
| 1198 | nmdc:mga0k408_87368_c1 | 3300050493 | Bacteria | 1831 |
| 1199 | nmdc:mga06z11_111956_c1 | 3300050494 | Bacteria | 1513 |
| 1200 | nmdc:mga06z11_12395_c1 | 3300050494 | Bacteria | 3707 |
| 1201 | nmdc:mga06z11_124247_c1 | 3300050494 | Bacteria | 1443 |
| 1202 | nmdc:mga06z11_1795_c1 | 3300050494 | Bacteria | 8072 |
| 1203 | nmdc:mga06z11_46174_c1 | 3300050494 | Bacteria | 2206 |
| 1204 | nmdc:mga04h51_71172_c1 | 3300050495 | Bacteria | 1214 |
| 1205 | nmdc:mga07m45_27930_c1 | 3300050496 | Bacteria | 3113 |
| 1206 | nmdc:mga07m45_95220_c1 | 3300050496 | Bacteria | 1708 |
| 1207 | nmdc:mga05p37_13519_c1 | 3300050507 | Bacteria | 9784 |
| 1208 | nmdc:mga05p37_48051_c1 | 3300050507 | Bacteria | 5248 |
| 1209 | nmdc:mga05p37_49294_c1 | 3300050507 | Bacteria | 5179 |
| 1210 | nmdc:mga05p37_56_c3 | 3300050507 | Bacteria | 77819 |
| 1211 | nmdc:mga05p37_751885_c1 | 3300050507 | Bacteria | 1074 |
| 1212 | nmdc:mga09592_124051_c1 | 3300050508 | Bacteria | 2220 |
| 1213 | nmdc:mga09592_976_c1 | 3300050508 | Bacteria | 22595 |
| 1214 | nmdc:mga0qj67_34625_c1 | 3300050509 | Bacteria | 3946 |
| 1215 | nmdc:mga0qj67_4772_c1 | 3300050509 | Bacteria | 9855 |
| 1216 | nmdc:mga06r32_34244_c1 | 3300050510 | Bacteria | 4789 |
| 1217 | nmdc:mga08y16_10784_c1 | 3300050511 | Bacteria | 9592 |
| 1218 | nmdc:mga08y16_176438_c1 | 3300050511 | Bacteria | 2219 |
| 1219 | nmdc:mga08y16_206_c1 | 3300050511 | Bacteria | 46039 |
| 1220 | nmdc:mga08y16_2396_c1 | 3300050511 | Bacteria | 19256 |
| 1221 | nmdc:mga0n895_126045_c1 | 3300050512 | Bacteria | 2584 |
| 1222 | nmdc:mga0n895_201249_c1 | 3300050512 | Bacteria | 2022 |
| 1223 | nmdc:mga0n895_2429_c1 | 3300050512 | Bacteria | 14534 |
| 1224 | nmdc:mga0n895_2745_c2 | 3300050512 | Bacteria | 4921 |
| 1225 | nmdc:mga0n895_51689_c1 | 3300050512 | Bacteria | 4032 |
| 1226 | nmdc:mga0n895_5847_c1 | 3300050512 | Bacteria | 10340 |
| 1227 | nmdc:mga0rr50_144889_c1 | 3300050513 | Bacteria | 1914 |
| 1228 | nmdc:mga0rr50_46884_c1 | 3300050513 | Bacteria | 3184 |
| 1229 | nmdc:mga08x19_262272_c1 | 3300050514 | Bacteria | 1195 |
| 1230 | nmdc:mga0a205_11514_c1 | 3300050515 | Bacteria | 8147 |
| 1231 | nmdc:mga0a205_169150_c1 | 3300050515 | Bacteria | 2081 |
| 1232 | nmdc:mga0a205_375552_c1 | 3300050515 | Bacteria | 1287 |
| 1233 | nmdc:mga0a205_6435_c1 | 3300050515 | Bacteria | 10616 |
| 1234 | nmdc:mga0a205_80_c1 | 3300050515 | Bacteria | 53083 |
| 1235 | nmdc:mga0a205_89878_c1 | 3300050515 | Bacteria | 2968 |
| 1236 | Ga0495601_0000360 | 3300053077 | Bacteria | 23959 |
| 1237 | Ga0495601_0001260 | 3300053077 | Bacteria | 13862 |
| 1238 | Ga0495601_0007151 | 3300053077 | Bacteria | 6544 |
| 1239 | Ga0495601_0009390 | 3300053077 | Bacteria | 5785 |
| 1240 | Ga0495601_0020113 | 3300053077 | Bacteria | 4075 |
| 1241 | Ga0495601_0029689 | 3300053077 | Bacteria | 3393 |
| 1242 | Ga0495612_0000964 | 3300053078 | Bacteria | 11832 |
| 1243 | Ga0495612_0002659 | 3300053078 | Bacteria | 7371 |
| 1244 | Ga0495612_0005722 | 3300053078 | Bacteria | 5133 |
| 1245 | Ga0495612_0008741 | 3300053078 | Bacteria | 4108 |
| 1246 | Ga0495612_0009169 | 3300053078 | Bacteria | 4014 |
| 1247 | Ga0495612_0054148 | 3300053078 | Bacteria | 1653 |
| 1248 | Ga0495655_0002786 | 3300053083 | Bacteria | 2811 |
| 1249 | Ga0495595_0000552 | 3300053084 | Bacteria | 14281 |
| 1250 | Ga0495595_0001276 | 3300053084 | Bacteria | 9815 |
| 1251 | Ga0495595_0001912 | 3300053084 | Bacteria | 8091 |
| 1252 | Ga0495595_0003989 | 3300053084 | Bacteria | 5900 |
| 1253 | Ga0495619_0000375 | 3300053085 | Bacteria | 30799 |
| 1254 | Ga0495619_0000581 | 3300053085 | Bacteria | 24290 |
| 1255 | Ga0495619_0000664 | 3300053085 | Bacteria | 22535 |
| 1256 | Ga0495619_0001851 | 3300053085 | Bacteria | 14080 |
| 1257 | Ga0495619_0002169 | 3300053085 | Bacteria | 13003 |
| 1258 | Ga0495619_0080843 | 3300053085 | Bacteria | 2187 |
| 1259 | Ga0495619_0085474 | 3300053085 | Bacteria | 2130 |
| 1260 | Ga0495619_0094756 | 3300053085 | Bacteria | 2025 |
| 1261 | Ga0495619_0264286 | 3300053085 | Bacteria | 1192 |
| 1262 | Ga0500644_0008930 | 3300053088 | Bacteria | 2662 |
| 1263 | Ga0500647_0166931 | 3300053091 | Bacteria | 1018 |
| 1264 | Ga0500566_0000124 | 3300053094 | Bacteria | 40031 |
| 1265 | Ga0500566_0024974 | 3300053094 | Bacteria | 3504 |
| 1266 | Ga0500640_000336 | 3300053095 | Bacteria | 10879 |
| 1267 | Ga0500641_0018612 | 3300053096 | Bacteria | 2615 |
| 1268 | Ga0500572_001094 | 3300053111 | Bacteria | 7947 |
| 1269 | Ga0500591_058467 | 3300053115 | Bacteria | 1786 |
| 1270 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1271 | Ga0500595_020436 | 3300053119 | Bacteria | 2383 |
| 1272 | Ga0500559_0004459 | 3300053136 | Bacteria | 6643 |
| 1273 | Ga0500559_0008670 | 3300053136 | Bacteria | 4443 |
| 1274 | Ga0500588_0017273 | 3300053146 | Bacteria | 1881 |
| 1275 | Ga0500603_000189 | 3300053150 | Bacteria | 16056 |
| 1276 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1277 | Ga0500630_001137 | 3300053159 | Bacteria | 12415 |
| 1278 | Ga0500639_000115 | 3300053163 | Bacteria | 38497 |
| 1279 | Ga0500639_047362 | 3300053163 | Bacteria | 2246 |
| 1280 | Ga0500636_0044934 | 3300053177 | Bacteria | 2605 |
| 1281 | Ga0500637_0028335 | 3300053178 | Bacteria | 3097 |
| 1282 | Ga0500645_000471 | 3300053730 | Bacteria | 27490 |
| 1283 | Ga0500596_000790 | 3300053735 | Bacteria | 6239 |
| 1284 | Ga0500596_002245 | 3300053735 | Bacteria | 3833 |
| 1285 | Ga0500601_003639 | 3300053737 | Bacteria | 1673 |
| 1286 | Ga0501084_0036612 | 3300054114 | Bacteria | 4099 |
| 1287 | Ga0501084_0037087 | 3300054114 | Bacteria | 4073 |
| 1288 | Ga0501082_0010013 | 3300060353 | Bacteria | 8173 |
| 1289 | Ga0501082_0080227 | 3300060353 | Bacteria | 2815 |
| 1290 | Ga0501082_0080612 | 3300060353 | Bacteria | 2809 |
| 1291 | Ga0530510_0082247 | 3300061734 | Bacteria | 2345 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0449331 | Ga0496100_0449331_43_969 | 300 |
| 2 | 3300048913 | Ga0496110_0234585 | Ga0496110_0234585_745_1659 | 304 |
| 3 | 3300038443 | Ga0395901_0409119 | Ga0395901_0409119_218_1171 | 305 |
| 4 | 3300039093 | Ga0400489_28166 | Ga0400489_28166_35002_35985 | 308 |
| 5 | 3300006880 | Ga0075429_100064559 | Ga0075429_1000645593 | 310 |
| 6 | 3300046516 | Ga0495628_0026853 | Ga0495628_0026853_3743_4675 | 310 |
| 7 | 3300049584 | Ga0501068_0265072 | Ga0501068_0265072_140_1072 | 310 |
| 8 | 3300050507 | nmdc:mga05p37_48051_c1 | nmdc:mga05p37_48051_c1_733_1710 | 310 |
| 9 | 3300050508 | nmdc:mga09592_124051_c1 | nmdc:mga09592_124051_c1_858_1835 | 310 |
| 10 | 3300050509 | nmdc:mga0qj67_34625_c1 | nmdc:mga0qj67_34625_c1_2348_3325 | 310 |
| 11 | 3300005334 | Ga0068869_100091153 | Ga0068869_1000911532 | 311 |
| 12 | 3300005434 | Ga0070709_10000981 | Ga0070709_100009813 | 311 |
| 13 | 3300005435 | Ga0070714_100007967 | Ga0070714_1000079673 | 311 |
| 14 | 3300005436 | Ga0070713_100009246 | Ga0070713_1000092465 | 311 |
| 15 | 3300005437 | Ga0070710_10000179 | Ga0070710_100001794 | 311 |
| 16 | 3300005439 | Ga0070711_100013883 | Ga0070711_1000138833 | 311 |
| 17 | 3300005455 | Ga0070663_100268938 | Ga0070663_1002689382 | 311 |
| 18 | 3300005548 | Ga0070665_100367333 | Ga0070665_1003673332 | 311 |
| 19 | 3300005617 | Ga0068859_100032313 | Ga0068859_1000323134 | 311 |
| 20 | 3300005841 | Ga0068863_100110951 | Ga0068863_1001109514 | 311 |
| 21 | 3300005842 | Ga0068858_100385313 | Ga0068858_1003853132 | 311 |
| 22 | 3300005981 | Ga0081538_10007089 | Ga0081538_100070898 | 311 |
| 23 | 3300005983 | Ga0081540_1009400 | Ga0081540_10094006 | 311 |
| 24 | 3300006028 | Ga0070717_10002977 | Ga0070717_100029779 | 311 |
| 25 | 3300006038 | Ga0075365_10019169 | Ga0075365_100191694 | 311 |
| 26 | 3300006163 | Ga0070715_10000085 | Ga0070715_1000008514 | 311 |
| 27 | 3300006173 | Ga0070716_100001988 | Ga0070716_1000019883 | 311 |
| 28 | 3300006175 | Ga0070712_100019271 | Ga0070712_1000192713 | 311 |
| 29 | 3300006178 | Ga0075367_10053786 | Ga0075367_100537861 | 311 |
| 30 | 3300006186 | Ga0075369_10031469 | Ga0075369_100314692 | 311 |
| 31 | 3300006844 | Ga0075428_100214665 | Ga0075428_1002146651 | 311 |
| 32 | 3300006931 | Ga0097620_100032314 | Ga0097620_1000323144 | 311 |
| 33 | 3300009098 | Ga0105245_10328630 | Ga0105245_103286302 | 311 |
| 34 | 3300025898 | Ga0207692_10001204 | Ga0207692_100012048 | 311 |
| 35 | 3300025906 | Ga0207699_10000531 | Ga0207699_100005319 | 311 |
| 36 | 3300025915 | Ga0207693_10004067 | Ga0207693_100040678 | 311 |
| 37 | 3300025916 | Ga0207663_10001909 | Ga0207663_100019099 | 311 |
| 38 | 3300025928 | Ga0207700_10018036 | Ga0207700_100180363 | 311 |
| 39 | 3300025929 | Ga0207664_10014579 | Ga0207664_100145793 | 311 |
| 40 | 3300025939 | Ga0207665_10000577 | Ga0207665_1000057715 | 311 |
| 41 | 3300025961 | Ga0207712_10123332 | Ga0207712_101233322 | 311 |
| 42 | 3300026118 | Ga0207675_100492846 | Ga0207675_1004928461 | 311 |
| 43 | 3300028379 | Ga0268266_10000857 | Ga0268266_1000085737 | 311 |
| 44 | 3300028379 | Ga0268266_10341602 | Ga0268266_103416022 | 311 |
| 45 | 3300028380 | Ga0268265_10280135 | Ga0268265_102801351 | 311 |
| 46 | 3300031548 | Ga0307408_100257788 | Ga0307408_1002577882 | 311 |
| 47 | 3300031730 | Ga0307516_10198555 | Ga0307516_101985552 | 311 |
| 48 | 3300035725 | Ga0373947_0157465 | Ga0373947_0157465_330_1304 | 311 |
| 49 | 3300046455 | Ga0495603_0097985 | Ga0495603_0097985_449_1423 | 311 |
| 50 | 3300046459 | Ga0495629_0038335 | Ga0495629_0038335_1749_2723 | 311 |
| 51 | 3300046507 | Ga0495606_0142136 | Ga0495606_0142136_16_990 | 311 |
| 52 | 3300046523 | Ga0495644_0097729 | Ga0495644_0097729_84_1058 | 311 |
| 53 | 3300046663 | Ga0495635_0126093 | Ga0495635_0126093_424_1398 | 311 |
| 54 | 3300046674 | Ga0495588_0169779 | Ga0495588_0169779_62_1036 | 311 |
| 55 | 3300046684 | Ga0495669_0114672 | Ga0495669_0114672_20_994 | 311 |
| 56 | 3300047321 | Ga0495676_0184784 | Ga0495676_0184784_185_1159 | 311 |
| 57 | 3300048924 | Ga0496121_0053287 | Ga0496121_0053287_1070_2044 | 311 |
| 58 | 3300050492 | nmdc:mga0yw44_45328_c1 | nmdc:mga0yw44_45328_c1_260_1234 | 311 |
| 59 | 3300050492 | nmdc:mga0yw44_8313_c1 | nmdc:mga0yw44_8313_c1_3221_4195 | 311 |
| 60 | 3300050494 | nmdc:mga06z11_46174_c1 | nmdc:mga06z11_46174_c1_1161_2135 | 311 |
| 61 | 3300050507 | nmdc:mga05p37_49294_c1 | nmdc:mga05p37_49294_c1_1416_2390 | 311 |
| 62 | 3300050515 | nmdc:mga0a205_169150_c1 | nmdc:mga0a205_169150_c1_1116_2051 | 311 |
| 63 | 3300025900 | Ga0207710_10144383 | Ga0207710_101443831 | 312 |
| 64 | 3300025921 | Ga0207652_10028066 | Ga0207652_100280665 | 312 |
| 65 | 3300031507 | Ga0307509_10170661 | Ga0307509_101706612 | 312 |
| 66 | 3300033180 | Ga0307510_10093546 | Ga0307510_100935463 | 312 |
| 67 | 3300035114 | Ga0373939_0007617 | Ga0373939_0007617_495_1472 | 312 |
| 68 | 3300044694 | Ga0466963_0180802 | Ga0466963_0180802_360_1337 | 312 |
| 69 | 3300046460 | Ga0495638_0016637 | Ga0495638_0016637_3237_4211 | 312 |
| 70 | 3300046499 | Ga0495594_0071026 | Ga0495594_0071026_722_1696 | 312 |
| 71 | 3300046519 | Ga0495632_0062790 | Ga0495632_0062790_774_1748 | 312 |
| 72 | 3300046616 | Ga0495668_0013965 | Ga0495668_0013965_861_1835 | 312 |
| 73 | 3300046684 | Ga0495669_0024391 | Ga0495669_0024391_597_1571 | 312 |
| 74 | 3300048924 | Ga0496121_0029635 | Ga0496121_0029635_1011_1985 | 312 |
| 75 | 3300048929 | Ga0496126_0007157 | Ga0496126_0007157_2865_3839 | 312 |
| 76 | 3300053119 | Ga0500595_020436 | Ga0500595_020436_786_1760 | 312 |
| 77 | 3300037418 | Ga0395900_0208698 | Ga0395900_0208698_847_1824 | 313 |
| 78 | 3300049571 | Ga0501034_0504993 | Ga0501034_0504993_47_1024 | 313 |
| 79 | 3300005435 | Ga0070714_100088110 | Ga0070714_1000881102 | 314 |
| 80 | 3300005437 | Ga0070710_10095965 | Ga0070710_100959652 | 314 |
| 81 | 3300005458 | Ga0070681_10032494 | Ga0070681_100324946 | 314 |
| 82 | 3300005471 | Ga0070698_100103675 | Ga0070698_1001036751 | 314 |
| 83 | 3300005530 | Ga0070679_100067689 | Ga0070679_1000676894 | 314 |
| 84 | 3300005535 | Ga0070684_100112216 | Ga0070684_1001122162 | 314 |
| 85 | 3300005547 | Ga0070693_100165525 | Ga0070693_1001655252 | 314 |
| 86 | 3300005563 | Ga0068855_100180896 | Ga0068855_1001808962 | 314 |
| 87 | 3300005578 | Ga0068854_100074701 | Ga0068854_1000747014 | 314 |
| 88 | 3300005985 | Ga0081539_10052157 | Ga0081539_100521573 | 314 |
| 89 | 3300006175 | Ga0070712_100086512 | Ga0070712_1000865123 | 314 |
| 90 | 3300009551 | Ga0105238_10180828 | Ga0105238_101808282 | 314 |
| 91 | 3300025906 | Ga0207699_10328147 | Ga0207699_103281471 | 314 |
| 92 | 3300025921 | Ga0207652_10088727 | Ga0207652_100887274 | 314 |
| 93 | 3300025924 | Ga0207694_10126736 | Ga0207694_101267362 | 314 |
| 94 | 3300025929 | Ga0207664_10309524 | Ga0207664_103095242 | 314 |
| 95 | 3300026078 | Ga0207702_10363703 | Ga0207702_103637031 | 314 |
| 96 | 3300049587 | Ga0501071_0049887 | Ga0501071_0049887_440_1420 | 314 |
| 97 | 3300005937 | Ga0081455_10037370 | Ga0081455_100373704 | 315 |
| 98 | 3300005985 | Ga0081539_10015884 | Ga0081539_100158841 | 315 |
| 99 | 3300006038 | Ga0075365_10095195 | Ga0075365_100951951 | 315 |
| 100 | 3300006048 | Ga0075363_100010016 | Ga0075363_1000100164 | 315 |
| 101 | 3300006178 | Ga0075367_10116702 | Ga0075367_101167021 | 315 |
| 102 | 3300006353 | Ga0075370_10008478 | Ga0075370_100084782 | 315 |
| 103 | 3300025945 | Ga0207679_10279643 | Ga0207679_102796431 | 315 |
| 104 | 3300026095 | Ga0207676_10240398 | Ga0207676_102403982 | 315 |
| 105 | 3300028379 | Ga0268266_10004080 | Ga0268266_100040809 | 315 |
| 106 | 3300048918 | Ga0496115_0092475 | Ga0496115_0092475_1099_2073 | 315 |
| 107 | 3300050490 | nmdc:mga03n38_1257_c1 | nmdc:mga03n38_1257_c1_2814_3788 | 315 |
| 108 | 3300050494 | nmdc:mga06z11_12395_c1 | nmdc:mga06z11_12395_c1_317_1291 | 315 |
| 109 | 3300053091 | Ga0500647_0166931 | Ga0500647_0166931_26_973 | 315 |
| 110 | 3300027312 | Ga0209371_1002632 | Ga0209371_100263210 | 316 |
| 111 | 3300030500 | Ga0268256_1003412 | Ga0268256_10034128 | 316 |
| 112 | 3300037312 | Ga0395899_0113398 | Ga0395899_0113398_317_1291 | 316 |
| 113 | 3300037418 | Ga0395900_0000917 | Ga0395900_0000917_3812_4786 | 316 |
| 114 | 3300037466 | Ga0395898_0029930 | Ga0395898_0029930_2351_3325 | 316 |
| 115 | 3300037471 | Ga0395905_0271090 | Ga0395905_0271090_405_1379 | 316 |
| 116 | 3300038443 | Ga0395901_0019066 | Ga0395901_0019066_3891_4865 | 316 |
| 117 | 3300046518 | Ga0495631_0024362 | Ga0495631_0024362_856_1806 | 316 |
| 118 | 3300049571 | Ga0501034_0060308 | Ga0501034_0060308_442_1419 | 316 |
| 119 | 3300049583 | Ga0501067_0008059 | Ga0501067_0008059_1832_2809 | 316 |
| 120 | 3300049584 | Ga0501068_0048922 | Ga0501068_0048922_1258_2235 | 316 |
| 121 | 3300049586 | Ga0501070_0027632 | Ga0501070_0027632_311_1288 | 316 |
| 122 | 3300049588 | Ga0501072_0051754 | Ga0501072_0051754_979_1956 | 316 |
| 123 | 3300049590 | Ga0501074_0142131 | Ga0501074_0142131_429_1406 | 316 |
| 124 | 3300049742 | Ga0501080_0008717 | Ga0501080_0008717_1156_2133 | 316 |
| 125 | 3300049823 | Ga0501044_0032946 | Ga0501044_0032946_1257_2234 | 316 |
| 126 | 3300003659 | JGI25404J52841_10007800 | JGI25404J52841_100078004 | 317 |
| 127 | 3300005983 | Ga0081540_1000257 | Ga0081540_100025720 | 317 |
| 128 | 3300039447 | Ga0436361_0452981 | Ga0436361_0452981_1327_2298 | 317 |
| 129 | 3300046472 | Ga0495580_0028270 | Ga0495580_0028270_2223_3179 | 317 |
| 130 | 3300005468 | Ga0070707_100236520 | Ga0070707_1002365201 | 318 |
| 131 | 3300009551 | Ga0105238_10050560 | Ga0105238_100505604 | 318 |
| 132 | iso_pu_bacteria | 2842311132 | 2842317079 | 318 |
| 133 | iso_pu_bacteria | 2842495871 | 2842501446 | 318 |
| 134 | 3300005983 | Ga0081540_1032775 | Ga0081540_10327752 | 319 |
| 135 | 3300037466 | Ga0395898_0098943 | Ga0395898_0098943_1023_2000 | 320 |
| 136 | iso_pu_bacteria | 2513237101 | 2513692117 | 320 |
| 137 | iso_pu_bacteria | 2513237104 | 2513718096 | 320 |
| 138 | iso_pu_bacteria | 2524023205 | 2524436868 | 320 |
| 139 | iso_pu_bacteria | 2721755755 | 2723845510 | 320 |
| 140 | iso_pu_bacteria | 2744054633 | 2745080195 | 320 |
| 141 | iso_pu_bacteria | 2791355199 | 2793082666 | 320 |
| 142 | iso_pu_bacteria | 2874604998 | 2874607597 | 320 |
| 143 | iso_pu_bacteria | 2876761206 | 2876763836 | 320 |
| 144 | iso_pu_bacteria | 2876808645 | 2876809959 | 320 |
| 145 | iso_pu_bacteria | 2879110137 | 2879118246 | 320 |
| 146 | iso_pu_bacteria | 2889033259 | 2889040284 | 320 |
| 147 | iso_pu_bacteria | 2903768456 | 2903775820 | 320 |
| 148 | iso_pu_bacteria | 2906626472 | 2906634140 | 320 |
| 149 | iso_pu_bacteria | 2922361189 | 2922368186 | 320 |
| 150 | iso_pu_bacteria | 2922386360 | 2922388339 | 320 |
| 151 | iso_pu_bacteria | 2935959822 | 2935960142 | 320 |
| 152 | iso_pu_bacteria | 8006964411 | 8006970778 | 320 |
| 153 | iso_pu_bacteria | 8006984368 | 8006985629 | 320 |
| 154 | iso_pu_bacteria | 8006994254 | 8007000179 | 320 |
| 155 | iso_pu_bacteria | 8056673599 | 8056674245 | 320 |
| 156 | iso_pu_bacteria | 8056681323 | 8056685428 | 320 |
| 157 | 3300048906 | Ga0496103_0022038 | Ga0496103_0022038_60_1025 | 321 |
| 158 | 3300006177 | Ga0075362_10000796 | Ga0075362_100007965 | 322 |
| 159 | 3300005364 | Ga0070673_100116580 | Ga0070673_1001165802 | 323 |
| 160 | 3300005471 | Ga0070698_100004430 | Ga0070698_10000443013 | 323 |
| 161 | 3300005937 | Ga0081455_10000356 | Ga0081455_1000035619 | 323 |
| 162 | 3300005983 | Ga0081540_1000060 | Ga0081540_100006045 | 323 |
| 163 | 3300026067 | Ga0207678_10303421 | Ga0207678_103034211 | 323 |
| 164 | 3300031507 | Ga0307509_10184029 | Ga0307509_101840292 | 323 |
| 165 | 3300035086 | Ga0373934_0027921 | Ga0373934_0027921_204_1175 | 323 |
| 166 | 3300035114 | Ga0373939_0052100 | Ga0373939_0052100_109_1083 | 323 |
| 167 | 3300035117 | Ga0373953_0006310 | Ga0373953_0006310_1322_2293 | 323 |
| 168 | 3300035119 | Ga0373956_0115125 | Ga0373956_0115125_93_1064 | 323 |
| 169 | 3300035172 | Ga0373955_0011500 | Ga0373955_0011500_1381_2352 | 323 |
| 170 | 3300035724 | Ga0373933_0014389 | Ga0373933_0014389_2081_3052 | 323 |
| 171 | 3300036401 | Ga0373937_0007509 | Ga0373937_0007509_6449_7420 | 323 |
| 172 | 3300037853 | Ga0436364_0761681 | Ga0436364_0761681_825_1796 | 323 |
| 173 | 3300039447 | Ga0436361_0291544 | Ga0436361_0291544_1338_2315 | 323 |
| 174 | 3300044684 | Ga0466966_0082720 | Ga0466966_0082720_689_1663 | 323 |
| 175 | 3300046454 | Ga0495592_0096600 | Ga0495592_0096600_123_1094 | 323 |
| 176 | 3300046462 | Ga0495651_0023992 | Ga0495651_0023992_3714_4685 | 323 |
| 177 | 3300046536 | Ga0495587_0029413 | Ga0495587_0029413_525_1496 | 323 |
| 178 | 3300046559 | Ga0495667_0040819 | Ga0495667_0040819_733_1704 | 323 |
| 179 | 3300046679 | Ga0495623_0119469 | Ga0495623_0119469_546_1517 | 323 |
| 180 | 3300046809 | Ga0495600_0055606 | Ga0495600_0055606_229_1200 | 323 |
| 181 | 3300047322 | Ga0495680_0043116 | Ga0495680_0043116_811_1782 | 323 |
| 182 | 3300047444 | Ga0495675_0063085 | Ga0495675_0063085_628_1599 | 323 |
| 183 | 3300050489 | nmdc:mga03683_2160_c1 | nmdc:mga03683_2160_c1_4044_5054 | 323 |
| 184 | 3300053077 | Ga0495601_0020113 | Ga0495601_0020113_701_1672 | 323 |
| 185 | 3300053085 | Ga0495619_0080843 | Ga0495619_0080843_564_1535 | 323 |
| 186 | 3300003203 | JGI25406J46586_10000004 | JGI25406J46586_10000004102 | 324 |
| 187 | 3300005366 | Ga0070659_100224223 | Ga0070659_1002242232 | 324 |
| 188 | 3300005539 | Ga0068853_100161577 | Ga0068853_1001615772 | 324 |
| 189 | 3300005548 | Ga0070665_100071433 | Ga0070665_1000714333 | 324 |
| 190 | 3300005843 | Ga0068860_100000448 | Ga0068860_10000044845 | 324 |
| 191 | 3300005985 | Ga0081539_10000080 | Ga0081539_1000008025 | 324 |
| 192 | 3300006028 | Ga0070717_10016717 | Ga0070717_100167175 | 324 |
| 193 | 3300006038 | Ga0075365_10067595 | Ga0075365_100675953 | 324 |
| 194 | 3300007265 | Ga0099794_10104084 | Ga0099794_101040841 | 324 |
| 195 | 3300007788 | Ga0099795_10003566 | Ga0099795_100035664 | 324 |
| 196 | 3300009098 | Ga0105245_10322101 | Ga0105245_103221012 | 324 |
| 197 | 3300009101 | Ga0105247_10005459 | Ga0105247_100054596 | 324 |
| 198 | 3300009101 | Ga0105247_10036356 | Ga0105247_100363562 | 324 |
| 199 | 3300009174 | Ga0105241_10037962 | Ga0105241_100379623 | 324 |
| 200 | 3300009545 | Ga0105237_10023639 | Ga0105237_100236394 | 324 |
| 201 | 3300009545 | Ga0105237_10040193 | Ga0105237_100401932 | 324 |
| 202 | 3300009551 | Ga0105238_10062496 | Ga0105238_100624963 | 324 |
| 203 | 3300010159 | Ga0099796_10003100 | Ga0099796_100031005 | 324 |
| 204 | 3300010375 | Ga0105239_10005450 | Ga0105239_100054508 | 324 |
| 205 | 3300013100 | Ga0157373_10145122 | Ga0157373_101451222 | 324 |
| 206 | 3300013102 | Ga0157371_10047027 | Ga0157371_100470273 | 324 |
| 207 | 3300025914 | Ga0207671_10022987 | Ga0207671_100229874 | 324 |
| 208 | 3300025914 | Ga0207671_10046170 | Ga0207671_100461703 | 324 |
| 209 | 3300025914 | Ga0207671_10065535 | Ga0207671_100655352 | 324 |
| 210 | 3300025915 | Ga0207693_10021894 | Ga0207693_100218945 | 324 |
| 211 | 3300025919 | Ga0207657_10009757 | Ga0207657_100097575 | 324 |
| 212 | 3300025921 | Ga0207652_10408231 | Ga0207652_104082311 | 324 |
| 213 | 3300025922 | Ga0207646_10070925 | Ga0207646_100709252 | 324 |
| 214 | 3300025924 | Ga0207694_10041733 | Ga0207694_100417332 | 324 |
| 215 | 3300025949 | Ga0207667_10129105 | Ga0207667_101291052 | 324 |
| 216 | 3300026035 | Ga0207703_10091348 | Ga0207703_100913482 | 324 |
| 217 | 3300026041 | Ga0207639_10320401 | Ga0207639_103204011 | 324 |
| 218 | 3300028381 | Ga0268264_10000162 | Ga0268264_1000016240 | 324 |
| 219 | 3300030521 | Ga0307511_10059052 | Ga0307511_100590522 | 324 |
| 220 | 3300031456 | Ga0307513_10100118 | Ga0307513_101001183 | 324 |
| 221 | 3300031507 | Ga0307509_10193454 | Ga0307509_101934542 | 324 |
| 222 | 3300031616 | Ga0307508_10000001 | Ga0307508_10000001177 | 324 |
| 223 | 3300031616 | Ga0307508_10042265 | Ga0307508_100422654 | 324 |
| 224 | 3300031616 | Ga0307508_10057284 | Ga0307508_100572843 | 324 |
| 225 | 3300031616 | Ga0307508_10064279 | Ga0307508_100642792 | 324 |
| 226 | 3300031727 | Ga0316576_10001056 | Ga0316576_100010569 | 324 |
| 227 | 3300031730 | Ga0307516_10012533 | Ga0307516_100125333 | 324 |
| 228 | 3300031731 | Ga0307405_10358939 | Ga0307405_103589391 | 324 |
| 229 | 3300032002 | Ga0307416_100543646 | Ga0307416_1005436462 | 324 |
| 230 | 3300033179 | Ga0307507_10123347 | Ga0307507_101233472 | 324 |
| 231 | 3300033180 | Ga0307510_10068958 | Ga0307510_100689584 | 324 |
| 232 | 3300033544 | Ga0316215_1001492 | Ga0316215_10014923 | 324 |
| 233 | 3300035725 | Ga0373947_0193019 | Ga0373947_0193019_306_1280 | 324 |
| 234 | 3300036459 | Ga0372808_000887 | Ga0372808_000887_1414_2388 | 324 |
| 235 | 3300037068 | Ga0373925_0032152 | Ga0373925_0032152_1250_2224 | 324 |
| 236 | 3300037068 | Ga0373925_0165210 | Ga0373925_0165210_41_1015 | 324 |
| 237 | 3300039450 | Ga0436363_0379375 | Ga0436363_0379375_3301_4275 | 324 |
| 238 | 3300046477 | Ga0495664_0050337 | Ga0495664_0050337_1155_2129 | 324 |
| 239 | 3300046507 | Ga0495606_0001220 | Ga0495606_0001220_23049_24023 | 324 |
| 240 | 3300046557 | Ga0495622_0043586 | Ga0495622_0043586_405_1379 | 324 |
| 241 | 3300046559 | Ga0495667_0029602 | Ga0495667_0029602_1314_2288 | 324 |
| 242 | 3300047320 | Ga0495672_0067708 | Ga0495672_0067708_934_1908 | 324 |
| 243 | 3300047321 | Ga0495676_0054077 | Ga0495676_0054077_161_1135 | 324 |
| 244 | 3300047322 | Ga0495680_0205372 | Ga0495680_0205372_203_1177 | 324 |
| 245 | 3300047444 | Ga0495675_0061543 | Ga0495675_0061543_292_1266 | 324 |
| 246 | 3300048915 | Ga0496112_0000009 | Ga0496112_0000009_236795_237769 | 324 |
| 247 | 3300048919 | Ga0496116_0148251 | Ga0496116_0148251_252_1226 | 324 |
| 248 | 3300048920 | Ga0496117_0097463 | Ga0496117_0097463_143_1117 | 324 |
| 249 | 3300048921 | Ga0496118_0002370 | Ga0496118_0002370_11350_12324 | 324 |
| 250 | 3300048924 | Ga0496121_0000110 | Ga0496121_0000110_178509_179483 | 324 |
| 251 | 3300048927 | Ga0496124_0009400 | Ga0496124_0009400_2215_3189 | 324 |
| 252 | 3300048927 | Ga0496124_0081079 | Ga0496124_0081079_365_1339 | 324 |
| 253 | 3300048929 | Ga0496126_0077579 | Ga0496126_0077579_1012_1986 | 324 |
| 254 | 3300048929 | Ga0496126_0082735 | Ga0496126_0082735_1441_2415 | 324 |
| 255 | 3300049568 | Ga0501031_0065472 | Ga0501031_0065472_112_1086 | 324 |
| 256 | 3300049569 | Ga0501032_0000054 | Ga0501032_0000054_6230_7204 | 324 |
| 257 | 3300049570 | Ga0501033_0000025 | Ga0501033_0000025_110744_111718 | 324 |
| 258 | 3300049570 | Ga0501033_0028631 | Ga0501033_0028631_1101_2075 | 324 |
| 259 | 3300049571 | Ga0501034_0000177 | Ga0501034_0000177_20407_21381 | 324 |
| 260 | 3300049571 | Ga0501034_0162958 | Ga0501034_0162958_1002_1976 | 324 |
| 261 | 3300049572 | Ga0501036_0000025 | Ga0501036_0000025_93642_94616 | 324 |
| 262 | 3300049572 | Ga0501036_0185044 | Ga0501036_0185044_723_1697 | 324 |
| 263 | 3300049573 | Ga0501037_0000169 | Ga0501037_0000169_56682_57656 | 324 |
| 264 | 3300049574 | Ga0501038_0000029 | Ga0501038_0000029_37283_38257 | 324 |
| 265 | 3300049574 | Ga0501038_0159315 | Ga0501038_0159315_252_1226 | 324 |
| 266 | 3300049575 | Ga0501039_0014669 | Ga0501039_0014669_20_994 | 324 |
| 267 | 3300049579 | Ga0501043_0000067 | Ga0501043_0000067_38977_39951 | 324 |
| 268 | 3300049579 | Ga0501043_0097871 | Ga0501043_0097871_583_1557 | 324 |
| 269 | 3300049579 | Ga0501043_0189269 | Ga0501043_0189269_604_1578 | 324 |
| 270 | 3300049580 | Ga0501046_0000479 | Ga0501046_0000479_28818_29792 | 324 |
| 271 | 3300049581 | Ga0501047_0000061 | Ga0501047_0000061_84979_85953 | 324 |
| 272 | 3300049581 | Ga0501047_0467833 | Ga0501047_0467833_71_1045 | 324 |
| 273 | 3300049582 | Ga0501048_0000081 | Ga0501048_0000081_39651_40625 | 324 |
| 274 | 3300049583 | Ga0501067_0004093 | Ga0501067_0004093_6661_7635 | 324 |
| 275 | 3300049583 | Ga0501067_0142442 | Ga0501067_0142442_251_1225 | 324 |
| 276 | 3300049584 | Ga0501068_0009234 | Ga0501068_0009234_3981_4955 | 324 |
| 277 | 3300049585 | Ga0501069_0006408 | Ga0501069_0006408_4956_5930 | 324 |
| 278 | 3300049586 | Ga0501070_0012320 | Ga0501070_0012320_5057_6031 | 324 |
| 279 | 3300049587 | Ga0501071_0064801 | Ga0501071_0064801_449_1423 | 324 |
| 280 | 3300049588 | Ga0501072_0001324 | Ga0501072_0001324_13077_14051 | 324 |
| 281 | 3300049589 | Ga0501073_0004672 | Ga0501073_0004672_6368_7342 | 324 |
| 282 | 3300049589 | Ga0501073_0081895 | Ga0501073_0081895_115_1089 | 324 |
| 283 | 3300049589 | Ga0501073_0082488 | Ga0501073_0082488_530_1504 | 324 |
| 284 | 3300049590 | Ga0501074_0013180 | Ga0501074_0013180_2801_3775 | 324 |
| 285 | 3300049741 | Ga0501079_0052135 | Ga0501079_0052135_823_1797 | 324 |
| 286 | 3300049742 | Ga0501080_0039603 | Ga0501080_0039603_2222_3196 | 324 |
| 287 | 3300049744 | Ga0501083_0000544 | Ga0501083_0000544_9867_10841 | 324 |
| 288 | 3300049822 | Ga0501035_0001202 | Ga0501035_0001202_21136_22110 | 324 |
| 289 | 3300049822 | Ga0501035_0042124 | Ga0501035_0042124_1964_2938 | 324 |
| 290 | 3300049823 | Ga0501044_0000028 | Ga0501044_0000028_113220_114194 | 324 |
| 291 | 3300049823 | Ga0501044_0199019 | Ga0501044_0199019_353_1327 | 324 |
| 292 | 3300049824 | Ga0501045_0071853 | Ga0501045_0071853_1368_2342 | 324 |
| 293 | 3300053094 | Ga0500566_0000124 | Ga0500566_0000124_12045_13019 | 324 |
| 294 | 3300053095 | Ga0500640_000336 | Ga0500640_000336_3711_4685 | 324 |
| 295 | 3300053111 | Ga0500572_001094 | Ga0500572_001094_6213_7187 | 324 |
| 296 | 3300053115 | Ga0500591_058467 | Ga0500591_058467_296_1270 | 324 |
| 297 | 3300053136 | Ga0500559_0004459 | Ga0500559_0004459_5512_6486 | 324 |
| 298 | 3300053136 | Ga0500559_0008670 | Ga0500559_0008670_1432_2406 | 324 |
| 299 | 3300053150 | Ga0500603_000189 | Ga0500603_000189_12553_13527 | 324 |
| 300 | 3300053159 | Ga0500630_001137 | Ga0500630_001137_8361_9335 | 324 |
| 301 | 3300053163 | Ga0500639_000115 | Ga0500639_000115_11193_12167 | 324 |
| 302 | 3300053163 | Ga0500639_047362 | Ga0500639_047362_176_1150 | 324 |
| 303 | 3300053177 | Ga0500636_0044934 | Ga0500636_0044934_870_1844 | 324 |
| 304 | 3300053178 | Ga0500637_0028335 | Ga0500637_0028335_1850_2824 | 324 |
| 305 | 3300053735 | Ga0500596_000790 | Ga0500596_000790_3880_4854 | 324 |
| 306 | 3300053735 | Ga0500596_002245 | Ga0500596_002245_1130_2104 | 324 |
| 307 | 3300053737 | Ga0500601_003639 | Ga0500601_003639_612_1586 | 324 |
| 308 | 3300054114 | Ga0501084_0036612 | Ga0501084_0036612_236_1210 | 324 |
| 309 | 3300060353 | Ga0501082_0010013 | Ga0501082_0010013_4015_4989 | 324 |
| 310 | 2209111006 | 2214772983 | 2213792886 | 325 |
| 311 | 3300000041 | ARcpr5oldR_c000140 | ARcpr5oldR_0001406 | 325 |
| 312 | 3300000042 | ARSoilYngRDRAFT_c00234 | ARSoilYngRDRAFT_002346 | 325 |
| 313 | 3300000043 | ARcpr5yngRDRAFT_c000872 | ARcpr5yngRDRAFT_0008722 | 325 |
| 314 | 3300000044 | ARSoilOldRDRAFT_c000126 | ARSoilOldRDRAFT_00012612 | 325 |
| 315 | 3300000045 | ARCol0oldRDRAFT_c00368 | ARCol0oldRDRAFT_003685 | 325 |
| 316 | 3300000652 | ARCol0yngRDRAFT_1000665 | ARCol0yngRDRAFT_10006652 | 325 |
| 317 | 3300001977 | JGI24746J21847_1001655 | JGI24746J21847_10016553 | 325 |
| 318 | 3300001978 | JGI24747J21853_1000133 | JGI24747J21853_10001334 | 325 |
| 319 | 3300001989 | JGI24739J22299_10014140 | JGI24739J22299_100141402 | 325 |
| 320 | 3300001990 | JGI24737J22298_10000960 | JGI24737J22298_100009609 | 325 |
| 321 | 3300001990 | JGI24737J22298_10007118 | JGI24737J22298_100071182 | 325 |
| 322 | 3300001990 | JGI24737J22298_10021016 | JGI24737J22298_100210162 | 325 |
| 323 | 3300002067 | JGI24735J21928_10042458 | JGI24735J21928_100424583 | 325 |
| 324 | 3300002070 | JGI24750J21931_1000601 | JGI24750J21931_10006016 | 325 |
| 325 | 3300002070 | JGI24750J21931_1005810 | JGI24750J21931_10058102 | 325 |
| 326 | 3300002073 | JGI24745J21846_1000099 | JGI24745J21846_10000996 | 325 |
| 327 | 3300002074 | JGI24748J21848_1000721 | JGI24748J21848_10007213 | 325 |
| 328 | 3300002075 | JGI24738J21930_10000223 | JGI24738J21930_100002235 | 325 |
| 329 | 3300002076 | JGI24749J21850_1003197 | JGI24749J21850_10031973 | 325 |
| 330 | 3300002076 | JGI24749J21850_1010025 | JGI24749J21850_10100252 | 325 |
| 331 | 3300002077 | JGI24744J21845_10000129 | JGI24744J21845_1000012910 | 325 |
| 332 | 3300002077 | JGI24744J21845_10003963 | JGI24744J21845_100039634 | 325 |
| 333 | 3300002239 | JGI24034J26672_10000557 | JGI24034J26672_100005576 | 325 |
| 334 | 3300002239 | JGI24034J26672_10003132 | JGI24034J26672_100031323 | 325 |
| 335 | 3300002244 | JGI24742J22300_10000255 | JGI24742J22300_100002558 | 325 |
| 336 | 3300002244 | JGI24742J22300_10000264 | JGI24742J22300_100002648 | 325 |
| 337 | 3300002244 | JGI24742J22300_10000524 | JGI24742J22300_100005245 | 325 |
| 338 | 3300005276 | Ga0065717_1002284 | Ga0065717_10022842 | 325 |
| 339 | 3300005277 | Ga0065716_1001992 | Ga0065716_10019922 | 325 |
| 340 | 3300005289 | Ga0065704_10074561 | Ga0065704_100745615 | 325 |
| 341 | 3300005290 | Ga0065712_10009760 | Ga0065712_100097603 | 325 |
| 342 | 3300005290 | Ga0065712_10070835 | Ga0065712_100708352 | 325 |
| 343 | 3300005293 | Ga0065715_10089377 | Ga0065715_100893772 | 325 |
| 344 | 3300005328 | Ga0070676_10000012 | Ga0070676_1000001251 | 325 |
| 345 | 3300005329 | Ga0070683_100000139 | Ga0070683_10000013914 | 325 |
| 346 | 3300005329 | Ga0070683_100091253 | Ga0070683_1000912533 | 325 |
| 347 | 3300005330 | Ga0070690_100005164 | Ga0070690_1000051648 | 325 |
| 348 | 3300005330 | Ga0070690_100005412 | Ga0070690_1000054127 | 325 |
| 349 | 3300005330 | Ga0070690_100062958 | Ga0070690_1000629582 | 325 |
| 350 | 3300005331 | Ga0070670_100002014 | Ga0070670_1000020148 | 325 |
| 351 | 3300005331 | Ga0070670_100021801 | Ga0070670_1000218016 | 325 |
| 352 | 3300005331 | Ga0070670_100086294 | Ga0070670_1000862941 | 325 |
| 353 | 3300005333 | Ga0070677_10000125 | Ga0070677_100001256 | 325 |
| 354 | 3300005334 | Ga0068869_100000605 | Ga0068869_10000060512 | 325 |
| 355 | 3300005334 | Ga0068869_100021090 | Ga0068869_1000210904 | 325 |
| 356 | 3300005335 | Ga0070666_10017025 | Ga0070666_100170254 | 325 |
| 357 | 3300005335 | Ga0070666_10038295 | Ga0070666_100382951 | 325 |
| 358 | 3300005336 | Ga0070680_100000179 | Ga0070680_10000017911 | 325 |
| 359 | 3300005336 | Ga0070680_100010716 | Ga0070680_1000107161 | 325 |
| 360 | 3300005336 | Ga0070680_100014505 | Ga0070680_1000145053 | 325 |
| 361 | 3300005337 | Ga0070682_100000319 | Ga0070682_1000003199 | 325 |
| 362 | 3300005337 | Ga0070682_100016170 | Ga0070682_1000161705 | 325 |
| 363 | 3300005338 | Ga0068868_100000593 | Ga0068868_1000005934 | 325 |
| 364 | 3300005338 | Ga0068868_100004938 | Ga0068868_1000049386 | 325 |
| 365 | 3300005338 | Ga0068868_100060491 | Ga0068868_1000604913 | 325 |
| 366 | 3300005339 | Ga0070660_100001605 | Ga0070660_1000016055 | 325 |
| 367 | 3300005339 | Ga0070660_100086796 | Ga0070660_1000867962 | 325 |
| 368 | 3300005340 | Ga0070689_100004685 | Ga0070689_1000046859 | 325 |
| 369 | 3300005340 | Ga0070689_100062016 | Ga0070689_1000620162 | 325 |
| 370 | 3300005340 | Ga0070689_100079168 | Ga0070689_1000791682 | 325 |
| 371 | 3300005340 | Ga0070689_100210076 | Ga0070689_1002100762 | 325 |
| 372 | 3300005341 | Ga0070691_10001565 | Ga0070691_100015655 | 325 |
| 373 | 3300005341 | Ga0070691_10040470 | Ga0070691_100404703 | 325 |
| 374 | 3300005343 | Ga0070687_100118710 | Ga0070687_1001187102 | 325 |
| 375 | 3300005344 | Ga0070661_100001455 | Ga0070661_10000145513 | 325 |
| 376 | 3300005344 | Ga0070661_100089918 | Ga0070661_1000899182 | 325 |
| 377 | 3300005345 | Ga0070692_10000434 | Ga0070692_100004343 | 325 |
| 378 | 3300005345 | Ga0070692_10002195 | Ga0070692_100021956 | 325 |
| 379 | 3300005345 | Ga0070692_10024353 | Ga0070692_100243533 | 325 |
| 380 | 3300005347 | Ga0070668_100004423 | Ga0070668_1000044236 | 325 |
| 381 | 3300005347 | Ga0070668_100407758 | Ga0070668_1004077581 | 325 |
| 382 | 3300005353 | Ga0070669_100000409 | Ga0070669_1000004095 | 325 |
| 383 | 3300005353 | Ga0070669_100058741 | Ga0070669_1000587413 | 325 |
| 384 | 3300005353 | Ga0070669_100133693 | Ga0070669_1001336932 | 325 |
| 385 | 3300005354 | Ga0070675_100000166 | Ga0070675_10000016633 | 325 |
| 386 | 3300005354 | Ga0070675_100047183 | Ga0070675_1000471834 | 325 |
| 387 | 3300005354 | Ga0070675_100346017 | Ga0070675_1003460172 | 325 |
| 388 | 3300005355 | Ga0070671_100005674 | Ga0070671_10000567410 | 325 |
| 389 | 3300005355 | Ga0070671_100005938 | Ga0070671_1000059387 | 325 |
| 390 | 3300005355 | Ga0070671_100006280 | Ga0070671_1000062805 | 325 |
| 391 | 3300005355 | Ga0070671_100051098 | Ga0070671_1000510982 | 325 |
| 392 | 3300005355 | Ga0070671_100094656 | Ga0070671_1000946562 | 325 |
| 393 | 3300005355 | Ga0070671_100206327 | Ga0070671_1002063272 | 325 |
| 394 | 3300005356 | Ga0070674_100000644 | Ga0070674_10000064413 | 325 |
| 395 | 3300005356 | Ga0070674_100002605 | Ga0070674_1000026059 | 325 |
| 396 | 3300005364 | Ga0070673_100000041 | Ga0070673_10000004114 | 325 |
| 397 | 3300005364 | Ga0070673_100089493 | Ga0070673_1000894933 | 325 |
| 398 | 3300005365 | Ga0070688_100000180 | Ga0070688_10000018017 | 325 |
| 399 | 3300005365 | Ga0070688_100011831 | Ga0070688_1000118316 | 325 |
| 400 | 3300005365 | Ga0070688_100026530 | Ga0070688_1000265304 | 325 |
| 401 | 3300005365 | Ga0070688_100036302 | Ga0070688_1000363024 | 325 |
| 402 | 3300005365 | Ga0070688_100049523 | Ga0070688_1000495233 | 325 |
| 403 | 3300005365 | Ga0070688_100124822 | Ga0070688_1001248221 | 325 |
| 404 | 3300005366 | Ga0070659_100000752 | Ga0070659_10000075214 | 325 |
| 405 | 3300005366 | Ga0070659_100143341 | Ga0070659_1001433412 | 325 |
| 406 | 3300005366 | Ga0070659_100229856 | Ga0070659_1002298561 | 325 |
| 407 | 3300005367 | Ga0070667_100000365 | Ga0070667_1000003654 | 325 |
| 408 | 3300005367 | Ga0070667_100019077 | Ga0070667_1000190774 | 325 |
| 409 | 3300005406 | Ga0070703_10003914 | Ga0070703_100039144 | 325 |
| 410 | 3300005434 | Ga0070709_10003137 | Ga0070709_100031371 | 325 |
| 411 | 3300005434 | Ga0070709_10019500 | Ga0070709_100195003 | 325 |
| 412 | 3300005435 | Ga0070714_100057992 | Ga0070714_1000579922 | 325 |
| 413 | 3300005435 | Ga0070714_100098674 | Ga0070714_1000986743 | 325 |
| 414 | 3300005435 | Ga0070714_100110282 | Ga0070714_1001102821 | 325 |
| 415 | 3300005435 | Ga0070714_100398998 | Ga0070714_1003989981 | 325 |
| 416 | 3300005436 | Ga0070713_100063078 | Ga0070713_1000630782 | 325 |
| 417 | 3300005436 | Ga0070713_100135262 | Ga0070713_1001352622 | 325 |
| 418 | 3300005436 | Ga0070713_100195422 | Ga0070713_1001954222 | 325 |
| 419 | 3300005437 | Ga0070710_10005022 | Ga0070710_100050222 | 325 |
| 420 | 3300005437 | Ga0070710_10011315 | Ga0070710_100113155 | 325 |
| 421 | 3300005437 | Ga0070710_10083431 | Ga0070710_100834312 | 325 |
| 422 | 3300005437 | Ga0070710_10102081 | Ga0070710_101020812 | 325 |
| 423 | 3300005438 | Ga0070701_10000493 | Ga0070701_1000049313 | 325 |
| 424 | 3300005438 | Ga0070701_10012908 | Ga0070701_100129083 | 325 |
| 425 | 3300005439 | Ga0070711_100015744 | Ga0070711_1000157446 | 325 |
| 426 | 3300005439 | Ga0070711_100030851 | Ga0070711_1000308513 | 325 |
| 427 | 3300005439 | Ga0070711_100185604 | Ga0070711_1001856042 | 325 |
| 428 | 3300005439 | Ga0070711_100224195 | Ga0070711_1002241951 | 325 |
| 429 | 3300005440 | Ga0070705_100002314 | Ga0070705_1000023147 | 325 |
| 430 | 3300005440 | Ga0070705_100044262 | Ga0070705_1000442622 | 325 |
| 431 | 3300005441 | Ga0070700_100000467 | Ga0070700_10000046715 | 325 |
| 432 | 3300005441 | Ga0070700_100169928 | Ga0070700_1001699282 | 325 |
| 433 | 3300005444 | Ga0070694_100000065 | Ga0070694_10000006547 | 325 |
| 434 | 3300005444 | Ga0070694_100029375 | Ga0070694_1000293752 | 325 |
| 435 | 3300005444 | Ga0070694_100165982 | Ga0070694_1001659822 | 325 |
| 436 | 3300005445 | Ga0070708_100286274 | Ga0070708_1002862742 | 325 |
| 437 | 3300005455 | Ga0070663_100000473 | Ga0070663_10000047313 | 325 |
| 438 | 3300005455 | Ga0070663_100138607 | Ga0070663_1001386072 | 325 |
| 439 | 3300005455 | Ga0070663_100233791 | Ga0070663_1002337911 | 325 |
| 440 | 3300005456 | Ga0070678_100000091 | Ga0070678_1000000915 | 325 |
| 441 | 3300005456 | Ga0070678_100007141 | Ga0070678_1000071412 | 325 |
| 442 | 3300005456 | Ga0070678_100010348 | Ga0070678_1000103484 | 325 |
| 443 | 3300005456 | Ga0070678_100034927 | Ga0070678_1000349271 | 325 |
| 444 | 3300005456 | Ga0070678_100062680 | Ga0070678_1000626801 | 325 |
| 445 | 3300005457 | Ga0070662_100006535 | Ga0070662_1000065355 | 325 |
| 446 | 3300005457 | Ga0070662_100043231 | Ga0070662_1000432314 | 325 |
| 447 | 3300005457 | Ga0070662_100057442 | Ga0070662_1000574424 | 325 |
| 448 | 3300005457 | Ga0070662_100241111 | Ga0070662_1002411112 | 325 |
| 449 | 3300005458 | Ga0070681_10010003 | Ga0070681_100100038 | 325 |
| 450 | 3300005458 | Ga0070681_10092484 | Ga0070681_100924842 | 325 |
| 451 | 3300005458 | Ga0070681_10191610 | Ga0070681_101916102 | 325 |
| 452 | 3300005458 | Ga0070681_10223913 | Ga0070681_102239132 | 325 |
| 453 | 3300005459 | Ga0068867_100000859 | Ga0068867_10000085921 | 325 |
| 454 | 3300005459 | Ga0068867_100007691 | Ga0068867_1000076914 | 325 |
| 455 | 3300005459 | Ga0068867_100119168 | Ga0068867_1001191683 | 325 |
| 456 | 3300005466 | Ga0070685_10001731 | Ga0070685_100017313 | 325 |
| 457 | 3300005466 | Ga0070685_10015115 | Ga0070685_100151154 | 325 |
| 458 | 3300005466 | Ga0070685_10018921 | Ga0070685_100189214 | 325 |
| 459 | 3300005466 | Ga0070685_10041755 | Ga0070685_100417553 | 325 |
| 460 | 3300005468 | Ga0070707_100072359 | Ga0070707_1000723591 | 325 |
| 461 | 3300005530 | Ga0070679_100006957 | Ga0070679_1000069575 | 325 |
| 462 | 3300005530 | Ga0070679_100012754 | Ga0070679_1000127545 | 325 |
| 463 | 3300005535 | Ga0070684_100000219 | Ga0070684_1000002195 | 325 |
| 464 | 3300005535 | Ga0070684_100264601 | Ga0070684_1002646012 | 325 |
| 465 | 3300005539 | Ga0068853_100000600 | Ga0068853_10000060020 | 325 |
| 466 | 3300005539 | Ga0068853_100441788 | Ga0068853_1004417881 | 325 |
| 467 | 3300005543 | Ga0070672_100000019 | Ga0070672_10000001913 | 325 |
| 468 | 3300005543 | Ga0070672_100005606 | Ga0070672_1000056064 | 325 |
| 469 | 3300005543 | Ga0070672_100091597 | Ga0070672_1000915972 | 325 |
| 470 | 3300005543 | Ga0070672_100131022 | Ga0070672_1001310222 | 325 |
| 471 | 3300005544 | Ga0070686_100007875 | Ga0070686_1000078754 | 325 |
| 472 | 3300005544 | Ga0070686_100013361 | Ga0070686_1000133615 | 325 |
| 473 | 3300005544 | Ga0070686_100084027 | Ga0070686_1000840272 | 325 |
| 474 | 3300005544 | Ga0070686_100106911 | Ga0070686_1001069113 | 325 |
| 475 | 3300005545 | Ga0070695_100000474 | Ga0070695_10000047415 | 325 |
| 476 | 3300005545 | Ga0070695_100157083 | Ga0070695_1001570832 | 325 |
| 477 | 3300005546 | Ga0070696_100003100 | Ga0070696_10000310011 | 325 |
| 478 | 3300005546 | Ga0070696_100101172 | Ga0070696_1001011723 | 325 |
| 479 | 3300005546 | Ga0070696_100126973 | Ga0070696_1001269733 | 325 |
| 480 | 3300005547 | Ga0070693_100001868 | Ga0070693_1000018686 | 325 |
| 481 | 3300005547 | Ga0070693_100080784 | Ga0070693_1000807842 | 325 |
| 482 | 3300005548 | Ga0070665_100010015 | Ga0070665_1000100157 | 325 |
| 483 | 3300005549 | Ga0070704_100000252 | Ga0070704_10000025219 | 325 |
| 484 | 3300005549 | Ga0070704_100001606 | Ga0070704_10000160612 | 325 |
| 485 | 3300005549 | Ga0070704_100103247 | Ga0070704_1001032472 | 325 |
| 486 | 3300005563 | Ga0068855_100018421 | Ga0068855_1000184216 | 325 |
| 487 | 3300005563 | Ga0068855_100019721 | Ga0068855_1000197216 | 325 |
| 488 | 3300005563 | Ga0068855_100063129 | Ga0068855_1000631292 | 325 |
| 489 | 3300005563 | Ga0068855_100094398 | Ga0068855_1000943984 | 325 |
| 490 | 3300005564 | Ga0070664_100000819 | Ga0070664_10000081911 | 325 |
| 491 | 3300005564 | Ga0070664_100022255 | Ga0070664_1000222553 | 325 |
| 492 | 3300005564 | Ga0070664_100152816 | Ga0070664_1001528162 | 325 |
| 493 | 3300005577 | Ga0068857_100000768 | Ga0068857_1000007685 | 325 |
| 494 | 3300005578 | Ga0068854_100001736 | Ga0068854_1000017365 | 325 |
| 495 | 3300005578 | Ga0068854_100112791 | Ga0068854_1001127912 | 325 |
| 496 | 3300005614 | Ga0068856_100002295 | Ga0068856_10000229517 | 325 |
| 497 | 3300005614 | Ga0068856_100144924 | Ga0068856_1001449244 | 325 |
| 498 | 3300005614 | Ga0068856_100266791 | Ga0068856_1002667912 | 325 |
| 499 | 3300005615 | Ga0070702_100000898 | Ga0070702_1000008985 | 325 |
| 500 | 3300005615 | Ga0070702_100057764 | Ga0070702_1000577643 | 325 |
| 501 | 3300005616 | Ga0068852_100001992 | Ga0068852_10000199210 | 325 |
| 502 | 3300005616 | Ga0068852_100118580 | Ga0068852_1001185802 | 325 |
| 503 | 3300005616 | Ga0068852_100174225 | Ga0068852_1001742253 | 325 |
| 504 | 3300005617 | Ga0068859_100030288 | Ga0068859_1000302882 | 325 |
| 505 | 3300005617 | Ga0068859_100281836 | Ga0068859_1002818363 | 325 |
| 506 | 3300005618 | Ga0068864_100005938 | Ga0068864_10000593811 | 325 |
| 507 | 3300005618 | Ga0068864_100009491 | Ga0068864_1000094918 | 325 |
| 508 | 3300005618 | Ga0068864_100029150 | Ga0068864_1000291501 | 325 |
| 509 | 3300005718 | Ga0068866_10001028 | Ga0068866_100010285 | 325 |
| 510 | 3300005718 | Ga0068866_10013621 | Ga0068866_100136212 | 325 |
| 511 | 3300005718 | Ga0068866_10154896 | Ga0068866_101548961 | 325 |
| 512 | 3300005719 | Ga0068861_100000169 | Ga0068861_1000001695 | 325 |
| 513 | 3300005719 | Ga0068861_100190783 | Ga0068861_1001907832 | 325 |
| 514 | 3300005834 | Ga0068851_10024424 | Ga0068851_100244241 | 325 |
| 515 | 3300005840 | Ga0068870_10000586 | Ga0068870_100005864 | 325 |
| 516 | 3300005840 | Ga0068870_10003342 | Ga0068870_100033427 | 325 |
| 517 | 3300005841 | Ga0068863_100000381 | Ga0068863_10000038130 | 325 |
| 518 | 3300005841 | Ga0068863_100014411 | Ga0068863_1000144111 | 325 |
| 519 | 3300005842 | Ga0068858_100009197 | Ga0068858_1000091979 | 325 |
| 520 | 3300005842 | Ga0068858_100016225 | Ga0068858_1000162252 | 325 |
| 521 | 3300005842 | Ga0068858_100511731 | Ga0068858_1005117311 | 325 |
| 522 | 3300005843 | Ga0068860_100001472 | Ga0068860_10000147220 | 325 |
| 523 | 3300005843 | Ga0068860_100007428 | Ga0068860_1000074289 | 325 |
| 524 | 3300005843 | Ga0068860_100081520 | Ga0068860_1000815203 | 325 |
| 525 | 3300005844 | Ga0068862_100001886 | Ga0068862_1000018865 | 325 |
| 526 | 3300005844 | Ga0068862_100021781 | Ga0068862_1000217813 | 325 |
| 527 | 3300005844 | Ga0068862_100065508 | Ga0068862_1000655084 | 325 |
| 528 | 3300005937 | Ga0081455_10000036 | Ga0081455_10000036127 | 325 |
| 529 | 3300005937 | Ga0081455_10004173 | Ga0081455_1000417320 | 325 |
| 530 | 3300005937 | Ga0081455_10012017 | Ga0081455_100120175 | 325 |
| 531 | 3300005981 | Ga0081538_10023585 | Ga0081538_100235852 | 325 |
| 532 | 3300005983 | Ga0081540_1060985 | Ga0081540_10609852 | 325 |
| 533 | 3300006028 | Ga0070717_10000199 | Ga0070717_1000019916 | 325 |
| 534 | 3300006028 | Ga0070717_10199428 | Ga0070717_101994282 | 325 |
| 535 | 3300006038 | Ga0075365_10023303 | Ga0075365_100233032 | 325 |
| 536 | 3300006038 | Ga0075365_10063525 | Ga0075365_100635254 | 325 |
| 537 | 3300006042 | Ga0075368_10041807 | Ga0075368_100418071 | 325 |
| 538 | 3300006048 | Ga0075363_100019886 | Ga0075363_1000198861 | 325 |
| 539 | 3300006048 | Ga0075363_100061414 | Ga0075363_1000614142 | 325 |
| 540 | 3300006048 | Ga0075363_100091630 | Ga0075363_1000916302 | 325 |
| 541 | 3300006048 | Ga0075363_100133856 | Ga0075363_1001338562 | 325 |
| 542 | 3300006173 | Ga0070716_100002448 | Ga0070716_1000024486 | 325 |
| 543 | 3300006173 | Ga0070716_100100739 | Ga0070716_1001007393 | 325 |
| 544 | 3300006175 | Ga0070712_100002527 | Ga0070712_1000025277 | 325 |
| 545 | 3300006175 | Ga0070712_100014196 | Ga0070712_1000141964 | 325 |
| 546 | 3300006175 | Ga0070712_100017680 | Ga0070712_1000176804 | 325 |
| 547 | 3300006186 | Ga0075369_10051679 | Ga0075369_100516792 | 325 |
| 548 | 3300006194 | Ga0075427_10001399 | Ga0075427_100013992 | 325 |
| 549 | 3300006195 | Ga0075366_10016027 | Ga0075366_100160274 | 325 |
| 550 | 3300006195 | Ga0075366_10036158 | Ga0075366_100361583 | 325 |
| 551 | 3300006237 | Ga0097621_100001234 | Ga0097621_1000012345 | 325 |
| 552 | 3300006237 | Ga0097621_100025864 | Ga0097621_1000258642 | 325 |
| 553 | 3300006237 | Ga0097621_100043421 | Ga0097621_1000434214 | 325 |
| 554 | 3300006353 | Ga0075370_10057643 | Ga0075370_100576433 | 325 |
| 555 | 3300006358 | Ga0068871_100000068 | Ga0068871_10000006853 | 325 |
| 556 | 3300006358 | Ga0068871_100009351 | Ga0068871_1000093514 | 325 |
| 557 | 3300006358 | Ga0068871_100012500 | Ga0068871_1000125005 | 325 |
| 558 | 3300006358 | Ga0068871_100025352 | Ga0068871_1000253524 | 325 |
| 559 | 3300006844 | Ga0075428_100035558 | Ga0075428_1000355581 | 325 |
| 560 | 3300006844 | Ga0075428_100174934 | Ga0075428_1001749344 | 325 |
| 561 | 3300006846 | Ga0075430_100004696 | Ga0075430_1000046961 | 325 |
| 562 | 3300006847 | Ga0075431_100006639 | Ga0075431_1000066391 | 325 |
| 563 | 3300006852 | Ga0075433_10001599 | Ga0075433_1000159911 | 325 |
| 564 | 3300006852 | Ga0075433_10403539 | Ga0075433_104035392 | 325 |
| 565 | 3300006871 | Ga0075434_100000576 | Ga0075434_10000057618 | 325 |
| 566 | 3300006871 | Ga0075434_100001666 | Ga0075434_10000166611 | 325 |
| 567 | 3300006871 | Ga0075434_100073539 | Ga0075434_1000735395 | 325 |
| 568 | 3300006871 | Ga0075434_100113294 | Ga0075434_1001132942 | 325 |
| 569 | 3300006871 | Ga0075434_100208693 | Ga0075434_1002086931 | 325 |
| 570 | 3300006871 | Ga0075434_100468579 | Ga0075434_1004685791 | 325 |
| 571 | 3300006880 | Ga0075429_100060828 | Ga0075429_1000608281 | 325 |
| 572 | 3300006881 | Ga0068865_100005133 | Ga0068865_1000051336 | 325 |
| 573 | 3300006881 | Ga0068865_100103925 | Ga0068865_1001039252 | 325 |
| 574 | 3300006914 | Ga0075436_100070922 | Ga0075436_1000709223 | 325 |
| 575 | 3300006931 | Ga0097620_100030290 | Ga0097620_1000302902 | 325 |
| 576 | 3300006931 | Ga0097620_100281806 | Ga0097620_1002818063 | 325 |
| 577 | 3300007076 | Ga0075435_100002716 | Ga0075435_1000027165 | 325 |
| 578 | 3300007076 | Ga0075435_100009255 | Ga0075435_1000092558 | 325 |
| 579 | 3300007076 | Ga0075435_100010036 | Ga0075435_1000100366 | 325 |
| 580 | 3300007076 | Ga0075435_100153065 | Ga0075435_1001530653 | 325 |
| 581 | 3300009092 | Ga0105250_10017722 | Ga0105250_100177223 | 325 |
| 582 | 3300009093 | Ga0105240_10068510 | Ga0105240_100685102 | 325 |
| 583 | 3300009093 | Ga0105240_10153475 | Ga0105240_101534752 | 325 |
| 584 | 3300009094 | Ga0111539_10000082 | Ga0111539_1000008214 | 325 |
| 585 | 3300009094 | Ga0111539_10000503 | Ga0111539_1000050333 | 325 |
| 586 | 3300009094 | Ga0111539_10003417 | Ga0111539_1000341712 | 325 |
| 587 | 3300009094 | Ga0111539_10217427 | Ga0111539_102174272 | 325 |
| 588 | 3300009098 | Ga0105245_10000780 | Ga0105245_1000078013 | 325 |
| 589 | 3300009098 | Ga0105245_10091423 | Ga0105245_100914233 | 325 |
| 590 | 3300009098 | Ga0105245_10098843 | Ga0105245_100988432 | 325 |
| 591 | 3300009098 | Ga0105245_10244517 | Ga0105245_102445172 | 325 |
| 592 | 3300009101 | Ga0105247_10002726 | Ga0105247_100027266 | 325 |
| 593 | 3300009101 | Ga0105247_10017791 | Ga0105247_100177914 | 325 |
| 594 | 3300009101 | Ga0105247_10149201 | Ga0105247_101492012 | 325 |
| 595 | 3300009147 | Ga0114129_10009008 | Ga0114129_1000900813 | 325 |
| 596 | 3300009147 | Ga0114129_10013874 | Ga0114129_1001387411 | 325 |
| 597 | 3300009147 | Ga0114129_10987483 | Ga0114129_109874831 | 325 |
| 598 | 3300009148 | Ga0105243_10001083 | Ga0105243_1000108314 | 325 |
| 599 | 3300009148 | Ga0105243_10032306 | Ga0105243_100323065 | 325 |
| 600 | 3300009148 | Ga0105243_10033088 | Ga0105243_100330884 | 325 |
| 601 | 3300009174 | Ga0105241_10000760 | Ga0105241_1000076013 | 325 |
| 602 | 3300009174 | Ga0105241_10083372 | Ga0105241_100833724 | 325 |
| 603 | 3300009174 | Ga0105241_10095627 | Ga0105241_100956273 | 325 |
| 604 | 3300009176 | Ga0105242_10004818 | Ga0105242_1000481813 | 325 |
| 605 | 3300009176 | Ga0105242_10019812 | Ga0105242_100198126 | 325 |
| 606 | 3300009176 | Ga0105242_10043456 | Ga0105242_100434562 | 325 |
| 607 | 3300009177 | Ga0105248_10011305 | Ga0105248_100113053 | 325 |
| 608 | 3300009177 | Ga0105248_10031416 | Ga0105248_100314164 | 325 |
| 609 | 3300009177 | Ga0105248_10043099 | Ga0105248_100430992 | 325 |
| 610 | 3300009177 | Ga0105248_10076338 | Ga0105248_100763385 | 325 |
| 611 | 3300009177 | Ga0105248_10333411 | Ga0105248_103334112 | 325 |
| 612 | 3300009545 | Ga0105237_10006171 | Ga0105237_1000617112 | 325 |
| 613 | 3300009545 | Ga0105237_10024205 | Ga0105237_100242054 | 325 |
| 614 | 3300009551 | Ga0105238_10013907 | Ga0105238_100139074 | 325 |
| 615 | 3300009553 | Ga0105249_10002196 | Ga0105249_100021968 | 325 |
| 616 | 3300009553 | Ga0105249_10448538 | Ga0105249_104485382 | 325 |
| 617 | 3300010375 | Ga0105239_10002791 | Ga0105239_1000279112 | 325 |
| 618 | 3300010375 | Ga0105239_10049106 | Ga0105239_100491065 | 325 |
| 619 | 3300010375 | Ga0105239_10228125 | Ga0105239_102281252 | 325 |
| 620 | 3300011119 | Ga0105246_10001585 | Ga0105246_1000158514 | 325 |
| 621 | 3300011119 | Ga0105246_10270441 | Ga0105246_102704412 | 325 |
| 622 | 3300011119 | Ga0105246_10404033 | Ga0105246_104040331 | 325 |
| 623 | 3300012494 | Ga0157341_1001083 | Ga0157341_10010832 | 325 |
| 624 | 3300012515 | Ga0157338_1000167 | Ga0157338_10001674 | 325 |
| 625 | 3300013100 | Ga0157373_10006240 | Ga0157373_100062406 | 325 |
| 626 | 3300013102 | Ga0157371_10155413 | Ga0157371_101554133 | 325 |
| 627 | 3300013104 | Ga0157370_10030489 | Ga0157370_100304892 | 325 |
| 628 | 3300013104 | Ga0157370_10208804 | Ga0157370_102088042 | 325 |
| 629 | 3300013105 | Ga0157369_10160600 | Ga0157369_101606002 | 325 |
| 630 | 3300013296 | Ga0157374_10001691 | Ga0157374_1000169114 | 325 |
| 631 | 3300013296 | Ga0157374_10398584 | Ga0157374_103985842 | 325 |
| 632 | 3300013297 | Ga0157378_10001445 | Ga0157378_1000144513 | 325 |
| 633 | 3300013297 | Ga0157378_10049325 | Ga0157378_100493254 | 325 |
| 634 | 3300013297 | Ga0157378_10052925 | Ga0157378_100529254 | 325 |
| 635 | 3300013297 | Ga0157378_10510714 | Ga0157378_105107141 | 325 |
| 636 | 3300013306 | Ga0163162_10000790 | Ga0163162_1000079013 | 325 |
| 637 | 3300013307 | Ga0157372_10009037 | Ga0157372_100090378 | 325 |
| 638 | 3300013307 | Ga0157372_10419820 | Ga0157372_104198203 | 325 |
| 639 | 3300013308 | Ga0157375_10000468 | Ga0157375_1000046824 | 325 |
| 640 | 3300013308 | Ga0157375_10048514 | Ga0157375_100485144 | 325 |
| 641 | 3300013308 | Ga0157375_10182541 | Ga0157375_101825413 | 325 |
| 642 | 3300014325 | Ga0163163_10003322 | Ga0163163_1000332217 | 325 |
| 643 | 3300014325 | Ga0163163_10020189 | Ga0163163_100201896 | 325 |
| 644 | 3300014325 | Ga0163163_10061676 | Ga0163163_100616764 | 325 |
| 645 | 3300014325 | Ga0163163_10111016 | Ga0163163_101110163 | 325 |
| 646 | 3300014325 | Ga0163163_10398212 | Ga0163163_103982122 | 325 |
| 647 | 3300014326 | Ga0157380_10002913 | Ga0157380_1000291310 | 325 |
| 648 | 3300014326 | Ga0157380_10043495 | Ga0157380_100434952 | 325 |
| 649 | 3300014745 | Ga0157377_10000276 | Ga0157377_1000027614 | 325 |
| 650 | 3300014745 | Ga0157377_10038382 | Ga0157377_100383823 | 325 |
| 651 | 3300014968 | Ga0157379_10002285 | Ga0157379_1000228510 | 325 |
| 652 | 3300014968 | Ga0157379_10031389 | Ga0157379_100313894 | 325 |
| 653 | 3300014969 | Ga0157376_10000692 | Ga0157376_100006923 | 325 |
| 654 | 3300014969 | Ga0157376_10042226 | Ga0157376_100422264 | 325 |
| 655 | 3300017792 | Ga0163161_10000384 | Ga0163161_1000038413 | 325 |
| 656 | 3300017792 | Ga0163161_10039131 | Ga0163161_100391312 | 325 |
| 657 | 3300017792 | Ga0163161_10047076 | Ga0163161_100470762 | 325 |
| 658 | 3300021361 | Ga0213872_10022015 | Ga0213872_100220152 | 325 |
| 659 | 3300021384 | Ga0213876_10012755 | Ga0213876_100127553 | 325 |
| 660 | 3300024225 | Ga0224572_1010337 | Ga0224572_10103372 | 325 |
| 661 | 3300025271 | Ga0207666_1000097 | Ga0207666_100009713 | 325 |
| 662 | 3300025290 | Ga0207673_1000201 | Ga0207673_10002016 | 325 |
| 663 | 3300025297 | Ga0209758_1000638 | Ga0209758_100063829 | 325 |
| 664 | 3300025297 | Ga0209758_1030349 | Ga0209758_10303492 | 325 |
| 665 | 3300025302 | Ga0207426_1034655 | Ga0207426_10346552 | 325 |
| 666 | 3300025315 | Ga0207697_10000550 | Ga0207697_1000055013 | 325 |
| 667 | 3300025321 | Ga0207656_10104678 | Ga0207656_101046781 | 325 |
| 668 | 3300025893 | Ga0207682_10000088 | Ga0207682_1000008814 | 325 |
| 669 | 3300025893 | Ga0207682_10081589 | Ga0207682_100815892 | 325 |
| 670 | 3300025898 | Ga0207692_10000876 | Ga0207692_100008769 | 325 |
| 671 | 3300025898 | Ga0207692_10001966 | Ga0207692_100019664 | 325 |
| 672 | 3300025899 | Ga0207642_10000381 | Ga0207642_1000038114 | 325 |
| 673 | 3300025899 | Ga0207642_10020631 | Ga0207642_100206312 | 325 |
| 674 | 3300025900 | Ga0207710_10001324 | Ga0207710_100013246 | 325 |
| 675 | 3300025900 | Ga0207710_10001609 | Ga0207710_100016096 | 325 |
| 676 | 3300025900 | Ga0207710_10006390 | Ga0207710_100063905 | 325 |
| 677 | 3300025901 | Ga0207688_10001203 | Ga0207688_100012034 | 325 |
| 678 | 3300025901 | Ga0207688_10002655 | Ga0207688_100026558 | 325 |
| 679 | 3300025901 | Ga0207688_10059462 | Ga0207688_100594623 | 325 |
| 680 | 3300025903 | Ga0207680_10009047 | Ga0207680_100090474 | 325 |
| 681 | 3300025903 | Ga0207680_10132841 | Ga0207680_101328412 | 325 |
| 682 | 3300025903 | Ga0207680_10148619 | Ga0207680_101486191 | 325 |
| 683 | 3300025904 | Ga0207647_10002714 | Ga0207647_100027144 | 325 |
| 684 | 3300025904 | Ga0207647_10019352 | Ga0207647_100193524 | 325 |
| 685 | 3300025904 | Ga0207647_10075399 | Ga0207647_100753993 | 325 |
| 686 | 3300025905 | Ga0207685_10154206 | Ga0207685_101542061 | 325 |
| 687 | 3300025906 | Ga0207699_10002088 | Ga0207699_100020889 | 325 |
| 688 | 3300025907 | Ga0207645_10000140 | Ga0207645_100001404 | 325 |
| 689 | 3300025907 | Ga0207645_10034330 | Ga0207645_100343302 | 325 |
| 690 | 3300025907 | Ga0207645_10035558 | Ga0207645_100355584 | 325 |
| 691 | 3300025907 | Ga0207645_10059966 | Ga0207645_100599661 | 325 |
| 692 | 3300025908 | Ga0207643_10000083 | Ga0207643_100000834 | 325 |
| 693 | 3300025908 | Ga0207643_10001883 | Ga0207643_100018838 | 325 |
| 694 | 3300025909 | Ga0207705_10098196 | Ga0207705_100981962 | 325 |
| 695 | 3300025910 | Ga0207684_10075371 | Ga0207684_100753712 | 325 |
| 696 | 3300025910 | Ga0207684_10173160 | Ga0207684_101731602 | 325 |
| 697 | 3300025911 | Ga0207654_10002699 | Ga0207654_100026998 | 325 |
| 698 | 3300025912 | Ga0207707_10020854 | Ga0207707_100208546 | 325 |
| 699 | 3300025912 | Ga0207707_10160248 | Ga0207707_101602481 | 325 |
| 700 | 3300025912 | Ga0207707_10220579 | Ga0207707_102205792 | 325 |
| 701 | 3300025913 | Ga0207695_10167547 | Ga0207695_101675472 | 325 |
| 702 | 3300025913 | Ga0207695_10371047 | Ga0207695_103710472 | 325 |
| 703 | 3300025913 | Ga0207695_10416759 | Ga0207695_104167592 | 325 |
| 704 | 3300025914 | Ga0207671_10004533 | Ga0207671_100045336 | 325 |
| 705 | 3300025915 | Ga0207693_10007304 | Ga0207693_100073048 | 325 |
| 706 | 3300025915 | Ga0207693_10009632 | Ga0207693_100096325 | 325 |
| 707 | 3300025915 | Ga0207693_10015829 | Ga0207693_100158295 | 325 |
| 708 | 3300025915 | Ga0207693_10021626 | Ga0207693_100216262 | 325 |
| 709 | 3300025915 | Ga0207693_10078050 | Ga0207693_100780501 | 325 |
| 710 | 3300025916 | Ga0207663_10021132 | Ga0207663_100211323 | 325 |
| 711 | 3300025916 | Ga0207663_10029176 | Ga0207663_100291762 | 325 |
| 712 | 3300025917 | Ga0207660_10000073 | Ga0207660_1000007320 | 325 |
| 713 | 3300025917 | Ga0207660_10101848 | Ga0207660_101018482 | 325 |
| 714 | 3300025918 | Ga0207662_10000964 | Ga0207662_1000096413 | 325 |
| 715 | 3300025918 | Ga0207662_10001013 | Ga0207662_100010136 | 325 |
| 716 | 3300025918 | Ga0207662_10019591 | Ga0207662_100195914 | 325 |
| 717 | 3300025918 | Ga0207662_10199088 | Ga0207662_101990881 | 325 |
| 718 | 3300025919 | Ga0207657_10005395 | Ga0207657_1000539513 | 325 |
| 719 | 3300025919 | Ga0207657_10020125 | Ga0207657_100201257 | 325 |
| 720 | 3300025919 | Ga0207657_10033571 | Ga0207657_100335715 | 325 |
| 721 | 3300025919 | Ga0207657_10068436 | Ga0207657_100684363 | 325 |
| 722 | 3300025920 | Ga0207649_10000450 | Ga0207649_1000045019 | 325 |
| 723 | 3300025920 | Ga0207649_10013956 | Ga0207649_100139561 | 325 |
| 724 | 3300025920 | Ga0207649_10020627 | Ga0207649_100206271 | 325 |
| 725 | 3300025921 | Ga0207652_10008726 | Ga0207652_100087266 | 325 |
| 726 | 3300025921 | Ga0207652_10341105 | Ga0207652_103411052 | 325 |
| 727 | 3300025923 | Ga0207681_10000097 | Ga0207681_1000009732 | 325 |
| 728 | 3300025924 | Ga0207694_10024241 | Ga0207694_100242414 | 325 |
| 729 | 3300025925 | Ga0207650_10002648 | Ga0207650_100026482 | 325 |
| 730 | 3300025925 | Ga0207650_10020241 | Ga0207650_100202413 | 325 |
| 731 | 3300025925 | Ga0207650_10042894 | Ga0207650_100428944 | 325 |
| 732 | 3300025926 | Ga0207659_10000092 | Ga0207659_1000009246 | 325 |
| 733 | 3300025926 | Ga0207659_10006748 | Ga0207659_100067487 | 325 |
| 734 | 3300025926 | Ga0207659_10020865 | Ga0207659_100208654 | 325 |
| 735 | 3300025927 | Ga0207687_10000219 | Ga0207687_100002195 | 325 |
| 736 | 3300025927 | Ga0207687_10029871 | Ga0207687_100298714 | 325 |
| 737 | 3300025927 | Ga0207687_10219639 | Ga0207687_102196391 | 325 |
| 738 | 3300025928 | Ga0207700_10002485 | Ga0207700_100024857 | 325 |
| 739 | 3300025929 | Ga0207664_10005574 | Ga0207664_100055744 | 325 |
| 740 | 3300025931 | Ga0207644_10021419 | Ga0207644_100214192 | 325 |
| 741 | 3300025931 | Ga0207644_10091736 | Ga0207644_100917362 | 325 |
| 742 | 3300025931 | Ga0207644_10119158 | Ga0207644_101191582 | 325 |
| 743 | 3300025932 | Ga0207690_10003312 | Ga0207690_100033125 | 325 |
| 744 | 3300025932 | Ga0207690_10104156 | Ga0207690_101041562 | 325 |
| 745 | 3300025933 | Ga0207706_10004310 | Ga0207706_100043104 | 325 |
| 746 | 3300025933 | Ga0207706_10005901 | Ga0207706_100059013 | 325 |
| 747 | 3300025933 | Ga0207706_10008823 | Ga0207706_100088234 | 325 |
| 748 | 3300025933 | Ga0207706_10035694 | Ga0207706_100356941 | 325 |
| 749 | 3300025933 | Ga0207706_10285828 | Ga0207706_102858282 | 325 |
| 750 | 3300025933 | Ga0207706_10306745 | Ga0207706_103067451 | 325 |
| 751 | 3300025934 | Ga0207686_10000796 | Ga0207686_100007965 | 325 |
| 752 | 3300025934 | Ga0207686_10007990 | Ga0207686_100079903 | 325 |
| 753 | 3300025934 | Ga0207686_10219760 | Ga0207686_102197602 | 325 |
| 754 | 3300025935 | Ga0207709_10000362 | Ga0207709_1000036230 | 325 |
| 755 | 3300025935 | Ga0207709_10222423 | Ga0207709_102224232 | 325 |
| 756 | 3300025936 | Ga0207670_10002375 | Ga0207670_100023758 | 325 |
| 757 | 3300025936 | Ga0207670_10061867 | Ga0207670_100618673 | 325 |
| 758 | 3300025936 | Ga0207670_10097107 | Ga0207670_100971073 | 325 |
| 759 | 3300025936 | Ga0207670_10361239 | Ga0207670_103612391 | 325 |
| 760 | 3300025937 | Ga0207669_10000350 | Ga0207669_1000035011 | 325 |
| 761 | 3300025937 | Ga0207669_10014842 | Ga0207669_100148422 | 325 |
| 762 | 3300025937 | Ga0207669_10132331 | Ga0207669_101323312 | 325 |
| 763 | 3300025938 | Ga0207704_10000479 | Ga0207704_1000047910 | 325 |
| 764 | 3300025938 | Ga0207704_10012862 | Ga0207704_100128624 | 325 |
| 765 | 3300025939 | Ga0207665_10001702 | Ga0207665_1000170210 | 325 |
| 766 | 3300025939 | Ga0207665_10025177 | Ga0207665_100251775 | 325 |
| 767 | 3300025939 | Ga0207665_10144615 | Ga0207665_101446152 | 325 |
| 768 | 3300025940 | Ga0207691_10000283 | Ga0207691_1000028346 | 325 |
| 769 | 3300025940 | Ga0207691_10040853 | Ga0207691_100408534 | 325 |
| 770 | 3300025940 | Ga0207691_10070775 | Ga0207691_100707753 | 325 |
| 771 | 3300025940 | Ga0207691_10097671 | Ga0207691_100976712 | 325 |
| 772 | 3300025941 | Ga0207711_10009170 | Ga0207711_100091705 | 325 |
| 773 | 3300025941 | Ga0207711_10076028 | Ga0207711_100760283 | 325 |
| 774 | 3300025941 | Ga0207711_10087463 | Ga0207711_100874633 | 325 |
| 775 | 3300025941 | Ga0207711_10102644 | Ga0207711_101026442 | 325 |
| 776 | 3300025941 | Ga0207711_10221806 | Ga0207711_102218062 | 325 |
| 777 | 3300025942 | Ga0207689_10000085 | Ga0207689_1000008564 | 325 |
| 778 | 3300025942 | Ga0207689_10002370 | Ga0207689_100023706 | 325 |
| 779 | 3300025942 | Ga0207689_10044422 | Ga0207689_100444222 | 325 |
| 780 | 3300025944 | Ga0207661_10000464 | Ga0207661_1000046414 | 325 |
| 781 | 3300025944 | Ga0207661_10009753 | Ga0207661_100097537 | 325 |
| 782 | 3300025945 | Ga0207679_10000030 | Ga0207679_10000030153 | 325 |
| 783 | 3300025945 | Ga0207679_10006772 | Ga0207679_100067725 | 325 |
| 784 | 3300025949 | Ga0207667_10028631 | Ga0207667_100286317 | 325 |
| 785 | 3300025949 | Ga0207667_10047002 | Ga0207667_100470022 | 325 |
| 786 | 3300025949 | Ga0207667_10077756 | Ga0207667_100777564 | 325 |
| 787 | 3300025949 | Ga0207667_10105591 | Ga0207667_101055913 | 325 |
| 788 | 3300025960 | Ga0207651_10000422 | Ga0207651_100004226 | 325 |
| 789 | 3300025960 | Ga0207651_10032933 | Ga0207651_100329332 | 325 |
| 790 | 3300025961 | Ga0207712_10004682 | Ga0207712_100046826 | 325 |
| 791 | 3300025961 | Ga0207712_10026073 | Ga0207712_100260732 | 325 |
| 792 | 3300025972 | Ga0207668_10000114 | Ga0207668_1000011446 | 325 |
| 793 | 3300025972 | Ga0207668_10108475 | Ga0207668_101084752 | 325 |
| 794 | 3300025981 | Ga0207640_10000141 | Ga0207640_1000014151 | 325 |
| 795 | 3300025986 | Ga0207658_10007681 | Ga0207658_100076813 | 325 |
| 796 | 3300025986 | Ga0207658_10024116 | Ga0207658_100241162 | 325 |
| 797 | 3300025986 | Ga0207658_10261028 | Ga0207658_102610282 | 325 |
| 798 | 3300026023 | Ga0207677_10001776 | Ga0207677_100017765 | 325 |
| 799 | 3300026023 | Ga0207677_10013991 | Ga0207677_100139915 | 325 |
| 800 | 3300026023 | Ga0207677_10201482 | Ga0207677_102014821 | 325 |
| 801 | 3300026035 | Ga0207703_10000983 | Ga0207703_100009837 | 325 |
| 802 | 3300026035 | Ga0207703_10010486 | Ga0207703_100104862 | 325 |
| 803 | 3300026035 | Ga0207703_10331244 | Ga0207703_103312442 | 325 |
| 804 | 3300026041 | Ga0207639_10000305 | Ga0207639_1000030519 | 325 |
| 805 | 3300026041 | Ga0207639_10325978 | Ga0207639_103259783 | 325 |
| 806 | 3300026067 | Ga0207678_10000125 | Ga0207678_1000012553 | 325 |
| 807 | 3300026067 | Ga0207678_10026095 | Ga0207678_100260955 | 325 |
| 808 | 3300026067 | Ga0207678_10118507 | Ga0207678_101185073 | 325 |
| 809 | 3300026067 | Ga0207678_10121814 | Ga0207678_101218142 | 325 |
| 810 | 3300026075 | Ga0207708_10000187 | Ga0207708_1000018712 | 325 |
| 811 | 3300026075 | Ga0207708_10000256 | Ga0207708_1000025629 | 325 |
| 812 | 3300026075 | Ga0207708_10014918 | Ga0207708_100149187 | 325 |
| 813 | 3300026075 | Ga0207708_10140412 | Ga0207708_101404123 | 325 |
| 814 | 3300026075 | Ga0207708_10204175 | Ga0207708_102041752 | 325 |
| 815 | 3300026078 | Ga0207702_10005437 | Ga0207702_1000543710 | 325 |
| 816 | 3300026078 | Ga0207702_10025565 | Ga0207702_100255651 | 325 |
| 817 | 3300026078 | Ga0207702_10128627 | Ga0207702_101286274 | 325 |
| 818 | 3300026088 | Ga0207641_10003649 | Ga0207641_1000364914 | 325 |
| 819 | 3300026088 | Ga0207641_10055119 | Ga0207641_100551195 | 325 |
| 820 | 3300026089 | Ga0207648_10002168 | Ga0207648_1000216814 | 325 |
| 821 | 3300026089 | Ga0207648_10004949 | Ga0207648_100049496 | 325 |
| 822 | 3300026089 | Ga0207648_10304255 | Ga0207648_103042551 | 325 |
| 823 | 3300026089 | Ga0207648_10383293 | Ga0207648_103832931 | 325 |
| 824 | 3300026095 | Ga0207676_10000074 | Ga0207676_1000007413 | 325 |
| 825 | 3300026095 | Ga0207676_10007288 | Ga0207676_100072882 | 325 |
| 826 | 3300026095 | Ga0207676_10019580 | Ga0207676_100195806 | 325 |
| 827 | 3300026095 | Ga0207676_10513292 | Ga0207676_105132921 | 325 |
| 828 | 3300026116 | Ga0207674_10002501 | Ga0207674_1000250112 | 325 |
| 829 | 3300026118 | Ga0207675_100002373 | Ga0207675_10000237311 | 325 |
| 830 | 3300026118 | Ga0207675_100004556 | Ga0207675_10000455613 | 325 |
| 831 | 3300026118 | Ga0207675_100109415 | Ga0207675_1001094154 | 325 |
| 832 | 3300026121 | Ga0207683_10000014 | Ga0207683_1000001446 | 325 |
| 833 | 3300026121 | Ga0207683_10003999 | Ga0207683_100039998 | 325 |
| 834 | 3300026121 | Ga0207683_10005254 | Ga0207683_100052547 | 325 |
| 835 | 3300026121 | Ga0207683_10009094 | Ga0207683_100090949 | 325 |
| 836 | 3300026121 | Ga0207683_10045519 | Ga0207683_100455194 | 325 |
| 837 | 3300026142 | Ga0207698_10001242 | Ga0207698_1000124210 | 325 |
| 838 | 3300026142 | Ga0207698_10054980 | Ga0207698_100549803 | 325 |
| 839 | 3300026142 | Ga0207698_10070852 | Ga0207698_100708523 | 325 |
| 840 | 3300026142 | Ga0207698_10230441 | Ga0207698_102304412 | 325 |
| 841 | 3300026142 | Ga0207698_10324819 | Ga0207698_103248192 | 325 |
| 842 | 3300027543 | Ga0209999_1007609 | Ga0209999_10076093 | 325 |
| 843 | 3300027617 | Ga0210002_1003004 | Ga0210002_10030044 | 325 |
| 844 | 3300027671 | Ga0209588_1025585 | Ga0209588_10255852 | 325 |
| 845 | 3300027682 | Ga0209971_1016252 | Ga0209971_10162522 | 325 |
| 846 | 3300027695 | Ga0209966_1004843 | Ga0209966_10048433 | 325 |
| 847 | 3300027695 | Ga0209966_1006091 | Ga0209966_10060912 | 325 |
| 848 | 3300027717 | Ga0209998_10000361 | Ga0209998_1000036113 | 325 |
| 849 | 3300027717 | Ga0209998_10001516 | Ga0209998_100015166 | 325 |
| 850 | 3300027876 | Ga0209974_10012895 | Ga0209974_100128952 | 325 |
| 851 | 3300027876 | Ga0209974_10050653 | Ga0209974_100506532 | 325 |
| 852 | 3300027907 | Ga0207428_10000114 | Ga0207428_1000011469 | 325 |
| 853 | 3300027907 | Ga0207428_10000467 | Ga0207428_1000046735 | 325 |
| 854 | 3300027907 | Ga0207428_10011322 | Ga0207428_100113226 | 325 |
| 855 | 3300028380 | Ga0268265_10009966 | Ga0268265_100099664 | 325 |
| 856 | 3300028380 | Ga0268265_10129476 | Ga0268265_101294761 | 325 |
| 857 | 3300028381 | Ga0268264_10000469 | Ga0268264_1000046912 | 325 |
| 858 | 3300028381 | Ga0268264_10102270 | Ga0268264_101022703 | 325 |
| 859 | 3300028556 | Ga0265337_1001464 | Ga0265337_10014643 | 325 |
| 860 | 3300028800 | Ga0265338_10068822 | Ga0265338_100688224 | 325 |
| 861 | 3300030763 | Ga0265763_1000156 | Ga0265763_10001562 | 325 |
| 862 | 3300031090 | Ga0265760_10055801 | Ga0265760_100558011 | 325 |
| 863 | 3300031238 | Ga0265332_10000801 | Ga0265332_1000080116 | 325 |
| 864 | 3300031241 | Ga0265325_10000423 | Ga0265325_1000042325 | 325 |
| 865 | 3300031241 | Ga0265325_10025904 | Ga0265325_100259042 | 325 |
| 866 | 3300031241 | Ga0265325_10077594 | Ga0265325_100775942 | 325 |
| 867 | 3300031242 | Ga0265329_10046196 | Ga0265329_100461962 | 325 |
| 868 | 3300031249 | Ga0265339_10001378 | Ga0265339_100013788 | 325 |
| 869 | 3300031249 | Ga0265339_10003373 | Ga0265339_100033735 | 325 |
| 870 | 3300031250 | Ga0265331_10016240 | Ga0265331_100162401 | 325 |
| 871 | 3300031250 | Ga0265331_10025748 | Ga0265331_100257482 | 325 |
| 872 | 3300031344 | Ga0265316_10048508 | Ga0265316_100485082 | 325 |
| 873 | 3300031595 | Ga0265313_10000115 | Ga0265313_1000011545 | 325 |
| 874 | 3300031595 | Ga0265313_10002944 | Ga0265313_100029449 | 325 |
| 875 | 3300031595 | Ga0265313_10034290 | Ga0265313_100342902 | 325 |
| 876 | 3300031711 | Ga0265314_10005122 | Ga0265314_100051223 | 325 |
| 877 | 3300031711 | Ga0265314_10120472 | Ga0265314_101204722 | 325 |
| 878 | 3300031712 | Ga0265342_10000011 | Ga0265342_100000119 | 325 |
| 879 | 3300031712 | Ga0265342_10000763 | Ga0265342_1000076334 | 325 |
| 880 | 3300031852 | Ga0307410_10160269 | Ga0307410_101602692 | 325 |
| 881 | 3300032133 | Ga0316583_10005398 | Ga0316583_100053985 | 325 |
| 882 | 3300034816 | Ga0373930_0000150 | Ga0373930_0000150_3714_4691 | 325 |
| 883 | 3300034816 | Ga0373930_0001117 | Ga0373930_0001117_324_1301 | 325 |
| 884 | 3300034817 | Ga0373948_0000307 | Ga0373948_0000307_4901_5878 | 325 |
| 885 | 3300034817 | Ga0373948_0002698 | Ga0373948_0002698_1288_2265 | 325 |
| 886 | 3300034820 | Ga0373959_0001657 | Ga0373959_0001657_1344_2321 | 325 |
| 887 | 3300034957 | Ga0373938_0010297 | Ga0373938_0010297_47_1024 | 325 |
| 888 | 3300035083 | Ga0373926_0027180 | Ga0373926_0027180_188_1165 | 325 |
| 889 | 3300035084 | Ga0373928_0000222 | Ga0373928_0000222_7546_8523 | 325 |
| 890 | 3300035085 | Ga0373929_0002112 | Ga0373929_0002112_1764_2741 | 325 |
| 891 | 3300035086 | Ga0373934_0005831 | Ga0373934_0005831_382_1359 | 325 |
| 892 | 3300035089 | Ga0373944_0001828 | Ga0373944_0001828_2487_3464 | 325 |
| 893 | 3300035090 | Ga0373949_0001450 | Ga0373949_0001450_5146_6123 | 325 |
| 894 | 3300035091 | Ga0373951_0000721 | Ga0373951_0000721_630_1607 | 325 |
| 895 | 3300035091 | Ga0373951_0001245 | Ga0373951_0001245_5415_6392 | 325 |
| 896 | 3300035091 | Ga0373951_0011607 | Ga0373951_0011607_982_1959 | 325 |
| 897 | 3300035092 | Ga0373952_0000029 | Ga0373952_0000029_2072_3049 | 325 |
| 898 | 3300035092 | Ga0373952_0000148 | Ga0373952_0000148_8993_9970 | 325 |
| 899 | 3300035092 | Ga0373952_0011726 | Ga0373952_0011726_205_1182 | 325 |
| 900 | 3300035092 | Ga0373952_0017850 | Ga0373952_0017850_31_1008 | 325 |
| 901 | 3300035112 | Ga0373932_0001251 | Ga0373932_0001251_3808_4785 | 325 |
| 902 | 3300035112 | Ga0373932_0004135 | Ga0373932_0004135_2330_3307 | 325 |
| 903 | 3300035113 | Ga0373936_0006326 | Ga0373936_0006326_1897_2874 | 325 |
| 904 | 3300035114 | Ga0373939_0000339 | Ga0373939_0000339_1641_2618 | 325 |
| 905 | 3300035114 | Ga0373939_0002855 | Ga0373939_0002855_1799_2776 | 325 |
| 906 | 3300035115 | Ga0373941_0000835 | Ga0373941_0000835_4823_5800 | 325 |
| 907 | 3300035115 | Ga0373941_0002285 | Ga0373941_0002285_2235_3212 | 325 |
| 908 | 3300035115 | Ga0373941_0036460 | Ga0373941_0036460_421_1398 | 325 |
| 909 | 3300035116 | Ga0373945_0089477 | Ga0373945_0089477_203_1180 | 325 |
| 910 | 3300035117 | Ga0373953_0019732 | Ga0373953_0019732_738_1715 | 325 |
| 911 | 3300035117 | Ga0373953_0023666 | Ga0373953_0023666_507_1484 | 325 |
| 912 | 3300035118 | Ga0373954_0024463 | Ga0373954_0024463_566_1543 | 325 |
| 913 | 3300035118 | Ga0373954_0024781 | Ga0373954_0024781_1563_2540 | 325 |
| 914 | 3300035119 | Ga0373956_0045734 | Ga0373956_0045734_330_1307 | 325 |
| 915 | 3300035121 | Ga0373960_0000372 | Ga0373960_0000372_3046_4023 | 325 |
| 916 | 3300035121 | Ga0373960_0025992 | Ga0373960_0025992_135_1112 | 325 |
| 917 | 3300035121 | Ga0373960_0064146 | Ga0373960_0064146_98_1075 | 325 |
| 918 | 3300035170 | Ga0373943_0016793 | Ga0373943_0016793_618_1595 | 325 |
| 919 | 3300035170 | Ga0373943_0209439 | Ga0373943_0209439_77_1054 | 325 |
| 920 | 3300035171 | Ga0373946_0006340 | Ga0373946_0006340_1854_2831 | 325 |
| 921 | 3300035171 | Ga0373946_0009821 | Ga0373946_0009821_373_1350 | 325 |
| 922 | 3300035171 | Ga0373946_0041237 | Ga0373946_0041237_298_1275 | 325 |
| 923 | 3300035172 | Ga0373955_0001269 | Ga0373955_0001269_7101_8078 | 325 |
| 924 | 3300035172 | Ga0373955_0001523 | Ga0373955_0001523_2245_3222 | 325 |
| 925 | 3300035172 | Ga0373955_0004969 | Ga0373955_0004969_3105_4082 | 325 |
| 926 | 3300035172 | Ga0373955_0043425 | Ga0373955_0043425_959_1936 | 325 |
| 927 | 3300035207 | Ga0373942_0000767 | Ga0373942_0000767_4632_5609 | 325 |
| 928 | 3300035241 | Ga0373961_0001835 | Ga0373961_0001835_689_1666 | 325 |
| 929 | 3300035241 | Ga0373961_0003896 | Ga0373961_0003896_2131_3108 | 325 |
| 930 | 3300035241 | Ga0373961_0019391 | Ga0373961_0019391_725_1702 | 325 |
| 931 | 3300035241 | Ga0373961_0054588 | Ga0373961_0054588_43_1020 | 325 |
| 932 | 3300035242 | Ga0373962_0005133 | Ga0373962_0005133_1426_2403 | 325 |
| 933 | 3300035242 | Ga0373962_0005930 | Ga0373962_0005930_304_1281 | 325 |
| 934 | 3300035242 | Ga0373962_0006682 | Ga0373962_0006682_1248_2225 | 325 |
| 935 | 3300035691 | Ga0373931_0000169 | Ga0373931_0000169_18939_19916 | 325 |
| 936 | 3300035691 | Ga0373931_0006379 | Ga0373931_0006379_3851_4828 | 325 |
| 937 | 3300035691 | Ga0373931_0088502 | Ga0373931_0088502_107_1084 | 325 |
| 938 | 3300035692 | Ga0373935_0020667 | Ga0373935_0020667_1486_2463 | 325 |
| 939 | 3300035692 | Ga0373935_0057410 | Ga0373935_0057410_855_1832 | 325 |
| 940 | 3300035695 | Ga0373927_0016232 | Ga0373927_0016232_969_1946 | 325 |
| 941 | 3300035695 | Ga0373927_0050616 | Ga0373927_0050616_970_1947 | 325 |
| 942 | 3300035695 | Ga0373927_0210555 | Ga0373927_0210555_21_998 | 325 |
| 943 | 3300035724 | Ga0373933_0005311 | Ga0373933_0005311_5469_6446 | 325 |
| 944 | 3300035724 | Ga0373933_0017906 | Ga0373933_0017906_1018_1995 | 325 |
| 945 | 3300035725 | Ga0373947_0007521 | Ga0373947_0007521_5204_6181 | 325 |
| 946 | 3300036401 | Ga0373937_0001052 | Ga0373937_0001052_12417_13394 | 325 |
| 947 | 3300036401 | Ga0373937_0038298 | Ga0373937_0038298_2674_3651 | 325 |
| 948 | 3300036401 | Ga0373937_0049021 | Ga0373937_0049021_2238_3215 | 325 |
| 949 | 3300036401 | Ga0373937_0055079 | Ga0373937_0055079_837_1814 | 325 |
| 950 | 3300036401 | Ga0373937_0110823 | Ga0373937_0110823_858_1835 | 325 |
| 951 | 3300036401 | Ga0373937_0537414 | Ga0373937_0537414_55_1032 | 325 |
| 952 | 3300037068 | Ga0373925_0022589 | Ga0373925_0022589_603_1580 | 325 |
| 953 | 3300037312 | Ga0395899_0158714 | Ga0395899_0158714_229_1206 | 325 |
| 954 | 3300037418 | Ga0395900_0005265 | Ga0395900_0005265_11803_12813 | 325 |
| 955 | 3300037418 | Ga0395900_0006751 | Ga0395900_0006751_317_1342 | 325 |
| 956 | 3300037466 | Ga0395898_0014510 | Ga0395898_0014510_2605_3615 | 325 |
| 957 | 3300037466 | Ga0395898_0022478 | Ga0395898_0022478_2512_3537 | 325 |
| 958 | 3300037466 | Ga0395898_0319420 | Ga0395898_0319420_211_1188 | 325 |
| 959 | 3300038443 | Ga0395901_0111106 | Ga0395901_0111106_34_1059 | 325 |
| 960 | 3300039437 | Ga0436365_0193033 | Ga0436365_0193033_4256_5233 | 325 |
| 961 | 3300039447 | Ga0436361_0425913 | Ga0436361_0425913_720_1697 | 325 |
| 962 | 3300042008 | Ga0439450_008705 | Ga0439450_008705_141_1118 | 325 |
| 963 | 3300044712 | Ga0453684_0037028 | Ga0453684_0037028_3476_4453 | 325 |
| 964 | 3300046454 | Ga0495592_0024186 | Ga0495592_0024186_2183_3160 | 325 |
| 965 | 3300046454 | Ga0495592_0032431 | Ga0495592_0032431_2945_3922 | 325 |
| 966 | 3300046454 | Ga0495592_0040848 | Ga0495592_0040848_972_1949 | 325 |
| 967 | 3300046454 | Ga0495592_0131419 | Ga0495592_0131419_497_1474 | 325 |
| 968 | 3300046455 | Ga0495603_0008030 | Ga0495603_0008030_238_1215 | 325 |
| 969 | 3300046459 | Ga0495629_0000535 | Ga0495629_0000535_15226_16203 | 325 |
| 970 | 3300046459 | Ga0495629_0081599 | Ga0495629_0081599_906_1883 | 325 |
| 971 | 3300046459 | Ga0495629_0107782 | Ga0495629_0107782_372_1349 | 325 |
| 972 | 3300046460 | Ga0495638_0102310 | Ga0495638_0102310_569_1546 | 325 |
| 973 | 3300046461 | Ga0495641_0019259 | Ga0495641_0019259_1079_2056 | 325 |
| 974 | 3300046462 | Ga0495651_0000606 | Ga0495651_0000606_13435_14412 | 325 |
| 975 | 3300046462 | Ga0495651_0011021 | Ga0495651_0011021_3863_4840 | 325 |
| 976 | 3300046462 | Ga0495651_0011844 | Ga0495651_0011844_4633_5610 | 325 |
| 977 | 3300046462 | Ga0495651_0020645 | Ga0495651_0020645_1064_2041 | 325 |
| 978 | 3300046462 | Ga0495651_0113072 | Ga0495651_0113072_769_1746 | 325 |
| 979 | 3300046463 | Ga0495653_0002673 | Ga0495653_0002673_9563_10540 | 325 |
| 980 | 3300046463 | Ga0495653_0012564 | Ga0495653_0012564_3189_4166 | 325 |
| 981 | 3300046463 | Ga0495653_0093751 | Ga0495653_0093751_1007_1984 | 325 |
| 982 | 3300046472 | Ga0495580_0023721 | Ga0495580_0023721_2584_3561 | 325 |
| 983 | 3300046473 | Ga0495582_0039312 | Ga0495582_0039312_562_1539 | 325 |
| 984 | 3300046473 | Ga0495582_0074369 | Ga0495582_0074369_716_1693 | 325 |
| 985 | 3300046476 | Ga0495662_0010283 | Ga0495662_0010283_1895_2872 | 325 |
| 986 | 3300046476 | Ga0495662_0066440 | Ga0495662_0066440_235_1212 | 325 |
| 987 | 3300046477 | Ga0495664_0027493 | Ga0495664_0027493_1879_2856 | 325 |
| 988 | 3300046477 | Ga0495664_0033931 | Ga0495664_0033931_1774_2751 | 325 |
| 989 | 3300046491 | Ga0495584_0097244 | Ga0495584_0097244_468_1445 | 325 |
| 990 | 3300046492 | Ga0495585_0008366 | Ga0495585_0008366_3114_4091 | 325 |
| 991 | 3300046499 | Ga0495594_0043598 | Ga0495594_0043598_1381_2358 | 325 |
| 992 | 3300046501 | Ga0495607_0048620 | Ga0495607_0048620_333_1310 | 325 |
| 993 | 3300046511 | Ga0495608_0000591 | Ga0495608_0000591_13181_14158 | 325 |
| 994 | 3300046511 | Ga0495608_0001474 | Ga0495608_0001474_160_1137 | 325 |
| 995 | 3300046511 | Ga0495608_0039849 | Ga0495608_0039849_1736_2713 | 325 |
| 996 | 3300046511 | Ga0495608_0055452 | Ga0495608_0055452_1164_2141 | 325 |
| 997 | 3300046514 | Ga0495618_0001466 | Ga0495618_0001466_7003_7980 | 325 |
| 998 | 3300046514 | Ga0495618_0004984 | Ga0495618_0004984_4336_5313 | 325 |
| 999 | 3300046514 | Ga0495618_0132206 | Ga0495618_0132206_334_1311 | 325 |
| 1000 | 3300046516 | Ga0495628_0001927 | Ga0495628_0001927_6957_7934 | 325 |
| 1001 | 3300046516 | Ga0495628_0023873 | Ga0495628_0023873_481_1458 | 325 |
| 1002 | 3300046516 | Ga0495628_0144414 | Ga0495628_0144414_793_1770 | 325 |
| 1003 | 3300046516 | Ga0495628_0221416 | Ga0495628_0221416_17_994 | 325 |
| 1004 | 3300046517 | Ga0495630_0081198 | Ga0495630_0081198_1201_2178 | 325 |
| 1005 | 3300046517 | Ga0495630_0176249 | Ga0495630_0176249_182_1159 | 325 |
| 1006 | 3300046523 | Ga0495644_0002701 | Ga0495644_0002701_3122_4099 | 325 |
| 1007 | 3300046526 | Ga0495666_0012992 | Ga0495666_0012992_645_1622 | 325 |
| 1008 | 3300046526 | Ga0495666_0123226 | Ga0495666_0123226_95_1072 | 325 |
| 1009 | 3300046529 | Ga0495652_0003497 | Ga0495652_0003497_10000_10977 | 325 |
| 1010 | 3300046529 | Ga0495652_0022449 | Ga0495652_0022449_4338_5315 | 325 |
| 1011 | 3300046529 | Ga0495652_0048857 | Ga0495652_0048857_1351_2451 | 325 |
| 1012 | 3300046529 | Ga0495652_0121480 | Ga0495652_0121480_732_1709 | 325 |
| 1013 | 3300046531 | Ga0495665_0023481 | Ga0495665_0023481_857_1834 | 325 |
| 1014 | 3300046533 | Ga0495640_0002454 | Ga0495640_0002454_8432_9409 | 325 |
| 1015 | 3300046533 | Ga0495640_0054384 | Ga0495640_0054384_1158_2135 | 325 |
| 1016 | 3300046533 | Ga0495640_0056745 | Ga0495640_0056745_1252_2229 | 325 |
| 1017 | 3300046535 | Ga0495586_0036479 | Ga0495586_0036479_933_1910 | 325 |
| 1018 | 3300046536 | Ga0495587_0002240 | Ga0495587_0002240_10287_11264 | 325 |
| 1019 | 3300046536 | Ga0495587_0011870 | Ga0495587_0011870_984_1961 | 325 |
| 1020 | 3300046536 | Ga0495587_0027093 | Ga0495587_0027093_1548_2525 | 325 |
| 1021 | 3300046536 | Ga0495587_0047875 | Ga0495587_0047875_594_1571 | 325 |
| 1022 | 3300046543 | Ga0495645_0002539 | Ga0495645_0002539_9915_10892 | 325 |
| 1023 | 3300046543 | Ga0495645_0019854 | Ga0495645_0019854_17_994 | 325 |
| 1024 | 3300046543 | Ga0495645_0056174 | Ga0495645_0056174_1131_2108 | 325 |
| 1025 | 3300046543 | Ga0495645_0100340 | Ga0495645_0100340_26_1003 | 325 |
| 1026 | 3300046557 | Ga0495622_0015565 | Ga0495622_0015565_444_1421 | 325 |
| 1027 | 3300046558 | Ga0495633_0002969 | Ga0495633_0002969_8613_9590 | 325 |
| 1028 | 3300046559 | Ga0495667_0005199 | Ga0495667_0005199_5496_6473 | 325 |
| 1029 | 3300046559 | Ga0495667_0026523 | Ga0495667_0026523_1279_2256 | 325 |
| 1030 | 3300046559 | Ga0495667_0088464 | Ga0495667_0088464_520_1497 | 325 |
| 1031 | 3300046615 | Ga0495656_0002822 | Ga0495656_0002822_3050_4027 | 325 |
| 1032 | 3300046615 | Ga0495656_0004061 | Ga0495656_0004061_2194_3171 | 325 |
| 1033 | 3300046642 | Ga0495634_0002842 | Ga0495634_0002842_13223_14200 | 325 |
| 1034 | 3300046663 | Ga0495635_0003751 | Ga0495635_0003751_1076_2053 | 325 |
| 1035 | 3300046663 | Ga0495635_0003881 | Ga0495635_0003881_713_1690 | 325 |
| 1036 | 3300046663 | Ga0495635_0021401 | Ga0495635_0021401_3244_4221 | 325 |
| 1037 | 3300046663 | Ga0495635_0287356 | Ga0495635_0287356_41_1018 | 325 |
| 1038 | 3300046665 | Ga0495661_0044928 | Ga0495661_0044928_1361_2338 | 325 |
| 1039 | 3300046674 | Ga0495588_0045221 | Ga0495588_0045221_226_1203 | 325 |
| 1040 | 3300046675 | Ga0495657_0003270 | Ga0495657_0003270_7721_8698 | 325 |
| 1041 | 3300046675 | Ga0495657_0010946 | Ga0495657_0010946_1379_2356 | 325 |
| 1042 | 3300046678 | Ga0495599_0000564 | Ga0495599_0000564_9423_10400 | 325 |
| 1043 | 3300046678 | Ga0495599_0004481 | Ga0495599_0004481_2119_3096 | 325 |
| 1044 | 3300046678 | Ga0495599_0017530 | Ga0495599_0017530_554_1531 | 325 |
| 1045 | 3300046678 | Ga0495599_0073266 | Ga0495599_0073266_422_1399 | 325 |
| 1046 | 3300046679 | Ga0495623_0007330 | Ga0495623_0007330_1664_2641 | 325 |
| 1047 | 3300046680 | Ga0495646_0020687 | Ga0495646_0020687_1697_2674 | 325 |
| 1048 | 3300046680 | Ga0495646_0054563 | Ga0495646_0054563_377_1354 | 325 |
| 1049 | 3300046680 | Ga0495646_0058838 | Ga0495646_0058838_648_1625 | 325 |
| 1050 | 3300046681 | Ga0495647_0024629 | Ga0495647_0024629_64_1041 | 325 |
| 1051 | 3300046681 | Ga0495647_0045345 | Ga0495647_0045345_62_1039 | 325 |
| 1052 | 3300046681 | Ga0495647_0045645 | Ga0495647_0045645_548_1525 | 325 |
| 1053 | 3300046683 | Ga0495658_0000788 | Ga0495658_0000788_3469_4446 | 325 |
| 1054 | 3300046683 | Ga0495658_0006062 | Ga0495658_0006062_2010_2987 | 325 |
| 1055 | 3300046683 | Ga0495658_0009215 | Ga0495658_0009215_3445_4422 | 325 |
| 1056 | 3300046689 | Ga0495613_0024361 | Ga0495613_0024361_2954_3931 | 325 |
| 1057 | 3300046689 | Ga0495613_0072271 | Ga0495613_0072271_12_989 | 325 |
| 1058 | 3300046689 | Ga0495613_0213481 | Ga0495613_0213481_285_1262 | 325 |
| 1059 | 3300046690 | Ga0495624_0016249 | Ga0495624_0016249_260_1237 | 325 |
| 1060 | 3300046691 | Ga0495670_0000291 | Ga0495670_0000291_14048_15025 | 325 |
| 1061 | 3300046809 | Ga0495600_0001326 | Ga0495600_0001326_648_1625 | 325 |
| 1062 | 3300046809 | Ga0495600_0004060 | Ga0495600_0004060_6920_7897 | 325 |
| 1063 | 3300046809 | Ga0495600_0011214 | Ga0495600_0011214_1159_2136 | 325 |
| 1064 | 3300046809 | Ga0495600_0017893 | Ga0495600_0017893_3378_4355 | 325 |
| 1065 | 3300046809 | Ga0495600_0137385 | Ga0495600_0137385_320_1297 | 325 |
| 1066 | 3300047315 | Ga0495581_0081264 | Ga0495581_0081264_788_1765 | 325 |
| 1067 | 3300047315 | Ga0495581_0102123 | Ga0495581_0102123_358_1335 | 325 |
| 1068 | 3300047317 | Ga0495604_0003818 | Ga0495604_0003818_8397_9374 | 325 |
| 1069 | 3300047317 | Ga0495604_0003891 | Ga0495604_0003891_8665_9642 | 325 |
| 1070 | 3300047317 | Ga0495604_0009082 | Ga0495604_0009082_2398_3375 | 325 |
| 1071 | 3300047317 | Ga0495604_0015025 | Ga0495604_0015025_4003_4980 | 325 |
| 1072 | 3300047317 | Ga0495604_0028398 | Ga0495604_0028398_1478_2455 | 325 |
| 1073 | 3300047317 | Ga0495604_0052923 | Ga0495604_0052923_1479_2456 | 325 |
| 1074 | 3300047319 | Ga0495674_0015363 | Ga0495674_0015363_814_1791 | 325 |
| 1075 | 3300047319 | Ga0495674_0024339 | Ga0495674_0024339_4313_5290 | 325 |
| 1076 | 3300047319 | Ga0495674_0027169 | Ga0495674_0027169_130_1107 | 325 |
| 1077 | 3300047319 | Ga0495674_0197387 | Ga0495674_0197387_599_1576 | 325 |
| 1078 | 3300047319 | Ga0495674_0354222 | Ga0495674_0354222_33_1010 | 325 |
| 1079 | 3300047321 | Ga0495676_0021794 | Ga0495676_0021794_3464_4441 | 325 |
| 1080 | 3300047322 | Ga0495680_0001686 | Ga0495680_0001686_12316_13293 | 325 |
| 1081 | 3300047322 | Ga0495680_0011254 | Ga0495680_0011254_5687_6664 | 325 |
| 1082 | 3300047322 | Ga0495680_0012959 | Ga0495680_0012959_909_1886 | 325 |
| 1083 | 3300047322 | Ga0495680_0044687 | Ga0495680_0044687_1479_2456 | 325 |
| 1084 | 3300047444 | Ga0495675_0001544 | Ga0495675_0001544_10827_11804 | 325 |
| 1085 | 3300047444 | Ga0495675_0002669 | Ga0495675_0002669_98_1075 | 325 |
| 1086 | 3300047444 | Ga0495675_0120623 | Ga0495675_0120623_525_1502 | 325 |
| 1087 | 3300047471 | Ga0495684_0002087 | Ga0495684_0002087_8679_9656 | 325 |
| 1088 | 3300047471 | Ga0495684_0003625 | Ga0495684_0003625_272_1249 | 325 |
| 1089 | 3300047471 | Ga0495684_0038790 | Ga0495684_0038790_439_1416 | 325 |
| 1090 | 3300047471 | Ga0495684_0147563 | Ga0495684_0147563_710_1687 | 325 |
| 1091 | 3300047673 | Ga0495593_0004626 | Ga0495593_0004626_5688_6665 | 325 |
| 1092 | 3300047673 | Ga0495593_0014724 | Ga0495593_0014724_83_1060 | 325 |
| 1093 | 3300047673 | Ga0495593_0047243 | Ga0495593_0047243_667_1644 | 325 |
| 1094 | 3300048088 | Ga0495602_0000740 | Ga0495602_0000740_24699_25676 | 325 |
| 1095 | 3300048088 | Ga0495602_0005526 | Ga0495602_0005526_10922_11899 | 325 |
| 1096 | 3300048088 | Ga0495602_0132217 | Ga0495602_0132217_89_1066 | 325 |
| 1097 | 3300048088 | Ga0495602_0144903 | Ga0495602_0144903_752_1729 | 325 |
| 1098 | 3300048089 | Ga0495614_0030039 | Ga0495614_0030039_1078_2055 | 325 |
| 1099 | 3300048903 | Ga0496100_0000106 | Ga0496100_0000106_34922_35899 | 325 |
| 1100 | 3300048903 | Ga0496100_0000499 | Ga0496100_0000499_12574_13551 | 325 |
| 1101 | 3300048903 | Ga0496100_0002951 | Ga0496100_0002951_2330_3307 | 325 |
| 1102 | 3300048903 | Ga0496100_0003648 | Ga0496100_0003648_4059_5036 | 325 |
| 1103 | 3300048903 | Ga0496100_0027659 | Ga0496100_0027659_312_1289 | 325 |
| 1104 | 3300048903 | Ga0496100_0256274 | Ga0496100_0256274_270_1247 | 325 |
| 1105 | 3300048904 | Ga0496101_0000992 | Ga0496101_0000992_8338_9315 | 325 |
| 1106 | 3300048904 | Ga0496101_0002929 | Ga0496101_0002929_7851_8828 | 325 |
| 1107 | 3300048904 | Ga0496101_0003940 | Ga0496101_0003940_3933_4910 | 325 |
| 1108 | 3300048904 | Ga0496101_0020995 | Ga0496101_0020995_1660_2637 | 325 |
| 1109 | 3300048904 | Ga0496101_0023715 | Ga0496101_0023715_1524_2501 | 325 |
| 1110 | 3300048904 | Ga0496101_0228639 | Ga0496101_0228639_225_1202 | 325 |
| 1111 | 3300048904 | Ga0496101_0279117 | Ga0496101_0279117_70_1047 | 325 |
| 1112 | 3300048905 | Ga0496102_0011236 | Ga0496102_0011236_3625_4602 | 325 |
| 1113 | 3300048905 | Ga0496102_0019045 | Ga0496102_0019045_1994_2971 | 325 |
| 1114 | 3300048905 | Ga0496102_0039093 | Ga0496102_0039093_325_1302 | 325 |
| 1115 | 3300048905 | Ga0496102_0372135 | Ga0496102_0372135_145_1122 | 325 |
| 1116 | 3300048906 | Ga0496103_0003647 | Ga0496103_0003647_745_1722 | 325 |
| 1117 | 3300048906 | Ga0496103_0006368 | Ga0496103_0006368_3030_4007 | 325 |
| 1118 | 3300048906 | Ga0496103_0014587 | Ga0496103_0014587_215_1192 | 325 |
| 1119 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_75669_76646 | 325 |
| 1120 | 3300048907 | Ga0496104_0000506 | Ga0496104_0000506_26779_27756 | 325 |
| 1121 | 3300048907 | Ga0496104_0005547 | Ga0496104_0005547_1049_2026 | 325 |
| 1122 | 3300048907 | Ga0496104_0035462 | Ga0496104_0035462_3455_4432 | 325 |
| 1123 | 3300048907 | Ga0496104_0122840 | Ga0496104_0122840_1223_2200 | 325 |
| 1124 | 3300048908 | Ga0496105_0001574 | Ga0496105_0001574_5001_5978 | 325 |
| 1125 | 3300048908 | Ga0496105_0003533 | Ga0496105_0003533_2383_3360 | 325 |
| 1126 | 3300048908 | Ga0496105_0108687 | Ga0496105_0108687_983_1960 | 325 |
| 1127 | 3300048908 | Ga0496105_0161028 | Ga0496105_0161028_834_1811 | 325 |
| 1128 | 3300048909 | Ga0496106_0002499 | Ga0496106_0002499_8566_9543 | 325 |
| 1129 | 3300048909 | Ga0496106_0002626 | Ga0496106_0002626_8865_9842 | 325 |
| 1130 | 3300048909 | Ga0496106_0005418 | Ga0496106_0005418_4975_5952 | 325 |
| 1131 | 3300048909 | Ga0496106_0012172 | Ga0496106_0012172_2776_3753 | 325 |
| 1132 | 3300048909 | Ga0496106_0013964 | Ga0496106_0013964_318_1295 | 325 |
| 1133 | 3300048909 | Ga0496106_0019052 | Ga0496106_0019052_361_1338 | 325 |
| 1134 | 3300048909 | Ga0496106_0024338 | Ga0496106_0024338_3015_3992 | 325 |
| 1135 | 3300048909 | Ga0496106_0173682 | Ga0496106_0173682_353_1330 | 325 |
| 1136 | 3300048910 | Ga0496107_0000223 | Ga0496107_0000223_8365_9342 | 325 |
| 1137 | 3300048910 | Ga0496107_0015336 | Ga0496107_0015336_251_1228 | 325 |
| 1138 | 3300048910 | Ga0496107_0030108 | Ga0496107_0030108_1662_2639 | 325 |
| 1139 | 3300048910 | Ga0496107_0034213 | Ga0496107_0034213_1073_2050 | 325 |
| 1140 | 3300048910 | Ga0496107_0041516 | Ga0496107_0041516_1878_2855 | 325 |
| 1141 | 3300048910 | Ga0496107_0044051 | Ga0496107_0044051_1659_2636 | 325 |
| 1142 | 3300048911 | Ga0496108_0003914 | Ga0496108_0003914_906_1883 | 325 |
| 1143 | 3300048911 | Ga0496108_0007392 | Ga0496108_0007392_7700_8677 | 325 |
| 1144 | 3300048911 | Ga0496108_0024579 | Ga0496108_0024579_509_1486 | 325 |
| 1145 | 3300048912 | Ga0496109_0002315 | Ga0496109_0002315_14393_15370 | 325 |
| 1146 | 3300048912 | Ga0496109_0014846 | Ga0496109_0014846_3071_4048 | 325 |
| 1147 | 3300048912 | Ga0496109_0039401 | Ga0496109_0039401_3151_4128 | 325 |
| 1148 | 3300048912 | Ga0496109_0041676 | Ga0496109_0041676_3030_4007 | 325 |
| 1149 | 3300048912 | Ga0496109_0052216 | Ga0496109_0052216_2166_3143 | 325 |
| 1150 | 3300048912 | Ga0496109_0227777 | Ga0496109_0227777_498_1475 | 325 |
| 1151 | 3300048913 | Ga0496110_0003039 | Ga0496110_0003039_4178_5155 | 325 |
| 1152 | 3300048913 | Ga0496110_0091854 | Ga0496110_0091854_1294_2271 | 325 |
| 1153 | 3300048913 | Ga0496110_0568629 | Ga0496110_0568629_35_1012 | 325 |
| 1154 | 3300048914 | Ga0496111_0064475 | Ga0496111_0064475_1659_2636 | 325 |
| 1155 | 3300048915 | Ga0496112_0035958 | Ga0496112_0035958_2141_3118 | 325 |
| 1156 | 3300048915 | Ga0496112_0075543 | Ga0496112_0075543_644_1621 | 325 |
| 1157 | 3300048915 | Ga0496112_0089540 | Ga0496112_0089540_584_1561 | 325 |
| 1158 | 3300048915 | Ga0496112_0153498 | Ga0496112_0153498_211_1188 | 325 |
| 1159 | 3300048915 | Ga0496112_0283160 | Ga0496112_0283160_35_1012 | 325 |
| 1160 | 3300048915 | Ga0496112_0324574 | Ga0496112_0324574_50_1027 | 325 |
| 1161 | 3300048916 | Ga0496113_0000068 | Ga0496113_0000068_14075_15052 | 325 |
| 1162 | 3300048916 | Ga0496113_0006216 | Ga0496113_0006216_4310_5287 | 325 |
| 1163 | 3300048916 | Ga0496113_0010789 | Ga0496113_0010789_3836_4813 | 325 |
| 1164 | 3300048917 | Ga0496114_0006516 | Ga0496114_0006516_6996_7973 | 325 |
| 1165 | 3300048917 | Ga0496114_0006841 | Ga0496114_0006841_7156_8133 | 325 |
| 1166 | 3300048917 | Ga0496114_0010582 | Ga0496114_0010582_251_1228 | 325 |
| 1167 | 3300048918 | Ga0496115_0016939 | Ga0496115_0016939_1710_2687 | 325 |
| 1168 | 3300048918 | Ga0496115_0017044 | Ga0496115_0017044_3287_4264 | 325 |
| 1169 | 3300048918 | Ga0496115_0021146 | Ga0496115_0021146_2999_3976 | 325 |
| 1170 | 3300048918 | Ga0496115_0021880 | Ga0496115_0021880_1780_2757 | 325 |
| 1171 | 3300048918 | Ga0496115_0070184 | Ga0496115_0070184_1214_2191 | 325 |
| 1172 | 3300048918 | Ga0496115_0073152 | Ga0496115_0073152_1574_2551 | 325 |
| 1173 | 3300048918 | Ga0496115_0101293 | Ga0496115_0101293_1367_2344 | 325 |
| 1174 | 3300048918 | Ga0496115_0152757 | Ga0496115_0152757_153_1130 | 325 |
| 1175 | 3300049568 | Ga0501031_0117126 | Ga0501031_0117126_12_989 | 325 |
| 1176 | 3300049569 | Ga0501032_0018083 | Ga0501032_0018083_2228_3205 | 325 |
| 1177 | 3300049570 | Ga0501033_0023027 | Ga0501033_0023027_932_1909 | 325 |
| 1178 | 3300049570 | Ga0501033_0079600 | Ga0501033_0079600_1129_2106 | 325 |
| 1179 | 3300049571 | Ga0501034_0000852 | Ga0501034_0000852_3382_4359 | 325 |
| 1180 | 3300049571 | Ga0501034_0002201 | Ga0501034_0002201_16961_17938 | 325 |
| 1181 | 3300049571 | Ga0501034_0019869 | Ga0501034_0019869_5864_6841 | 325 |
| 1182 | 3300049571 | Ga0501034_0050663 | Ga0501034_0050663_607_1584 | 325 |
| 1183 | 3300049571 | Ga0501034_0091389 | Ga0501034_0091389_1022_1999 | 325 |
| 1184 | 3300049571 | Ga0501034_0105422 | Ga0501034_0105422_41_1018 | 325 |
| 1185 | 3300049571 | Ga0501034_0294162 | Ga0501034_0294162_283_1260 | 325 |
| 1186 | 3300049571 | Ga0501034_0444425 | Ga0501034_0444425_140_1117 | 325 |
| 1187 | 3300049572 | Ga0501036_0009246 | Ga0501036_0009246_3363_4340 | 325 |
| 1188 | 3300049572 | Ga0501036_0066423 | Ga0501036_0066423_454_1431 | 325 |
| 1189 | 3300049572 | Ga0501036_0073792 | Ga0501036_0073792_1796_2773 | 325 |
| 1190 | 3300049573 | Ga0501037_0075246 | Ga0501037_0075246_1241_2218 | 325 |
| 1191 | 3300049573 | Ga0501037_0077130 | Ga0501037_0077130_410_1387 | 325 |
| 1192 | 3300049574 | Ga0501038_0017001 | Ga0501038_0017001_5029_6006 | 325 |
| 1193 | 3300049574 | Ga0501038_0074200 | Ga0501038_0074200_1824_2801 | 325 |
| 1194 | 3300049574 | Ga0501038_0127566 | Ga0501038_0127566_183_1160 | 325 |
| 1195 | 3300049575 | Ga0501039_0045614 | Ga0501039_0045614_1088_2065 | 325 |
| 1196 | 3300049575 | Ga0501039_0067453 | Ga0501039_0067453_1131_2108 | 325 |
| 1197 | 3300049575 | Ga0501039_0082471 | Ga0501039_0082471_1175_2152 | 325 |
| 1198 | 3300049575 | Ga0501039_0278275 | Ga0501039_0278275_272_1249 | 325 |
| 1199 | 3300049579 | Ga0501043_0023705 | Ga0501043_0023705_2889_3866 | 325 |
| 1200 | 3300049579 | Ga0501043_0071008 | Ga0501043_0071008_1630_2607 | 325 |
| 1201 | 3300049580 | Ga0501046_0047106 | Ga0501046_0047106_1511_2488 | 325 |
| 1202 | 3300049580 | Ga0501046_0083647 | Ga0501046_0083647_1233_2210 | 325 |
| 1203 | 3300049580 | Ga0501046_0164904 | Ga0501046_0164904_552_1529 | 325 |
| 1204 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_71080_72057 | 325 |
| 1205 | 3300049581 | Ga0501047_0052348 | Ga0501047_0052348_1153_2130 | 325 |
| 1206 | 3300049581 | Ga0501047_0083522 | Ga0501047_0083522_355_1332 | 325 |
| 1207 | 3300049581 | Ga0501047_0145268 | Ga0501047_0145268_1262_2239 | 325 |
| 1208 | 3300049581 | Ga0501047_0168967 | Ga0501047_0168967_402_1379 | 325 |
| 1209 | 3300049582 | Ga0501048_0000592 | Ga0501048_0000592_22655_23632 | 325 |
| 1210 | 3300049584 | Ga0501068_0037047 | Ga0501068_0037047_149_1126 | 325 |
| 1211 | 3300049584 | Ga0501068_0061949 | Ga0501068_0061949_1061_2038 | 325 |
| 1212 | 3300049585 | Ga0501069_0103112 | Ga0501069_0103112_87_1064 | 325 |
| 1213 | 3300049586 | Ga0501070_0015707 | Ga0501070_0015707_4422_5399 | 325 |
| 1214 | 3300049586 | Ga0501070_0036608 | Ga0501070_0036608_1542_2519 | 325 |
| 1215 | 3300049586 | Ga0501070_0049872 | Ga0501070_0049872_231_1208 | 325 |
| 1216 | 3300049586 | Ga0501070_0261127 | Ga0501070_0261127_84_1061 | 325 |
| 1217 | 3300049586 | Ga0501070_0368536 | Ga0501070_0368536_84_1061 | 325 |
| 1218 | 3300049588 | Ga0501072_0072650 | Ga0501072_0072650_1630_2607 | 325 |
| 1219 | 3300049588 | Ga0501072_0101546 | Ga0501072_0101546_1174_2151 | 325 |
| 1220 | 3300049588 | Ga0501072_0189609 | Ga0501072_0189609_147_1124 | 325 |
| 1221 | 3300049589 | Ga0501073_0011255 | Ga0501073_0011255_2159_3136 | 325 |
| 1222 | 3300049590 | Ga0501074_0219597 | Ga0501074_0219597_84_1061 | 325 |
| 1223 | 3300049591 | Ga0501075_0029716 | Ga0501075_0029716_140_1117 | 325 |
| 1224 | 3300049592 | Ga0501076_0050177 | Ga0501076_0050177_850_1827 | 325 |
| 1225 | 3300049742 | Ga0501080_0000314 | Ga0501080_0000314_14439_15416 | 325 |
| 1226 | 3300049742 | Ga0501080_0069440 | Ga0501080_0069440_1585_2562 | 325 |
| 1227 | 3300049742 | Ga0501080_0357233 | Ga0501080_0357233_84_1061 | 325 |
| 1228 | 3300049744 | Ga0501083_0082807 | Ga0501083_0082807_155_1132 | 325 |
| 1229 | 3300049744 | Ga0501083_0114245 | Ga0501083_0114245_80_1057 | 325 |
| 1230 | 3300049822 | Ga0501035_0001359 | Ga0501035_0001359_1716_2693 | 325 |
| 1231 | 3300049822 | Ga0501035_0008723 | Ga0501035_0008723_550_1527 | 325 |
| 1232 | 3300049822 | Ga0501035_0026602 | Ga0501035_0026602_3615_4592 | 325 |
| 1233 | 3300049822 | Ga0501035_0049713 | Ga0501035_0049713_1539_2516 | 325 |
| 1234 | 3300049822 | Ga0501035_0321787 | Ga0501035_0321787_184_1161 | 325 |
| 1235 | 3300049822 | Ga0501035_0338074 | Ga0501035_0338074_46_1023 | 325 |
| 1236 | 3300049823 | Ga0501044_0015194 | Ga0501044_0015194_5231_6208 | 325 |
| 1237 | 3300049823 | Ga0501044_0030272 | Ga0501044_0030272_4249_5226 | 325 |
| 1238 | 3300049823 | Ga0501044_0042616 | Ga0501044_0042616_1502_2479 | 325 |
| 1239 | 3300049823 | Ga0501044_0123366 | Ga0501044_0123366_1280_2257 | 325 |
| 1240 | 3300049823 | Ga0501044_0200222 | Ga0501044_0200222_739_1716 | 325 |
| 1241 | 3300049823 | Ga0501044_0235340 | Ga0501044_0235340_135_1112 | 325 |
| 1242 | 3300049824 | Ga0501045_0079940 | Ga0501045_0079940_836_1813 | 325 |
| 1243 | 3300050489 | nmdc:mga03683_27872_c2 | nmdc:mga03683_27872_c2_409_1386 | 325 |
| 1244 | 3300050490 | nmdc:mga03n38_62424_c1 | nmdc:mga03n38_62424_c1_664_1641 | 325 |
| 1245 | 3300050492 | nmdc:mga0yw44_124278_c1 | nmdc:mga0yw44_124278_c1_525_1502 | 325 |
| 1246 | 3300050492 | nmdc:mga0yw44_30616_c1 | nmdc:mga0yw44_30616_c1_296_1273 | 325 |
| 1247 | 3300050492 | nmdc:mga0yw44_74353_c1 | nmdc:mga0yw44_74353_c1_139_1116 | 325 |
| 1248 | 3300050493 | nmdc:mga0k408_30724_c1 | nmdc:mga0k408_30724_c1_88_1065 | 325 |
| 1249 | 3300050493 | nmdc:mga0k408_87368_c1 | nmdc:mga0k408_87368_c1_486_1463 | 325 |
| 1250 | 3300050494 | nmdc:mga06z11_111956_c1 | nmdc:mga06z11_111956_c1_154_1137 | 325 |
| 1251 | 3300050494 | nmdc:mga06z11_124247_c1 | nmdc:mga06z11_124247_c1_43_1020 | 325 |
| 1252 | 3300050494 | nmdc:mga06z11_1795_c1 | nmdc:mga06z11_1795_c1_3346_4323 | 325 |
| 1253 | 3300050495 | nmdc:mga04h51_71172_c1 | nmdc:mga04h51_71172_c1_76_1053 | 325 |
| 1254 | 3300050496 | nmdc:mga07m45_27930_c1 | nmdc:mga07m45_27930_c1_2042_3019 | 325 |
| 1255 | 3300050496 | nmdc:mga07m45_95220_c1 | nmdc:mga07m45_95220_c1_550_1527 | 325 |
| 1256 | 3300050507 | nmdc:mga05p37_13519_c1 | nmdc:mga05p37_13519_c1_2771_3748 | 325 |
| 1257 | 3300050507 | nmdc:mga05p37_56_c3 | nmdc:mga05p37_56_c3_34567_35544 | 325 |
| 1258 | 3300050507 | nmdc:mga05p37_751885_c1 | nmdc:mga05p37_751885_c1_69_1046 | 325 |
| 1259 | 3300050508 | nmdc:mga09592_976_c1 | nmdc:mga09592_976_c1_7832_8809 | 325 |
| 1260 | 3300050509 | nmdc:mga0qj67_4772_c1 | nmdc:mga0qj67_4772_c1_1979_2956 | 325 |
| 1261 | 3300050510 | nmdc:mga06r32_34244_c1 | nmdc:mga06r32_34244_c1_185_1162 | 325 |
| 1262 | 3300050511 | nmdc:mga08y16_10784_c1 | nmdc:mga08y16_10784_c1_4869_5846 | 325 |
| 1263 | 3300050511 | nmdc:mga08y16_176438_c1 | nmdc:mga08y16_176438_c1_599_1576 | 325 |
| 1264 | 3300050511 | nmdc:mga08y16_206_c1 | nmdc:mga08y16_206_c1_10496_11473 | 325 |
| 1265 | 3300050511 | nmdc:mga08y16_2396_c1 | nmdc:mga08y16_2396_c1_9180_10157 | 325 |
| 1266 | 3300050512 | nmdc:mga0n895_126045_c1 | nmdc:mga0n895_126045_c1_924_1901 | 325 |
| 1267 | 3300050512 | nmdc:mga0n895_201249_c1 | nmdc:mga0n895_201249_c1_178_1155 | 325 |
| 1268 | 3300050512 | nmdc:mga0n895_2429_c1 | nmdc:mga0n895_2429_c1_12071_13048 | 325 |
| 1269 | 3300050512 | nmdc:mga0n895_2745_c2 | nmdc:mga0n895_2745_c2_188_1165 | 325 |
| 1270 | 3300050512 | nmdc:mga0n895_51689_c1 | nmdc:mga0n895_51689_c1_1205_2182 | 325 |
| 1271 | 3300050512 | nmdc:mga0n895_5847_c1 | nmdc:mga0n895_5847_c1_6414_7391 | 325 |
| 1272 | 3300050513 | nmdc:mga0rr50_144889_c1 | nmdc:mga0rr50_144889_c1_626_1603 | 325 |
| 1273 | 3300050513 | nmdc:mga0rr50_46884_c1 | nmdc:mga0rr50_46884_c1_612_1589 | 325 |
| 1274 | 3300050514 | nmdc:mga08x19_262272_c1 | nmdc:mga08x19_262272_c1_123_1100 | 325 |
| 1275 | 3300050515 | nmdc:mga0a205_11514_c1 | nmdc:mga0a205_11514_c1_3053_4030 | 325 |
| 1276 | 3300050515 | nmdc:mga0a205_375552_c1 | nmdc:mga0a205_375552_c1_193_1170 | 325 |
| 1277 | 3300050515 | nmdc:mga0a205_6435_c1 | nmdc:mga0a205_6435_c1_9362_10339 | 325 |
| 1278 | 3300050515 | nmdc:mga0a205_80_c1 | nmdc:mga0a205_80_c1_41535_42512 | 325 |
| 1279 | 3300050515 | nmdc:mga0a205_89878_c1 | nmdc:mga0a205_89878_c1_445_1422 | 325 |
| 1280 | 3300053077 | Ga0495601_0000360 | Ga0495601_0000360_16114_17091 | 325 |
| 1281 | 3300053077 | Ga0495601_0001260 | Ga0495601_0001260_649_1626 | 325 |
| 1282 | 3300053077 | Ga0495601_0007151 | Ga0495601_0007151_3314_4291 | 325 |
| 1283 | 3300053077 | Ga0495601_0009390 | Ga0495601_0009390_752_1729 | 325 |
| 1284 | 3300053077 | Ga0495601_0029689 | Ga0495601_0029689_1291_2268 | 325 |
| 1285 | 3300053078 | Ga0495612_0000964 | Ga0495612_0000964_468_1445 | 325 |
| 1286 | 3300053078 | Ga0495612_0002659 | Ga0495612_0002659_4749_5726 | 325 |
| 1287 | 3300053078 | Ga0495612_0005722 | Ga0495612_0005722_1941_2918 | 325 |
| 1288 | 3300053078 | Ga0495612_0008741 | Ga0495612_0008741_1766_2743 | 325 |
| 1289 | 3300053078 | Ga0495612_0009169 | Ga0495612_0009169_1140_2117 | 325 |
| 1290 | 3300053078 | Ga0495612_0054148 | Ga0495612_0054148_174_1151 | 325 |
| 1291 | 3300053083 | Ga0495655_0002786 | Ga0495655_0002786_1321_2298 | 325 |
| 1292 | 3300053084 | Ga0495595_0000552 | Ga0495595_0000552_9744_10721 | 325 |
| 1293 | 3300053084 | Ga0495595_0001276 | Ga0495595_0001276_5431_6408 | 325 |
| 1294 | 3300053084 | Ga0495595_0001912 | Ga0495595_0001912_7004_7981 | 325 |
| 1295 | 3300053084 | Ga0495595_0003989 | Ga0495595_0003989_992_1969 | 325 |
| 1296 | 3300053085 | Ga0495619_0000375 | Ga0495619_0000375_11413_12390 | 325 |
| 1297 | 3300053085 | Ga0495619_0000581 | Ga0495619_0000581_10266_11243 | 325 |
| 1298 | 3300053085 | Ga0495619_0000664 | Ga0495619_0000664_48_1025 | 325 |
| 1299 | 3300053085 | Ga0495619_0001851 | Ga0495619_0001851_11543_12520 | 325 |
| 1300 | 3300053085 | Ga0495619_0002169 | Ga0495619_0002169_6301_7278 | 325 |
| 1301 | 3300053085 | Ga0495619_0085474 | Ga0495619_0085474_354_1331 | 325 |
| 1302 | 3300053085 | Ga0495619_0094756 | Ga0495619_0094756_492_1469 | 325 |
| 1303 | 3300053085 | Ga0495619_0264286 | Ga0495619_0264286_138_1115 | 325 |
| 1304 | 3300053088 | Ga0500644_0008930 | Ga0500644_0008930_928_1905 | 325 |
| 1305 | 3300053094 | Ga0500566_0024974 | Ga0500566_0024974_10_987 | 325 |
| 1306 | 3300053096 | Ga0500641_0018612 | Ga0500641_0018612_1568_2545 | 325 |
| 1307 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_46900_47877 | 325 |
| 1308 | 3300053146 | Ga0500588_0017273 | Ga0500588_0017273_890_1867 | 325 |
| 1309 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_61744_62721 | 325 |
| 1310 | 3300053730 | Ga0500645_000471 | Ga0500645_000471_23154_24131 | 325 |
| 1311 | 3300054114 | Ga0501084_0037087 | Ga0501084_0037087_1455_2432 | 325 |
| 1312 | 3300060353 | Ga0501082_0080227 | Ga0501082_0080227_975_1952 | 325 |
| 1313 | 3300060353 | Ga0501082_0080612 | Ga0501082_0080612_943_1920 | 325 |
| 1314 | 3300061734 | Ga0530510_0082247 | Ga0530510_0082247_1300_2277 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qor-assembly1.cif.gz_B | crystal structure of escherichia coli quinone oxidoreductase complexed with nadph | 0.981 | 3 | 325 |
| 3jyl-assembly1.cif.gz_A | crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase | 0.9747 | 1 | 325 |
| 1qor-assembly1.cif.gz_B | crystal structure of escherichia coli quinone oxidoreductase complexed with nadph | 0.9721 | 3 | 325 |
| 4rvu-assembly1.cif.gz_D | the native structure of mycobacterial rv1454c complexed with nadph | 0.9713 | 1 | 325 |
| 4rvu-assembly2.cif.gz_C | the native structure of mycobacterial rv1454c complexed with nadph | 0.9703 | 3 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LVH0_176_320_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9915 | 125 | 269 | 3.40.50.720 |
| af_Q336S6_1_326_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9861 | 2 | 325 | 3.90.180.10 |
| af_P28304_2_327_2.170.150.20 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.98 | 3 | 325 | 2.170.150.20 |
| af_I1LVH0_176_320_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.978 | 125 | 269 | 3.40.50.720 |
| af_O74489_1_324_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9764 | 2 | 324 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528FI11-F1-model_v4 | Quinone oxidoreductase | 0.9939 | 109 | 325 |
GO:0003960
GO:0005829 GO:0008270 GO:0035925 GO:0070402 |
| AF-A0A4V1TF63-F1-model_v4 | Quinone oxidoreductase | 0.9933 | 144 | 325 |
GO:0003960
GO:0005829 GO:0035925 GO:0070402 |
| AF-A0A126NTD3-F1-model_v4 | Quinone oxidoreductase | 0.993 | 1 | 325 |
GO:0003960
GO:0005829 GO:0008270 GO:0035925 GO:0070402 |
| AF-A0A699GSK4-F1-model_v4 | GroES-like zinc-binding alcohol dehydrogenase family protein | 0.9922 | 124 | 325 |
GO:0003960
GO:0005829 GO:0035925 GO:0070402 |
| AF-A0A5B7AB61-F1-model_v4 | Putative quinone oxidoreductase isoform X2 (EC 1.6.5.5) | 0.992 | 124 | 325 |
GO:0003960
GO:0005829 GO:0035925 GO:0070402 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar