F492890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1312 | 653 | 1086 | 374 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0051791|Ga0495648_0051791_696_1979 |
| Length | 427 |
| Sequence | MDHALSPVNRPFSALSAAQQNFQHRYKNDNICGKYAKLSARLPLSPAGLIARSMTAEPFRSQLAALEQRGRLRRLSPRAGRDFASNDYLALAGDPMIAQAVADAVARGVPLGSGGSRLLRGNAPEHEGLEAKAADFFRTQAALFVANGYVGNLALFSTLPQRGDLIVADELIHASAHDGMRMSKAAAVFARHNDVQSFADLIAAFRAEGGKGRIWIAVETLYSMDGDMAPLADLAKLAAQHDAMLLLDEAHGTGVFGPGGRGLSAGLDGLHNVITLHTCGKAMGAEGALICGPRIHIDYLVNRARAFIFSTAPSPLMAVAVSAALDRIERADDLRERLKTLRQDAAEEICAPLGLPSPRSQILPVILGDDPRAMAAAAALQEAGFDVRGIRPPTVPPGTSRLRISLTLNASRSDVAALGRELQRVMR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 3 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 4 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 5 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 6 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 7 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 8 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 9 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 10 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 11 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 12 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 13 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 14 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 15 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 16 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 17 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 18 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 19 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 20 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 21 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 22 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 23 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 24 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 25 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 26 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 27 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 28 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 29 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 30 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 31 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 32 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 33 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 34 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 35 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 36 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 37 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 38 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 39 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 40 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 41 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 42 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 43 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 44 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 45 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 46 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 47 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 48 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 49 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 50 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 51 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 52 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 53 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 54 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 55 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 56 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 57 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 58 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 59 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 60 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 61 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 62 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 63 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 64 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 65 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 66 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 67 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 68 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 69 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 70 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 71 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 72 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 73 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 74 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 75 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 76 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 77 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 78 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 79 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 80 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 81 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 82 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 83 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 84 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 85 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 86 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 87 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 88 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 89 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 90 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 91 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 92 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 93 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 94 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 95 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 96 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 97 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 98 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 99 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 100 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 101 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 102 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 103 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 104 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 105 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 106 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 107 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 108 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 109 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 110 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 111 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 112 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 113 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 114 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 115 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 116 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 117 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 118 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 119 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 120 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 121 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 122 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 123 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 124 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 125 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 126 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 127 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 128 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 129 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 130 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 131 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 132 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 133 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 134 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 135 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 136 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 137 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 138 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 139 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 140 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 141 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 142 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 143 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 144 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 145 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 146 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 147 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 148 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 149 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 150 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 151 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 152 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 153 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 154 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 155 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 156 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 157 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 158 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 159 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 160 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 161 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 162 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 163 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 164 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 165 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 166 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 167 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 168 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 169 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 170 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 171 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 172 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 173 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 174 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 175 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 176 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 177 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 178 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 179 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 180 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 181 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 182 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 183 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 184 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 185 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 186 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 187 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 188 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 189 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 190 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 191 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 192 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 193 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 194 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 195 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 196 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 197 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 198 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 199 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 200 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 201 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 202 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 203 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 204 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 205 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 206 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 207 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 208 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 209 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 210 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 211 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 212 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 213 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 214 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 215 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 216 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 217 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 218 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 219 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 220 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 221 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 222 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 223 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 224 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 225 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 226 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 227 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 228 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 229 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 230 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 231 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 232 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 233 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 234 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 235 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 236 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 237 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 238 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 239 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 240 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 241 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 242 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 243 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 244 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 245 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 246 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 249 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 252 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 253 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 267 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 268 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 269 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 270 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 271 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 272 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 273 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 274 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 277 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 278 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 280 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 281 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 282 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 283 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 284 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 285 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 286 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 287 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 288 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 289 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 290 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 291 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 292 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 293 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 294 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 295 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 296 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 297 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 298 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 299 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 301 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 302 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 304 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 314 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 315 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 322 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 328 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 331 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 332 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 333 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 335 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 336 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 337 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 338 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 339 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 343 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 344 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 345 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 346 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 348 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 350 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 352 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 355 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 358 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 418 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 419 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 420 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 421 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 422 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 423 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 424 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 425 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 426 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 427 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 428 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 429 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 430 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 431 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 432 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 433 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 434 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 435 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 436 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 437 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 438 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 439 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 440 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 441 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 442 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 443 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 444 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 445 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 446 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 447 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 448 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 449 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 450 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 451 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 452 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 453 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 454 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 455 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 456 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 457 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 458 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 459 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 460 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 461 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 462 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 463 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 464 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 465 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 466 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 467 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 468 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 469 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 470 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 471 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 472 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 473 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 474 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 475 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 476 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 477 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 478 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 523 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 524 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 525 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 526 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 527 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 528 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 529 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 530 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 531 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 532 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 533 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 534 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 535 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 536 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 537 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 538 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 539 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 540 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 541 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 542 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 543 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 544 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 545 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 546 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 548 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 549 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 550 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 557 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 559 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 569 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 572 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 573 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 574 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 575 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 576 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 577 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 578 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 579 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 580 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 581 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 582 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 586 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 587 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 588 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 589 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 590 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 591 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 593 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 594 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 595 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 596 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 597 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 598 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 599 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 600 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 601 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 602 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 603 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 604 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 605 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 606 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 607 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 608 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 609 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 610 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 611 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 612 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 613 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 614 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 615 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 616 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 617 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 618 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 619 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 620 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 621 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 622 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 623 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 624 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 625 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 626 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 627 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 629 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 630 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 631 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 632 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 633 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 634 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 635 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 636 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 638 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 639 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 640 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 641 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 642 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 643 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 644 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 645 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 646 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 647 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 648 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 649 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 650 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 651 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 652 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
| 653 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.7 |
| Metatranscriptomes | 0 |
| Isolates | 17.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.69 |
| Bulb | 0 |
| Endosphere | 15.78 |
| Nodule | 7.24 |
| Rhizoplane | 2.52 |
| Rhizosphere | 61.43 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 12.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_544056 | 2162886007 | Bacteria | 7056 |
| 2 | JGI24736J21556_1015781 | 3300001904 | Bacteria | 1208 |
| 3 | JGI24741J21665_1000689 | 3300001915 | Bacteria | 10201 |
| 4 | JGI24741J21665_1005930 | 3300001915 | Bacteria | 2501 |
| 5 | JGI24752J21851_1000602 | 3300001976 | Bacteria | 4796 |
| 6 | JGI24752J21851_1000987 | 3300001976 | Bacteria | 3888 |
| 7 | JGI24740J21852_10000308 | 3300001979 | Bacteria | 20760 |
| 8 | JGI24740J21852_10000942 | 3300001979 | Bacteria | 12938 |
| 9 | JGI24739J22299_10003198 | 3300001989 | Bacteria | 6246 |
| 10 | JGI24739J22299_10006801 | 3300001989 | Bacteria | 4303 |
| 11 | JGI24737J22298_10001465 | 3300001990 | Bacteria | 8407 |
| 12 | JGI24737J22298_10003438 | 3300001990 | Bacteria | 5597 |
| 13 | JGI24737J22298_10008136 | 3300001990 | Bacteria | 3523 |
| 14 | JGI24735J21928_10001446 | 3300002067 | Bacteria | 8392 |
| 15 | JGI24738J21930_10001077 | 3300002075 | Bacteria | 7736 |
| 16 | JGI24749J21850_1007117 | 3300002076 | Bacteria | 1556 |
| 17 | JGI24751J29686_10000062 | 3300002459 | Bacteria | 61661 |
| 18 | JGI24751J29686_10009347 | 3300002459 | Bacteria | 2014 |
| 19 | JGI25152J39213_1002260 | 3300002773 | Bacteria | 7440 |
| 20 | JGI25150J39212_1000838 | 3300002774 | Bacteria | 10284 |
| 21 | JGI25159J45721_1000783 | 3300002987 | Bacteria | 13825 |
| 22 | JGI25151J46595_10004404 | 3300003187 | Bacteria | 7460 |
| 23 | JGI25151J46595_10024486 | 3300003187 | Bacteria | 2469 |
| 24 | JGI25165J46597_1000104 | 3300003214 | Bacteria | 152363 |
| 25 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 26 | JGI25153J46596_10000064 | 3300003215 | Bacteria | 125642 |
| 27 | JGI25153J46596_10003643 | 3300003215 | Bacteria | 8534 |
| 28 | JGI25153J46596_10004902 | 3300003215 | Bacteria | 7113 |
| 29 | rootH2_10028904 | 3300003320 | Bacteria | 1410 |
| 30 | rootH2_10108382 | 3300003320 | Bacteria | 3344 |
| 31 | rootH2_10236114 | 3300003320 | Bacteria | 4078 |
| 32 | rootL2_10109219 | 3300003322 | Bacteria | 2184 |
| 33 | rootL2_10163604 | 3300003322 | Bacteria | 2975 |
| 34 | rootL2_10261820 | 3300003322 | Bacteria | 1464 |
| 35 | rootH1_10009808 | 3300003323 | Bacteria | 4490 |
| 36 | rootH1_10009809 | 3300003316 | Bacteria | 30543 |
| 37 | rootH1_10009809 | 3300003323 | Bacteria | 2798 |
| 38 | rootH1_10172432 | 3300003323 | Bacteria | 6353 |
| 39 | rootH1_10193712 | 3300003323 | Bacteria | 3284 |
| 40 | JGI25160J50197_1000005 | 3300003354 | Bacteria | 417280 |
| 41 | JGI25160J50197_1000103 | 3300003354 | Bacteria | 80968 |
| 42 | JGI25160J50197_1003719 | 3300003354 | Bacteria | 6731 |
| 43 | JGI25161J50226_1000010 | 3300003374 | Bacteria | 214823 |
| 44 | JGI25161J50226_1000090 | 3300003374 | Bacteria | 73647 |
| 45 | JGI25161J50226_1001080 | 3300003374 | Bacteria | 9210 |
| 46 | Ga0055525_1000063 | 3300003759 | Bacteria | 198877 |
| 47 | Ga0055525_1000064 | 3300003759 | Bacteria | 198750 |
| 48 | Ga0055542_1000123 | 3300003762 | Bacteria | 101557 |
| 49 | Ga0055529_1000144 | 3300003763 | Bacteria | 101557 |
| 50 | Ga0055526_1002619 | 3300003771 | Bacteria | 12029 |
| 51 | Ga0055526_1005251 | 3300003771 | Bacteria | 7512 |
| 52 | Ga0055536_1002718 | 3300003781 | Bacteria | 9812 |
| 53 | Ga0055536_1011770 | 3300003781 | Bacteria | 3309 |
| 54 | Ga0055536_1014539 | 3300003781 | Bacteria | 2753 |
| 55 | Ga0055534_1002619 | 3300003784 | Bacteria | 6129 |
| 56 | Ga0055528_1004834 | 3300003790 | Bacteria | 6405 |
| 57 | Ga0055530_10000024 | 3300003791 | Bacteria | 135706 |
| 58 | Ga0055530_10000344 | 3300003791 | Bacteria | 42089 |
| 59 | Ga0055540_1002224 | 3300003792 | Bacteria | 10514 |
| 60 | Ga0055531_10000012 | 3300003794 | Bacteria | 191187 |
| 61 | Ga0055531_10000164 | 3300003794 | Bacteria | 75390 |
| 62 | Ga0058692_1001612 | 3300003856 | Bacteria | 8099 |
| 63 | Ga0055543_1000064 | 3300004625 | Bacteria | 97355 |
| 64 | Ga0055543_1000087 | 3300004625 | Bacteria | 81157 |
| 65 | Ga0055543_1000863 | 3300004625 | Bacteria | 14563 |
| 66 | Ga0065165_1000002 | 3300005262 | Bacteria | 444192 |
| 67 | Ga0065165_1000776 | 3300005262 | Bacteria | 42909 |
| 68 | Ga0065165_1001281 | 3300005262 | Bacteria | 28374 |
| 69 | Ga0065165_1001556 | 3300005262 | Bacteria | 23823 |
| 70 | Ga0065165_1007851 | 3300005262 | Bacteria | 5134 |
| 71 | Ga0065165_1009795 | 3300005262 | Bacteria | 4237 |
| 72 | Ga0065165_1011637 | 3300005262 | Bacteria | 3646 |
| 73 | Ga0065704_10001031 | 3300005289 | Bacteria | 10014 |
| 74 | Ga0065704_10073124 | 3300005289 | Bacteria | 7559 |
| 75 | Ga0065704_10074376 | 3300005289 | Bacteria | 6327 |
| 76 | Ga0065704_10086442 | 3300005289 | Bacteria | 3119 |
| 77 | Ga0070658_10001705 | 3300005327 | Bacteria | 18552 |
| 78 | Ga0070658_10017194 | 3300005327 | Bacteria | 5787 |
| 79 | Ga0070658_10169902 | 3300005327 | Bacteria | 1831 |
| 80 | Ga0070676_10017191 | 3300005328 | Bacteria | 4001 |
| 81 | Ga0070683_100000962 | 3300005329 | Bacteria | 21403 |
| 82 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 83 | Ga0070670_100000169 | 3300005331 | Bacteria | 59093 |
| 84 | Ga0070670_100042311 | 3300005331 | Bacteria | 3916 |
| 85 | Ga0070670_100099495 | 3300005331 | Bacteria | 2502 |
| 86 | Ga0070666_10000054 | 3300005335 | Bacteria | 95458 |
| 87 | Ga0070666_10007041 | 3300005335 | Bacteria | 6932 |
| 88 | Ga0070666_10044443 | 3300005335 | Bacteria | 2975 |
| 89 | Ga0070666_10046068 | 3300005335 | Bacteria | 2924 |
| 90 | Ga0070666_10089550 | 3300005335 | Bacteria | 2112 |
| 91 | Ga0070682_100001250 | 3300005337 | Bacteria | 14430 |
| 92 | Ga0068868_100221914 | 3300005338 | Bacteria | 1583 |
| 93 | Ga0068868_100358336 | 3300005338 | Bacteria | 1251 |
| 94 | Ga0070660_100034716 | 3300005339 | Bacteria | 3812 |
| 95 | Ga0070660_100054269 | 3300005339 | Bacteria | 3094 |
| 96 | Ga0070660_100244572 | 3300005339 | Bacteria | 1462 |
| 97 | Ga0070661_100015865 | 3300005344 | Bacteria | 5315 |
| 98 | Ga0070668_100000020 | 3300005347 | Bacteria | 98203 |
| 99 | Ga0070668_100000061 | 3300005347 | Bacteria | 66924 |
| 100 | Ga0070668_100001209 | 3300005347 | Bacteria | 18347 |
| 101 | Ga0070668_100041319 | 3300005347 | Bacteria | 3533 |
| 102 | Ga0070668_100118204 | 3300005347 | Bacteria | 2116 |
| 103 | Ga0070668_100164162 | 3300005347 | Bacteria | 1804 |
| 104 | Ga0070668_100187455 | 3300005347 | Bacteria | 1693 |
| 105 | Ga0070669_100000060 | 3300005353 | Bacteria | 108287 |
| 106 | Ga0070669_100000097 | 3300005353 | Bacteria | 86804 |
| 107 | Ga0070669_100124102 | 3300005353 | Bacteria | 1974 |
| 108 | Ga0070669_100191849 | 3300005353 | Bacteria | 1603 |
| 109 | Ga0070669_100212821 | 3300005353 | Bacteria | 1526 |
| 110 | Ga0070669_100324816 | 3300005353 | Bacteria | 1243 |
| 111 | Ga0070675_100132388 | 3300005354 | Bacteria | 2126 |
| 112 | Ga0070671_100000350 | 3300005355 | Bacteria | 31605 |
| 113 | Ga0070671_100000854 | 3300005355 | Bacteria | 22207 |
| 114 | Ga0070671_100003166 | 3300005355 | Bacteria | 12836 |
| 115 | Ga0070671_100004846 | 3300005355 | Bacteria | 10698 |
| 116 | Ga0070671_100103294 | 3300005355 | Bacteria | 2391 |
| 117 | Ga0070671_100330526 | 3300005355 | Bacteria | 1299 |
| 118 | Ga0070673_100064021 | 3300005364 | Bacteria | 2928 |
| 119 | Ga0070659_100020104 | 3300005366 | Bacteria | 5070 |
| 120 | Ga0070659_100022429 | 3300005366 | Bacteria | 4820 |
| 121 | Ga0070659_100054816 | 3300005366 | Bacteria | 3141 |
| 122 | Ga0070659_100057665 | 3300005366 | Bacteria | 3063 |
| 123 | Ga0070667_100000055 | 3300005367 | Bacteria | 151072 |
| 124 | Ga0070667_100000322 | 3300005367 | Bacteria | 53499 |
| 125 | Ga0070667_100001030 | 3300005367 | Bacteria | 25481 |
| 126 | Ga0070667_100001092 | 3300005367 | Bacteria | 24859 |
| 127 | Ga0070711_100017006 | 3300005439 | Bacteria | 4625 |
| 128 | Ga0070705_100043596 | 3300005440 | Bacteria | 2572 |
| 129 | Ga0070663_100026232 | 3300005455 | Bacteria | 3944 |
| 130 | Ga0070663_100029469 | 3300005455 | Bacteria | 3751 |
| 131 | Ga0070663_100116814 | 3300005455 | Bacteria | 2011 |
| 132 | Ga0070678_100000413 | 3300005456 | Bacteria | 20163 |
| 133 | Ga0070678_100006179 | 3300005456 | Bacteria | 7000 |
| 134 | Ga0070678_100066125 | 3300005456 | Bacteria | 2687 |
| 135 | Ga0070678_100168357 | 3300005456 | Bacteria | 1782 |
| 136 | Ga0070681_10011283 | 3300005458 | Bacteria | 8837 |
| 137 | Ga0070681_10246910 | 3300005458 | Bacteria | 1698 |
| 138 | Ga0068867_100078471 | 3300005459 | Bacteria | 2484 |
| 139 | Ga0070679_100002275 | 3300005530 | Bacteria | 17356 |
| 140 | Ga0070679_100004658 | 3300005530 | Bacteria | 12655 |
| 141 | Ga0070679_100056063 | 3300005530 | Bacteria | 3925 |
| 142 | Ga0070679_100135681 | 3300005530 | Bacteria | 2442 |
| 143 | Ga0070679_100259665 | 3300005530 | Bacteria | 1692 |
| 144 | Ga0070684_100000297 | 3300005535 | Bacteria | 34479 |
| 145 | Ga0070684_100092842 | 3300005535 | Bacteria | 2686 |
| 146 | Ga0070684_100095686 | 3300005535 | Bacteria | 2646 |
| 147 | Ga0070697_100239459 | 3300005536 | Bacteria | 1549 |
| 148 | Ga0068853_100089918 | 3300005539 | Bacteria | 2698 |
| 149 | Ga0070686_100094573 | 3300005544 | Bacteria | 2006 |
| 150 | Ga0070695_100005196 | 3300005545 | Bacteria | 7682 |
| 151 | Ga0070696_100000797 | 3300005546 | Bacteria | 20306 |
| 152 | Ga0070696_100005838 | 3300005546 | Bacteria | 8212 |
| 153 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 154 | Ga0070665_100001971 | 3300005548 | Bacteria | 23078 |
| 155 | Ga0070665_100003281 | 3300005548 | Bacteria | 17362 |
| 156 | Ga0070665_100014237 | 3300005548 | Bacteria | 7990 |
| 157 | Ga0070665_100060637 | 3300005548 | Bacteria | 3792 |
| 158 | Ga0070665_100169754 | 3300005548 | Bacteria | 2183 |
| 159 | Ga0070704_100073247 | 3300005549 | Bacteria | 2495 |
| 160 | Ga0068855_100017039 | 3300005563 | Bacteria | 8741 |
| 161 | Ga0068855_100098645 | 3300005563 | Bacteria | 3365 |
| 162 | Ga0068855_100145628 | 3300005563 | Bacteria | 2697 |
| 163 | Ga0068855_100182749 | 3300005563 | Bacteria | 2370 |
| 164 | Ga0070664_100037558 | 3300005564 | Bacteria | 4073 |
| 165 | Ga0070664_100045092 | 3300005564 | Bacteria | 3724 |
| 166 | Ga0070664_100350905 | 3300005564 | Bacteria | 1342 |
| 167 | Ga0068857_100007564 | 3300005577 | Bacteria | 9353 |
| 168 | Ga0068857_100072443 | 3300005577 | Bacteria | 3070 |
| 169 | Ga0068854_100009241 | 3300005578 | Bacteria | 6359 |
| 170 | Ga0068854_100195991 | 3300005578 | Bacteria | 1585 |
| 171 | Ga0068856_100000581 | 3300005614 | Bacteria | 39928 |
| 172 | Ga0068856_100139383 | 3300005614 | Bacteria | 2432 |
| 173 | Ga0068856_100535407 | 3300005614 | Bacteria | 1192 |
| 174 | Ga0068852_100226879 | 3300005616 | Bacteria | 1779 |
| 175 | Ga0068859_100000847 | 3300005617 | Bacteria | 31136 |
| 176 | Ga0068859_100021274 | 3300005617 | Bacteria | 6509 |
| 177 | Ga0068859_100075652 | 3300005617 | Bacteria | 3407 |
| 178 | Ga0068859_100174343 | 3300005617 | Bacteria | 2232 |
| 179 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 180 | Ga0068864_100000011 | 3300005618 | Bacteria | 350056 |
| 181 | Ga0068864_100000870 | 3300005618 | Bacteria | 25428 |
| 182 | Ga0068864_100014218 | 3300005618 | Bacteria | 6609 |
| 183 | Ga0068864_100049297 | 3300005618 | Bacteria | 3623 |
| 184 | Ga0068864_100084553 | 3300005618 | Bacteria | 2788 |
| 185 | Ga0068864_100099687 | 3300005618 | Bacteria | 2574 |
| 186 | Ga0068864_100263181 | 3300005618 | Bacteria | 1605 |
| 187 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 188 | Ga0068863_100000030 | 3300005841 | Bacteria | 176023 |
| 189 | Ga0068863_100000053 | 3300005841 | Bacteria | 125195 |
| 190 | Ga0068863_100002111 | 3300005841 | Bacteria | 19717 |
| 191 | Ga0068863_100038845 | 3300005841 | Bacteria | 4528 |
| 192 | Ga0068863_100069839 | 3300005841 | Bacteria | 3321 |
| 193 | Ga0068863_100114929 | 3300005841 | Bacteria | 2564 |
| 194 | Ga0068858_100000022 | 3300005842 | Bacteria | 169718 |
| 195 | Ga0068858_100000186 | 3300005842 | Bacteria | 65965 |
| 196 | Ga0068858_100000222 | 3300005842 | Bacteria | 61633 |
| 197 | Ga0068858_100028145 | 3300005842 | Bacteria | 5222 |
| 198 | Ga0068858_100076465 | 3300005842 | Bacteria | 3109 |
| 199 | Ga0068860_100000090 | 3300005843 | Bacteria | 151520 |
| 200 | Ga0068860_100091566 | 3300005843 | Bacteria | 2897 |
| 201 | Ga0068860_100094572 | 3300005843 | Bacteria | 2848 |
| 202 | Ga0068860_100165043 | 3300005843 | Bacteria | 2137 |
| 203 | Ga0068860_100290841 | 3300005843 | Bacteria | 1599 |
| 204 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 205 | Ga0068862_100000104 | 3300005844 | Bacteria | 100182 |
| 206 | Ga0068862_100001021 | 3300005844 | Bacteria | 26923 |
| 207 | Ga0068862_100001485 | 3300005844 | Bacteria | 21504 |
| 208 | Ga0068862_100411861 | 3300005844 | Bacteria | 1267 |
| 209 | Ga0075365_10015345 | 3300006038 | Bacteria | 4633 |
| 210 | Ga0075368_10003978 | 3300006042 | Bacteria | 4977 |
| 211 | Ga0075368_10022290 | 3300006042 | Bacteria | 2410 |
| 212 | Ga0075363_100003818 | 3300006048 | Bacteria | 6495 |
| 213 | Ga0075363_100004343 | 3300006048 | Bacteria | 6181 |
| 214 | Ga0075363_100063969 | 3300006048 | Bacteria | 1987 |
| 215 | Ga0075364_10015635 | 3300006051 | Bacteria | 4709 |
| 216 | Ga0075364_10097247 | 3300006051 | Bacteria | 1958 |
| 217 | Ga0070716_100030220 | 3300006173 | Bacteria | 2937 |
| 218 | Ga0070716_100070279 | 3300006173 | Bacteria | 2055 |
| 219 | Ga0070712_100003369 | 3300006175 | Bacteria | 9825 |
| 220 | Ga0075362_10000064 | 3300006177 | Bacteria | 30699 |
| 221 | Ga0075362_10004725 | 3300006177 | Bacteria | 4919 |
| 222 | Ga0075367_10000664 | 3300006178 | Bacteria | 13170 |
| 223 | Ga0075367_10002499 | 3300006178 | Bacteria | 8425 |
| 224 | Ga0075367_10024153 | 3300006178 | Bacteria | 3428 |
| 225 | Ga0075367_10042598 | 3300006178 | Bacteria | 2657 |
| 226 | Ga0075367_10176015 | 3300006178 | Bacteria | 1333 |
| 227 | Ga0075369_10009043 | 3300006186 | Bacteria | 3857 |
| 228 | Ga0075366_10000133 | 3300006195 | Bacteria | 31068 |
| 229 | Ga0075366_10006964 | 3300006195 | Bacteria | 6224 |
| 230 | Ga0097621_100000498 | 3300006237 | Bacteria | 27559 |
| 231 | Ga0097621_100013282 | 3300006237 | Bacteria | 6133 |
| 232 | Ga0097621_100144718 | 3300006237 | Bacteria | 2034 |
| 233 | Ga0097621_100166468 | 3300006237 | Bacteria | 1898 |
| 234 | Ga0075370_10000015 | 3300006353 | Bacteria | 62164 |
| 235 | Ga0068871_100000406 | 3300006358 | Bacteria | 29738 |
| 236 | Ga0068871_100010613 | 3300006358 | Bacteria | 6731 |
| 237 | Ga0068871_100018177 | 3300006358 | Bacteria | 5338 |
| 238 | Ga0097620_100000847 | 3300006931 | Bacteria | 31136 |
| 239 | Ga0097620_100021274 | 3300006931 | Bacteria | 6509 |
| 240 | Ga0097620_100075651 | 3300006931 | Bacteria | 3407 |
| 241 | Ga0097620_100174356 | 3300006931 | Bacteria | 2232 |
| 242 | Ga0105251_10000342 | 3300009011 | Bacteria | 46221 |
| 243 | Ga0105251_10003145 | 3300009011 | Bacteria | 12252 |
| 244 | Ga0105244_10000058 | 3300009036 | Bacteria | 128877 |
| 245 | Ga0105245_10001826 | 3300009098 | Bacteria | 19371 |
| 246 | Ga0105245_10010667 | 3300009098 | Bacteria | 7993 |
| 247 | Ga0105245_10221379 | 3300009098 | Bacteria | 1826 |
| 248 | Ga0105247_10000840 | 3300009101 | Bacteria | 23345 |
| 249 | Ga0105247_10086235 | 3300009101 | Bacteria | 1987 |
| 250 | Ga0105247_10108412 | 3300009101 | Bacteria | 1784 |
| 251 | Ga0105243_10000090 | 3300009148 | Bacteria | 102483 |
| 252 | Ga0105243_10000192 | 3300009148 | Bacteria | 71429 |
| 253 | Ga0105243_10026130 | 3300009148 | Bacteria | 4467 |
| 254 | Ga0105243_10030367 | 3300009148 | Bacteria | 4160 |
| 255 | Ga0105241_10020587 | 3300009174 | Bacteria | 4875 |
| 256 | Ga0105241_10101590 | 3300009174 | Bacteria | 2286 |
| 257 | Ga0105241_10140905 | 3300009174 | Bacteria | 1963 |
| 258 | Ga0105248_10000229 | 3300009177 | Bacteria | 64280 |
| 259 | Ga0105248_10001858 | 3300009177 | Bacteria | 23422 |
| 260 | Ga0105248_10037315 | 3300009177 | Bacteria | 5436 |
| 261 | Ga0105248_10043322 | 3300009177 | Bacteria | 5046 |
| 262 | Ga0105248_10067604 | 3300009177 | Bacteria | 4012 |
| 263 | Ga0105248_10409215 | 3300009177 | Bacteria | 1527 |
| 264 | Ga0105237_10092985 | 3300009545 | Bacteria | 3005 |
| 265 | Ga0105238_10008814 | 3300009551 | Bacteria | 10092 |
| 266 | Ga0105238_10039059 | 3300009551 | Bacteria | 4816 |
| 267 | Ga0105238_10153934 | 3300009551 | Bacteria | 2274 |
| 268 | Ga0105249_10000106 | 3300009553 | Bacteria | 115526 |
| 269 | Ga0105249_10011772 | 3300009553 | Bacteria | 7691 |
| 270 | Ga0105249_10069094 | 3300009553 | Bacteria | 3260 |
| 271 | Ga0105249_10101973 | 3300009553 | Bacteria | 2700 |
| 272 | Ga0105249_10108871 | 3300009553 | Bacteria | 2616 |
| 273 | Ga0105249_10149886 | 3300009553 | Bacteria | 2245 |
| 274 | Ga0105249_10159348 | 3300009553 | Bacteria | 2179 |
| 275 | Ga0123341_1015241 | 3300009765 | Bacteria | 6858 |
| 276 | Ga0123341_1026276 | 3300009765 | Bacteria | 4625 |
| 277 | Ga0123342_1016039 | 3300009766 | Bacteria | 6622 |
| 278 | Ga0105239_10352621 | 3300010375 | Bacteria | 1661 |
| 279 | Ga0105246_10000491 | 3300011119 | Bacteria | 21441 |
| 280 | Ga0105246_10024573 | 3300011119 | Bacteria | 3916 |
| 281 | Ga0157373_10000019 | 3300013100 | Bacteria | 166579 |
| 282 | Ga0157371_10000138 | 3300013102 | Bacteria | 105621 |
| 283 | Ga0157371_10000187 | 3300013102 | Bacteria | 91186 |
| 284 | Ga0157371_10055251 | 3300013102 | Bacteria | 2817 |
| 285 | Ga0157370_10000037 | 3300013104 | Bacteria | 136803 |
| 286 | Ga0157370_10000289 | 3300013104 | Bacteria | 63849 |
| 287 | Ga0157370_10014403 | 3300013104 | Bacteria | 8086 |
| 288 | Ga0157370_10015069 | 3300013104 | Bacteria | 7877 |
| 289 | Ga0157370_10027971 | 3300013104 | Bacteria | 5552 |
| 290 | Ga0157370_10030229 | 3300013104 | Bacteria | 5309 |
| 291 | Ga0157370_10188461 | 3300013104 | Bacteria | 1915 |
| 292 | Ga0157370_10218841 | 3300013104 | Bacteria | 1764 |
| 293 | Ga0157369_10001685 | 3300013105 | Bacteria | 26974 |
| 294 | Ga0157369_10410859 | 3300013105 | Bacteria | 1404 |
| 295 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 296 | Ga0157378_10049262 | 3300013297 | Bacteria | 3747 |
| 297 | Ga0163162_10001728 | 3300013306 | Bacteria | 20466 |
| 298 | Ga0163162_10009006 | 3300013306 | Bacteria | 9703 |
| 299 | Ga0163162_10070659 | 3300013306 | Bacteria | 3542 |
| 300 | Ga0157375_10000313 | 3300013308 | Bacteria | 43467 |
| 301 | Ga0157375_10094894 | 3300013308 | Bacteria | 3053 |
| 302 | Ga0163163_10116377 | 3300014325 | Bacteria | 2704 |
| 303 | Ga0157380_10000083 | 3300014326 | Bacteria | 52136 |
| 304 | Ga0182008_10000015 | 3300014497 | Bacteria | 243121 |
| 305 | Ga0157379_10067349 | 3300014968 | Bacteria | 3200 |
| 306 | Ga0157379_10068223 | 3300014968 | Bacteria | 3180 |
| 307 | Ga0157379_10073045 | 3300014968 | Bacteria | 3070 |
| 308 | Ga0157376_10075409 | 3300014969 | Bacteria | 2878 |
| 309 | Ga0182006_1000011 | 3300015261 | Bacteria | 408647 |
| 310 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 311 | Ga0183363_1030 | 3300015690 | Bacteria | 49061 |
| 312 | Ga0183361_10078 | 3300016635 | Bacteria | 2971 |
| 313 | Ga0163161_10057497 | 3300017792 | Bacteria | 2826 |
| 314 | Ga0163161_10098300 | 3300017792 | Bacteria | 2175 |
| 315 | Ga0214544_1000158 | 3300021320 | Bacteria | 101943 |
| 316 | Ga0214542_1001567 | 3300021321 | Bacteria | 47020 |
| 317 | Ga0214543_1000234 | 3300021327 | Bacteria | 84243 |
| 318 | Ga0214543_1001418 | 3300021327 | Bacteria | 46073 |
| 319 | Ga0213876_10015478 | 3300021384 | Bacteria | 4036 |
| 320 | Ga0213876_10163503 | 3300021384 | Bacteria | 1184 |
| 321 | Ga0213871_10006084 | 3300021441 | Bacteria | 2534 |
| 322 | Ga0209436_100126 | 3300025208 | Bacteria | 37591 |
| 323 | Ga0209436_100556 | 3300025208 | Bacteria | 16119 |
| 324 | Ga0209147_101850 | 3300025229 | Bacteria | 6493 |
| 325 | Ga0209563_100066 | 3300025230 | Bacteria | 257382 |
| 326 | Ga0207425_1000228 | 3300025245 | Bacteria | 43864 |
| 327 | Ga0209677_102327 | 3300025253 | Bacteria | 7293 |
| 328 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 329 | Ga0209129_1000082 | 3300025258 | Bacteria | 183436 |
| 330 | Ga0209129_1000424 | 3300025258 | Bacteria | 32069 |
| 331 | Ga0209129_1001242 | 3300025258 | Bacteria | 14638 |
| 332 | Ga0209129_1002843 | 3300025258 | Bacteria | 8009 |
| 333 | Ga0209233_1000164 | 3300025261 | Bacteria | 152430 |
| 334 | Ga0209233_1014593 | 3300025261 | Bacteria | 2209 |
| 335 | Ga0209565_1000166 | 3300025263 | Bacteria | 85898 |
| 336 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 337 | Ga0209455_1002862 | 3300025272 | Bacteria | 6387 |
| 338 | Ga0209455_1009694 | 3300025272 | Bacteria | 2509 |
| 339 | Ga0209673_1004601 | 3300025273 | Bacteria | 7314 |
| 340 | Ga0209673_1011852 | 3300025273 | Bacteria | 3560 |
| 341 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 342 | Ga0209130_1000010 | 3300025284 | Bacteria | 444920 |
| 343 | Ga0209130_1000098 | 3300025284 | Bacteria | 142506 |
| 344 | Ga0209675_1000033 | 3300025291 | Bacteria | 271576 |
| 345 | Ga0209675_1004347 | 3300025291 | Bacteria | 6341 |
| 346 | Ga0209676_1000138 | 3300025292 | Bacteria | 178932 |
| 347 | Ga0209676_1000148 | 3300025292 | Bacteria | 172161 |
| 348 | Ga0209676_1001403 | 3300025292 | Bacteria | 23290 |
| 349 | Ga0209676_1020842 | 3300025292 | Bacteria | 2213 |
| 350 | Ga0209676_1022758 | 3300025292 | Bacteria | 2068 |
| 351 | Ga0209676_1031134 | 3300025292 | Bacteria | 1622 |
| 352 | Ga0209025_1000172 | 3300025294 | Bacteria | 160407 |
| 353 | Ga0209025_1000234 | 3300025294 | Bacteria | 130341 |
| 354 | Ga0209025_1000304 | 3300025294 | Bacteria | 109508 |
| 355 | Ga0209025_1000689 | 3300025294 | Bacteria | 57945 |
| 356 | Ga0209564_1000025 | 3300025295 | Bacteria | 520535 |
| 357 | Ga0209564_1002096 | 3300025295 | Bacteria | 17065 |
| 358 | Ga0209564_1003037 | 3300025295 | Bacteria | 11946 |
| 359 | Ga0209564_1007547 | 3300025295 | Bacteria | 5600 |
| 360 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 361 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 362 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 363 | Ga0209758_1004381 | 3300025297 | Bacteria | 11797 |
| 364 | Ga0209758_1006462 | 3300025297 | Bacteria | 8406 |
| 365 | Ga0209758_1018335 | 3300025297 | Bacteria | 3434 |
| 366 | Ga0209758_1039302 | 3300025297 | Bacteria | 1801 |
| 367 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 368 | Ga0209050_1000039 | 3300025298 | Bacteria | 410069 |
| 369 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 370 | Ga0209050_1004457 | 3300025298 | Bacteria | 9446 |
| 371 | Ga0209050_1023211 | 3300025298 | Bacteria | 2190 |
| 372 | Ga0209256_1000311 | 3300025299 | Bacteria | 84751 |
| 373 | Ga0209256_1011274 | 3300025299 | Bacteria | 3601 |
| 374 | Ga0207426_1000036 | 3300025302 | Bacteria | 444920 |
| 375 | Ga0207426_1000045 | 3300025302 | Bacteria | 422847 |
| 376 | Ga0207426_1000069 | 3300025302 | Bacteria | 334513 |
| 377 | Ga0207426_1000968 | 3300025302 | Bacteria | 28326 |
| 378 | Ga0209051_1000415 | 3300025303 | Bacteria | 58919 |
| 379 | Ga0209051_1023758 | 3300025303 | Bacteria | 2540 |
| 380 | Ga0209257_1000051 | 3300025304 | Bacteria | 434166 |
| 381 | Ga0209257_1000076 | 3300025304 | Bacteria | 324617 |
| 382 | Ga0209257_1000130 | 3300025304 | Bacteria | 212188 |
| 383 | Ga0209257_1004707 | 3300025304 | Bacteria | 10238 |
| 384 | Ga0209257_1004726 | 3300025304 | Bacteria | 10196 |
| 385 | Ga0209257_1005137 | 3300025304 | Bacteria | 9463 |
| 386 | Ga0207655_1000693 | 3300025728 | Bacteria | 39160 |
| 387 | Ga0207713_1008759 | 3300025735 | Bacteria | 5767 |
| 388 | Ga0207710_10000606 | 3300025900 | Bacteria | 20949 |
| 389 | Ga0207688_10041105 | 3300025901 | Bacteria | 2571 |
| 390 | Ga0207680_10003164 | 3300025903 | Bacteria | 7735 |
| 391 | Ga0207680_10004498 | 3300025903 | Bacteria | 6613 |
| 392 | Ga0207680_10013481 | 3300025903 | Bacteria | 4201 |
| 393 | Ga0207647_10116069 | 3300025904 | Bacteria | 1580 |
| 394 | Ga0207645_10032980 | 3300025907 | Bacteria | 3329 |
| 395 | Ga0207705_10000120 | 3300025909 | Bacteria | 87080 |
| 396 | Ga0207705_10002397 | 3300025909 | Bacteria | 14472 |
| 397 | Ga0207705_10005207 | 3300025909 | Bacteria | 9750 |
| 398 | Ga0207654_10005355 | 3300025911 | Bacteria | 6482 |
| 399 | Ga0207707_10246650 | 3300025912 | Bacteria | 1552 |
| 400 | Ga0207695_10078679 | 3300025913 | Bacteria | 3345 |
| 401 | Ga0207695_10147102 | 3300025913 | Bacteria | 2299 |
| 402 | Ga0207671_10009634 | 3300025914 | Bacteria | 8052 |
| 403 | Ga0207671_10124641 | 3300025914 | Bacteria | 1972 |
| 404 | Ga0207693_10009341 | 3300025915 | Bacteria | 7995 |
| 405 | Ga0207657_10227081 | 3300025919 | Bacteria | 1494 |
| 406 | Ga0207649_10002019 | 3300025920 | Bacteria | 11541 |
| 407 | Ga0207649_10104952 | 3300025920 | Bacteria | 1877 |
| 408 | Ga0207652_10001588 | 3300025921 | Bacteria | 20009 |
| 409 | Ga0207652_10088169 | 3300025921 | Bacteria | 2722 |
| 410 | Ga0207652_10114658 | 3300025921 | Bacteria | 2393 |
| 411 | Ga0207652_10133510 | 3300025921 | Bacteria | 2215 |
| 412 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 413 | Ga0207681_10000030 | 3300025923 | Bacteria | 173766 |
| 414 | Ga0207681_10013391 | 3300025923 | Bacteria | 5076 |
| 415 | Ga0207681_10094045 | 3300025923 | Bacteria | 2147 |
| 416 | Ga0207694_10011664 | 3300025924 | Bacteria | 6629 |
| 417 | Ga0207694_10014727 | 3300025924 | Bacteria | 5896 |
| 418 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 419 | Ga0207650_10000294 | 3300025925 | Bacteria | 50141 |
| 420 | Ga0207650_10024163 | 3300025925 | Bacteria | 4317 |
| 421 | Ga0207650_10147411 | 3300025925 | Bacteria | 1855 |
| 422 | Ga0207659_10111542 | 3300025926 | Bacteria | 2080 |
| 423 | Ga0207687_10001337 | 3300025927 | Bacteria | 16848 |
| 424 | Ga0207687_10077549 | 3300025927 | Bacteria | 2390 |
| 425 | Ga0207700_10133081 | 3300025928 | Bacteria | 2033 |
| 426 | Ga0207644_10000050 | 3300025931 | Bacteria | 93772 |
| 427 | Ga0207644_10000096 | 3300025931 | Bacteria | 63618 |
| 428 | Ga0207644_10000944 | 3300025931 | Bacteria | 18531 |
| 429 | Ga0207644_10123833 | 3300025931 | Bacteria | 1971 |
| 430 | Ga0207644_10130713 | 3300025931 | Bacteria | 1922 |
| 431 | Ga0207690_10007651 | 3300025932 | Bacteria | 6409 |
| 432 | Ga0207690_10187969 | 3300025932 | Bacteria | 1560 |
| 433 | Ga0207706_10019021 | 3300025933 | Bacteria | 6178 |
| 434 | Ga0207706_10072781 | 3300025933 | Bacteria | 3022 |
| 435 | Ga0207709_10000364 | 3300025935 | Bacteria | 45576 |
| 436 | Ga0207709_10000503 | 3300025935 | Bacteria | 34770 |
| 437 | Ga0207709_10013050 | 3300025935 | Bacteria | 4580 |
| 438 | Ga0207709_10026116 | 3300025935 | Bacteria | 3351 |
| 439 | Ga0207709_10035978 | 3300025935 | Bacteria | 2931 |
| 440 | Ga0207709_10155844 | 3300025935 | Bacteria | 1587 |
| 441 | Ga0207669_10000100 | 3300025937 | Bacteria | 43316 |
| 442 | Ga0207669_10000461 | 3300025937 | Bacteria | 17704 |
| 443 | Ga0207665_10045233 | 3300025939 | Bacteria | 2947 |
| 444 | Ga0207711_10001356 | 3300025941 | Bacteria | 23103 |
| 445 | Ga0207711_10003309 | 3300025941 | Bacteria | 13998 |
| 446 | Ga0207711_10007985 | 3300025941 | Bacteria | 8853 |
| 447 | Ga0207711_10011245 | 3300025941 | Bacteria | 7436 |
| 448 | Ga0207711_10014920 | 3300025941 | Bacteria | 6455 |
| 449 | Ga0207711_10123872 | 3300025941 | Bacteria | 2310 |
| 450 | Ga0207689_10139464 | 3300025942 | Bacteria | 1997 |
| 451 | Ga0207661_10002325 | 3300025944 | Bacteria | 13094 |
| 452 | Ga0207679_10006553 | 3300025945 | Bacteria | 7359 |
| 453 | Ga0207679_10051529 | 3300025945 | Bacteria | 3013 |
| 454 | Ga0207679_10203629 | 3300025945 | Bacteria | 1655 |
| 455 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 456 | Ga0207667_10127428 | 3300025949 | Bacteria | 2622 |
| 457 | Ga0207667_10129082 | 3300025949 | Bacteria | 2604 |
| 458 | Ga0207667_10157687 | 3300025949 | Bacteria | 2335 |
| 459 | Ga0207667_10318729 | 3300025949 | Bacteria | 1588 |
| 460 | Ga0207651_10045874 | 3300025960 | Bacteria | 2934 |
| 461 | Ga0207712_10000224 | 3300025961 | Bacteria | 55674 |
| 462 | Ga0207712_10071451 | 3300025961 | Bacteria | 2496 |
| 463 | Ga0207712_10082993 | 3300025961 | Bacteria | 2338 |
| 464 | Ga0207712_10208815 | 3300025961 | Bacteria | 1553 |
| 465 | Ga0207668_10000027 | 3300025972 | Bacteria | 125575 |
| 466 | Ga0207668_10000048 | 3300025972 | Bacteria | 100390 |
| 467 | Ga0207668_10000832 | 3300025972 | Bacteria | 18652 |
| 468 | Ga0207668_10004020 | 3300025972 | Bacteria | 8659 |
| 469 | Ga0207668_10020257 | 3300025972 | Bacteria | 4222 |
| 470 | Ga0207668_10060594 | 3300025972 | Bacteria | 2657 |
| 471 | Ga0207668_10136003 | 3300025972 | Bacteria | 1883 |
| 472 | Ga0207640_10074572 | 3300025981 | Bacteria | 2296 |
| 473 | Ga0207640_10161164 | 3300025981 | Bacteria | 1660 |
| 474 | Ga0207658_10000090 | 3300025986 | Bacteria | 100143 |
| 475 | Ga0207658_10000853 | 3300025986 | Bacteria | 25495 |
| 476 | Ga0207658_10003610 | 3300025986 | Bacteria | 10935 |
| 477 | Ga0207658_10003728 | 3300025986 | Bacteria | 10731 |
| 478 | Ga0207703_10000048 | 3300026035 | Bacteria | 151143 |
| 479 | Ga0207703_10000231 | 3300026035 | Bacteria | 63888 |
| 480 | Ga0207703_10000428 | 3300026035 | Bacteria | 44367 |
| 481 | Ga0207703_10001069 | 3300026035 | Bacteria | 26141 |
| 482 | Ga0207703_10027853 | 3300026035 | Bacteria | 4451 |
| 483 | Ga0207703_10141440 | 3300026035 | Bacteria | 2089 |
| 484 | Ga0207639_10001044 | 3300026041 | Bacteria | 18817 |
| 485 | Ga0207639_10001988 | 3300026041 | Bacteria | 13760 |
| 486 | Ga0207678_10001105 | 3300026067 | Bacteria | 24731 |
| 487 | Ga0207678_10001352 | 3300026067 | Bacteria | 22581 |
| 488 | Ga0207678_10008945 | 3300026067 | Bacteria | 8818 |
| 489 | Ga0207678_10030824 | 3300026067 | Bacteria | 4683 |
| 490 | Ga0207708_10168730 | 3300026075 | Bacteria | 1732 |
| 491 | Ga0207702_10000922 | 3300026078 | Bacteria | 30419 |
| 492 | Ga0207702_10003624 | 3300026078 | Bacteria | 14015 |
| 493 | Ga0207702_10005099 | 3300026078 | Bacteria | 11548 |
| 494 | Ga0207702_10137145 | 3300026078 | Bacteria | 2209 |
| 495 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 496 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 497 | Ga0207641_10000093 | 3300026088 | Bacteria | 125747 |
| 498 | Ga0207641_10005852 | 3300026088 | Bacteria | 10434 |
| 499 | Ga0207648_10112303 | 3300026089 | Bacteria | 2393 |
| 500 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 501 | Ga0207676_10000040 | 3300026095 | Bacteria | 167947 |
| 502 | Ga0207676_10000270 | 3300026095 | Bacteria | 44974 |
| 503 | Ga0207676_10000658 | 3300026095 | Bacteria | 27657 |
| 504 | Ga0207676_10128951 | 3300026095 | Bacteria | 2147 |
| 505 | Ga0207674_10012575 | 3300026116 | Bacteria | 9457 |
| 506 | Ga0207674_10078586 | 3300026116 | Bacteria | 3304 |
| 507 | Ga0207674_10154662 | 3300026116 | Bacteria | 2249 |
| 508 | Ga0207675_100002408 | 3300026118 | Bacteria | 18527 |
| 509 | Ga0207675_100014882 | 3300026118 | Bacteria | 7261 |
| 510 | Ga0207683_10009115 | 3300026121 | Bacteria | 8456 |
| 511 | Ga0207683_10016012 | 3300026121 | Bacteria | 6382 |
| 512 | Ga0207683_10227772 | 3300026121 | Bacteria | 1699 |
| 513 | Ga0207698_10001069 | 3300026142 | Bacteria | 15923 |
| 514 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 515 | Ga0209371_1000901 | 3300027312 | Bacteria | 23610 |
| 516 | Ga0209998_10020384 | 3300027717 | Bacteria | 1418 |
| 517 | Ga0209813_10000240 | 3300027866 | Bacteria | 16302 |
| 518 | Ga0209813_10002387 | 3300027866 | Bacteria | 4306 |
| 519 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 520 | Ga0268266_10000505 | 3300028379 | Bacteria | 55387 |
| 521 | Ga0268266_10008793 | 3300028379 | Bacteria | 8949 |
| 522 | Ga0268266_10129411 | 3300028379 | Bacteria | 2256 |
| 523 | Ga0268266_10132273 | 3300028379 | Bacteria | 2232 |
| 524 | Ga0268266_10317952 | 3300028379 | Bacteria | 1456 |
| 525 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 526 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 527 | Ga0268265_10000970 | 3300028380 | Bacteria | 26248 |
| 528 | Ga0268265_10001609 | 3300028380 | Bacteria | 18629 |
| 529 | Ga0268264_10000075 | 3300028381 | Bacteria | 256011 |
| 530 | Ga0268264_10000288 | 3300028381 | Bacteria | 84755 |
| 531 | Ga0268264_10016089 | 3300028381 | Bacteria | 6129 |
| 532 | Ga0268264_10020758 | 3300028381 | Bacteria | 5368 |
| 533 | Ga0265337_1003505 | 3300028556 | Bacteria | 6779 |
| 534 | Ga0265337_1018245 | 3300028556 | Bacteria | 2232 |
| 535 | Ga0265319_1012596 | 3300028563 | Bacteria | 3412 |
| 536 | Ga0265334_10001203 | 3300028573 | Bacteria | 12660 |
| 537 | Ga0265334_10003663 | 3300028573 | Bacteria | 6953 |
| 538 | Ga0265323_10000276 | 3300028653 | Bacteria | 29667 |
| 539 | Ga0265336_10000268 | 3300028666 | Bacteria | 36633 |
| 540 | Ga0307517_10039586 | 3300028786 | Bacteria | 5171 |
| 541 | Ga0307517_10066936 | 3300028786 | Bacteria | 3297 |
| 542 | Ga0307517_10108979 | 3300028786 | Bacteria | 2122 |
| 543 | Ga0307517_10123559 | 3300028786 | Bacteria | 1901 |
| 544 | Ga0307515_10001309 | 3300028794 | Bacteria | 56564 |
| 545 | Ga0307515_10011735 | 3300028794 | Bacteria | 16580 |
| 546 | Ga0307515_10178793 | 3300028794 | Bacteria | 2081 |
| 547 | Ga0265338_10000280 | 3300028800 | Bacteria | 91942 |
| 548 | Ga0265338_10002006 | 3300028800 | Bacteria | 31607 |
| 549 | Ga0265324_10006739 | 3300029957 | Bacteria | 4745 |
| 550 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 551 | Ga0268256_1003747 | 3300030500 | Bacteria | 6672 |
| 552 | Ga0316181_1184579 | 3300030744 | Bacteria | 2553 |
| 553 | Ga0265328_10000046 | 3300031239 | Bacteria | 81288 |
| 554 | Ga0265328_10000374 | 3300031239 | Bacteria | 20850 |
| 555 | Ga0265325_10001237 | 3300031241 | Bacteria | 18224 |
| 556 | Ga0265325_10078699 | 3300031241 | Bacteria | 1642 |
| 557 | Ga0265339_10004888 | 3300031249 | Bacteria | 9039 |
| 558 | Ga0265339_10058837 | 3300031249 | Bacteria | 2074 |
| 559 | Ga0265331_10000005 | 3300031250 | Bacteria | 465192 |
| 560 | Ga0265331_10000710 | 3300031250 | Bacteria | 28344 |
| 561 | Ga0265331_10006726 | 3300031250 | Bacteria | 6740 |
| 562 | Ga0265331_10021328 | 3300031250 | Bacteria | 3317 |
| 563 | Ga0265327_10007316 | 3300031251 | Bacteria | 8557 |
| 564 | Ga0265316_10000099 | 3300031344 | Bacteria | 95020 |
| 565 | Ga0307513_10002506 | 3300031456 | Bacteria | 25411 |
| 566 | Ga0307513_10047620 | 3300031456 | Bacteria | 4661 |
| 567 | Ga0307513_10058104 | 3300031456 | Bacteria | 4114 |
| 568 | Ga0307408_100020170 | 3300031548 | Bacteria | 4494 |
| 569 | Ga0307408_100029929 | 3300031548 | Bacteria | 3777 |
| 570 | Ga0307408_100137872 | 3300031548 | Bacteria | 1911 |
| 571 | Ga0265313_10003964 | 3300031595 | Bacteria | 11628 |
| 572 | Ga0265313_10021233 | 3300031595 | Bacteria | 3556 |
| 573 | Ga0307508_10002027 | 3300031616 | Bacteria | 21969 |
| 574 | Ga0265314_10004906 | 3300031711 | Bacteria | 12225 |
| 575 | Ga0265314_10013928 | 3300031711 | Bacteria | 6469 |
| 576 | Ga0265342_10122872 | 3300031712 | Bacteria | 1460 |
| 577 | Ga0307516_10000075 | 3300031730 | Bacteria | 107790 |
| 578 | Ga0307516_10000405 | 3300031730 | Bacteria | 56495 |
| 579 | Ga0307405_10080332 | 3300031731 | Bacteria | 2128 |
| 580 | Ga0307405_10136541 | 3300031731 | Bacteria | 1703 |
| 581 | Ga0307406_10031537 | 3300031901 | Bacteria | 3228 |
| 582 | Ga0307412_10000012 | 3300031911 | Bacteria | 404180 |
| 583 | Ga0307412_10002385 | 3300031911 | Bacteria | 10434 |
| 584 | Ga0307412_10015694 | 3300031911 | Bacteria | 4496 |
| 585 | Ga0307412_10024561 | 3300031911 | Bacteria | 3721 |
| 586 | Ga0307412_10025707 | 3300031911 | Bacteria | 3650 |
| 587 | Ga0307412_10081056 | 3300031911 | Bacteria | 2243 |
| 588 | Ga0307412_10089214 | 3300031911 | Bacteria | 2152 |
| 589 | Ga0307412_10106867 | 3300031911 | Bacteria | 1990 |
| 590 | Ga0307409_100020314 | 3300031995 | Bacteria | 4523 |
| 591 | Ga0307416_100000010 | 3300032002 | Bacteria | 320243 |
| 592 | Ga0307416_100016318 | 3300032002 | Bacteria | 5158 |
| 593 | Ga0307414_10003589 | 3300032004 | Bacteria | 8306 |
| 594 | Ga0307414_10057339 | 3300032004 | Bacteria | 2737 |
| 595 | Ga0307414_10098008 | 3300032004 | Bacteria | 2198 |
| 596 | Ga0307414_10124383 | 3300032004 | Bacteria | 1989 |
| 597 | Ga0307411_10259531 | 3300032005 | Bacteria | 1371 |
| 598 | Ga0307415_100346861 | 3300032126 | Bacteria | 1248 |
| 599 | Ga0373936_0009423 | 3300035113 | Bacteria | 3681 |
| 600 | Ga0373927_0012559 | 3300035695 | Bacteria | 5640 |
| 601 | Ga0373933_0070230 | 3300035724 | Bacteria | 2130 |
| 602 | Ga0373937_0110950 | 3300036401 | Bacteria | 2551 |
| 603 | Ga0395898_0011345 | 3300037466 | Bacteria | 9259 |
| 604 | Ga0395905_0000022 | 3300037471 | Bacteria | 321527 |
| 605 | Ga0395905_0029458 | 3300037471 | Bacteria | 5172 |
| 606 | Ga0395905_0043737 | 3300037471 | Bacteria | 4201 |
| 607 | Ga0395905_0213062 | 3300037471 | Bacteria | 1809 |
| 608 | Ga0436364_1153948 | 3300037853 | Bacteria | 5332 |
| 609 | Ga0436365_0458255 | 3300039437 | Bacteria | 5602 |
| 610 | Ga0436360_0100021 | 3300039438 | Bacteria | 1846 |
| 611 | Ga0436360_0660683 | 3300039438 | Bacteria | 1335 |
| 612 | Ga0436362_0301465 | 3300039453 | Bacteria | 1820 |
| 613 | Ga0439436_0002588 | 3300041404 | Bacteria | 5446 |
| 614 | Ga0439461_0001983 | 3300041410 | Bacteria | 3235 |
| 615 | Ga0439465_0000135 | 3300041413 | Bacteria | 18045 |
| 616 | Ga0439465_0004120 | 3300041413 | Bacteria | 4729 |
| 617 | Ga0439465_0004263 | 3300041413 | Bacteria | 4651 |
| 618 | Ga0451849_1264891 | 3300041505 | Bacteria | 8051 |
| 619 | Ga0439445_0002086 | 3300042004 | Bacteria | 4426 |
| 620 | Ga0439445_0007629 | 3300042004 | Bacteria | 2517 |
| 621 | Ga0439432_004445 | 3300042006 | Bacteria | 5121 |
| 622 | Ga0439449_0032077 | 3300042007 | Bacteria | 1958 |
| 623 | Ga0439449_0044226 | 3300042007 | Bacteria | 1652 |
| 624 | Ga0439462_0001400 | 3300042015 | Bacteria | 5347 |
| 625 | Ga0450905_008293 | 3300042142 | Bacteria | 1421 |
| 626 | Ga0439434_0000065 | 3300042435 | Bacteria | 25739 |
| 627 | Ga0450918_001885 | 3300042531 | Bacteria | 4056 |
| 628 | Ga0466969_0001849 | 3300044656 | Bacteria | 11316 |
| 629 | Ga0466966_0000273 | 3300044684 | Bacteria | 33831 |
| 630 | Ga0466963_0006909 | 3300044694 | Bacteria | 6751 |
| 631 | Ga0453684_0000062 | 3300044712 | Bacteria | 487590 |
| 632 | Ga0453684_0000071 | 3300044712 | Bacteria | 448904 |
| 633 | Ga0466957_0007115 | 3300044842 | Bacteria | 6328 |
| 634 | Ga0466957_0129265 | 3300044842 | Bacteria | 1617 |
| 635 | Ga0466957_0206626 | 3300044842 | Bacteria | 1292 |
| 636 | Ga0466959_0000621 | 3300045049 | Bacteria | 20577 |
| 637 | Ga0466959_0071675 | 3300045049 | Bacteria | 2509 |
| 638 | Ga0466958_0095231 | 3300045836 | Bacteria | 1845 |
| 639 | Ga0466967_0026329 | 3300045976 | Bacteria | 4816 |
| 640 | Ga0495617_001529 | 3300046452 | Bacteria | 10042 |
| 641 | Ga0495617_015587 | 3300046452 | Bacteria | 2574 |
| 642 | Ga0495627_000003 | 3300046453 | Bacteria | 704557 |
| 643 | Ga0495627_000225 | 3300046453 | Bacteria | 60005 |
| 644 | Ga0495627_000324 | 3300046453 | Bacteria | 46576 |
| 645 | Ga0495627_010260 | 3300046453 | Bacteria | 3412 |
| 646 | Ga0495592_0066709 | 3300046454 | Bacteria | 2633 |
| 647 | Ga0495592_0196937 | 3300046454 | Bacteria | 1362 |
| 648 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 649 | Ga0495650_0000172 | 3300046471 | Bacteria | 142776 |
| 650 | Ga0495650_0003357 | 3300046471 | Bacteria | 11747 |
| 651 | Ga0495605_0001337 | 3300046474 | Bacteria | 16311 |
| 652 | Ga0495662_0048142 | 3300046476 | Bacteria | 2058 |
| 653 | Ga0495664_0157937 | 3300046477 | Bacteria | 1376 |
| 654 | Ga0495584_0022076 | 3300046491 | Bacteria | 3230 |
| 655 | Ga0495584_0046587 | 3300046491 | Bacteria | 2187 |
| 656 | Ga0495585_0006200 | 3300046492 | Bacteria | 7451 |
| 657 | Ga0495585_0015028 | 3300046492 | Bacteria | 4501 |
| 658 | Ga0495596_0005171 | 3300046500 | Bacteria | 6214 |
| 659 | Ga0495607_0080002 | 3300046501 | Bacteria | 1799 |
| 660 | Ga0495583_0001198 | 3300046506 | Bacteria | 27870 |
| 661 | Ga0495583_0001819 | 3300046506 | Bacteria | 20011 |
| 662 | Ga0495583_0002397 | 3300046506 | Bacteria | 16123 |
| 663 | Ga0495583_0012705 | 3300046506 | Bacteria | 4744 |
| 664 | Ga0495583_0029817 | 3300046506 | Bacteria | 2665 |
| 665 | Ga0495583_0033366 | 3300046506 | Bacteria | 2476 |
| 666 | Ga0495606_0002807 | 3300046507 | Bacteria | 19394 |
| 667 | Ga0495606_0013347 | 3300046507 | Bacteria | 6497 |
| 668 | Ga0495606_0032790 | 3300046507 | Bacteria | 3593 |
| 669 | Ga0495606_0067291 | 3300046507 | Bacteria | 2269 |
| 670 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 671 | Ga0495610_0000085 | 3300046512 | Bacteria | 112390 |
| 672 | Ga0495616_0000192 | 3300046513 | Bacteria | 50986 |
| 673 | Ga0495616_0026474 | 3300046513 | Bacteria | 3086 |
| 674 | Ga0495631_0001421 | 3300046518 | Bacteria | 14544 |
| 675 | Ga0495631_0012838 | 3300046518 | Bacteria | 4079 |
| 676 | Ga0495632_0000013 | 3300046519 | Bacteria | 247879 |
| 677 | Ga0495632_0000612 | 3300046519 | Bacteria | 32954 |
| 678 | Ga0495632_0011139 | 3300046519 | Bacteria | 5267 |
| 679 | Ga0495632_0032939 | 3300046519 | Bacteria | 2665 |
| 680 | Ga0495637_0000100 | 3300046520 | Bacteria | 65373 |
| 681 | Ga0495637_0007164 | 3300046520 | Bacteria | 5551 |
| 682 | Ga0495637_0015444 | 3300046520 | Bacteria | 3581 |
| 683 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 684 | Ga0495643_0009885 | 3300046522 | Bacteria | 5897 |
| 685 | Ga0495643_0011121 | 3300046522 | Bacteria | 5501 |
| 686 | Ga0495643_0020159 | 3300046522 | Bacteria | 3850 |
| 687 | Ga0495643_0029986 | 3300046522 | Bacteria | 3041 |
| 688 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 689 | Ga0495648_0000933 | 3300046524 | Bacteria | 30373 |
| 690 | Ga0495648_0000993 | 3300046524 | Bacteria | 29167 |
| 691 | Ga0495648_0051791 | 3300046524 | Bacteria | 2498 |
| 692 | Ga0495648_0077423 | 3300046524 | Bacteria | 1906 |
| 693 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 694 | Ga0495663_0000010 | 3300046525 | Bacteria | 161009 |
| 695 | Ga0495663_0004862 | 3300046525 | Bacteria | 3754 |
| 696 | Ga0495663_0007071 | 3300046525 | Bacteria | 3098 |
| 697 | Ga0495642_0035268 | 3300046528 | Bacteria | 2018 |
| 698 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 699 | Ga0495654_0000224 | 3300046530 | Bacteria | 52709 |
| 700 | Ga0495654_0092421 | 3300046530 | Bacteria | 1402 |
| 701 | Ga0495654_0108064 | 3300046530 | Bacteria | 1272 |
| 702 | Ga0495609_0020647 | 3300046538 | Bacteria | 3042 |
| 703 | Ga0495609_0044694 | 3300046538 | Bacteria | 1986 |
| 704 | Ga0495597_0067954 | 3300046542 | Bacteria | 1541 |
| 705 | Ga0495622_0004872 | 3300046557 | Bacteria | 6215 |
| 706 | Ga0495633_0000008 | 3300046558 | Bacteria | 301830 |
| 707 | Ga0495633_0000092 | 3300046558 | Bacteria | 121446 |
| 708 | Ga0495633_0001757 | 3300046558 | Bacteria | 16080 |
| 709 | Ga0495633_0003754 | 3300046558 | Bacteria | 9986 |
| 710 | Ga0495633_0004038 | 3300046558 | Bacteria | 9495 |
| 711 | Ga0495633_0005139 | 3300046558 | Bacteria | 8110 |
| 712 | Ga0495633_0006121 | 3300046558 | Bacteria | 7204 |
| 713 | Ga0495633_0018058 | 3300046558 | Bacteria | 3588 |
| 714 | Ga0495633_0020674 | 3300046558 | Bacteria | 3306 |
| 715 | Ga0495633_0023728 | 3300046558 | Bacteria | 3037 |
| 716 | Ga0495633_0050884 | 3300046558 | Bacteria | 1952 |
| 717 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 718 | Ga0495668_0000080 | 3300046616 | Bacteria | 157259 |
| 719 | Ga0495668_0001200 | 3300046616 | Bacteria | 26319 |
| 720 | Ga0495668_0015691 | 3300046616 | Bacteria | 4416 |
| 721 | Ga0495668_0017970 | 3300046616 | Bacteria | 4093 |
| 722 | Ga0495668_0040440 | 3300046616 | Bacteria | 2600 |
| 723 | Ga0495668_0063372 | 3300046616 | Bacteria | 2036 |
| 724 | Ga0495668_0068429 | 3300046616 | Bacteria | 1953 |
| 725 | Ga0495668_0143433 | 3300046616 | Bacteria | 1307 |
| 726 | Ga0495625_0000621 | 3300046660 | Bacteria | 51568 |
| 727 | Ga0495625_0000727 | 3300046660 | Bacteria | 46264 |
| 728 | Ga0495625_0001091 | 3300046660 | Bacteria | 35271 |
| 729 | Ga0495625_0010254 | 3300046660 | Bacteria | 7769 |
| 730 | Ga0495625_0039111 | 3300046660 | Bacteria | 3466 |
| 731 | Ga0495625_0039189 | 3300046660 | Bacteria | 3462 |
| 732 | Ga0495588_0001528 | 3300046674 | Bacteria | 9899 |
| 733 | Ga0495588_0023967 | 3300046674 | Bacteria | 3028 |
| 734 | Ga0495588_0047113 | 3300046674 | Bacteria | 2213 |
| 735 | Ga0495588_0095861 | 3300046674 | Bacteria | 1556 |
| 736 | Ga0495669_0000214 | 3300046684 | Bacteria | 34972 |
| 737 | Ga0495669_0007253 | 3300046684 | Bacteria | 4645 |
| 738 | Ga0495670_0000005 | 3300046691 | Bacteria | 289725 |
| 739 | Ga0495670_0010251 | 3300046691 | Bacteria | 4604 |
| 740 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 741 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 742 | Ga0495671_0046736 | 3300046692 | Bacteria | 2164 |
| 743 | Ga0495671_0160411 | 3300046692 | Bacteria | 1094 |
| 744 | Ga0495649_0039161 | 3300046694 | Bacteria | 2599 |
| 745 | Ga0495649_0058484 | 3300046694 | Bacteria | 2077 |
| 746 | Ga0495600_0012916 | 3300046809 | Bacteria | 5234 |
| 747 | Ga0495660_0021376 | 3300046810 | Bacteria | 3706 |
| 748 | Ga0495672_0032885 | 3300047320 | Bacteria | 3219 |
| 749 | Ga0495687_001639 | 3300047443 | Bacteria | 20146 |
| 750 | Ga0495687_006734 | 3300047443 | Bacteria | 6956 |
| 751 | Ga0495677_0006070 | 3300047445 | Bacteria | 4567 |
| 752 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 753 | Ga0495673_0009404 | 3300047469 | Bacteria | 5410 |
| 754 | Ga0495681_0000013 | 3300047470 | Bacteria | 189155 |
| 755 | Ga0495681_0000725 | 3300047470 | Bacteria | 25287 |
| 756 | Ga0495681_0008616 | 3300047470 | Bacteria | 6369 |
| 757 | Ga0495681_0010003 | 3300047470 | Bacteria | 5778 |
| 758 | Ga0495686_0000416 | 3300047472 | Bacteria | 67601 |
| 759 | Ga0495686_0000701 | 3300047472 | Bacteria | 45238 |
| 760 | Ga0495686_0009517 | 3300047472 | Bacteria | 6991 |
| 761 | Ga0495686_0019667 | 3300047472 | Bacteria | 4510 |
| 762 | Ga0495686_0020937 | 3300047472 | Bacteria | 4355 |
| 763 | Ga0495686_0051336 | 3300047472 | Bacteria | 2588 |
| 764 | Ga0495686_0054829 | 3300047472 | Bacteria | 2495 |
| 765 | Ga0495602_0124838 | 3300048088 | Bacteria | 2064 |
| 766 | Ga0496101_0040605 | 3300048904 | Bacteria | 3314 |
| 767 | Ga0496101_0061414 | 3300048904 | Bacteria | 2729 |
| 768 | Ga0496102_0000213 | 3300048905 | Bacteria | 76751 |
| 769 | Ga0496102_0062782 | 3300048905 | Bacteria | 3402 |
| 770 | Ga0496102_0173771 | 3300048905 | Bacteria | 2028 |
| 771 | Ga0496102_0213611 | 3300048905 | Bacteria | 1819 |
| 772 | Ga0496103_0000782 | 3300048906 | Bacteria | 23417 |
| 773 | Ga0496104_0012047 | 3300048907 | Bacteria | 7762 |
| 774 | Ga0496104_0023140 | 3300048907 | Bacteria | 5712 |
| 775 | Ga0496104_0031887 | 3300048907 | Bacteria | 4903 |
| 776 | Ga0496104_0174409 | 3300048907 | Bacteria | 2060 |
| 777 | Ga0496106_0022487 | 3300048909 | Bacteria | 4685 |
| 778 | Ga0496108_0003150 | 3300048911 | Bacteria | 13268 |
| 779 | Ga0496108_0003651 | 3300048911 | Bacteria | 12345 |
| 780 | Ga0496108_0166028 | 3300048911 | Bacteria | 1909 |
| 781 | Ga0496109_0014694 | 3300048912 | Bacteria | 6814 |
| 782 | Ga0496109_0181853 | 3300048912 | Bacteria | 1975 |
| 783 | Ga0496110_0091815 | 3300048913 | Bacteria | 2717 |
| 784 | Ga0496110_0189422 | 3300048913 | Bacteria | 1868 |
| 785 | Ga0496110_0383103 | 3300048913 | Bacteria | 1281 |
| 786 | Ga0496111_0128100 | 3300048914 | Bacteria | 1877 |
| 787 | Ga0496112_0029831 | 3300048915 | Bacteria | 5277 |
| 788 | Ga0496112_0088648 | 3300048915 | Bacteria | 3062 |
| 789 | Ga0496113_0038568 | 3300048916 | Bacteria | 3514 |
| 790 | Ga0496114_0001667 | 3300048917 | Bacteria | 16851 |
| 791 | Ga0496114_0025240 | 3300048917 | Bacteria | 4857 |
| 792 | Ga0496114_0174339 | 3300048917 | Bacteria | 1876 |
| 793 | Ga0496115_0000785 | 3300048918 | Bacteria | 23300 |
| 794 | Ga0496115_0005734 | 3300048918 | Bacteria | 9040 |
| 795 | Ga0496116_0000053 | 3300048919 | Bacteria | 291837 |
| 796 | Ga0496116_0006359 | 3300048919 | Bacteria | 10745 |
| 797 | Ga0496116_0073291 | 3300048919 | Bacteria | 2160 |
| 798 | Ga0496116_0092699 | 3300048919 | Bacteria | 1831 |
| 799 | Ga0496117_0000066 | 3300048920 | Bacteria | 253534 |
| 800 | Ga0496117_0000089 | 3300048920 | Bacteria | 210551 |
| 801 | Ga0496117_0002444 | 3300048920 | Bacteria | 23397 |
| 802 | Ga0496117_0006220 | 3300048920 | Bacteria | 12173 |
| 803 | Ga0496117_0066710 | 3300048920 | Bacteria | 2439 |
| 804 | Ga0496117_0114070 | 3300048920 | Bacteria | 1676 |
| 805 | Ga0496118_0000207 | 3300048921 | Bacteria | 102753 |
| 806 | Ga0496118_0000221 | 3300048921 | Bacteria | 99682 |
| 807 | Ga0496118_0007705 | 3300048921 | Bacteria | 11319 |
| 808 | Ga0496118_0018005 | 3300048921 | Bacteria | 6399 |
| 809 | Ga0496118_0021302 | 3300048921 | Bacteria | 5712 |
| 810 | Ga0496119_0000038 | 3300048922 | Bacteria | 209546 |
| 811 | Ga0496119_0006920 | 3300048922 | Bacteria | 10344 |
| 812 | Ga0496119_0012665 | 3300048922 | Bacteria | 6825 |
| 813 | Ga0496119_0022050 | 3300048922 | Bacteria | 4577 |
| 814 | Ga0496119_0050725 | 3300048922 | Bacteria | 2555 |
| 815 | Ga0496119_0087073 | 3300048922 | Bacteria | 1783 |
| 816 | Ga0496120_0000100 | 3300048923 | Bacteria | 143064 |
| 817 | Ga0496120_0014878 | 3300048923 | Bacteria | 5159 |
| 818 | Ga0496120_0073387 | 3300048923 | Bacteria | 1873 |
| 819 | Ga0496121_0000542 | 3300048924 | Bacteria | 71767 |
| 820 | Ga0496121_0002040 | 3300048924 | Bacteria | 31978 |
| 821 | Ga0496121_0002349 | 3300048924 | Bacteria | 29176 |
| 822 | Ga0496121_0010693 | 3300048924 | Bacteria | 10299 |
| 823 | Ga0496121_0013808 | 3300048924 | Bacteria | 8645 |
| 824 | Ga0496121_0034219 | 3300048924 | Bacteria | 4577 |
| 825 | Ga0496121_0049074 | 3300048924 | Bacteria | 3584 |
| 826 | Ga0496122_0000057 | 3300048925 | Bacteria | 253452 |
| 827 | Ga0496122_0000109 | 3300048925 | Bacteria | 190828 |
| 828 | Ga0496122_0000118 | 3300048925 | Bacteria | 182789 |
| 829 | Ga0496122_0000700 | 3300048925 | Bacteria | 66410 |
| 830 | Ga0496122_0003899 | 3300048925 | Bacteria | 19105 |
| 831 | Ga0496122_0003976 | 3300048925 | Bacteria | 18866 |
| 832 | Ga0496122_0009972 | 3300048925 | Bacteria | 9892 |
| 833 | Ga0496122_0010527 | 3300048925 | Bacteria | 9507 |
| 834 | Ga0496122_0029086 | 3300048925 | Bacteria | 4671 |
| 835 | Ga0496122_0033274 | 3300048925 | Bacteria | 4244 |
| 836 | Ga0496122_0103514 | 3300048925 | Bacteria | 1894 |
| 837 | Ga0496122_0122712 | 3300048925 | Bacteria | 1671 |
| 838 | Ga0496123_0000096 | 3300048926 | Bacteria | 173914 |
| 839 | Ga0496123_0000930 | 3300048926 | Bacteria | 45779 |
| 840 | Ga0496123_0005631 | 3300048926 | Bacteria | 12506 |
| 841 | Ga0496123_0007098 | 3300048926 | Bacteria | 10645 |
| 842 | Ga0496123_0007161 | 3300048926 | Bacteria | 10587 |
| 843 | Ga0496123_0010458 | 3300048926 | Bacteria | 8199 |
| 844 | Ga0496123_0011663 | 3300048926 | Bacteria | 7586 |
| 845 | Ga0496123_0063861 | 3300048926 | Bacteria | 2349 |
| 846 | Ga0496123_0159903 | 3300048926 | Bacteria | 1202 |
| 847 | Ga0496124_0001031 | 3300048927 | Bacteria | 44122 |
| 848 | Ga0496124_0012788 | 3300048927 | Bacteria | 8247 |
| 849 | Ga0496124_0019580 | 3300048927 | Bacteria | 6290 |
| 850 | Ga0496124_0039779 | 3300048927 | Bacteria | 4072 |
| 851 | Ga0496125_0000145 | 3300048928 | Bacteria | 156267 |
| 852 | Ga0496125_0000547 | 3300048928 | Bacteria | 64865 |
| 853 | Ga0496125_0002742 | 3300048928 | Bacteria | 22289 |
| 854 | Ga0496125_0003355 | 3300048928 | Bacteria | 19500 |
| 855 | Ga0496125_0024786 | 3300048928 | Bacteria | 5507 |
| 856 | Ga0496125_0032349 | 3300048928 | Bacteria | 4647 |
| 857 | Ga0496125_0033622 | 3300048928 | Bacteria | 4534 |
| 858 | Ga0496125_0047287 | 3300048928 | Bacteria | 3600 |
| 859 | Ga0496126_0001041 | 3300048929 | Bacteria | 46865 |
| 860 | Ga0496126_0002687 | 3300048929 | Bacteria | 23498 |
| 861 | Ga0496126_0003357 | 3300048929 | Bacteria | 20298 |
| 862 | Ga0496126_0012770 | 3300048929 | Bacteria | 8585 |
| 863 | Ga0496126_0021273 | 3300048929 | Bacteria | 6339 |
| 864 | Ga0496126_0034512 | 3300048929 | Bacteria | 4751 |
| 865 | Ga0496126_0050780 | 3300048929 | Bacteria | 3778 |
| 866 | Ga0496126_0085797 | 3300048929 | Bacteria | 2775 |
| 867 | Ga0495678_007036 | 3300049459 | Bacteria | 5895 |
| 868 | Ga0495678_023424 | 3300049459 | Bacteria | 2683 |
| 869 | Ga0501290_000012 | 3300049513 | Bacteria | 28888 |
| 870 | Ga0501292_000043 | 3300049515 | Bacteria | 28998 |
| 871 | Ga0501300_000322 | 3300049523 | Bacteria | 7249 |
| 872 | Ga0501031_0003517 | 3300049568 | Bacteria | 10051 |
| 873 | Ga0501032_0002875 | 3300049569 | Bacteria | 13394 |
| 874 | Ga0501032_0016935 | 3300049569 | Bacteria | 5122 |
| 875 | Ga0501032_0049585 | 3300049569 | Bacteria | 2832 |
| 876 | Ga0501032_0072177 | 3300049569 | Bacteria | 2301 |
| 877 | Ga0501032_0087427 | 3300049569 | Bacteria | 2070 |
| 878 | Ga0501033_0008378 | 3300049570 | Bacteria | 8007 |
| 879 | Ga0501033_0009071 | 3300049570 | Bacteria | 7673 |
| 880 | Ga0501033_0015281 | 3300049570 | Bacteria | 5823 |
| 881 | Ga0501033_0016189 | 3300049570 | Bacteria | 5646 |
| 882 | Ga0501033_0017174 | 3300049570 | Bacteria | 5468 |
| 883 | Ga0501033_0050570 | 3300049570 | Bacteria | 3082 |
| 884 | Ga0501033_0052332 | 3300049570 | Bacteria | 3026 |
| 885 | Ga0501033_0055294 | 3300049570 | Bacteria | 2935 |
| 886 | Ga0501033_0299043 | 3300049570 | Bacteria | 1133 |
| 887 | Ga0501034_0000413 | 3300049571 | Bacteria | 71861 |
| 888 | Ga0501034_0006169 | 3300049571 | Bacteria | 12922 |
| 889 | Ga0501034_0009021 | 3300049571 | Bacteria | 10474 |
| 890 | Ga0501034_0037717 | 3300049571 | Bacteria | 4895 |
| 891 | Ga0501034_0049702 | 3300049571 | Bacteria | 4231 |
| 892 | Ga0501034_0060477 | 3300049571 | Bacteria | 3805 |
| 893 | Ga0501034_0134285 | 3300049571 | Bacteria | 2456 |
| 894 | Ga0501034_0209105 | 3300049571 | Bacteria | 1907 |
| 895 | Ga0501034_0211938 | 3300049571 | Bacteria | 1892 |
| 896 | Ga0501036_0001251 | 3300049572 | Bacteria | 19465 |
| 897 | Ga0501036_0017675 | 3300049572 | Bacteria | 5967 |
| 898 | Ga0501036_0027231 | 3300049572 | Bacteria | 4829 |
| 899 | Ga0501036_0041128 | 3300049572 | Bacteria | 3912 |
| 900 | Ga0501036_0126744 | 3300049572 | Bacteria | 2156 |
| 901 | Ga0501037_0003285 | 3300049573 | Bacteria | 11744 |
| 902 | Ga0501037_0011305 | 3300049573 | Bacteria | 6570 |
| 903 | Ga0501037_0069024 | 3300049573 | Bacteria | 2573 |
| 904 | Ga0501037_0167128 | 3300049573 | Bacteria | 1566 |
| 905 | Ga0501038_0002993 | 3300049574 | Bacteria | 15751 |
| 906 | Ga0501038_0059869 | 3300049574 | Bacteria | 3260 |
| 907 | Ga0501038_0208230 | 3300049574 | Bacteria | 1566 |
| 908 | Ga0501038_0225527 | 3300049574 | Bacteria | 1493 |
| 909 | Ga0501038_0308854 | 3300049574 | Bacteria | 1239 |
| 910 | Ga0501039_0005059 | 3300049575 | Bacteria | 9996 |
| 911 | Ga0501039_0022121 | 3300049575 | Bacteria | 4879 |
| 912 | Ga0501039_0030137 | 3300049575 | Bacteria | 4182 |
| 913 | Ga0501039_0128969 | 3300049575 | Bacteria | 1984 |
| 914 | Ga0501039_0203291 | 3300049575 | Bacteria | 1557 |
| 915 | Ga0501042_0006147 | 3300049578 | Bacteria | 7785 |
| 916 | Ga0501042_0015292 | 3300049578 | Bacteria | 5253 |
| 917 | Ga0501043_0014567 | 3300049579 | Bacteria | 6157 |
| 918 | Ga0501043_0021795 | 3300049579 | Bacteria | 5024 |
| 919 | Ga0501043_0045792 | 3300049579 | Bacteria | 3439 |
| 920 | Ga0501043_0058613 | 3300049579 | Bacteria | 3022 |
| 921 | Ga0501043_0092094 | 3300049579 | Bacteria | 2383 |
| 922 | Ga0501043_0128969 | 3300049579 | Bacteria | 1982 |
| 923 | Ga0501046_0000035 | 3300049580 | Bacteria | 161495 |
| 924 | Ga0501046_0001206 | 3300049580 | Bacteria | 25105 |
| 925 | Ga0501046_0036342 | 3300049580 | Bacteria | 3964 |
| 926 | Ga0501046_0088409 | 3300049580 | Bacteria | 2386 |
| 927 | Ga0501047_0007678 | 3300049581 | Bacteria | 10159 |
| 928 | Ga0501047_0012927 | 3300049581 | Bacteria | 7906 |
| 929 | Ga0501047_0027525 | 3300049581 | Bacteria | 5477 |
| 930 | Ga0501047_0056294 | 3300049581 | Bacteria | 3802 |
| 931 | Ga0501047_0153398 | 3300049581 | Bacteria | 2178 |
| 932 | Ga0501047_0156664 | 3300049581 | Bacteria | 2151 |
| 933 | Ga0501047_0189155 | 3300049581 | Bacteria | 1923 |
| 934 | Ga0501048_0002015 | 3300049582 | Bacteria | 15430 |
| 935 | Ga0501048_0008779 | 3300049582 | Bacteria | 7616 |
| 936 | Ga0501048_0175560 | 3300049582 | Bacteria | 1518 |
| 937 | Ga0501067_0000260 | 3300049583 | Bacteria | 28874 |
| 938 | Ga0501067_0006624 | 3300049583 | Bacteria | 6425 |
| 939 | Ga0501068_0007179 | 3300049584 | Bacteria | 6171 |
| 940 | Ga0501068_0066584 | 3300049584 | Bacteria | 2194 |
| 941 | Ga0501069_0002372 | 3300049585 | Bacteria | 9550 |
| 942 | Ga0501069_0025616 | 3300049585 | Bacteria | 3225 |
| 943 | Ga0501070_0007427 | 3300049586 | Bacteria | 9306 |
| 944 | Ga0501070_0106630 | 3300049586 | Bacteria | 2316 |
| 945 | Ga0501070_0181658 | 3300049586 | Bacteria | 1731 |
| 946 | Ga0501071_0087456 | 3300049587 | Bacteria | 2286 |
| 947 | Ga0501072_0025799 | 3300049588 | Bacteria | 4579 |
| 948 | Ga0501072_0216776 | 3300049588 | Bacteria | 1525 |
| 949 | Ga0501073_0007949 | 3300049589 | Bacteria | 7870 |
| 950 | Ga0501073_0061825 | 3300049589 | Bacteria | 2612 |
| 951 | Ga0501076_0187738 | 3300049592 | Bacteria | 1686 |
| 952 | Ga0501206_000178 | 3300049653 | Bacteria | 7066 |
| 953 | Ga0501222_000195 | 3300049662 | Bacteria | 10908 |
| 954 | Ga0501223_000008 | 3300049663 | Bacteria | 117828 |
| 955 | Ga0501223_000033 | 3300049663 | Bacteria | 49156 |
| 956 | Ga0501223_001464 | 3300049663 | Bacteria | 5463 |
| 957 | Ga0501224_000026 | 3300049664 | Bacteria | 54620 |
| 958 | Ga0501224_000252 | 3300049664 | Bacteria | 6122 |
| 959 | Ga0501233_000479 | 3300049668 | Bacteria | 6377 |
| 960 | Ga0501235_012715 | 3300049669 | Bacteria | 1852 |
| 961 | Ga0501249_000111 | 3300049679 | Bacteria | 25221 |
| 962 | Ga0501259_000261 | 3300049688 | Bacteria | 8281 |
| 963 | Ga0501261_000028 | 3300049690 | Bacteria | 32508 |
| 964 | Ga0501221_012623 | 3300049704 | Bacteria | 1540 |
| 965 | Ga0501225_0000018 | 3300049705 | Bacteria | 59791 |
| 966 | Ga0501225_0000046 | 3300049705 | Bacteria | 41537 |
| 967 | Ga0501225_0000335 | 3300049705 | Bacteria | 14740 |
| 968 | Ga0501225_0020238 | 3300049705 | Bacteria | 1840 |
| 969 | Ga0501079_0024088 | 3300049741 | Bacteria | 4670 |
| 970 | Ga0501080_0009913 | 3300049742 | Bacteria | 8704 |
| 971 | Ga0501080_0146125 | 3300049742 | Bacteria | 2185 |
| 972 | Ga0501083_0016907 | 3300049744 | Bacteria | 5095 |
| 973 | Ga0501241_000019 | 3300049758 | Bacteria | 88612 |
| 974 | Ga0501241_000189 | 3300049758 | Bacteria | 13925 |
| 975 | Ga0501279_000030 | 3300049775 | Bacteria | 37693 |
| 976 | Ga0501280_000040 | 3300049776 | Bacteria | 38251 |
| 977 | Ga0501281_00088 | 3300049777 | Bacteria | 10781 |
| 978 | Ga0501282_000136 | 3300049778 | Bacteria | 8648 |
| 979 | Ga0501283_000528 | 3300049779 | Bacteria | 5020 |
| 980 | Ga0501035_0005333 | 3300049822 | Bacteria | 12163 |
| 981 | Ga0501035_0012722 | 3300049822 | Bacteria | 7777 |
| 982 | Ga0501035_0017828 | 3300049822 | Bacteria | 6548 |
| 983 | Ga0501035_0034127 | 3300049822 | Bacteria | 4624 |
| 984 | Ga0501035_0101787 | 3300049822 | Bacteria | 2521 |
| 985 | Ga0501035_0136614 | 3300049822 | Bacteria | 2134 |
| 986 | Ga0501035_0175436 | 3300049822 | Bacteria | 1849 |
| 987 | Ga0501035_0181510 | 3300049822 | Bacteria | 1813 |
| 988 | Ga0501044_0002233 | 3300049823 | Bacteria | 22166 |
| 989 | Ga0501044_0007604 | 3300049823 | Bacteria | 11913 |
| 990 | Ga0501044_0027397 | 3300049823 | Bacteria | 6023 |
| 991 | Ga0501044_0052375 | 3300049823 | Bacteria | 4206 |
| 992 | Ga0501044_0056167 | 3300049823 | Bacteria | 4042 |
| 993 | Ga0501044_0095863 | 3300049823 | Bacteria | 2989 |
| 994 | Ga0501044_0106881 | 3300049823 | Bacteria | 2810 |
| 995 | Ga0501044_0204246 | 3300049823 | Bacteria | 1933 |
| 996 | Ga0501044_0239057 | 3300049823 | Bacteria | 1760 |
| 997 | Ga0501044_0384524 | 3300049823 | Bacteria | 1318 |
| 998 | Ga0501045_0035107 | 3300049824 | Bacteria | 3640 |
| 999 | Ga0501226_000066 | 3300049853 | Bacteria | 34204 |
| 1000 | nmdc:mga03683_113_c1 | 3300050489 | Bacteria | 27805 |
| 1001 | nmdc:mga03n38_2972_c1 | 3300050490 | Bacteria | 5359 |
| 1002 | nmdc:mga03n38_3514_c1 | 3300050490 | Bacteria | 5049 |
| 1003 | nmdc:mga00v17_128953_c1 | 3300050491 | Bacteria | 1615 |
| 1004 | nmdc:mga00v17_17_c1 | 3300050491 | Bacteria | 121949 |
| 1005 | nmdc:mga00v17_47940_c1 | 3300050491 | Bacteria | 2589 |
| 1006 | nmdc:mga0k408_38443_c1 | 3300050493 | Bacteria | 2746 |
| 1007 | nmdc:mga0k408_9_c2 | 3300050493 | Bacteria | 64937 |
| 1008 | nmdc:mga06z11_134103_c1 | 3300050494 | Bacteria | 1394 |
| 1009 | nmdc:mga06z11_136_c1 | 3300050494 | Bacteria | 29270 |
| 1010 | nmdc:mga06z11_601_c1 | 3300050494 | Bacteria | 13143 |
| 1011 | nmdc:mga06z11_7485_c1 | 3300050494 | Bacteria | 4496 |
| 1012 | nmdc:mga04h51_18_c1 | 3300050495 | Bacteria | 74460 |
| 1013 | nmdc:mga04h51_22235_c1 | 3300050495 | Bacteria | 1917 |
| 1014 | nmdc:mga04h51_2380_c1 | 3300050495 | Bacteria | 4456 |
| 1015 | nmdc:mga04h51_26340_c1 | 3300050495 | Bacteria | 1797 |
| 1016 | nmdc:mga07m45_13_c1 | 3300050496 | Bacteria | 65600 |
| 1017 | nmdc:mga07m45_391_c1 | 3300050496 | Bacteria | 18042 |
| 1018 | nmdc:mga0sz30_121_c1 | 3300050516 | Bacteria | 29087 |
| 1019 | nmdc:mga0sz30_24246_c1 | 3300050516 | Bacteria | 2474 |
| 1020 | nmdc:mga0sz30_253_c2 | 3300050516 | Bacteria | 8672 |
| 1021 | Ga0500610_0000034 | 3300053079 | Bacteria | 49152 |
| 1022 | Ga0500610_0013892 | 3300053079 | Bacteria | 3762 |
| 1023 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 1024 | Ga0500643_000577 | 3300053087 | Bacteria | 25463 |
| 1025 | Ga0500643_001255 | 3300053087 | Bacteria | 15032 |
| 1026 | Ga0500643_005656 | 3300053087 | Bacteria | 5346 |
| 1027 | Ga0500643_030126 | 3300053087 | Bacteria | 1664 |
| 1028 | Ga0500647_0011154 | 3300053091 | Bacteria | 4001 |
| 1029 | Ga0500647_0014081 | 3300053091 | Bacteria | 3630 |
| 1030 | Ga0500651_0003100 | 3300053093 | Bacteria | 9004 |
| 1031 | Ga0500566_0000771 | 3300053094 | Bacteria | 18098 |
| 1032 | Ga0500566_0008535 | 3300053094 | Bacteria | 6058 |
| 1033 | Ga0500641_0014493 | 3300053096 | Bacteria | 2911 |
| 1034 | Ga0500560_000810 | 3300053107 | Bacteria | 4814 |
| 1035 | Ga0500560_001662 | 3300053107 | Bacteria | 3964 |
| 1036 | Ga0500569_018439 | 3300053109 | Bacteria | 1802 |
| 1037 | Ga0500572_016322 | 3300053111 | Bacteria | 1889 |
| 1038 | Ga0500592_000077 | 3300053116 | Bacteria | 24748 |
| 1039 | Ga0500592_000537 | 3300053116 | Bacteria | 6266 |
| 1040 | Ga0500595_001745 | 3300053119 | Bacteria | 11341 |
| 1041 | Ga0500607_000098 | 3300053121 | Bacteria | 65919 |
| 1042 | Ga0500614_001221 | 3300053123 | Bacteria | 6255 |
| 1043 | Ga0500618_004495 | 3300053125 | Bacteria | 4430 |
| 1044 | Ga0500652_000014 | 3300053131 | Bacteria | 147740 |
| 1045 | Ga0500655_000307 | 3300053133 | Bacteria | 11138 |
| 1046 | Ga0500559_0012414 | 3300053136 | Bacteria | 3621 |
| 1047 | Ga0500559_0099150 | 3300053136 | Bacteria | 1341 |
| 1048 | Ga0500559_0116722 | 3300053136 | Bacteria | 1239 |
| 1049 | Ga0500561_0000278 | 3300053137 | Bacteria | 8944 |
| 1050 | Ga0500568_0000872 | 3300053139 | Bacteria | 21157 |
| 1051 | Ga0500568_0014517 | 3300053139 | Bacteria | 3554 |
| 1052 | Ga0500568_0067331 | 3300053139 | Bacteria | 1376 |
| 1053 | Ga0500573_0000015 | 3300053140 | Bacteria | 192264 |
| 1054 | Ga0500573_0000037 | 3300053140 | Bacteria | 107603 |
| 1055 | Ga0500590_000114 | 3300053148 | Bacteria | 21825 |
| 1056 | Ga0500590_000841 | 3300053148 | Bacteria | 11538 |
| 1057 | Ga0500590_002695 | 3300053148 | Bacteria | 7983 |
| 1058 | Ga0500604_0001472 | 3300053151 | Bacteria | 6574 |
| 1059 | Ga0500622_0001565 | 3300053156 | Bacteria | 18093 |
| 1060 | Ga0500624_000003 | 3300053157 | Bacteria | 253364 |
| 1061 | Ga0500624_000011 | 3300053157 | Bacteria | 168125 |
| 1062 | Ga0500624_000443 | 3300053157 | Bacteria | 12488 |
| 1063 | Ga0500627_0000043 | 3300053158 | Bacteria | 65441 |
| 1064 | Ga0500627_0000278 | 3300053158 | Bacteria | 14608 |
| 1065 | Ga0500627_0002274 | 3300053158 | Bacteria | 5642 |
| 1066 | Ga0500627_0012802 | 3300053158 | Bacteria | 3157 |
| 1067 | Ga0500627_0029037 | 3300053158 | Bacteria | 2303 |
| 1068 | Ga0500634_0008457 | 3300053161 | Bacteria | 5147 |
| 1069 | Ga0500636_0006352 | 3300053177 | Bacteria | 6782 |
| 1070 | Ga0500636_0012009 | 3300053177 | Bacteria | 5073 |
| 1071 | Ga0500636_0085951 | 3300053177 | Bacteria | 1807 |
| 1072 | Ga0500637_0000045 | 3300053178 | Bacteria | 44699 |
| 1073 | Ga0500637_0089187 | 3300053178 | Bacteria | 1785 |
| 1074 | Ga0500570_000053 | 3300053724 | Bacteria | 28643 |
| 1075 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 1076 | Ga0500645_011886 | 3300053730 | Bacteria | 2828 |
| 1077 | Ga0500645_034139 | 3300053730 | Bacteria | 1519 |
| 1078 | Ga0500596_002101 | 3300053735 | Bacteria | 3966 |
| 1079 | Ga0501084_0009365 | 3300054114 | Bacteria | 8103 |
| 1080 | Ga0501084_0052635 | 3300054114 | Bacteria | 3406 |
| 1081 | Ga0500661_000046 | 3300055283 | Bacteria | 18860 |
| 1082 | Ga0501082_0001610 | 3300060353 | Bacteria | 19885 |
| 1083 | Ga0501082_0032979 | 3300060353 | Bacteria | 4466 |
| 1084 | Ga0501082_0060202 | 3300060353 | Bacteria | 3271 |
| 1085 | Ga0466962_0014907 | 3300061719 | Bacteria | 3746 |
| 1086 | Ga0466962_0039032 | 3300061719 | Bacteria | 2274 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0128969 | Ga0501039_0128969_997_1935 | 300 |
| 2 | 3300025921 | Ga0207652_10088169 | Ga0207652_100881691 | 302 |
| 3 | 3300053730 | Ga0500645_034139 | Ga0500645_034139_540_1502 | 318 |
| 4 | 3300048925 | Ga0496122_0122712 | Ga0496122_0122712_498_1499 | 322 |
| 5 | 3300049570 | Ga0501033_0299043 | Ga0501033_0299043_37_1023 | 326 |
| 6 | 3300039438 | Ga0436360_0660683 | Ga0436360_0660683_23_1039 | 329 |
| 7 | 3300046522 | Ga0495643_0009885 | Ga0495643_0009885_2467_3456 | 329 |
| 8 | 3300005289 | Ga0065704_10073124 | Ga0065704_100731243 | 332 |
| 9 | 3300054114 | Ga0501084_0052635 | Ga0501084_0052635_1472_2488 | 332 |
| 10 | 3300005530 | Ga0070679_100135681 | Ga0070679_1001356813 | 335 |
| 11 | 3300049569 | Ga0501032_0002875 | Ga0501032_0002875_8085_9215 | 335 |
| 12 | 3300049570 | Ga0501033_0015281 | Ga0501033_0015281_1665_2795 | 335 |
| 13 | 3300049571 | Ga0501034_0006169 | Ga0501034_0006169_5615_6745 | 335 |
| 14 | 3300049572 | Ga0501036_0001251 | Ga0501036_0001251_8027_9157 | 335 |
| 15 | 3300049573 | Ga0501037_0003285 | Ga0501037_0003285_6775_7905 | 335 |
| 16 | 3300049575 | Ga0501039_0005059 | Ga0501039_0005059_4824_5954 | 335 |
| 17 | 3300049578 | Ga0501042_0006147 | Ga0501042_0006147_4383_5513 | 335 |
| 18 | 3300049579 | Ga0501043_0045792 | Ga0501043_0045792_517_1647 | 335 |
| 19 | 3300049580 | Ga0501046_0001206 | Ga0501046_0001206_11680_12810 | 335 |
| 20 | 3300049581 | Ga0501047_0007678 | Ga0501047_0007678_3029_4159 | 335 |
| 21 | 3300049582 | Ga0501048_0008779 | Ga0501048_0008779_5158_6288 | 335 |
| 22 | 3300049583 | Ga0501067_0000260 | Ga0501067_0000260_15965_17095 | 335 |
| 23 | 3300049584 | Ga0501068_0066584 | Ga0501068_0066584_967_2097 | 335 |
| 24 | 3300049585 | Ga0501069_0002372 | Ga0501069_0002372_5318_6448 | 335 |
| 25 | 3300049586 | Ga0501070_0007427 | Ga0501070_0007427_8086_9216 | 335 |
| 26 | 3300049588 | Ga0501072_0216776 | Ga0501072_0216776_97_1227 | 335 |
| 27 | 3300049589 | Ga0501073_0061825 | Ga0501073_0061825_1179_2309 | 335 |
| 28 | 3300049741 | Ga0501079_0024088 | Ga0501079_0024088_2832_3962 | 335 |
| 29 | 3300049742 | Ga0501080_0009913 | Ga0501080_0009913_4418_5548 | 335 |
| 30 | 3300049822 | Ga0501035_0017828 | Ga0501035_0017828_4240_5370 | 335 |
| 31 | 3300054114 | Ga0501084_0009365 | Ga0501084_0009365_1665_2795 | 335 |
| 32 | 3300060353 | Ga0501082_0001610 | Ga0501082_0001610_5244_6374 | 335 |
| 33 | 3300005339 | Ga0070660_100034716 | Ga0070660_1000347163 | 337 |
| 34 | 3300005366 | Ga0070659_100057665 | Ga0070659_1000576653 | 337 |
| 35 | 3300005563 | Ga0068855_100145628 | Ga0068855_1001456283 | 337 |
| 36 | 3300013104 | Ga0157370_10030229 | Ga0157370_100302292 | 337 |
| 37 | 3300025949 | Ga0207667_10127428 | Ga0207667_101274282 | 337 |
| 38 | 3300003322 | rootL2_10109219 | rootL2_101092192 | 343 |
| 39 | 3300013308 | Ga0157375_10000313 | Ga0157375_1000031320 | 343 |
| 40 | 3300009098 | Ga0105245_10221379 | Ga0105245_102213792 | 344 |
| 41 | 3300047472 | Ga0495686_0000701 | Ga0495686_0000701_13781_14854 | 345 |
| 42 | 3300049758 | Ga0501241_000189 | Ga0501241_000189_10775_11845 | 345 |
| 43 | 3300041505 | Ga0451849_1264891 | Ga0451849_1264891_3381_4454 | 346 |
| 44 | 3300046674 | Ga0495588_0047113 | Ga0495588_0047113_266_1339 | 346 |
| 45 | 3300049823 | Ga0501044_0384524 | Ga0501044_0384524_262_1308 | 346 |
| 46 | 3300046692 | Ga0495671_0160411 | Ga0495671_0160411_10_1065 | 347 |
| 47 | 3300005289 | Ga0065704_10074376 | Ga0065704_100743764 | 350 |
| 48 | 3300025272 | Ga0209455_1009694 | Ga0209455_10096942 | 350 |
| 49 | 3300005262 | Ga0065165_1001556 | Ga0065165_10015561 | 351 |
| 50 | 3300026118 | Ga0207675_100014882 | Ga0207675_1000148828 | 351 |
| 51 | 3300009101 | Ga0105247_10108412 | Ga0105247_101084123 | 352 |
| 52 | 3300009177 | Ga0105248_10037315 | Ga0105248_100373154 | 352 |
| 53 | 3300009553 | Ga0105249_10011772 | Ga0105249_100117724 | 352 |
| 54 | 3300013102 | Ga0157371_10055251 | Ga0157371_100552513 | 352 |
| 55 | 3300025961 | Ga0207712_10208815 | Ga0207712_102088151 | 352 |
| 56 | 3300060353 | Ga0501082_0060202 | Ga0501082_0060202_1210_2367 | 352 |
| 57 | 3300005355 | Ga0070671_100330526 | Ga0070671_1003305261 | 353 |
| 58 | 3300049571 | Ga0501034_0209105 | Ga0501034_0209105_97_1167 | 353 |
| 59 | 3300025921 | Ga0207652_10001588 | Ga0207652_1000158817 | 354 |
| 60 | 3300046525 | Ga0495663_0000010 | Ga0495663_0000010_142693_143802 | 354 |
| 61 | 3300053148 | Ga0500590_002695 | Ga0500590_002695_304_1434 | 354 |
| 62 | 3300005327 | Ga0070658_10017194 | Ga0070658_100171945 | 355 |
| 63 | 3300005329 | Ga0070683_100000962 | Ga0070683_1000009629 | 355 |
| 64 | 3300005535 | Ga0070684_100000297 | Ga0070684_1000002978 | 355 |
| 65 | 3300005564 | Ga0070664_100037558 | Ga0070664_1000375582 | 355 |
| 66 | 3300005577 | Ga0068857_100007564 | Ga0068857_1000075645 | 355 |
| 67 | 3300005614 | Ga0068856_100000581 | Ga0068856_10000058113 | 355 |
| 68 | 3300013105 | Ga0157369_10001685 | Ga0157369_100016853 | 355 |
| 69 | 3300025944 | Ga0207661_10002325 | Ga0207661_100023253 | 355 |
| 70 | 3300025945 | Ga0207679_10006553 | Ga0207679_100065532 | 355 |
| 71 | 3300026078 | Ga0207702_10000922 | Ga0207702_100009225 | 355 |
| 72 | 3300026116 | Ga0207674_10012575 | Ga0207674_100125757 | 355 |
| 73 | 3300009545 | Ga0105237_10092985 | Ga0105237_100929852 | 357 |
| 74 | 3300013104 | Ga0157370_10027971 | Ga0157370_100279711 | 357 |
| 75 | 3300031595 | Ga0265313_10003964 | Ga0265313_100039644 | 357 |
| 76 | 3300048929 | Ga0496126_0021273 | Ga0496126_0021273_2154_3287 | 357 |
| 77 | 3300053140 | Ga0500573_0000037 | Ga0500573_0000037_43130_44290 | 357 |
| 78 | iso_pu_bacteria | 2582581278 | 2585141511 | 357 |
| 79 | iso_pu_bacteria | 2582581873 | 2585424712 | 357 |
| 80 | iso_pu_bacteria | 2585428045 | 2587680445 | 357 |
| 81 | iso_pu_bacteria | 2585428060 | 2587749467 | 357 |
| 82 | iso_pu_bacteria | 2585428095 | 2587866752 | 357 |
| 83 | iso_pu_bacteria | 2585428182 | 2588208111 | 357 |
| 84 | iso_pu_bacteria | 2585428183 | 2588213307 | 357 |
| 85 | iso_pu_bacteria | 2585428184 | 2588219924 | 357 |
| 86 | iso_pu_bacteria | 2585428185 | 2588223807 | 357 |
| 87 | iso_pu_bacteria | 2588253712 | 2588446566 | 357 |
| 88 | iso_pu_bacteria | 2588254255 | 2590600725 | 357 |
| 89 | iso_pu_bacteria | 2588254257 | 2590612021 | 357 |
| 90 | iso_pu_bacteria | 2728369107 | 2729198698 | 357 |
| 91 | iso_pu_bacteria | 2751185877 | 2753672579 | 357 |
| 92 | iso_pu_bacteria | 2765235839 | 2765572699 | 357 |
| 93 | iso_pu_bacteria | 2772190705 | 2772603938 | 357 |
| 94 | iso_pu_bacteria | 2775506739 | 2775672858 | 357 |
| 95 | iso_pu_bacteria | 2816332188 | 2816873053 | 357 |
| 96 | iso_pu_bacteria | 2842083920 | 2842084301 | 357 |
| 97 | iso_pu_bacteria | 2871720351 | 2871723858 | 357 |
| 98 | iso_pu_bacteria | 2889290771 | 2889291575 | 357 |
| 99 | iso_pu_bacteria | 2905999023 | 2906000702 | 357 |
| 100 | iso_pu_bacteria | 2919097161 | 2919099276 | 357 |
| 101 | iso_pu_bacteria | 2919399522 | 2919402996 | 357 |
| 102 | iso_pu_bacteria | 2919692658 | 2919695220 | 357 |
| 103 | iso_pu_bacteria | 2946019816 | 2946021526 | 357 |
| 104 | iso_pu_bacteria | 2977243572 | 2977246138 | 357 |
| 105 | iso_pu_bacteria | 2993372514 | 2993373451 | 357 |
| 106 | iso_pu_bacteria | 2993480792 | 2993484136 | 357 |
| 107 | 3300015261 | Ga0182006_1000011 | Ga0182006_1000011353 | 358 |
| 108 | 3300031911 | Ga0307412_10000012 | Ga0307412_1000001282 | 358 |
| 109 | 3300032002 | Ga0307416_100000010 | Ga0307416_10000001057 | 358 |
| 110 | 3300032004 | Ga0307414_10124383 | Ga0307414_101243833 | 358 |
| 111 | 3300042142 | Ga0450905_008293 | Ga0450905_008293_25_1125 | 358 |
| 112 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_1565984_1567084 | 358 |
| 113 | 3300048925 | Ga0496122_0033274 | Ga0496122_0033274_647_1747 | 358 |
| 114 | iso_pu_bacteria | 2945924605 | 2945927216 | 358 |
| 115 | 3300003320 | rootH2_10108382 | rootH2_101083822 | 359 |
| 116 | 3300003322 | rootL2_10261820 | rootL2_102618202 | 359 |
| 117 | 3300003323 | rootH1_10172432 | rootH1_101724324 | 359 |
| 118 | 3300003323 | rootH1_10193712 | rootH1_101937123 | 359 |
| 119 | 3300003759 | Ga0055525_1000063 | Ga0055525_1000063138 | 359 |
| 120 | 3300003759 | Ga0055525_1000064 | Ga0055525_1000064138 | 359 |
| 121 | 3300003784 | Ga0055534_1002619 | Ga0055534_10026194 | 359 |
| 122 | 3300005335 | Ga0070666_10044443 | Ga0070666_100444431 | 359 |
| 123 | 3300005337 | Ga0070682_100001250 | Ga0070682_10000125015 | 359 |
| 124 | 3300005455 | Ga0070663_100116814 | Ga0070663_1001168141 | 359 |
| 125 | 3300005546 | Ga0070696_100000797 | Ga0070696_10000079718 | 359 |
| 126 | 3300005563 | Ga0068855_100182749 | Ga0068855_1001827493 | 359 |
| 127 | 3300005618 | Ga0068864_100263181 | Ga0068864_1002631812 | 359 |
| 128 | 3300005841 | Ga0068863_100038845 | Ga0068863_1000388453 | 359 |
| 129 | 3300005843 | Ga0068860_100290841 | Ga0068860_1002908412 | 359 |
| 130 | 3300009036 | Ga0105244_10000058 | Ga0105244_1000005838 | 359 |
| 131 | 3300009148 | Ga0105243_10000090 | Ga0105243_1000009016 | 359 |
| 132 | 3300009148 | Ga0105243_10030367 | Ga0105243_100303674 | 359 |
| 133 | 3300013100 | Ga0157373_10000019 | Ga0157373_10000019120 | 359 |
| 134 | 3300013104 | Ga0157370_10014403 | Ga0157370_100144034 | 359 |
| 135 | 3300013104 | Ga0157370_10015069 | Ga0157370_100150694 | 359 |
| 136 | 3300014497 | Ga0182008_10000015 | Ga0182008_1000001530 | 359 |
| 137 | 3300025230 | Ga0209563_100066 | Ga0209563_100066198 | 359 |
| 138 | 3300025728 | Ga0207655_1000693 | Ga0207655_100069326 | 359 |
| 139 | 3300025935 | Ga0207709_10000364 | Ga0207709_1000036422 | 359 |
| 140 | 3300025935 | Ga0207709_10035978 | Ga0207709_100359781 | 359 |
| 141 | 3300025941 | Ga0207711_10003309 | Ga0207711_100033093 | 359 |
| 142 | 3300025949 | Ga0207667_10129082 | Ga0207667_101290823 | 359 |
| 143 | 3300025961 | Ga0207712_10071451 | Ga0207712_100714513 | 359 |
| 144 | 3300026067 | Ga0207678_10030824 | Ga0207678_100308241 | 359 |
| 145 | 3300041413 | Ga0439465_0004263 | Ga0439465_0004263_1613_2722 | 359 |
| 146 | 3300042004 | Ga0439445_0002086 | Ga0439445_0002086_2299_3408 | 359 |
| 147 | 3300044712 | Ga0453684_0000062 | Ga0453684_0000062_362145_363257 | 359 |
| 148 | 3300044842 | Ga0466957_0129265 | Ga0466957_0129265_436_1578 | 359 |
| 149 | 3300046453 | Ga0495627_000003 | Ga0495627_000003_324300_325409 | 359 |
| 150 | 3300046453 | Ga0495627_010260 | Ga0495627_010260_1621_2730 | 359 |
| 151 | 3300046500 | Ga0495596_0005171 | Ga0495596_0005171_2076_3185 | 359 |
| 152 | 3300046522 | Ga0495643_0029986 | Ga0495643_0029986_1433_2542 | 359 |
| 153 | 3300046525 | Ga0495663_0007071 | Ga0495663_0007071_1042_2154 | 359 |
| 154 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_795600_796709 | 359 |
| 155 | 3300046558 | Ga0495633_0000008 | Ga0495633_0000008_251231_252340 | 359 |
| 156 | 3300046558 | Ga0495633_0003754 | Ga0495633_0003754_4397_5506 | 359 |
| 157 | 3300047472 | Ga0495686_0000416 | Ga0495686_0000416_10083_11192 | 359 |
| 158 | 3300048905 | Ga0496102_0062782 | Ga0496102_0062782_1230_2339 | 359 |
| 159 | 3300048916 | Ga0496113_0038568 | Ga0496113_0038568_1600_2709 | 359 |
| 160 | 3300048919 | Ga0496116_0000053 | Ga0496116_0000053_33539_34648 | 359 |
| 161 | 3300048920 | Ga0496117_0000089 | Ga0496117_0000089_122002_123111 | 359 |
| 162 | 3300048921 | Ga0496118_0000221 | Ga0496118_0000221_50845_51954 | 359 |
| 163 | 3300048922 | Ga0496119_0000038 | Ga0496119_0000038_121995_123104 | 359 |
| 164 | 3300048925 | Ga0496122_0000109 | Ga0496122_0000109_56919_58028 | 359 |
| 165 | 3300048925 | Ga0496122_0000118 | Ga0496122_0000118_114070_115179 | 359 |
| 166 | 3300048925 | Ga0496122_0000700 | Ga0496122_0000700_7442_8551 | 359 |
| 167 | 3300048925 | Ga0496122_0003899 | Ga0496122_0003899_12985_14094 | 359 |
| 168 | 3300048926 | Ga0496123_0000930 | Ga0496123_0000930_3126_4235 | 359 |
| 169 | 3300048926 | Ga0496123_0007098 | Ga0496123_0007098_1235_2344 | 359 |
| 170 | 3300048926 | Ga0496123_0011663 | Ga0496123_0011663_3824_4933 | 359 |
| 171 | 3300048928 | Ga0496125_0000547 | Ga0496125_0000547_3634_4743 | 359 |
| 172 | 3300048928 | Ga0496125_0003355 | Ga0496125_0003355_34_1143 | 359 |
| 173 | 3300048928 | Ga0496125_0032349 | Ga0496125_0032349_2953_4062 | 359 |
| 174 | 3300048929 | Ga0496126_0001041 | Ga0496126_0001041_9401_10510 | 359 |
| 175 | iso_pu_bacteria | 2511231000 | 2511231265 | 359 |
| 176 | iso_pu_bacteria | 2582581281 | 2585156727 | 359 |
| 177 | iso_pu_bacteria | 2582581282 | 2585160970 | 359 |
| 178 | 3300001915 | JGI24741J21665_1000689 | JGI24741J21665_10006897 | 360 |
| 179 | 3300005327 | Ga0070658_10001705 | Ga0070658_100017058 | 360 |
| 180 | 3300025291 | Ga0209675_1000033 | Ga0209675_1000033142 | 360 |
| 181 | 3300025909 | Ga0207705_10000120 | Ga0207705_1000012024 | 360 |
| 182 | 3300025911 | Ga0207654_10005355 | Ga0207654_100053552 | 360 |
| 183 | 3300025924 | Ga0207694_10011664 | Ga0207694_100116646 | 360 |
| 184 | 3300026078 | Ga0207702_10003624 | Ga0207702_100036243 | 360 |
| 185 | 3300026142 | Ga0207698_10001069 | Ga0207698_1000106916 | 360 |
| 186 | 3300031911 | Ga0307412_10002385 | Ga0307412_100023852 | 360 |
| 187 | 3300031911 | Ga0307412_10024561 | Ga0307412_100245613 | 360 |
| 188 | 3300046691 | Ga0495670_0000005 | Ga0495670_0000005_49579_50694 | 360 |
| 189 | 3300048917 | Ga0496114_0001667 | Ga0496114_0001667_5297_6454 | 360 |
| 190 | 3300049581 | Ga0501047_0189155 | Ga0501047_0189155_764_1897 | 360 |
| 191 | 3300049758 | Ga0501241_000019 | Ga0501241_000019_75874_76986 | 360 |
| 192 | iso_pu_bacteria | 3003233435 | 3003236392 | 360 |
| 193 | 3300001979 | JGI24740J21852_10000942 | JGI24740J21852_1000094210 | 361 |
| 194 | 3300003320 | rootH2_10236114 | rootH2_102361143 | 361 |
| 195 | 3300006173 | Ga0070716_100070279 | Ga0070716_1000702793 | 361 |
| 196 | 3300027717 | Ga0209998_10020384 | Ga0209998_100203842 | 361 |
| 197 | iso_pu_bacteria | 2585428115 | 2587942835 | 361 |
| 198 | iso_pu_bacteria | 2585428187 | 2588233394 | 361 |
| 199 | 3300003791 | Ga0055530_10000344 | Ga0055530_100003448 | 362 |
| 200 | 3300003794 | Ga0055531_10000012 | Ga0055531_1000001278 | 362 |
| 201 | 3300025298 | Ga0209050_1000039 | Ga0209050_1000039278 | 362 |
| 202 | 3300025304 | Ga0209257_1000051 | Ga0209257_1000051278 | 362 |
| 203 | 3300035113 | Ga0373936_0009423 | Ga0373936_0009423_1792_2925 | 362 |
| 204 | 3300042006 | Ga0439432_004445 | Ga0439432_004445_2346_3458 | 362 |
| 205 | 3300046452 | Ga0495617_001529 | Ga0495617_001529_7796_8884 | 362 |
| 206 | 3300046691 | Ga0495670_0010251 | Ga0495670_0010251_2333_3454 | 362 |
| 207 | 3300049572 | Ga0501036_0041128 | Ga0501036_0041128_302_1432 | 362 |
| 208 | 3300049572 | Ga0501036_0126744 | Ga0501036_0126744_287_1417 | 362 |
| 209 | 3300049574 | Ga0501038_0002993 | Ga0501038_0002993_2971_4101 | 362 |
| 210 | 3300049574 | Ga0501038_0059869 | Ga0501038_0059869_611_1741 | 362 |
| 211 | 3300049575 | Ga0501039_0203291 | Ga0501039_0203291_34_1164 | 362 |
| 212 | 3300049579 | Ga0501043_0021795 | Ga0501043_0021795_2860_3990 | 362 |
| 213 | 3300049581 | Ga0501047_0056294 | Ga0501047_0056294_972_2102 | 362 |
| 214 | 3300049586 | Ga0501070_0106630 | Ga0501070_0106630_33_1163 | 362 |
| 215 | 3300049823 | Ga0501044_0007604 | Ga0501044_0007604_7475_8605 | 362 |
| 216 | 3300053091 | Ga0500647_0014081 | Ga0500647_0014081_2256_3389 | 362 |
| 217 | 3300053094 | Ga0500566_0000771 | Ga0500566_0000771_4508_5641 | 362 |
| 218 | 3300053111 | Ga0500572_016322 | Ga0500572_016322_96_1229 | 362 |
| 219 | 3300053123 | Ga0500614_001221 | Ga0500614_001221_3705_4838 | 362 |
| 220 | 3300053735 | Ga0500596_002101 | Ga0500596_002101_1418_2551 | 362 |
| 221 | 3300005536 | Ga0070697_100239459 | Ga0070697_1002394591 | 363 |
| 222 | 3300015690 | Ga0183363_1007 | Ga0183363_100790 | 363 |
| 223 | 3300016635 | Ga0183361_10078 | Ga0183361_100783 | 363 |
| 224 | 3300021441 | Ga0213871_10006084 | Ga0213871_100060841 | 363 |
| 225 | 3300025261 | Ga0209233_1014593 | Ga0209233_10145931 | 363 |
| 226 | 3300025272 | Ga0209455_1002862 | Ga0209455_10028622 | 363 |
| 227 | 3300031250 | Ga0265331_10021328 | Ga0265331_100213283 | 363 |
| 228 | 3300031911 | Ga0307412_10015694 | Ga0307412_100156945 | 363 |
| 229 | 3300039438 | Ga0436360_0100021 | Ga0436360_0100021_281_1405 | 363 |
| 230 | 3300039453 | Ga0436362_0301465 | Ga0436362_0301465_325_1449 | 363 |
| 231 | 3300049570 | Ga0501033_0052332 | Ga0501033_0052332_30_1160 | 363 |
| 232 | 3300049573 | Ga0501037_0069024 | Ga0501037_0069024_732_1862 | 363 |
| 233 | 3300049579 | Ga0501043_0058613 | Ga0501043_0058613_1672_2802 | 363 |
| 234 | 3300049580 | Ga0501046_0000035 | Ga0501046_0000035_25812_26945 | 363 |
| 235 | 3300049582 | Ga0501048_0175560 | Ga0501048_0175560_143_1273 | 363 |
| 236 | 3300049583 | Ga0501067_0006624 | Ga0501067_0006624_4837_5967 | 363 |
| 237 | 3300049584 | Ga0501068_0007179 | Ga0501068_0007179_2524_3654 | 363 |
| 238 | 3300049585 | Ga0501069_0025616 | Ga0501069_0025616_282_1412 | 363 |
| 239 | 3300049587 | Ga0501071_0087456 | Ga0501071_0087456_820_1950 | 363 |
| 240 | 3300049588 | Ga0501072_0025799 | Ga0501072_0025799_1737_2867 | 363 |
| 241 | 3300049589 | Ga0501073_0007949 | Ga0501073_0007949_4401_5531 | 363 |
| 242 | 3300049592 | Ga0501076_0187738 | Ga0501076_0187738_98_1228 | 363 |
| 243 | 3300049744 | Ga0501083_0016907 | Ga0501083_0016907_451_1581 | 363 |
| 244 | 3300049824 | Ga0501045_0035107 | Ga0501045_0035107_1505_2635 | 363 |
| 245 | 3300053177 | Ga0500636_0012009 | Ga0500636_0012009_595_1728 | 363 |
| 246 | 3300053178 | Ga0500637_0089187 | Ga0500637_0089187_14_1147 | 363 |
| 247 | 3300001976 | JGI24752J21851_1000602 | JGI24752J21851_10006022 | 364 |
| 248 | 3300002459 | JGI24751J29686_10009347 | JGI24751J29686_100093472 | 364 |
| 249 | 3300003320 | rootH2_10028904 | rootH2_100289041 | 364 |
| 250 | 3300003323 | rootH1_10009808 | rootH1_100098084 | 364 |
| 251 | 3300003323 | rootH1_10009809 | rootH1_100098091 | 364 |
| 252 | 3300005331 | Ga0070670_100099495 | Ga0070670_1000994953 | 364 |
| 253 | 3300005335 | Ga0070666_10000054 | Ga0070666_100000542 | 364 |
| 254 | 3300005353 | Ga0070669_100000097 | Ga0070669_1000000978 | 364 |
| 255 | 3300005440 | Ga0070705_100043596 | Ga0070705_1000435963 | 364 |
| 256 | 3300005544 | Ga0070686_100094573 | Ga0070686_1000945732 | 364 |
| 257 | 3300005614 | Ga0068856_100139383 | Ga0068856_1001393832 | 364 |
| 258 | 3300005617 | Ga0068859_100000847 | Ga0068859_1000008473 | 364 |
| 259 | 3300005843 | Ga0068860_100094572 | Ga0068860_1000945723 | 364 |
| 260 | 3300005844 | Ga0068862_100001021 | Ga0068862_1000010218 | 364 |
| 261 | 3300006931 | Ga0097620_100000847 | Ga0097620_1000008473 | 364 |
| 262 | 3300009101 | Ga0105247_10000840 | Ga0105247_1000084012 | 364 |
| 263 | 3300013249 | Ga0171463_1002 | Ga0171463_10021004 | 364 |
| 264 | 3300013306 | Ga0163162_10009006 | Ga0163162_100090061 | 364 |
| 265 | 3300015690 | Ga0183363_1030 | Ga0183363_103043 | 364 |
| 266 | 3300025900 | Ga0207710_10000606 | Ga0207710_1000060612 | 364 |
| 267 | 3300025903 | Ga0207680_10003164 | Ga0207680_100031642 | 364 |
| 268 | 3300025923 | Ga0207681_10000030 | Ga0207681_100000308 | 364 |
| 269 | 3300025925 | Ga0207650_10024163 | Ga0207650_100241635 | 364 |
| 270 | 3300025941 | Ga0207711_10014920 | Ga0207711_100149203 | 364 |
| 271 | 3300025972 | Ga0207668_10004020 | Ga0207668_100040202 | 364 |
| 272 | 3300025986 | Ga0207658_10003610 | Ga0207658_1000361011 | 364 |
| 273 | 3300026035 | Ga0207703_10001069 | Ga0207703_100010693 | 364 |
| 274 | 3300026078 | Ga0207702_10137145 | Ga0207702_101371452 | 364 |
| 275 | 3300028380 | Ga0268265_10000970 | Ga0268265_100009709 | 364 |
| 276 | 3300028381 | Ga0268264_10000288 | Ga0268264_1000028837 | 364 |
| 277 | 3300037471 | Ga0395905_0000022 | Ga0395905_0000022_112743_113849 | 364 |
| 278 | 3300037471 | Ga0395905_0029458 | Ga0395905_0029458_1339_2439 | 364 |
| 279 | 3300044656 | Ga0466969_0001849 | Ga0466969_0001849_3287_4387 | 364 |
| 280 | 3300044684 | Ga0466966_0000273 | Ga0466966_0000273_11494_12594 | 364 |
| 281 | 3300044842 | Ga0466957_0007115 | Ga0466957_0007115_352_1452 | 364 |
| 282 | 3300045049 | Ga0466959_0000621 | Ga0466959_0000621_7984_9084 | 364 |
| 283 | 3300045049 | Ga0466959_0071675 | Ga0466959_0071675_118_1224 | 364 |
| 284 | 3300045836 | Ga0466958_0095231 | Ga0466958_0095231_222_1322 | 364 |
| 285 | 3300046477 | Ga0495664_0157937 | Ga0495664_0157937_136_1281 | 364 |
| 286 | 3300046506 | Ga0495583_0002397 | Ga0495583_0002397_9301_10446 | 364 |
| 287 | 3300047472 | Ga0495686_0051336 | Ga0495686_0051336_1300_2430 | 364 |
| 288 | 3300048907 | Ga0496104_0012047 | Ga0496104_0012047_3284_4411 | 364 |
| 289 | 3300048909 | Ga0496106_0022487 | Ga0496106_0022487_2027_3154 | 364 |
| 290 | 3300048911 | Ga0496108_0003150 | Ga0496108_0003150_8154_9281 | 364 |
| 291 | 3300048912 | Ga0496109_0014694 | Ga0496109_0014694_1892_3019 | 364 |
| 292 | 3300048913 | Ga0496110_0091815 | Ga0496110_0091815_844_1971 | 364 |
| 293 | 3300048915 | Ga0496112_0029831 | Ga0496112_0029831_3694_4821 | 364 |
| 294 | 3300048924 | Ga0496121_0000542 | Ga0496121_0000542_17110_18234 | 364 |
| 295 | 3300061719 | Ga0466962_0014907 | Ga0466962_0014907_1673_2773 | 364 |
| 296 | 3300061719 | Ga0466962_0039032 | Ga0466962_0039032_793_1905 | 364 |
| 297 | 3300005355 | Ga0070671_100000350 | Ga0070671_10000035031 | 365 |
| 298 | 3300005841 | Ga0068863_100000030 | Ga0068863_100000030114 | 365 |
| 299 | 3300005844 | Ga0068862_100411861 | Ga0068862_1004118611 | 365 |
| 300 | 3300025931 | Ga0207644_10000096 | Ga0207644_1000009675 | 365 |
| 301 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001169 | 365 |
| 302 | 3300028381 | Ga0268264_10016089 | Ga0268264_100160892 | 365 |
| 303 | 3300031731 | Ga0307405_10136541 | Ga0307405_101365412 | 365 |
| 304 | 3300046454 | Ga0495592_0066709 | Ga0495592_0066709_1162_2307 | 365 |
| 305 | 3300046530 | Ga0495654_0000224 | Ga0495654_0000224_7777_8877 | 365 |
| 306 | 3300046538 | Ga0495609_0044694 | Ga0495609_0044694_76_1191 | 365 |
| 307 | 3300046616 | Ga0495668_0001200 | Ga0495668_0001200_6323_7423 | 365 |
| 308 | 3300046674 | Ga0495588_0095861 | Ga0495588_0095861_375_1520 | 365 |
| 309 | 3300049571 | Ga0501034_0134285 | Ga0501034_0134285_194_1324 | 365 |
| 310 | 3300049823 | Ga0501044_0027397 | Ga0501044_0027397_621_1751 | 365 |
| 311 | 3300053158 | Ga0500627_0000278 | Ga0500627_0000278_3351_4451 | 365 |
| 312 | iso_pu_bacteria | 2643221541 | 2643728911 | 365 |
| 313 | iso_pu_bacteria | 2643221605 | 2644038166 | 365 |
| 314 | iso_pu_bacteria | 2643221606 | 2644044926 | 365 |
| 315 | iso_pu_bacteria | 2643221671 | 2644391099 | 365 |
| 316 | iso_pu_bacteria | 2928027323 | 2928029416 | 365 |
| 317 | iso_pu_bacteria | 2984555340 | 2984556613 | 365 |
| 318 | iso_pu_bacteria | 2984564862 | 2984565214 | 365 |
| 319 | iso_pu_bacteria | 2993356040 | 2993356290 | 365 |
| 320 | 3300003781 | Ga0055536_1002718 | Ga0055536_10027185 | 366 |
| 321 | 3300003791 | Ga0055530_10000024 | Ga0055530_1000002471 | 366 |
| 322 | 3300003794 | Ga0055531_10000164 | Ga0055531_1000016462 | 366 |
| 323 | 3300025258 | Ga0209129_1000424 | Ga0209129_10004243 | 366 |
| 324 | 3300025304 | Ga0209257_1000130 | Ga0209257_1000130152 | 366 |
| 325 | 3300025928 | Ga0207700_10133081 | Ga0207700_101330812 | 366 |
| 326 | 3300035724 | Ga0373933_0070230 | Ga0373933_0070230_546_1655 | 366 |
| 327 | 3300036401 | Ga0373937_0110950 | Ga0373937_0110950_669_1778 | 366 |
| 328 | 3300046538 | Ga0495609_0020647 | Ga0495609_0020647_760_1905 | 366 |
| 329 | 3300028556 | Ga0265337_1003505 | Ga0265337_10035054 | 367 |
| 330 | 3300028573 | Ga0265334_10001203 | Ga0265334_1000120311 | 367 |
| 331 | 3300031595 | Ga0265313_10021233 | Ga0265313_100212335 | 367 |
| 332 | 3300031712 | Ga0265342_10122872 | Ga0265342_101228722 | 367 |
| 333 | 3300044712 | Ga0453684_0000071 | Ga0453684_0000071_158032_159144 | 367 |
| 334 | 3300046454 | Ga0495592_0196937 | Ga0495592_0196937_85_1230 | 367 |
| 335 | 3300048905 | Ga0496102_0173771 | Ga0496102_0173771_614_1738 | 367 |
| 336 | 3300002076 | JGI24749J21850_1007117 | JGI24749J21850_10071172 | 368 |
| 337 | 3300002459 | JGI24751J29686_10000062 | JGI24751J29686_1000006240 | 368 |
| 338 | 3300005331 | Ga0070670_100000005 | Ga0070670_100000005275 | 368 |
| 339 | 3300005347 | Ga0070668_100000020 | Ga0070668_10000002085 | 368 |
| 340 | 3300005347 | Ga0070668_100041319 | Ga0070668_1000413194 | 368 |
| 341 | 3300005347 | Ga0070668_100164162 | Ga0070668_1001641622 | 368 |
| 342 | 3300005353 | Ga0070669_100000060 | Ga0070669_10000006014 | 368 |
| 343 | 3300005353 | Ga0070669_100124102 | Ga0070669_1001241022 | 368 |
| 344 | 3300005355 | Ga0070671_100000854 | Ga0070671_10000085418 | 368 |
| 345 | 3300005367 | Ga0070667_100000055 | Ga0070667_10000005559 | 368 |
| 346 | 3300005367 | Ga0070667_100001092 | Ga0070667_10000109229 | 368 |
| 347 | 3300005616 | Ga0068852_100226879 | Ga0068852_1002268792 | 368 |
| 348 | 3300005617 | Ga0068859_100174343 | Ga0068859_1001743432 | 368 |
| 349 | 3300005618 | Ga0068864_100000011 | Ga0068864_100000011272 | 368 |
| 350 | 3300005618 | Ga0068864_100014218 | Ga0068864_1000142187 | 368 |
| 351 | 3300005841 | Ga0068863_100002111 | Ga0068863_10000211115 | 368 |
| 352 | 3300005842 | Ga0068858_100000186 | Ga0068858_10000018665 | 368 |
| 353 | 3300005843 | Ga0068860_100000090 | Ga0068860_10000009060 | 368 |
| 354 | 3300005844 | Ga0068862_100000104 | Ga0068862_10000010465 | 368 |
| 355 | 3300005844 | Ga0068862_100001485 | Ga0068862_1000014858 | 368 |
| 356 | 3300006195 | Ga0075366_10006964 | Ga0075366_100069645 | 368 |
| 357 | 3300006931 | Ga0097620_100174356 | Ga0097620_1001743562 | 368 |
| 358 | 3300009177 | Ga0105248_10000229 | Ga0105248_100002296 | 368 |
| 359 | 3300009553 | Ga0105249_10149886 | Ga0105249_101498862 | 368 |
| 360 | 3300014326 | Ga0157380_10000083 | Ga0157380_100000834 | 368 |
| 361 | 3300017792 | Ga0163161_10098300 | Ga0163161_100983002 | 368 |
| 362 | 3300021384 | Ga0213876_10015478 | Ga0213876_100154783 | 368 |
| 363 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001385 | 368 |
| 364 | 3300025923 | Ga0207681_10013391 | Ga0207681_100133915 | 368 |
| 365 | 3300025925 | Ga0207650_10000018 | Ga0207650_10000018272 | 368 |
| 366 | 3300025931 | Ga0207644_10000050 | Ga0207644_1000005074 | 368 |
| 367 | 3300025941 | Ga0207711_10001356 | Ga0207711_100013567 | 368 |
| 368 | 3300025972 | Ga0207668_10000048 | Ga0207668_100000486 | 368 |
| 369 | 3300025972 | Ga0207668_10020257 | Ga0207668_100202575 | 368 |
| 370 | 3300025972 | Ga0207668_10136003 | Ga0207668_101360032 | 368 |
| 371 | 3300025986 | Ga0207658_10000090 | Ga0207658_10000090102 | 368 |
| 372 | 3300025986 | Ga0207658_10003728 | Ga0207658_1000372811 | 368 |
| 373 | 3300026035 | Ga0207703_10000231 | Ga0207703_100002319 | 368 |
| 374 | 3300026088 | Ga0207641_10005852 | Ga0207641_100058525 | 368 |
| 375 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004665 | 368 |
| 376 | 3300026095 | Ga0207676_10000658 | Ga0207676_100006588 | 368 |
| 377 | 3300026118 | Ga0207675_100002408 | Ga0207675_10000240816 | 368 |
| 378 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002391 | 368 |
| 379 | 3300028380 | Ga0268265_10001609 | Ga0268265_100016098 | 368 |
| 380 | 3300028381 | Ga0268264_10000075 | Ga0268264_10000075102 | 368 |
| 381 | 3300031911 | Ga0307412_10081056 | Ga0307412_100810562 | 368 |
| 382 | 3300039437 | Ga0436365_0458255 | Ga0436365_0458255_2339_3469 | 368 |
| 383 | 3300046474 | Ga0495605_0001337 | Ga0495605_0001337_9951_11096 | 368 |
| 384 | 3300046492 | Ga0495585_0006200 | Ga0495585_0006200_5041_6186 | 368 |
| 385 | 3300046501 | Ga0495607_0080002 | Ga0495607_0080002_576_1721 | 368 |
| 386 | 3300046506 | Ga0495583_0029817 | Ga0495583_0029817_1257_2402 | 368 |
| 387 | 3300046513 | Ga0495616_0026474 | Ga0495616_0026474_959_2104 | 368 |
| 388 | 3300046518 | Ga0495631_0001421 | Ga0495631_0001421_9455_10600 | 368 |
| 389 | 3300046519 | Ga0495632_0011139 | Ga0495632_0011139_3039_4184 | 368 |
| 390 | 3300046530 | Ga0495654_0108064 | Ga0495654_0108064_93_1238 | 368 |
| 391 | 3300046616 | Ga0495668_0017970 | Ga0495668_0017970_2009_3154 | 368 |
| 392 | 3300046660 | Ga0495625_0000621 | Ga0495625_0000621_1478_2623 | 368 |
| 393 | 3300046810 | Ga0495660_0021376 | Ga0495660_0021376_566_1711 | 368 |
| 394 | 3300048917 | Ga0496114_0174339 | Ga0496114_0174339_201_1346 | 368 |
| 395 | 3300049459 | Ga0495678_007036 | Ga0495678_007036_1513_2658 | 368 |
| 396 | 3300049569 | Ga0501032_0087427 | Ga0501032_0087427_320_1429 | 368 |
| 397 | 3300049571 | Ga0501034_0049702 | Ga0501034_0049702_938_2047 | 368 |
| 398 | 3300049579 | Ga0501043_0128969 | Ga0501043_0128969_826_1935 | 368 |
| 399 | 3300049581 | Ga0501047_0012927 | Ga0501047_0012927_2472_3581 | 368 |
| 400 | 3300049679 | Ga0501249_000111 | Ga0501249_000111_2834_3943 | 368 |
| 401 | 3300049823 | Ga0501044_0204246 | Ga0501044_0204246_57_1166 | 368 |
| 402 | 3300050493 | nmdc:mga0k408_38443_c1 | nmdc:mga0k408_38443_c1_1600_2709 | 368 |
| 403 | 3300053079 | Ga0500610_0013892 | Ga0500610_0013892_1264_2409 | 368 |
| 404 | 3300053109 | Ga0500569_018439 | Ga0500569_018439_302_1447 | 368 |
| 405 | 3300053730 | Ga0500645_011886 | Ga0500645_011886_310_1419 | 368 |
| 406 | iso_pu_bacteria | 2713897090 | 2715499777 | 368 |
| 407 | 3300041410 | Ga0439461_0001983 | Ga0439461_0001983_1200_2312 | 369 |
| 408 | 3300041413 | Ga0439465_0000135 | Ga0439465_0000135_15324_16436 | 369 |
| 409 | 3300042015 | Ga0439462_0001400 | Ga0439462_0001400_1945_3057 | 369 |
| 410 | 3300042435 | Ga0439434_0000065 | Ga0439434_0000065_15072_16184 | 369 |
| 411 | 3300048924 | Ga0496121_0013808 | Ga0496121_0013808_2444_3568 | 369 |
| 412 | 3300049569 | Ga0501032_0072177 | Ga0501032_0072177_537_1664 | 369 |
| 413 | 3300049570 | Ga0501033_0016189 | Ga0501033_0016189_63_1190 | 369 |
| 414 | 3300049570 | Ga0501033_0017174 | Ga0501033_0017174_3738_4865 | 369 |
| 415 | 3300049586 | Ga0501070_0181658 | Ga0501070_0181658_157_1284 | 369 |
| 416 | 3300049822 | Ga0501035_0175436 | Ga0501035_0175436_103_1230 | 369 |
| 417 | iso_pu_bacteria | 2738541275 | 2738712837 | 369 |
| 418 | iso_pu_bacteria | 2738541301 | 2738851261 | 369 |
| 419 | iso_pu_bacteria | 2738541304 | 2738866991 | 369 |
| 420 | iso_pu_bacteria | 2738543022 | 2739299508 | 369 |
| 421 | iso_pu_bacteria | 2738543033 | 2739361187 | 369 |
| 422 | iso_pu_bacteria | 2915650412 | 2915653581 | 369 |
| 423 | 3300003215 | JGI25153J46596_10003643 | JGI25153J46596_100036433 | 370 |
| 424 | 3300005327 | Ga0070658_10169902 | Ga0070658_101699022 | 370 |
| 425 | 3300005530 | Ga0070679_100004658 | Ga0070679_1000046582 | 370 |
| 426 | 3300005530 | Ga0070679_100259665 | Ga0070679_1002596651 | 370 |
| 427 | 3300005535 | Ga0070684_100095686 | Ga0070684_1000956862 | 370 |
| 428 | 3300005564 | Ga0070664_100350905 | Ga0070664_1003509051 | 370 |
| 429 | 3300005843 | Ga0068860_100165043 | Ga0068860_1001650433 | 370 |
| 430 | 3300006358 | Ga0068871_100018177 | Ga0068871_1000181773 | 370 |
| 431 | 3300009177 | Ga0105248_10001858 | Ga0105248_1000185813 | 370 |
| 432 | 3300021384 | Ga0213876_10163503 | Ga0213876_101635031 | 370 |
| 433 | 3300025253 | Ga0209677_102327 | Ga0209677_1023276 | 370 |
| 434 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013169 | 370 |
| 435 | 3300025304 | Ga0209257_1005137 | Ga0209257_100513711 | 370 |
| 436 | 3300025909 | Ga0207705_10002397 | Ga0207705_1000239710 | 370 |
| 437 | 3300025920 | Ga0207649_10104952 | Ga0207649_101049522 | 370 |
| 438 | 3300025921 | Ga0207652_10133510 | Ga0207652_101335102 | 370 |
| 439 | 3300028800 | Ga0265338_10002006 | Ga0265338_1000200621 | 370 |
| 440 | 3300031239 | Ga0265328_10000046 | Ga0265328_1000004622 | 370 |
| 441 | 3300031241 | Ga0265325_10078699 | Ga0265325_100786992 | 370 |
| 442 | 3300031249 | Ga0265339_10058837 | Ga0265339_100588372 | 370 |
| 443 | 3300031250 | Ga0265331_10000710 | Ga0265331_1000071016 | 370 |
| 444 | 3300031251 | Ga0265327_10007316 | Ga0265327_100073167 | 370 |
| 445 | 3300031344 | Ga0265316_10000099 | Ga0265316_1000009921 | 370 |
| 446 | 3300031711 | Ga0265314_10004906 | Ga0265314_100049063 | 370 |
| 447 | 3300037853 | Ga0436364_1153948 | Ga0436364_1153948_377_1507 | 370 |
| 448 | 3300046530 | Ga0495654_0092421 | Ga0495654_0092421_189_1331 | 370 |
| 449 | 3300048088 | Ga0495602_0124838 | Ga0495602_0124838_496_1626 | 370 |
| 450 | 3300048911 | Ga0496108_0166028 | Ga0496108_0166028_113_1255 | 370 |
| 451 | 3300048929 | Ga0496126_0034512 | Ga0496126_0034512_1437_2564 | 370 |
| 452 | 3300049570 | Ga0501033_0009071 | Ga0501033_0009071_4561_5748 | 370 |
| 453 | 3300049571 | Ga0501034_0009021 | Ga0501034_0009021_6617_7753 | 370 |
| 454 | 3300049571 | Ga0501034_0211938 | Ga0501034_0211938_733_1869 | 370 |
| 455 | 3300049573 | Ga0501037_0167128 | Ga0501037_0167128_178_1305 | 370 |
| 456 | 3300049581 | Ga0501047_0027525 | Ga0501047_0027525_1791_2978 | 370 |
| 457 | 3300049581 | Ga0501047_0153398 | Ga0501047_0153398_474_1601 | 370 |
| 458 | 3300049581 | Ga0501047_0156664 | Ga0501047_0156664_879_2006 | 370 |
| 459 | 3300049822 | Ga0501035_0181510 | Ga0501035_0181510_137_1264 | 370 |
| 460 | 3300049823 | Ga0501044_0095863 | Ga0501044_0095863_1214_2401 | 370 |
| 461 | 3300049823 | Ga0501044_0239057 | Ga0501044_0239057_561_1688 | 370 |
| 462 | 3300050496 | nmdc:mga07m45_391_c1 | nmdc:mga07m45_391_c1_14142_15284 | 370 |
| 463 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_692909_694036 | 370 |
| 464 | 3300053087 | Ga0500643_030126 | Ga0500643_030126_44_1177 | 370 |
| 465 | 3300053121 | Ga0500607_000098 | Ga0500607_000098_26861_28000 | 370 |
| 466 | 3300053139 | Ga0500568_0014517 | Ga0500568_0014517_683_1810 | 370 |
| 467 | iso_pu_bacteria | 2512564014 | 2512645079 | 370 |
| 468 | iso_pu_bacteria | 2534681786 | 2535486463 | 370 |
| 469 | iso_pu_bacteria | 2643221560 | 2643822442 | 370 |
| 470 | iso_pu_bacteria | 2643221563 | 2643833547 | 370 |
| 471 | iso_pu_bacteria | 2643221608 | 2644054474 | 370 |
| 472 | iso_pu_bacteria | 2751185897 | 2753766794 | 370 |
| 473 | iso_pu_bacteria | 2775507255 | 2778125796 | 370 |
| 474 | iso_pu_bacteria | 2808606401 | 2809063405 | 370 |
| 475 | iso_pu_bacteria | 2808606404 | 2809079159 | 370 |
| 476 | iso_pu_bacteria | 2808606405 | 2809083467 | 370 |
| 477 | iso_pu_bacteria | 2852653556 | 2852656750 | 370 |
| 478 | iso_pu_bacteria | 2852680915 | 2852682046 | 370 |
| 479 | iso_pu_bacteria | 2880518877 | 2880520675 | 370 |
| 480 | iso_pu_bacteria | 2885409591 | 2885413892 | 370 |
| 481 | iso_pu_bacteria | 2919709256 | 2919711231 | 370 |
| 482 | iso_pu_bacteria | 8057132660 | 8057133743 | 370 |
| 483 | 3300002774 | JGI25150J39212_1000838 | JGI25150J39212_10008382 | 371 |
| 484 | 3300003215 | JGI25153J46596_10000064 | JGI25153J46596_10000064102 | 371 |
| 485 | 3300003771 | Ga0055526_1002619 | Ga0055526_10026193 | 371 |
| 486 | 3300003792 | Ga0055540_1002224 | Ga0055540_10022243 | 371 |
| 487 | 3300005353 | Ga0070669_100191849 | Ga0070669_1001918492 | 371 |
| 488 | 3300005364 | Ga0070673_100064021 | Ga0070673_1000640213 | 371 |
| 489 | 3300005439 | Ga0070711_100017006 | Ga0070711_1000170065 | 371 |
| 490 | 3300005456 | Ga0070678_100168357 | Ga0070678_1001683572 | 371 |
| 491 | 3300005458 | Ga0070681_10011283 | Ga0070681_100112836 | 371 |
| 492 | 3300005539 | Ga0068853_100089918 | Ga0068853_1000899182 | 371 |
| 493 | 3300005545 | Ga0070695_100005196 | Ga0070695_1000051969 | 371 |
| 494 | 3300005549 | Ga0070704_100073247 | Ga0070704_1000732473 | 371 |
| 495 | 3300005564 | Ga0070664_100045092 | Ga0070664_1000450922 | 371 |
| 496 | 3300005842 | Ga0068858_100076465 | Ga0068858_1000764653 | 371 |
| 497 | 3300006038 | Ga0075365_10015345 | Ga0075365_100153452 | 371 |
| 498 | 3300006042 | Ga0075368_10003978 | Ga0075368_100039785 | 371 |
| 499 | 3300006042 | Ga0075368_10022290 | Ga0075368_100222903 | 371 |
| 500 | 3300006048 | Ga0075363_100003818 | Ga0075363_1000038184 | 371 |
| 501 | 3300006048 | Ga0075363_100063969 | Ga0075363_1000639692 | 371 |
| 502 | 3300006051 | Ga0075364_10015635 | Ga0075364_100156352 | 371 |
| 503 | 3300006173 | Ga0070716_100030220 | Ga0070716_1000302201 | 371 |
| 504 | 3300006175 | Ga0070712_100003369 | Ga0070712_1000033698 | 371 |
| 505 | 3300006178 | Ga0075367_10002499 | Ga0075367_100024993 | 371 |
| 506 | 3300006237 | Ga0097621_100166468 | Ga0097621_1001664682 | 371 |
| 507 | 3300009101 | Ga0105247_10086235 | Ga0105247_100862352 | 371 |
| 508 | 3300009148 | Ga0105243_10026130 | Ga0105243_100261302 | 371 |
| 509 | 3300009174 | Ga0105241_10101590 | Ga0105241_101015902 | 371 |
| 510 | 3300009174 | Ga0105241_10140905 | Ga0105241_101409052 | 371 |
| 511 | 3300009551 | Ga0105238_10008814 | Ga0105238_100088147 | 371 |
| 512 | 3300011119 | Ga0105246_10024573 | Ga0105246_100245734 | 371 |
| 513 | 3300013105 | Ga0157369_10410859 | Ga0157369_104108591 | 371 |
| 514 | 3300014968 | Ga0157379_10067349 | Ga0157379_100673493 | 371 |
| 515 | 3300025245 | Ga0207425_1000228 | Ga0207425_100022843 | 371 |
| 516 | 3300025258 | Ga0209129_1001242 | Ga0209129_10012422 | 371 |
| 517 | 3300025263 | Ga0209565_1000166 | Ga0209565_100016634 | 371 |
| 518 | 3300025273 | Ga0209673_1004601 | Ga0209673_100460110 | 371 |
| 519 | 3300025292 | Ga0209676_1022758 | Ga0209676_10227582 | 371 |
| 520 | 3300025294 | Ga0209025_1000304 | Ga0209025_100030496 | 371 |
| 521 | 3300025295 | Ga0209564_1003037 | Ga0209564_10030379 | 371 |
| 522 | 3300025297 | Ga0209758_1000019 | Ga0209758_1000019210 | 371 |
| 523 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011272 | 371 |
| 524 | 3300025303 | Ga0209051_1000415 | Ga0209051_100041519 | 371 |
| 525 | 3300025304 | Ga0209257_1004707 | Ga0209257_10047074 | 371 |
| 526 | 3300025304 | Ga0209257_1004726 | Ga0209257_10047264 | 371 |
| 527 | 3300025915 | Ga0207693_10009341 | Ga0207693_100093414 | 371 |
| 528 | 3300025931 | Ga0207644_10130713 | Ga0207644_101307131 | 371 |
| 529 | 3300025932 | Ga0207690_10187969 | Ga0207690_101879692 | 371 |
| 530 | 3300025935 | Ga0207709_10155844 | Ga0207709_101558442 | 371 |
| 531 | 3300025939 | Ga0207665_10045233 | Ga0207665_100452331 | 371 |
| 532 | 3300025942 | Ga0207689_10139464 | Ga0207689_101394643 | 371 |
| 533 | 3300025945 | Ga0207679_10203629 | Ga0207679_102036292 | 371 |
| 534 | 3300025960 | Ga0207651_10045874 | Ga0207651_100458742 | 371 |
| 535 | 3300026035 | Ga0207703_10141440 | Ga0207703_101414402 | 371 |
| 536 | 3300026067 | Ga0207678_10001352 | Ga0207678_1000135218 | 371 |
| 537 | 3300026075 | Ga0207708_10168730 | Ga0207708_101687302 | 371 |
| 538 | 3300026121 | Ga0207683_10227772 | Ga0207683_102277723 | 371 |
| 539 | 3300027866 | Ga0209813_10002387 | Ga0209813_100023872 | 371 |
| 540 | 3300031239 | Ga0265328_10000374 | Ga0265328_1000037410 | 371 |
| 541 | 3300031250 | Ga0265331_10000005 | Ga0265331_10000005256 | 371 |
| 542 | 3300031730 | Ga0307516_10000405 | Ga0307516_100004053 | 371 |
| 543 | 3300044842 | Ga0466957_0206626 | Ga0466957_0206626_131_1264 | 371 |
| 544 | 3300046616 | Ga0495668_0040440 | Ga0495668_0040440_921_2066 | 371 |
| 545 | 3300047472 | Ga0495686_0054829 | Ga0495686_0054829_1271_2404 | 371 |
| 546 | 3300048904 | Ga0496101_0061414 | Ga0496101_0061414_1257_2390 | 371 |
| 547 | 3300048907 | Ga0496104_0174409 | Ga0496104_0174409_686_1819 | 371 |
| 548 | 3300048918 | Ga0496115_0005734 | Ga0496115_0005734_317_1450 | 371 |
| 549 | 3300048924 | Ga0496121_0010693 | Ga0496121_0010693_3382_4512 | 371 |
| 550 | 3300048925 | Ga0496122_0010527 | Ga0496122_0010527_7745_8878 | 371 |
| 551 | 3300048928 | Ga0496125_0000145 | Ga0496125_0000145_83066_84199 | 371 |
| 552 | 3300048929 | Ga0496126_0003357 | Ga0496126_0003357_7308_8438 | 371 |
| 553 | 3300049568 | Ga0501031_0003517 | Ga0501031_0003517_7561_8697 | 371 |
| 554 | 3300049569 | Ga0501032_0049585 | Ga0501032_0049585_1686_2822 | 371 |
| 555 | 3300049570 | Ga0501033_0008378 | Ga0501033_0008378_4103_5239 | 371 |
| 556 | 3300049572 | Ga0501036_0027231 | Ga0501036_0027231_926_2062 | 371 |
| 557 | 3300049573 | Ga0501037_0011305 | Ga0501037_0011305_5413_6549 | 371 |
| 558 | 3300049574 | Ga0501038_0225527 | Ga0501038_0225527_347_1483 | 371 |
| 559 | 3300049574 | Ga0501038_0308854 | Ga0501038_0308854_22_1158 | 371 |
| 560 | 3300049575 | Ga0501039_0022121 | Ga0501039_0022121_2458_3594 | 371 |
| 561 | 3300049578 | Ga0501042_0015292 | Ga0501042_0015292_1568_2704 | 371 |
| 562 | 3300049579 | Ga0501043_0014567 | Ga0501043_0014567_2015_3151 | 371 |
| 563 | 3300049580 | Ga0501046_0036342 | Ga0501046_0036342_1543_2679 | 371 |
| 564 | 3300049582 | Ga0501048_0002015 | Ga0501048_0002015_3635_4768 | 371 |
| 565 | 3300049742 | Ga0501080_0146125 | Ga0501080_0146125_352_1488 | 371 |
| 566 | 3300049822 | Ga0501035_0034127 | Ga0501035_0034127_2203_3339 | 371 |
| 567 | 3300049822 | Ga0501035_0136614 | Ga0501035_0136614_104_1240 | 371 |
| 568 | 3300049823 | Ga0501044_0106881 | Ga0501044_0106881_1401_2537 | 371 |
| 569 | 3300050490 | nmdc:mga03n38_3514_c1 | nmdc:mga03n38_3514_c1_3288_4433 | 371 |
| 570 | 3300050491 | nmdc:mga00v17_47940_c1 | nmdc:mga00v17_47940_c1_877_2022 | 371 |
| 571 | 3300050494 | nmdc:mga06z11_134103_c1 | nmdc:mga06z11_134103_c1_108_1253 | 371 |
| 572 | 3300050494 | nmdc:mga06z11_601_c1 | nmdc:mga06z11_601_c1_3639_4784 | 371 |
| 573 | 3300050495 | nmdc:mga04h51_2380_c1 | nmdc:mga04h51_2380_c1_505_1650 | 371 |
| 574 | 3300050495 | nmdc:mga04h51_26340_c1 | nmdc:mga04h51_26340_c1_37_1182 | 371 |
| 575 | iso_pu_bacteria | 2510917028 | 2511186182 | 371 |
| 576 | iso_pu_bacteria | 2513237088 | 2513595103 | 371 |
| 577 | iso_pu_bacteria | 2513237138 | 2513867407 | 371 |
| 578 | iso_pu_bacteria | 2513237144 | 2513910805 | 371 |
| 579 | iso_pu_bacteria | 2513237146 | 2513927238 | 371 |
| 580 | iso_pu_bacteria | 2513237159 | 2513999155 | 371 |
| 581 | iso_pu_bacteria | 2516143018 | 2516206024 | 371 |
| 582 | iso_pu_bacteria | 2524023209 | 2524461992 | 371 |
| 583 | iso_pu_bacteria | 2537561587 | 2537875322 | 371 |
| 584 | iso_pu_bacteria | 2554235003 | 2554244958 | 371 |
| 585 | iso_pu_bacteria | 2558860100 | 2558866881 | 371 |
| 586 | iso_pu_bacteria | 2558860242 | 2559297209 | 371 |
| 587 | iso_pu_bacteria | 2582581283 | 2585164876 | 371 |
| 588 | iso_pu_bacteria | 2582581298 | 2585226262 | 371 |
| 589 | iso_pu_bacteria | 2582581299 | 2585230340 | 371 |
| 590 | iso_pu_bacteria | 2582581305 | 2585260947 | 371 |
| 591 | iso_pu_bacteria | 2582581306 | 2585265254 | 371 |
| 592 | iso_pu_bacteria | 2582581865 | 2585385612 | 371 |
| 593 | iso_pu_bacteria | 2582581866 | 2585396999 | 371 |
| 594 | iso_pu_bacteria | 2582581867 | 2585401642 | 371 |
| 595 | iso_pu_bacteria | 2585427529 | 2585548818 | 371 |
| 596 | iso_pu_bacteria | 2585427590 | 2585821336 | 371 |
| 597 | iso_pu_bacteria | 2588253730 | 2588513652 | 371 |
| 598 | iso_pu_bacteria | 2599185170 | 2599415321 | 371 |
| 599 | iso_pu_bacteria | 2599185210 | 2599605172 | 371 |
| 600 | iso_pu_bacteria | 2599185352 | 2600196506 | 371 |
| 601 | iso_pu_bacteria | 2600255279 | 2601611690 | 371 |
| 602 | iso_pu_bacteria | 2600255308 | 2601748758 | 371 |
| 603 | iso_pu_bacteria | 2643221558 | 2643812594 | 371 |
| 604 | iso_pu_bacteria | 2643221582 | 2643921751 | 371 |
| 605 | iso_pu_bacteria | 2643221607 | 2644047277 | 371 |
| 606 | iso_pu_bacteria | 2643221634 | 2644191887 | 371 |
| 607 | iso_pu_bacteria | 2643221636 | 2644199648 | 371 |
| 608 | iso_pu_bacteria | 2643221686 | 2644480066 | 371 |
| 609 | iso_pu_bacteria | 2643221689 | 2644496880 | 371 |
| 610 | iso_pu_bacteria | 2643221693 | 2644520418 | 371 |
| 611 | iso_pu_bacteria | 2643221723 | 2644674948 | 371 |
| 612 | iso_pu_bacteria | 2657244999 | 2657685096 | 371 |
| 613 | iso_pu_bacteria | 2751185800 | 2753361054 | 371 |
| 614 | iso_pu_bacteria | 2758568016 | 2758637817 | 371 |
| 615 | iso_pu_bacteria | 2775506902 | 2776268044 | 371 |
| 616 | iso_pu_bacteria | 2775506904 | 2776283391 | 371 |
| 617 | iso_pu_bacteria | 2791355091 | 2792620433 | 371 |
| 618 | iso_pu_bacteria | 2791355092 | 2792625791 | 371 |
| 619 | iso_pu_bacteria | 2791355094 | 2792638736 | 371 |
| 620 | iso_pu_bacteria | 2791355094 | 2792642912 | 371 |
| 621 | iso_pu_bacteria | 2791355123 | 2792750992 | 371 |
| 622 | iso_pu_bacteria | 2791355263 | 2793344653 | 371 |
| 623 | iso_pu_bacteria | 2802429268 | 2804754929 | 371 |
| 624 | iso_pu_bacteria | 2808606387 | 2808988833 | 371 |
| 625 | iso_pu_bacteria | 2818991439 | 2819561301 | 371 |
| 626 | iso_pu_bacteria | 2838035591 | 2838038954 | 371 |
| 627 | iso_pu_bacteria | 2838661181 | 2838664454 | 371 |
| 628 | iso_pu_bacteria | 2838675328 | 2838679547 | 371 |
| 629 | iso_pu_bacteria | 2838714209 | 2838718904 | 371 |
| 630 | iso_pu_bacteria | 2838719591 | 2838723903 | 371 |
| 631 | iso_pu_bacteria | 2838724970 | 2838729225 | 371 |
| 632 | iso_pu_bacteria | 2841846520 | 2841851005 | 371 |
| 633 | iso_pu_bacteria | 2841859092 | 2841863813 | 371 |
| 634 | iso_pu_bacteria | 2842124991 | 2842129924 | 371 |
| 635 | iso_pu_bacteria | 2842130223 | 2842134334 | 371 |
| 636 | iso_pu_bacteria | 2842152218 | 2842156330 | 371 |
| 637 | iso_pu_bacteria | 2842170452 | 2842175150 | 371 |
| 638 | iso_pu_bacteria | 2842175837 | 2842180066 | 371 |
| 639 | iso_pu_bacteria | 2842187318 | 2842191515 | 371 |
| 640 | iso_pu_bacteria | 2842211629 | 2842215832 | 371 |
| 641 | iso_pu_bacteria | 2842224351 | 2842228668 | 371 |
| 642 | iso_pu_bacteria | 2842298080 | 2842303339 | 371 |
| 643 | iso_pu_bacteria | 2842357229 | 2842362062 | 371 |
| 644 | iso_pu_bacteria | 2842515876 | 2842520595 | 371 |
| 645 | iso_pu_bacteria | 2842521101 | 2842524900 | 371 |
| 646 | iso_pu_bacteria | 2844163670 | 2844168838 | 371 |
| 647 | iso_pu_bacteria | 2847417321 | 2847419812 | 371 |
| 648 | iso_pu_bacteria | 2848992105 | 2848994828 | 371 |
| 649 | iso_pu_bacteria | 2855872281 | 2855877328 | 371 |
| 650 | iso_pu_bacteria | 2856356410 | 2856360667 | 371 |
| 651 | iso_pu_bacteria | 2856364286 | 2856368382 | 371 |
| 652 | iso_pu_bacteria | 2857349434 | 2857350107 | 371 |
| 653 | iso_pu_bacteria | 2869285874 | 2869289943 | 371 |
| 654 | iso_pu_bacteria | 2871429161 | 2871434162 | 371 |
| 655 | iso_pu_bacteria | 2874146452 | 2874152115 | 371 |
| 656 | iso_pu_bacteria | 2874155637 | 2874158781 | 371 |
| 657 | iso_pu_bacteria | 2876363079 | 2876365294 | 371 |
| 658 | iso_pu_bacteria | 2876413966 | 2876418105 | 371 |
| 659 | iso_pu_bacteria | 2878745973 | 2878749088 | 371 |
| 660 | iso_pu_bacteria | 2881147464 | 2881154544 | 371 |
| 661 | iso_pu_bacteria | 2881845957 | 2881852336 | 371 |
| 662 | iso_pu_bacteria | 2885318864 | 2885324567 | 371 |
| 663 | iso_pu_bacteria | 2899275550 | 2899276798 | 371 |
| 664 | iso_pu_bacteria | 2899792073 | 2899793252 | 371 |
| 665 | iso_pu_bacteria | 2899845264 | 2899850513 | 371 |
| 666 | iso_pu_bacteria | 2903448605 | 2903455848 | 371 |
| 667 | iso_pu_bacteria | 2903492973 | 2903505053 | 371 |
| 668 | iso_pu_bacteria | 2903528002 | 2903529945 | 371 |
| 669 | iso_pu_bacteria | 2904659560 | 2904662714 | 371 |
| 670 | iso_pu_bacteria | 2906308376 | 2906311413 | 371 |
| 671 | iso_pu_bacteria | 2906321335 | 2906326859 | 371 |
| 672 | iso_pu_bacteria | 2919114240 | 2919118721 | 371 |
| 673 | iso_pu_bacteria | 2920822456 | 2920827749 | 371 |
| 674 | iso_pu_bacteria | 2923556063 | 2923556768 | 371 |
| 675 | iso_pu_bacteria | 2926754445 | 2926758271 | 371 |
| 676 | iso_pu_bacteria | 2926760298 | 2926764177 | 371 |
| 677 | iso_pu_bacteria | 2933006813 | 2933011104 | 371 |
| 678 | iso_pu_bacteria | 2933011516 | 2933016356 | 371 |
| 679 | iso_pu_bacteria | 2933016740 | 2933021554 | 371 |
| 680 | iso_pu_bacteria | 2933594066 | 2933599070 | 371 |
| 681 | iso_pu_bacteria | 2937813078 | 2937816768 | 371 |
| 682 | iso_pu_bacteria | 2958100919 | 2958107768 | 371 |
| 683 | iso_pu_bacteria | 2958130278 | 2958134315 | 371 |
| 684 | iso_pu_bacteria | 2958144490 | 2958150337 | 371 |
| 685 | iso_pu_bacteria | 2958172287 | 2958172517 | 371 |
| 686 | iso_pu_bacteria | 2958179912 | 2958183167 | 371 |
| 687 | iso_pu_bacteria | 2960637947 | 2960643146 | 371 |
| 688 | iso_pu_bacteria | 2961077736 | 2961081134 | 371 |
| 689 | iso_pu_bacteria | 2961114664 | 2961117694 | 371 |
| 690 | iso_pu_bacteria | 2964628898 | 2964629397 | 371 |
| 691 | iso_pu_bacteria | 2964719344 | 2964724875 | 371 |
| 692 | iso_pu_bacteria | 2968083720 | 2968085766 | 371 |
| 693 | iso_pu_bacteria | 2968091066 | 2968091121 | 371 |
| 694 | iso_pu_bacteria | 2968110612 | 2968113789 | 371 |
| 695 | iso_pu_bacteria | 2968128360 | 2968134371 | 371 |
| 696 | iso_pu_bacteria | 2977828996 | 2977834573 | 371 |
| 697 | iso_pu_bacteria | 2977843712 | 2977844035 | 371 |
| 698 | iso_pu_bacteria | 2977864932 | 2977867279 | 371 |
| 699 | iso_pu_bacteria | 2977942078 | 2977947212 | 371 |
| 700 | iso_pu_bacteria | 2979089926 | 2979090724 | 371 |
| 701 | iso_pu_bacteria | 2979095461 | 2979096247 | 371 |
| 702 | iso_pu_bacteria | 2979100975 | 2979101794 | 371 |
| 703 | iso_pu_bacteria | 2979710463 | 2979717417 | 371 |
| 704 | iso_pu_bacteria | 2984509177 | 2984510271 | 371 |
| 705 | iso_pu_bacteria | 2984518228 | 2984519024 | 371 |
| 706 | iso_pu_bacteria | 2984537506 | 2984538620 | 371 |
| 707 | iso_pu_bacteria | 2984601300 | 2984605328 | 371 |
| 708 | iso_pu_bacteria | 2987636660 | 2987637254 | 371 |
| 709 | iso_pu_bacteria | 2996887358 | 2996888614 | 371 |
| 710 | iso_pu_bacteria | 3002141150 | 3002145731 | 371 |
| 711 | iso_pu_bacteria | 3004203850 | 3004204145 | 371 |
| 712 | iso_pu_bacteria | 3005416602 | 3005423545 | 371 |
| 713 | iso_pu_bacteria | 637000159 | 637077896 | 371 |
| 714 | iso_pu_bacteria | 637000159 | 637080195 | 371 |
| 715 | iso_pu_bacteria | 643692032 | 643826708 | 371 |
| 716 | iso_pu_bacteria | 650716007 | 650843636 | 371 |
| 717 | iso_pu_bacteria | 8002060224 | 8002060712 | 371 |
| 718 | iso_pu_bacteria | 8003570095 | 8003574099 | 371 |
| 719 | iso_pu_bacteria | 8004387939 | 8004392128 | 371 |
| 720 | iso_pu_bacteria | 8004703790 | 8004705248 | 371 |
| 721 | iso_pu_bacteria | 8004714634 | 8004717769 | 371 |
| 722 | iso_pu_bacteria | 8005258706 | 8005264461 | 371 |
| 723 | iso_pu_bacteria | 8005314921 | 8005321091 | 371 |
| 724 | iso_pu_bacteria | 8005321885 | 8005323141 | 371 |
| 725 | iso_pu_bacteria | 8005484373 | 8005487926 | 371 |
| 726 | iso_pu_bacteria | 8046767195 | 8046770595 | 371 |
| 727 | iso_pu_bacteria | 8049293176 | 8049298053 | 371 |
| 728 | iso_pu_bacteria | 8057575449 | 8057578381 | 371 |
| 729 | 3300001989 | JGI24739J22299_10003198 | JGI24739J22299_100031983 | 372 |
| 730 | 3300001990 | JGI24737J22298_10003438 | JGI24737J22298_100034382 | 372 |
| 731 | 3300001990 | JGI24737J22298_10008136 | JGI24737J22298_100081363 | 372 |
| 732 | 3300002773 | JGI25152J39213_1002260 | JGI25152J39213_10022607 | 372 |
| 733 | 3300002987 | JGI25159J45721_1000783 | JGI25159J45721_100078311 | 372 |
| 734 | 3300003215 | JGI25153J46596_10000008 | JGI25153J46596_10000008335 | 372 |
| 735 | 3300003215 | JGI25153J46596_10004902 | JGI25153J46596_100049024 | 372 |
| 736 | 3300003322 | rootL2_10163604 | rootL2_101636043 | 372 |
| 737 | 3300003354 | JGI25160J50197_1003719 | JGI25160J50197_10037195 | 372 |
| 738 | 3300003374 | JGI25161J50226_1000010 | JGI25161J50226_1000010102 | 372 |
| 739 | 3300003762 | Ga0055542_1000123 | Ga0055542_100012336 | 372 |
| 740 | 3300003763 | Ga0055529_1000144 | Ga0055529_100014436 | 372 |
| 741 | 3300003771 | Ga0055526_1005251 | Ga0055526_10052514 | 372 |
| 742 | 3300004625 | Ga0055543_1000064 | Ga0055543_100006441 | 372 |
| 743 | 3300005262 | Ga0065165_1009795 | Ga0065165_10097953 | 372 |
| 744 | 3300005328 | Ga0070676_10017191 | Ga0070676_100171912 | 372 |
| 745 | 3300005331 | Ga0070670_100042311 | Ga0070670_1000423114 | 372 |
| 746 | 3300005335 | Ga0070666_10046068 | Ga0070666_100460683 | 372 |
| 747 | 3300005335 | Ga0070666_10089550 | Ga0070666_100895503 | 372 |
| 748 | 3300005338 | Ga0068868_100221914 | Ga0068868_1002219141 | 372 |
| 749 | 3300005338 | Ga0068868_100358336 | Ga0068868_1003583361 | 372 |
| 750 | 3300005339 | Ga0070660_100054269 | Ga0070660_1000542692 | 372 |
| 751 | 3300005339 | Ga0070660_100244572 | Ga0070660_1002445721 | 372 |
| 752 | 3300005344 | Ga0070661_100015865 | Ga0070661_1000158654 | 372 |
| 753 | 3300005347 | Ga0070668_100118204 | Ga0070668_1001182042 | 372 |
| 754 | 3300005354 | Ga0070675_100132388 | Ga0070675_1001323882 | 372 |
| 755 | 3300005366 | Ga0070659_100054816 | Ga0070659_1000548162 | 372 |
| 756 | 3300005456 | Ga0070678_100000413 | Ga0070678_1000004136 | 372 |
| 757 | 3300005456 | Ga0070678_100006179 | Ga0070678_1000061794 | 372 |
| 758 | 3300005456 | Ga0070678_100066125 | Ga0070678_1000661253 | 372 |
| 759 | 3300005458 | Ga0070681_10246910 | Ga0070681_102469101 | 372 |
| 760 | 3300005459 | Ga0068867_100078471 | Ga0068867_1000784712 | 372 |
| 761 | 3300005530 | Ga0070679_100002275 | Ga0070679_1000022754 | 372 |
| 762 | 3300005530 | Ga0070679_100056063 | Ga0070679_1000560634 | 372 |
| 763 | 3300005535 | Ga0070684_100092842 | Ga0070684_1000928422 | 372 |
| 764 | 3300005548 | Ga0070665_100000023 | Ga0070665_10000002366 | 372 |
| 765 | 3300005548 | Ga0070665_100001971 | Ga0070665_1000019719 | 372 |
| 766 | 3300005548 | Ga0070665_100014237 | Ga0070665_1000142377 | 372 |
| 767 | 3300005548 | Ga0070665_100169754 | Ga0070665_1001697543 | 372 |
| 768 | 3300005563 | Ga0068855_100098645 | Ga0068855_1000986453 | 372 |
| 769 | 3300005577 | Ga0068857_100072443 | Ga0068857_1000724433 | 372 |
| 770 | 3300005578 | Ga0068854_100009241 | Ga0068854_1000092419 | 372 |
| 771 | 3300005614 | Ga0068856_100535407 | Ga0068856_1005354071 | 372 |
| 772 | 3300006048 | Ga0075363_100004343 | Ga0075363_1000043435 | 372 |
| 773 | 3300006051 | Ga0075364_10097247 | Ga0075364_100972472 | 372 |
| 774 | 3300006177 | Ga0075362_10000064 | Ga0075362_100000643 | 372 |
| 775 | 3300006186 | Ga0075369_10009043 | Ga0075369_100090433 | 372 |
| 776 | 3300006195 | Ga0075366_10000133 | Ga0075366_100001338 | 372 |
| 777 | 3300006237 | Ga0097621_100000498 | Ga0097621_10000049820 | 372 |
| 778 | 3300006237 | Ga0097621_100013282 | Ga0097621_1000132822 | 372 |
| 779 | 3300006237 | Ga0097621_100144718 | Ga0097621_1001447183 | 372 |
| 780 | 3300006353 | Ga0075370_10000015 | Ga0075370_1000001554 | 372 |
| 781 | 3300006358 | Ga0068871_100000406 | Ga0068871_10000040621 | 372 |
| 782 | 3300006358 | Ga0068871_100010613 | Ga0068871_1000106133 | 372 |
| 783 | 3300009148 | Ga0105243_10000192 | Ga0105243_1000019269 | 372 |
| 784 | 3300009553 | Ga0105249_10159348 | Ga0105249_101593482 | 372 |
| 785 | 3300013102 | Ga0157371_10000138 | Ga0157371_1000013859 | 372 |
| 786 | 3300013104 | Ga0157370_10218841 | Ga0157370_102188412 | 372 |
| 787 | 3300014969 | Ga0157376_10075409 | Ga0157376_100754092 | 372 |
| 788 | 3300017792 | Ga0163161_10057497 | Ga0163161_100574972 | 372 |
| 789 | 3300025208 | Ga0209436_100126 | Ga0209436_10012621 | 372 |
| 790 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011799 | 372 |
| 791 | 3300025258 | Ga0209129_1002843 | Ga0209129_10028437 | 372 |
| 792 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006394 | 372 |
| 793 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001525 | 372 |
| 794 | 3300025295 | Ga0209564_1007547 | Ga0209564_10075475 | 372 |
| 795 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017692 | 372 |
| 796 | 3300025297 | Ga0209758_1004381 | Ga0209758_10043819 | 372 |
| 797 | 3300025299 | Ga0209256_1011274 | Ga0209256_10112742 | 372 |
| 798 | 3300025302 | Ga0207426_1000045 | Ga0207426_1000045134 | 372 |
| 799 | 3300025901 | Ga0207688_10041105 | Ga0207688_100411052 | 372 |
| 800 | 3300025903 | Ga0207680_10013481 | Ga0207680_100134813 | 372 |
| 801 | 3300025904 | Ga0207647_10116069 | Ga0207647_101160692 | 372 |
| 802 | 3300025907 | Ga0207645_10032980 | Ga0207645_100329803 | 372 |
| 803 | 3300025909 | Ga0207705_10005207 | Ga0207705_100052077 | 372 |
| 804 | 3300025912 | Ga0207707_10246650 | Ga0207707_102466501 | 372 |
| 805 | 3300025913 | Ga0207695_10147102 | Ga0207695_101471022 | 372 |
| 806 | 3300025914 | Ga0207671_10009634 | Ga0207671_100096347 | 372 |
| 807 | 3300025919 | Ga0207657_10227081 | Ga0207657_102270812 | 372 |
| 808 | 3300025920 | Ga0207649_10002019 | Ga0207649_100020193 | 372 |
| 809 | 3300025921 | Ga0207652_10114658 | Ga0207652_101146582 | 372 |
| 810 | 3300025925 | Ga0207650_10147411 | Ga0207650_101474112 | 372 |
| 811 | 3300025926 | Ga0207659_10111542 | Ga0207659_101115422 | 372 |
| 812 | 3300025932 | Ga0207690_10007651 | Ga0207690_100076516 | 372 |
| 813 | 3300025933 | Ga0207706_10019021 | Ga0207706_100190213 | 372 |
| 814 | 3300025935 | Ga0207709_10000503 | Ga0207709_100005036 | 372 |
| 815 | 3300025937 | Ga0207669_10000100 | Ga0207669_1000010044 | 372 |
| 816 | 3300025937 | Ga0207669_10000461 | Ga0207669_1000046114 | 372 |
| 817 | 3300025945 | Ga0207679_10051529 | Ga0207679_100515292 | 372 |
| 818 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002524 | 372 |
| 819 | 3300025949 | Ga0207667_10157687 | Ga0207667_101576873 | 372 |
| 820 | 3300025972 | Ga0207668_10060594 | Ga0207668_100605943 | 372 |
| 821 | 3300025981 | Ga0207640_10074572 | Ga0207640_100745723 | 372 |
| 822 | 3300026041 | Ga0207639_10001988 | Ga0207639_100019886 | 372 |
| 823 | 3300026067 | Ga0207678_10001105 | Ga0207678_1000110513 | 372 |
| 824 | 3300026089 | Ga0207648_10112303 | Ga0207648_101123032 | 372 |
| 825 | 3300026116 | Ga0207674_10078586 | Ga0207674_100785863 | 372 |
| 826 | 3300026121 | Ga0207683_10009115 | Ga0207683_100091156 | 372 |
| 827 | 3300026121 | Ga0207683_10016012 | Ga0207683_100160122 | 372 |
| 828 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021412 | 372 |
| 829 | 3300028379 | Ga0268266_10000505 | Ga0268266_1000050515 | 372 |
| 830 | 3300028379 | Ga0268266_10008793 | Ga0268266_100087939 | 372 |
| 831 | 3300028379 | Ga0268266_10132273 | Ga0268266_101322732 | 372 |
| 832 | 3300028379 | Ga0268266_10317952 | Ga0268266_103179522 | 372 |
| 833 | 3300028786 | Ga0307517_10066936 | Ga0307517_100669362 | 372 |
| 834 | 3300028786 | Ga0307517_10123559 | Ga0307517_101235592 | 372 |
| 835 | 3300031456 | Ga0307513_10047620 | Ga0307513_100476202 | 372 |
| 836 | 3300041413 | Ga0439465_0004120 | Ga0439465_0004120_3285_4427 | 372 |
| 837 | 3300044694 | Ga0466963_0006909 | Ga0466963_0006909_136_1287 | 372 |
| 838 | 3300045976 | Ga0466967_0026329 | Ga0466967_0026329_3045_4196 | 372 |
| 839 | 3300046471 | Ga0495650_0000172 | Ga0495650_0000172_4797_5948 | 372 |
| 840 | 3300046491 | Ga0495584_0046587 | Ga0495584_0046587_124_1275 | 372 |
| 841 | 3300046492 | Ga0495585_0015028 | Ga0495585_0015028_2238_3389 | 372 |
| 842 | 3300046506 | Ga0495583_0001819 | Ga0495583_0001819_2088_3239 | 372 |
| 843 | 3300046506 | Ga0495583_0012705 | Ga0495583_0012705_1617_2768 | 372 |
| 844 | 3300046506 | Ga0495583_0033366 | Ga0495583_0033366_839_1990 | 372 |
| 845 | 3300046507 | Ga0495606_0002807 | Ga0495606_0002807_4804_5955 | 372 |
| 846 | 3300046507 | Ga0495606_0013347 | Ga0495606_0013347_3432_4583 | 372 |
| 847 | 3300046507 | Ga0495606_0032790 | Ga0495606_0032790_965_2116 | 372 |
| 848 | 3300046518 | Ga0495631_0012838 | Ga0495631_0012838_2317_3468 | 372 |
| 849 | 3300046522 | Ga0495643_0011121 | Ga0495643_0011121_2340_3491 | 372 |
| 850 | 3300046524 | Ga0495648_0000993 | Ga0495648_0000993_4867_6018 | 372 |
| 851 | 3300046524 | Ga0495648_0077423 | Ga0495648_0077423_49_1200 | 372 |
| 852 | 3300046525 | Ga0495663_0004862 | Ga0495663_0004862_1877_3028 | 372 |
| 853 | 3300046528 | Ga0495642_0035268 | Ga0495642_0035268_260_1411 | 372 |
| 854 | 3300046557 | Ga0495622_0004872 | Ga0495622_0004872_1429_2580 | 372 |
| 855 | 3300046558 | Ga0495633_0004038 | Ga0495633_0004038_5129_6280 | 372 |
| 856 | 3300046558 | Ga0495633_0023728 | Ga0495633_0023728_1808_2974 | 372 |
| 857 | 3300046616 | Ga0495668_0000080 | Ga0495668_0000080_111941_113092 | 372 |
| 858 | 3300046616 | Ga0495668_0143433 | Ga0495668_0143433_124_1275 | 372 |
| 859 | 3300046660 | Ga0495625_0001091 | Ga0495625_0001091_5870_7021 | 372 |
| 860 | 3300046660 | Ga0495625_0010254 | Ga0495625_0010254_911_2062 | 372 |
| 861 | 3300046684 | Ga0495669_0000214 | Ga0495669_0000214_29502_30653 | 372 |
| 862 | 3300046694 | Ga0495649_0039161 | Ga0495649_0039161_174_1325 | 372 |
| 863 | 3300046809 | Ga0495600_0012916 | Ga0495600_0012916_927_2078 | 372 |
| 864 | 3300047443 | Ga0495687_001639 | Ga0495687_001639_4971_6122 | 372 |
| 865 | 3300047443 | Ga0495687_006734 | Ga0495687_006734_3609_4760 | 372 |
| 866 | 3300047445 | Ga0495677_0006070 | Ga0495677_0006070_1845_2996 | 372 |
| 867 | 3300047470 | Ga0495681_0010003 | Ga0495681_0010003_2203_3354 | 372 |
| 868 | 3300048905 | Ga0496102_0000213 | Ga0496102_0000213_53769_54920 | 372 |
| 869 | 3300048906 | Ga0496103_0000782 | Ga0496103_0000782_3722_4873 | 372 |
| 870 | 3300048907 | Ga0496104_0023140 | Ga0496104_0023140_1985_3136 | 372 |
| 871 | 3300048917 | Ga0496114_0025240 | Ga0496114_0025240_3629_4780 | 372 |
| 872 | 3300048918 | Ga0496115_0000785 | Ga0496115_0000785_18514_19665 | 372 |
| 873 | 3300048919 | Ga0496116_0006359 | Ga0496116_0006359_9584_10735 | 372 |
| 874 | 3300048920 | Ga0496117_0002444 | Ga0496117_0002444_3681_4832 | 372 |
| 875 | 3300048921 | Ga0496118_0000207 | Ga0496118_0000207_47117_48268 | 372 |
| 876 | 3300048922 | Ga0496119_0012665 | Ga0496119_0012665_851_2002 | 372 |
| 877 | 3300048923 | Ga0496120_0014878 | Ga0496120_0014878_1624_2775 | 372 |
| 878 | 3300048924 | Ga0496121_0002349 | Ga0496121_0002349_3668_4819 | 372 |
| 879 | 3300048925 | Ga0496122_0029086 | Ga0496122_0029086_1571_2722 | 372 |
| 880 | 3300048926 | Ga0496123_0010458 | Ga0496123_0010458_4555_5706 | 372 |
| 881 | 3300048927 | Ga0496124_0001031 | Ga0496124_0001031_39295_40446 | 372 |
| 882 | 3300048928 | Ga0496125_0002742 | Ga0496125_0002742_4647_5798 | 372 |
| 883 | 3300048929 | Ga0496126_0002687 | Ga0496126_0002687_18678_19829 | 372 |
| 884 | 3300049569 | Ga0501032_0016935 | Ga0501032_0016935_3114_4250 | 372 |
| 885 | 3300049570 | Ga0501033_0050570 | Ga0501033_0050570_1916_3058 | 372 |
| 886 | 3300049571 | Ga0501034_0037717 | Ga0501034_0037717_2435_3571 | 372 |
| 887 | 3300049572 | Ga0501036_0017675 | Ga0501036_0017675_3206_4342 | 372 |
| 888 | 3300049575 | Ga0501039_0030137 | Ga0501039_0030137_1049_2185 | 372 |
| 889 | 3300049579 | Ga0501043_0092094 | Ga0501043_0092094_1201_2343 | 372 |
| 890 | 3300049580 | Ga0501046_0088409 | Ga0501046_0088409_878_2020 | 372 |
| 891 | 3300049822 | Ga0501035_0005333 | Ga0501035_0005333_2885_4021 | 372 |
| 892 | 3300049822 | Ga0501035_0012722 | Ga0501035_0012722_6028_7170 | 372 |
| 893 | 3300049823 | Ga0501044_0002233 | Ga0501044_0002233_11368_12504 | 372 |
| 894 | 3300050489 | nmdc:mga03683_113_c1 | nmdc:mga03683_113_c1_23803_24951 | 372 |
| 895 | 3300050490 | nmdc:mga03n38_2972_c1 | nmdc:mga03n38_2972_c1_1080_2228 | 372 |
| 896 | 3300050491 | nmdc:mga00v17_128953_c1 | nmdc:mga00v17_128953_c1_398_1546 | 372 |
| 897 | 3300050493 | nmdc:mga0k408_9_c2 | nmdc:mga0k408_9_c2_15803_16951 | 372 |
| 898 | 3300050496 | nmdc:mga07m45_13_c1 | nmdc:mga07m45_13_c1_48078_49226 | 372 |
| 899 | 3300050516 | nmdc:mga0sz30_253_c2 | nmdc:mga0sz30_253_c2_3765_4913 | 372 |
| 900 | 3300053079 | Ga0500610_0000034 | Ga0500610_0000034_24901_26052 | 372 |
| 901 | 3300053094 | Ga0500566_0008535 | Ga0500566_0008535_1317_2450 | 372 |
| 902 | 3300053096 | Ga0500641_0014493 | Ga0500641_0014493_295_1449 | 372 |
| 903 | 3300053119 | Ga0500595_001745 | Ga0500595_001745_5734_6885 | 372 |
| 904 | 3300053136 | Ga0500559_0116722 | Ga0500559_0116722_102_1223 | 372 |
| 905 | 3300053140 | Ga0500573_0000015 | Ga0500573_0000015_153283_154407 | 372 |
| 906 | 3300053177 | Ga0500636_0006352 | Ga0500636_0006352_2319_3485 | 372 |
| 907 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_48366_49517 | 372 |
| 908 | 3300060353 | Ga0501082_0032979 | Ga0501082_0032979_39_1175 | 372 |
| 909 | iso_pu_bacteria | 2891088606 | 2891093134 | 372 |
| 910 | 3300001976 | JGI24752J21851_1000987 | JGI24752J21851_10009871 | 373 |
| 911 | 3300003187 | JGI25151J46595_10004404 | JGI25151J46595_100044042 | 373 |
| 912 | 3300003187 | JGI25151J46595_10024486 | JGI25151J46595_100244861 | 373 |
| 913 | 3300003214 | JGI25165J46597_1000104 | JGI25165J46597_100010446 | 373 |
| 914 | 3300003354 | JGI25160J50197_1000005 | JGI25160J50197_1000005264 | 373 |
| 915 | 3300003354 | JGI25160J50197_1000103 | JGI25160J50197_100010346 | 373 |
| 916 | 3300003374 | JGI25161J50226_1000090 | JGI25161J50226_100009044 | 373 |
| 917 | 3300003374 | JGI25161J50226_1001080 | JGI25161J50226_10010807 | 373 |
| 918 | 3300003781 | Ga0055536_1011770 | Ga0055536_10117703 | 373 |
| 919 | 3300003781 | Ga0055536_1014539 | Ga0055536_10145393 | 373 |
| 920 | 3300003790 | Ga0055528_1004834 | Ga0055528_10048347 | 373 |
| 921 | 3300003856 | Ga0058692_1001612 | Ga0058692_10016129 | 373 |
| 922 | 3300004625 | Ga0055543_1000087 | Ga0055543_100008736 | 373 |
| 923 | 3300004625 | Ga0055543_1000863 | Ga0055543_10008638 | 373 |
| 924 | 3300005262 | Ga0065165_1000002 | Ga0065165_1000002127 | 373 |
| 925 | 3300005262 | Ga0065165_1000776 | Ga0065165_100077636 | 373 |
| 926 | 3300005262 | Ga0065165_1001281 | Ga0065165_10012813 | 373 |
| 927 | 3300005262 | Ga0065165_1007851 | Ga0065165_10078515 | 373 |
| 928 | 3300005262 | Ga0065165_1011637 | Ga0065165_10116374 | 373 |
| 929 | 3300005289 | Ga0065704_10086442 | Ga0065704_100864423 | 373 |
| 930 | 3300005331 | Ga0070670_100000169 | Ga0070670_10000016916 | 373 |
| 931 | 3300005347 | Ga0070668_100001209 | Ga0070668_10000120921 | 373 |
| 932 | 3300005353 | Ga0070669_100212821 | Ga0070669_1002128211 | 373 |
| 933 | 3300005353 | Ga0070669_100324816 | Ga0070669_1003248161 | 373 |
| 934 | 3300005355 | Ga0070671_100003166 | Ga0070671_1000031666 | 373 |
| 935 | 3300005355 | Ga0070671_100103294 | Ga0070671_1001032943 | 373 |
| 936 | 3300005366 | Ga0070659_100020104 | Ga0070659_1000201043 | 373 |
| 937 | 3300005367 | Ga0070667_100000322 | Ga0070667_10000032254 | 373 |
| 938 | 3300005455 | Ga0070663_100029469 | Ga0070663_1000294693 | 373 |
| 939 | 3300005546 | Ga0070696_100005838 | Ga0070696_1000058386 | 373 |
| 940 | 3300005548 | Ga0070665_100060637 | Ga0070665_1000606373 | 373 |
| 941 | 3300005563 | Ga0068855_100017039 | Ga0068855_1000170392 | 373 |
| 942 | 3300005578 | Ga0068854_100195991 | Ga0068854_1001959912 | 373 |
| 943 | 3300005617 | Ga0068859_100021274 | Ga0068859_1000212742 | 373 |
| 944 | 3300005617 | Ga0068859_100075652 | Ga0068859_1000756523 | 373 |
| 945 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004402 | 373 |
| 946 | 3300005618 | Ga0068864_100000870 | Ga0068864_10000087021 | 373 |
| 947 | 3300005618 | Ga0068864_100049297 | Ga0068864_1000492974 | 373 |
| 948 | 3300005618 | Ga0068864_100084553 | Ga0068864_1000845531 | 373 |
| 949 | 3300005618 | Ga0068864_100099687 | Ga0068864_1000996872 | 373 |
| 950 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002403 | 373 |
| 951 | 3300005841 | Ga0068863_100069839 | Ga0068863_1000698392 | 373 |
| 952 | 3300005841 | Ga0068863_100114929 | Ga0068863_1001149293 | 373 |
| 953 | 3300005842 | Ga0068858_100000022 | Ga0068858_100000022139 | 373 |
| 954 | 3300005842 | Ga0068858_100000222 | Ga0068858_10000022229 | 373 |
| 955 | 3300005844 | Ga0068862_100000002 | Ga0068862_10000000299 | 373 |
| 956 | 3300006177 | Ga0075362_10004725 | Ga0075362_100047253 | 373 |
| 957 | 3300006178 | Ga0075367_10000664 | Ga0075367_100006642 | 373 |
| 958 | 3300006178 | Ga0075367_10024153 | Ga0075367_100241533 | 373 |
| 959 | 3300006178 | Ga0075367_10176015 | Ga0075367_101760152 | 373 |
| 960 | 3300006931 | Ga0097620_100021274 | Ga0097620_1000212742 | 373 |
| 961 | 3300006931 | Ga0097620_100075651 | Ga0097620_1000756513 | 373 |
| 962 | 3300009011 | Ga0105251_10000342 | Ga0105251_1000034217 | 373 |
| 963 | 3300009098 | Ga0105245_10001826 | Ga0105245_100018265 | 373 |
| 964 | 3300009098 | Ga0105245_10010667 | Ga0105245_100106672 | 373 |
| 965 | 3300009177 | Ga0105248_10067604 | Ga0105248_100676045 | 373 |
| 966 | 3300009177 | Ga0105248_10409215 | Ga0105248_104092151 | 373 |
| 967 | 3300009551 | Ga0105238_10039059 | Ga0105238_100390593 | 373 |
| 968 | 3300009553 | Ga0105249_10000106 | Ga0105249_1000010624 | 373 |
| 969 | 3300009553 | Ga0105249_10069094 | Ga0105249_100690942 | 373 |
| 970 | 3300009765 | Ga0123341_1015241 | Ga0123341_10152413 | 373 |
| 971 | 3300009765 | Ga0123341_1026276 | Ga0123341_10262762 | 373 |
| 972 | 3300009766 | Ga0123342_1016039 | Ga0123342_10160393 | 373 |
| 973 | 3300011119 | Ga0105246_10000491 | Ga0105246_1000049114 | 373 |
| 974 | 3300013102 | Ga0157371_10000187 | Ga0157371_1000018772 | 373 |
| 975 | 3300013104 | Ga0157370_10000037 | Ga0157370_1000003776 | 373 |
| 976 | 3300013104 | Ga0157370_10000289 | Ga0157370_1000028915 | 373 |
| 977 | 3300013297 | Ga0157378_10049262 | Ga0157378_100492624 | 373 |
| 978 | 3300013306 | Ga0163162_10001728 | Ga0163162_1000172814 | 373 |
| 979 | 3300013306 | Ga0163162_10070659 | Ga0163162_100706591 | 373 |
| 980 | 3300013308 | Ga0157375_10094894 | Ga0157375_100948942 | 373 |
| 981 | 3300014325 | Ga0163163_10116377 | Ga0163163_101163771 | 373 |
| 982 | 3300014968 | Ga0157379_10068223 | Ga0157379_100682232 | 373 |
| 983 | 3300014968 | Ga0157379_10073045 | Ga0157379_100730452 | 373 |
| 984 | 3300021320 | Ga0214544_1000158 | Ga0214544_1000158108 | 373 |
| 985 | 3300021321 | Ga0214542_1001567 | Ga0214542_10015675 | 373 |
| 986 | 3300021327 | Ga0214543_1000234 | Ga0214543_100023420 | 373 |
| 987 | 3300021327 | Ga0214543_1001418 | Ga0214543_100141819 | 373 |
| 988 | 3300025208 | Ga0209436_100556 | Ga0209436_1005564 | 373 |
| 989 | 3300025258 | Ga0209129_1000082 | Ga0209129_100008292 | 373 |
| 990 | 3300025261 | Ga0209233_1000164 | Ga0209233_100016496 | 373 |
| 991 | 3300025273 | Ga0209673_1011852 | Ga0209673_10118522 | 373 |
| 992 | 3300025284 | Ga0209130_1000010 | Ga0209130_1000010125 | 373 |
| 993 | 3300025284 | Ga0209130_1000098 | Ga0209130_100009845 | 373 |
| 994 | 3300025291 | Ga0209675_1004347 | Ga0209675_10043472 | 373 |
| 995 | 3300025292 | Ga0209676_1000138 | Ga0209676_100013849 | 373 |
| 996 | 3300025292 | Ga0209676_1000148 | Ga0209676_100014873 | 373 |
| 997 | 3300025292 | Ga0209676_1001403 | Ga0209676_10014038 | 373 |
| 998 | 3300025292 | Ga0209676_1020842 | Ga0209676_10208422 | 373 |
| 999 | 3300025292 | Ga0209676_1031134 | Ga0209676_10311342 | 373 |
| 1000 | 3300025294 | Ga0209025_1000172 | Ga0209025_1000172151 | 373 |
| 1001 | 3300025294 | Ga0209025_1000234 | Ga0209025_10002349 | 373 |
| 1002 | 3300025294 | Ga0209025_1000689 | Ga0209025_100068929 | 373 |
| 1003 | 3300025295 | Ga0209564_1000025 | Ga0209564_1000025271 | 373 |
| 1004 | 3300025295 | Ga0209564_1002096 | Ga0209564_10020968 | 373 |
| 1005 | 3300025297 | Ga0209758_1006462 | Ga0209758_10064623 | 373 |
| 1006 | 3300025297 | Ga0209758_1018335 | Ga0209758_10183352 | 373 |
| 1007 | 3300025297 | Ga0209758_1039302 | Ga0209758_10393022 | 373 |
| 1008 | 3300025298 | Ga0209050_1000047 | Ga0209050_1000047114 | 373 |
| 1009 | 3300025298 | Ga0209050_1004457 | Ga0209050_10044579 | 373 |
| 1010 | 3300025298 | Ga0209050_1023211 | Ga0209050_10232112 | 373 |
| 1011 | 3300025299 | Ga0209256_1000311 | Ga0209256_100031111 | 373 |
| 1012 | 3300025302 | Ga0207426_1000036 | Ga0207426_1000036125 | 373 |
| 1013 | 3300025302 | Ga0207426_1000069 | Ga0207426_1000069215 | 373 |
| 1014 | 3300025302 | Ga0207426_1000968 | Ga0207426_100096818 | 373 |
| 1015 | 3300025303 | Ga0209051_1023758 | Ga0209051_10237582 | 373 |
| 1016 | 3300025304 | Ga0209257_1000076 | Ga0209257_100007670 | 373 |
| 1017 | 3300025735 | Ga0207713_1008759 | Ga0207713_10087592 | 373 |
| 1018 | 3300025924 | Ga0207694_10014727 | Ga0207694_100147274 | 373 |
| 1019 | 3300025925 | Ga0207650_10000294 | Ga0207650_1000029446 | 373 |
| 1020 | 3300025927 | Ga0207687_10001337 | Ga0207687_100013375 | 373 |
| 1021 | 3300025927 | Ga0207687_10077549 | Ga0207687_100775493 | 373 |
| 1022 | 3300025931 | Ga0207644_10000944 | Ga0207644_100009445 | 373 |
| 1023 | 3300025933 | Ga0207706_10072781 | Ga0207706_100727811 | 373 |
| 1024 | 3300025935 | Ga0207709_10013050 | Ga0207709_100130504 | 373 |
| 1025 | 3300025935 | Ga0207709_10026116 | Ga0207709_100261163 | 373 |
| 1026 | 3300025941 | Ga0207711_10007985 | Ga0207711_1000798512 | 373 |
| 1027 | 3300025941 | Ga0207711_10011245 | Ga0207711_100112452 | 373 |
| 1028 | 3300025941 | Ga0207711_10123872 | Ga0207711_101238723 | 373 |
| 1029 | 3300025949 | Ga0207667_10318729 | Ga0207667_103187292 | 373 |
| 1030 | 3300025961 | Ga0207712_10000224 | Ga0207712_1000022413 | 373 |
| 1031 | 3300025961 | Ga0207712_10082993 | Ga0207712_100829933 | 373 |
| 1032 | 3300025972 | Ga0207668_10000832 | Ga0207668_1000083221 | 373 |
| 1033 | 3300025981 | Ga0207640_10161164 | Ga0207640_101611641 | 373 |
| 1034 | 3300026035 | Ga0207703_10000048 | Ga0207703_1000004874 | 373 |
| 1035 | 3300026035 | Ga0207703_10000428 | Ga0207703_1000042831 | 373 |
| 1036 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002883 | 373 |
| 1037 | 3300026095 | Ga0207676_10000040 | Ga0207676_1000004078 | 373 |
| 1038 | 3300026095 | Ga0207676_10000270 | Ga0207676_1000027014 | 373 |
| 1039 | 3300026095 | Ga0207676_10128951 | Ga0207676_101289512 | 373 |
| 1040 | 3300027312 | Ga0209371_1000035 | Ga0209371_1000035174 | 373 |
| 1041 | 3300027312 | Ga0209371_1000901 | Ga0209371_10009012 | 373 |
| 1042 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003107 | 373 |
| 1043 | 3300028556 | Ga0265337_1018245 | Ga0265337_10182452 | 373 |
| 1044 | 3300028563 | Ga0265319_1012596 | Ga0265319_10125962 | 373 |
| 1045 | 3300028573 | Ga0265334_10003663 | Ga0265334_100036638 | 373 |
| 1046 | 3300028653 | Ga0265323_10000276 | Ga0265323_1000027610 | 373 |
| 1047 | 3300028666 | Ga0265336_10000268 | Ga0265336_100002688 | 373 |
| 1048 | 3300028786 | Ga0307517_10039586 | Ga0307517_100395861 | 373 |
| 1049 | 3300028786 | Ga0307517_10108979 | Ga0307517_101089792 | 373 |
| 1050 | 3300028794 | Ga0307515_10001309 | Ga0307515_1000130945 | 373 |
| 1051 | 3300028794 | Ga0307515_10011735 | Ga0307515_1001173517 | 373 |
| 1052 | 3300028794 | Ga0307515_10178793 | Ga0307515_101787932 | 373 |
| 1053 | 3300028800 | Ga0265338_10000280 | Ga0265338_1000028061 | 373 |
| 1054 | 3300029957 | Ga0265324_10006739 | Ga0265324_100067392 | 373 |
| 1055 | 3300030500 | Ga0268256_1000037 | Ga0268256_1000037173 | 373 |
| 1056 | 3300030500 | Ga0268256_1003747 | Ga0268256_10037477 | 373 |
| 1057 | 3300030744 | Ga0316181_1184579 | Ga0316181_11845792 | 373 |
| 1058 | 3300031241 | Ga0265325_10001237 | Ga0265325_1000123713 | 373 |
| 1059 | 3300031249 | Ga0265339_10004888 | Ga0265339_100048885 | 373 |
| 1060 | 3300031250 | Ga0265331_10006726 | Ga0265331_100067263 | 373 |
| 1061 | 3300031456 | Ga0307513_10002506 | Ga0307513_1000250620 | 373 |
| 1062 | 3300031456 | Ga0307513_10058104 | Ga0307513_100581043 | 373 |
| 1063 | 3300031548 | Ga0307408_100020170 | Ga0307408_1000201703 | 373 |
| 1064 | 3300031548 | Ga0307408_100029929 | Ga0307408_1000299293 | 373 |
| 1065 | 3300031616 | Ga0307508_10002027 | Ga0307508_100020273 | 373 |
| 1066 | 3300031711 | Ga0265314_10013928 | Ga0265314_100139282 | 373 |
| 1067 | 3300031730 | Ga0307516_10000075 | Ga0307516_1000007518 | 373 |
| 1068 | 3300031901 | Ga0307406_10031537 | Ga0307406_100315373 | 373 |
| 1069 | 3300031911 | Ga0307412_10025707 | Ga0307412_100257072 | 373 |
| 1070 | 3300032002 | Ga0307416_100016318 | Ga0307416_1000163183 | 373 |
| 1071 | 3300032004 | Ga0307414_10003589 | Ga0307414_100035893 | 373 |
| 1072 | 3300032004 | Ga0307414_10098008 | Ga0307414_100980082 | 373 |
| 1073 | 3300037466 | Ga0395898_0011345 | Ga0395898_0011345_7148_8314 | 373 |
| 1074 | 3300037471 | Ga0395905_0043737 | Ga0395905_0043737_2590_3714 | 373 |
| 1075 | 3300037471 | Ga0395905_0213062 | Ga0395905_0213062_181_1326 | 373 |
| 1076 | 3300041404 | Ga0439436_0002588 | Ga0439436_0002588_1286_2431 | 373 |
| 1077 | 3300042004 | Ga0439445_0007629 | Ga0439445_0007629_794_1942 | 373 |
| 1078 | 3300042007 | Ga0439449_0032077 | Ga0439449_0032077_461_1606 | 373 |
| 1079 | 3300042007 | Ga0439449_0044226 | Ga0439449_0044226_468_1616 | 373 |
| 1080 | 3300042531 | Ga0450918_001885 | Ga0450918_001885_1019_2164 | 373 |
| 1081 | 3300046476 | Ga0495662_0048142 | Ga0495662_0048142_594_1739 | 373 |
| 1082 | 3300046507 | Ga0495606_0067291 | Ga0495606_0067291_591_1715 | 373 |
| 1083 | 3300046522 | Ga0495643_0020159 | Ga0495643_0020159_2505_3650 | 373 |
| 1084 | 3300046542 | Ga0495597_0067954 | Ga0495597_0067954_86_1231 | 373 |
| 1085 | 3300046558 | Ga0495633_0006121 | Ga0495633_0006121_5903_7024 | 373 |
| 1086 | 3300046558 | Ga0495633_0020674 | Ga0495633_0020674_1871_3013 | 373 |
| 1087 | 3300046558 | Ga0495633_0050884 | Ga0495633_0050884_502_1644 | 373 |
| 1088 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_128043_129179 | 373 |
| 1089 | 3300046660 | Ga0495625_0000727 | Ga0495625_0000727_10773_11909 | 373 |
| 1090 | 3300046660 | Ga0495625_0039111 | Ga0495625_0039111_1002_2126 | 373 |
| 1091 | 3300046660 | Ga0495625_0039189 | Ga0495625_0039189_1765_2910 | 373 |
| 1092 | 3300046674 | Ga0495588_0001528 | Ga0495588_0001528_5769_6911 | 373 |
| 1093 | 3300046674 | Ga0495588_0023967 | Ga0495588_0023967_1772_2917 | 373 |
| 1094 | 3300046692 | Ga0495671_0046736 | Ga0495671_0046736_43_1185 | 373 |
| 1095 | 3300046694 | Ga0495649_0058484 | Ga0495649_0058484_188_1315 | 373 |
| 1096 | 3300047470 | Ga0495681_0008616 | Ga0495681_0008616_2572_3714 | 373 |
| 1097 | 3300048904 | Ga0496101_0040605 | Ga0496101_0040605_1086_2231 | 373 |
| 1098 | 3300048905 | Ga0496102_0213611 | Ga0496102_0213611_365_1522 | 373 |
| 1099 | 3300048907 | Ga0496104_0031887 | Ga0496104_0031887_913_2058 | 373 |
| 1100 | 3300048912 | Ga0496109_0181853 | Ga0496109_0181853_733_1887 | 373 |
| 1101 | 3300048914 | Ga0496111_0128100 | Ga0496111_0128100_67_1212 | 373 |
| 1102 | 3300048915 | Ga0496112_0088648 | Ga0496112_0088648_878_2002 | 373 |
| 1103 | 3300048919 | Ga0496116_0092699 | Ga0496116_0092699_558_1700 | 373 |
| 1104 | 3300048920 | Ga0496117_0000066 | Ga0496117_0000066_185294_186436 | 373 |
| 1105 | 3300048920 | Ga0496117_0006220 | Ga0496117_0006220_9388_10512 | 373 |
| 1106 | 3300048920 | Ga0496117_0114070 | Ga0496117_0114070_510_1655 | 373 |
| 1107 | 3300048921 | Ga0496118_0007705 | Ga0496118_0007705_6628_7770 | 373 |
| 1108 | 3300048921 | Ga0496118_0018005 | Ga0496118_0018005_751_1896 | 373 |
| 1109 | 3300048922 | Ga0496119_0006920 | Ga0496119_0006920_6170_7315 | 373 |
| 1110 | 3300048922 | Ga0496119_0022050 | Ga0496119_0022050_2955_4100 | 373 |
| 1111 | 3300048922 | Ga0496119_0050725 | Ga0496119_0050725_398_1543 | 373 |
| 1112 | 3300048922 | Ga0496119_0087073 | Ga0496119_0087073_528_1673 | 373 |
| 1113 | 3300048923 | Ga0496120_0000100 | Ga0496120_0000100_66073_67215 | 373 |
| 1114 | 3300048923 | Ga0496120_0073387 | Ga0496120_0073387_53_1198 | 373 |
| 1115 | 3300048924 | Ga0496121_0049074 | Ga0496121_0049074_1707_2852 | 373 |
| 1116 | 3300048925 | Ga0496122_0000057 | Ga0496122_0000057_66073_67215 | 373 |
| 1117 | 3300048925 | Ga0496122_0003976 | Ga0496122_0003976_4508_5653 | 373 |
| 1118 | 3300048926 | Ga0496123_0000096 | Ga0496123_0000096_106700_107842 | 373 |
| 1119 | 3300048926 | Ga0496123_0005631 | Ga0496123_0005631_4801_5946 | 373 |
| 1120 | 3300048926 | Ga0496123_0063861 | Ga0496123_0063861_453_1598 | 373 |
| 1121 | 3300048927 | Ga0496124_0012788 | Ga0496124_0012788_4246_5388 | 373 |
| 1122 | 3300048927 | Ga0496124_0039779 | Ga0496124_0039779_2364_3509 | 373 |
| 1123 | 3300048929 | Ga0496126_0050780 | Ga0496126_0050780_739_1884 | 373 |
| 1124 | 3300049513 | Ga0501290_000012 | Ga0501290_000012_17059_18183 | 373 |
| 1125 | 3300049515 | Ga0501292_000043 | Ga0501292_000043_12357_13481 | 373 |
| 1126 | 3300049523 | Ga0501300_000322 | Ga0501300_000322_5859_6983 | 373 |
| 1127 | 3300049570 | Ga0501033_0055294 | Ga0501033_0055294_154_1302 | 373 |
| 1128 | 3300049571 | Ga0501034_0000413 | Ga0501034_0000413_3531_4655 | 373 |
| 1129 | 3300049574 | Ga0501038_0208230 | Ga0501038_0208230_336_1460 | 373 |
| 1130 | 3300049653 | Ga0501206_000178 | Ga0501206_000178_3957_5081 | 373 |
| 1131 | 3300049662 | Ga0501222_000195 | Ga0501222_000195_1194_2318 | 373 |
| 1132 | 3300049663 | Ga0501223_001464 | Ga0501223_001464_1090_2214 | 373 |
| 1133 | 3300049664 | Ga0501224_000252 | Ga0501224_000252_3864_4988 | 373 |
| 1134 | 3300049688 | Ga0501259_000261 | Ga0501259_000261_5092_6216 | 373 |
| 1135 | 3300049690 | Ga0501261_000028 | Ga0501261_000028_19489_20613 | 373 |
| 1136 | 3300049705 | Ga0501225_0000335 | Ga0501225_0000335_6207_7331 | 373 |
| 1137 | 3300049775 | Ga0501279_000030 | Ga0501279_000030_23998_25122 | 373 |
| 1138 | 3300049776 | Ga0501280_000040 | Ga0501280_000040_24547_25671 | 373 |
| 1139 | 3300049777 | Ga0501281_00088 | Ga0501281_00088_7689_8813 | 373 |
| 1140 | 3300049778 | Ga0501282_000136 | Ga0501282_000136_7302_8426 | 373 |
| 1141 | 3300049779 | Ga0501283_000528 | Ga0501283_000528_1291_2415 | 373 |
| 1142 | 3300049822 | Ga0501035_0101787 | Ga0501035_0101787_806_1954 | 373 |
| 1143 | 3300049823 | Ga0501044_0052375 | Ga0501044_0052375_810_2009 | 373 |
| 1144 | 3300049823 | Ga0501044_0056167 | Ga0501044_0056167_975_2123 | 373 |
| 1145 | 3300050491 | nmdc:mga00v17_17_c1 | nmdc:mga00v17_17_c1_55819_56961 | 373 |
| 1146 | 3300050494 | nmdc:mga06z11_7485_c1 | nmdc:mga06z11_7485_c1_3177_4319 | 373 |
| 1147 | 3300050495 | nmdc:mga04h51_22235_c1 | nmdc:mga04h51_22235_c1_757_1899 | 373 |
| 1148 | 3300050516 | nmdc:mga0sz30_121_c1 | nmdc:mga0sz30_121_c1_19810_20952 | 373 |
| 1149 | 3300050516 | nmdc:mga0sz30_24246_c1 | nmdc:mga0sz30_24246_c1_839_1984 | 373 |
| 1150 | 3300053107 | Ga0500560_000810 | Ga0500560_000810_78_1220 | 373 |
| 1151 | 3300053107 | Ga0500560_001662 | Ga0500560_001662_624_1766 | 373 |
| 1152 | 3300053116 | Ga0500592_000077 | Ga0500592_000077_11162_12298 | 373 |
| 1153 | 3300053131 | Ga0500652_000014 | Ga0500652_000014_16904_18052 | 373 |
| 1154 | 3300053136 | Ga0500559_0099150 | Ga0500559_0099150_60_1184 | 373 |
| 1155 | 3300053137 | Ga0500561_0000278 | Ga0500561_0000278_6251_7393 | 373 |
| 1156 | 3300053139 | Ga0500568_0000872 | Ga0500568_0000872_5085_6221 | 373 |
| 1157 | 3300053139 | Ga0500568_0067331 | Ga0500568_0067331_139_1284 | 373 |
| 1158 | 3300053148 | Ga0500590_000841 | Ga0500590_000841_7457_8602 | 373 |
| 1159 | 3300053156 | Ga0500622_0001565 | Ga0500622_0001565_13445_14599 | 373 |
| 1160 | 3300053157 | Ga0500624_000003 | Ga0500624_000003_205679_206803 | 373 |
| 1161 | 3300053157 | Ga0500624_000011 | Ga0500624_000011_39427_40548 | 373 |
| 1162 | 3300053157 | Ga0500624_000443 | Ga0500624_000443_10725_11867 | 373 |
| 1163 | 3300053158 | Ga0500627_0000043 | Ga0500627_0000043_7080_8222 | 373 |
| 1164 | 3300053158 | Ga0500627_0012802 | Ga0500627_0012802_925_2052 | 373 |
| 1165 | 3300053158 | Ga0500627_0029037 | Ga0500627_0029037_1007_2143 | 373 |
| 1166 | 3300053161 | Ga0500634_0008457 | Ga0500634_0008457_431_1573 | 373 |
| 1167 | 3300053177 | Ga0500636_0085951 | Ga0500636_0085951_51_1199 | 373 |
| 1168 | 3300053178 | Ga0500637_0000045 | Ga0500637_0000045_16328_17452 | 373 |
| 1169 | iso_pu_bacteria | 2739367865 | 2740027423 | 373 |
| 1170 | iso_pu_bacteria | 2855020534 | 2855021162 | 373 |
| 1171 | iso_pu_bacteria | 2899259804 | 2899262073 | 373 |
| 1172 | iso_pu_bacteria | 2990265787 | 2990265916 | 373 |
| 1173 | iso_pu_bacteria | 2993693658 | 2993696293 | 373 |
| 1174 | 2162886007 | SwRhRL2b_contig_544056 | SwRhRL2b_0890.00002250 | 374 |
| 1175 | 3300001904 | JGI24736J21556_1015781 | JGI24736J21556_10157811 | 374 |
| 1176 | 3300001915 | JGI24741J21665_1005930 | JGI24741J21665_10059303 | 374 |
| 1177 | 3300001979 | JGI24740J21852_10000308 | JGI24740J21852_100003085 | 374 |
| 1178 | 3300001989 | JGI24739J22299_10006801 | JGI24739J22299_100068013 | 374 |
| 1179 | 3300001990 | JGI24737J22298_10001465 | JGI24737J22298_100014652 | 374 |
| 1180 | 3300002067 | JGI24735J21928_10001446 | JGI24735J21928_100014468 | 374 |
| 1181 | 3300002075 | JGI24738J21930_10001077 | JGI24738J21930_100010774 | 374 |
| 1182 | 3300005289 | Ga0065704_10001031 | Ga0065704_100010315 | 374 |
| 1183 | 3300005335 | Ga0070666_10007041 | Ga0070666_100070417 | 374 |
| 1184 | 3300005347 | Ga0070668_100000061 | Ga0070668_1000000617 | 374 |
| 1185 | 3300005347 | Ga0070668_100187455 | Ga0070668_1001874552 | 374 |
| 1186 | 3300005355 | Ga0070671_100004846 | Ga0070671_1000048463 | 374 |
| 1187 | 3300005366 | Ga0070659_100022429 | Ga0070659_1000224293 | 374 |
| 1188 | 3300005367 | Ga0070667_100001030 | Ga0070667_10000103017 | 374 |
| 1189 | 3300005455 | Ga0070663_100026232 | Ga0070663_1000262322 | 374 |
| 1190 | 3300005548 | Ga0070665_100003281 | Ga0070665_1000032817 | 374 |
| 1191 | 3300005841 | Ga0068863_100000053 | Ga0068863_100000053114 | 374 |
| 1192 | 3300005842 | Ga0068858_100028145 | Ga0068858_1000281454 | 374 |
| 1193 | 3300005843 | Ga0068860_100091566 | Ga0068860_1000915662 | 374 |
| 1194 | 3300006178 | Ga0075367_10042598 | Ga0075367_100425983 | 374 |
| 1195 | 3300009011 | Ga0105251_10003145 | Ga0105251_1000314515 | 374 |
| 1196 | 3300009174 | Ga0105241_10020587 | Ga0105241_100205873 | 374 |
| 1197 | 3300009177 | Ga0105248_10043322 | Ga0105248_100433223 | 374 |
| 1198 | 3300009551 | Ga0105238_10153934 | Ga0105238_101539342 | 374 |
| 1199 | 3300009553 | Ga0105249_10101973 | Ga0105249_101019733 | 374 |
| 1200 | 3300009553 | Ga0105249_10108871 | Ga0105249_101088711 | 374 |
| 1201 | 3300010375 | Ga0105239_10352621 | Ga0105239_103526211 | 374 |
| 1202 | 3300013104 | Ga0157370_10188461 | Ga0157370_101884611 | 374 |
| 1203 | 3300025229 | Ga0209147_101850 | Ga0209147_1018502 | 374 |
| 1204 | 3300025903 | Ga0207680_10004498 | Ga0207680_100044985 | 374 |
| 1205 | 3300025913 | Ga0207695_10078679 | Ga0207695_100786793 | 374 |
| 1206 | 3300025914 | Ga0207671_10124641 | Ga0207671_101246412 | 374 |
| 1207 | 3300025923 | Ga0207681_10094045 | Ga0207681_100940453 | 374 |
| 1208 | 3300025931 | Ga0207644_10123833 | Ga0207644_101238332 | 374 |
| 1209 | 3300025972 | Ga0207668_10000027 | Ga0207668_10000027114 | 374 |
| 1210 | 3300025986 | Ga0207658_10000853 | Ga0207658_1000085317 | 374 |
| 1211 | 3300026035 | Ga0207703_10027853 | Ga0207703_100278534 | 374 |
| 1212 | 3300026041 | Ga0207639_10001044 | Ga0207639_100010446 | 374 |
| 1213 | 3300026067 | Ga0207678_10008945 | Ga0207678_100089458 | 374 |
| 1214 | 3300026078 | Ga0207702_10005099 | Ga0207702_100050998 | 374 |
| 1215 | 3300026088 | Ga0207641_10000093 | Ga0207641_100000938 | 374 |
| 1216 | 3300026116 | Ga0207674_10154662 | Ga0207674_101546622 | 374 |
| 1217 | 3300027866 | Ga0209813_10000240 | Ga0209813_100002403 | 374 |
| 1218 | 3300028379 | Ga0268266_10129411 | Ga0268266_101294113 | 374 |
| 1219 | 3300028381 | Ga0268264_10020758 | Ga0268264_100207583 | 374 |
| 1220 | 3300031548 | Ga0307408_100137872 | Ga0307408_1001378722 | 374 |
| 1221 | 3300031731 | Ga0307405_10080332 | Ga0307405_100803322 | 374 |
| 1222 | 3300031911 | Ga0307412_10089214 | Ga0307412_100892142 | 374 |
| 1223 | 3300031911 | Ga0307412_10106867 | Ga0307412_101068672 | 374 |
| 1224 | 3300031995 | Ga0307409_100020314 | Ga0307409_1000203143 | 374 |
| 1225 | 3300032004 | Ga0307414_10057339 | Ga0307414_100573393 | 374 |
| 1226 | 3300032005 | Ga0307411_10259531 | Ga0307411_102595311 | 374 |
| 1227 | 3300032126 | Ga0307415_100346861 | Ga0307415_1003468611 | 374 |
| 1228 | 3300035695 | Ga0373927_0012559 | Ga0373927_0012559_3322_4455 | 374 |
| 1229 | 3300046452 | Ga0495617_015587 | Ga0495617_015587_509_1636 | 374 |
| 1230 | 3300046453 | Ga0495627_000225 | Ga0495627_000225_28128_29252 | 374 |
| 1231 | 3300046453 | Ga0495627_000324 | Ga0495627_000324_29240_30364 | 374 |
| 1232 | 3300046460 | Ga0495638_0000012 | Ga0495638_0000012_114828_115955 | 374 |
| 1233 | 3300046471 | Ga0495650_0003357 | Ga0495650_0003357_5595_6722 | 374 |
| 1234 | 3300046491 | Ga0495584_0022076 | Ga0495584_0022076_1363_2487 | 374 |
| 1235 | 3300046506 | Ga0495583_0001198 | Ga0495583_0001198_16833_17960 | 374 |
| 1236 | 3300046512 | Ga0495610_0000085 | Ga0495610_0000085_8162_9286 | 374 |
| 1237 | 3300046513 | Ga0495616_0000192 | Ga0495616_0000192_23722_24849 | 374 |
| 1238 | 3300046519 | Ga0495632_0000013 | Ga0495632_0000013_133454_134578 | 374 |
| 1239 | 3300046519 | Ga0495632_0000612 | Ga0495632_0000612_3803_4930 | 374 |
| 1240 | 3300046519 | Ga0495632_0032939 | Ga0495632_0032939_244_1368 | 374 |
| 1241 | 3300046520 | Ga0495637_0000100 | Ga0495637_0000100_17044_18168 | 374 |
| 1242 | 3300046520 | Ga0495637_0007164 | Ga0495637_0007164_4233_5357 | 374 |
| 1243 | 3300046520 | Ga0495637_0015444 | Ga0495637_0015444_1959_3092 | 374 |
| 1244 | 3300046522 | Ga0495643_0000010 | Ga0495643_0000010_271904_273028 | 374 |
| 1245 | 3300046524 | Ga0495648_0000038 | Ga0495648_0000038_75658_76785 | 374 |
| 1246 | 3300046524 | Ga0495648_0000933 | Ga0495648_0000933_7065_8189 | 374 |
| 1247 | 3300046524 | Ga0495648_0051791 | Ga0495648_0051791_696_1979 | 374 |
| 1248 | 3300046525 | Ga0495663_0000004 | Ga0495663_0000004_240718_241842 | 374 |
| 1249 | 3300046558 | Ga0495633_0000092 | Ga0495633_0000092_109133_110257 | 374 |
| 1250 | 3300046558 | Ga0495633_0001757 | Ga0495633_0001757_9593_10717 | 374 |
| 1251 | 3300046558 | Ga0495633_0005139 | Ga0495633_0005139_4943_6070 | 374 |
| 1252 | 3300046558 | Ga0495633_0018058 | Ga0495633_0018058_2102_3226 | 374 |
| 1253 | 3300046616 | Ga0495668_0015691 | Ga0495668_0015691_1866_2999 | 374 |
| 1254 | 3300046616 | Ga0495668_0063372 | Ga0495668_0063372_563_1696 | 374 |
| 1255 | 3300046616 | Ga0495668_0068429 | Ga0495668_0068429_738_1865 | 374 |
| 1256 | 3300046684 | Ga0495669_0007253 | Ga0495669_0007253_2844_3977 | 374 |
| 1257 | 3300046692 | Ga0495671_0000014 | Ga0495671_0000014_271904_273028 | 374 |
| 1258 | 3300046692 | Ga0495671_0000034 | Ga0495671_0000034_75092_76219 | 374 |
| 1259 | 3300047320 | Ga0495672_0032885 | Ga0495672_0032885_1417_2541 | 374 |
| 1260 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_147793_148920 | 374 |
| 1261 | 3300047469 | Ga0495673_0009404 | Ga0495673_0009404_2974_4098 | 374 |
| 1262 | 3300047470 | Ga0495681_0000013 | Ga0495681_0000013_11205_12329 | 374 |
| 1263 | 3300047470 | Ga0495681_0000725 | Ga0495681_0000725_16726_17850 | 374 |
| 1264 | 3300047472 | Ga0495686_0009517 | Ga0495686_0009517_3059_4183 | 374 |
| 1265 | 3300047472 | Ga0495686_0019667 | Ga0495686_0019667_1111_2235 | 374 |
| 1266 | 3300047472 | Ga0495686_0020937 | Ga0495686_0020937_2718_3842 | 374 |
| 1267 | 3300048911 | Ga0496108_0003651 | Ga0496108_0003651_1712_2836 | 374 |
| 1268 | 3300048913 | Ga0496110_0189422 | Ga0496110_0189422_706_1830 | 374 |
| 1269 | 3300048913 | Ga0496110_0383103 | Ga0496110_0383103_68_1192 | 374 |
| 1270 | 3300048919 | Ga0496116_0073291 | Ga0496116_0073291_588_1712 | 374 |
| 1271 | 3300048920 | Ga0496117_0066710 | Ga0496117_0066710_492_1616 | 374 |
| 1272 | 3300048921 | Ga0496118_0021302 | Ga0496118_0021302_1467_2591 | 374 |
| 1273 | 3300048924 | Ga0496121_0002040 | Ga0496121_0002040_26753_27877 | 374 |
| 1274 | 3300048924 | Ga0496121_0034219 | Ga0496121_0034219_2428_3552 | 374 |
| 1275 | 3300048925 | Ga0496122_0009972 | Ga0496122_0009972_891_2015 | 374 |
| 1276 | 3300048925 | Ga0496122_0103514 | Ga0496122_0103514_77_1201 | 374 |
| 1277 | 3300048926 | Ga0496123_0007161 | Ga0496123_0007161_2705_3829 | 374 |
| 1278 | 3300048926 | Ga0496123_0159903 | Ga0496123_0159903_22_1146 | 374 |
| 1279 | 3300048927 | Ga0496124_0019580 | Ga0496124_0019580_4181_5305 | 374 |
| 1280 | 3300048928 | Ga0496125_0024786 | Ga0496125_0024786_3999_5123 | 374 |
| 1281 | 3300048928 | Ga0496125_0033622 | Ga0496125_0033622_2988_4112 | 374 |
| 1282 | 3300048928 | Ga0496125_0047287 | Ga0496125_0047287_882_2012 | 374 |
| 1283 | 3300048929 | Ga0496126_0012770 | Ga0496126_0012770_310_1434 | 374 |
| 1284 | 3300048929 | Ga0496126_0085797 | Ga0496126_0085797_1159_2283 | 374 |
| 1285 | 3300049459 | Ga0495678_023424 | Ga0495678_023424_561_1685 | 374 |
| 1286 | 3300049571 | Ga0501034_0060477 | Ga0501034_0060477_1650_2786 | 374 |
| 1287 | 3300049663 | Ga0501223_000008 | Ga0501223_000008_25500_26624 | 374 |
| 1288 | 3300049663 | Ga0501223_000033 | Ga0501223_000033_26918_28054 | 374 |
| 1289 | 3300049664 | Ga0501224_000026 | Ga0501224_000026_26553_27689 | 374 |
| 1290 | 3300049668 | Ga0501233_000479 | Ga0501233_000479_4766_5902 | 374 |
| 1291 | 3300049669 | Ga0501235_012715 | Ga0501235_012715_197_1333 | 374 |
| 1292 | 3300049704 | Ga0501221_012623 | Ga0501221_012623_39_1163 | 374 |
| 1293 | 3300049705 | Ga0501225_0000018 | Ga0501225_0000018_56796_57932 | 374 |
| 1294 | 3300049705 | Ga0501225_0000046 | Ga0501225_0000046_35348_36472 | 374 |
| 1295 | 3300049705 | Ga0501225_0020238 | Ga0501225_0020238_492_1616 | 374 |
| 1296 | 3300049853 | Ga0501226_000066 | Ga0501226_000066_11983_13119 | 374 |
| 1297 | 3300050494 | nmdc:mga06z11_136_c1 | nmdc:mga06z11_136_c1_27153_28277 | 374 |
| 1298 | 3300050495 | nmdc:mga04h51_18_c1 | nmdc:mga04h51_18_c1_61151_62275 | 374 |
| 1299 | 3300053087 | Ga0500643_000577 | Ga0500643_000577_20965_22104 | 374 |
| 1300 | 3300053087 | Ga0500643_001255 | Ga0500643_001255_3211_4338 | 374 |
| 1301 | 3300053087 | Ga0500643_005656 | Ga0500643_005656_2071_3201 | 374 |
| 1302 | 3300053091 | Ga0500647_0011154 | Ga0500647_0011154_115_1248 | 374 |
| 1303 | 3300053093 | Ga0500651_0003100 | Ga0500651_0003100_5528_6661 | 374 |
| 1304 | 3300053116 | Ga0500592_000537 | Ga0500592_000537_2250_3383 | 374 |
| 1305 | 3300053125 | Ga0500618_004495 | Ga0500618_004495_357_1490 | 374 |
| 1306 | 3300053133 | Ga0500655_000307 | Ga0500655_000307_1335_2468 | 374 |
| 1307 | 3300053136 | Ga0500559_0012414 | Ga0500559_0012414_668_1795 | 374 |
| 1308 | 3300053148 | Ga0500590_000114 | Ga0500590_000114_13031_14164 | 374 |
| 1309 | 3300053151 | Ga0500604_0001472 | Ga0500604_0001472_1770_2897 | 374 |
| 1310 | 3300053158 | Ga0500627_0002274 | Ga0500627_0002274_3428_4555 | 374 |
| 1311 | 3300053724 | Ga0500570_000053 | Ga0500570_000053_14645_15778 | 374 |
| 1312 | 3300055283 | Ga0500661_000046 | Ga0500661_000046_1642_2769 | 374 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pob-assembly1.cif.gz_D | an irreversible, promiscuous and highly thermostable claisen-condensation biocatalyst drives the synthesis of substituted pyrroles | 0.938 | 5 | 372 |
| 7v5i-assembly1.cif.gz_B | structural insights into the substrate selectivity of acyl-coa transferase | 0.9367 | 2 | 372 |
| 3wy7-assembly2.cif.gz_C | crystal structure of mycobacterium smegmatis 7-keto-8-aminopelargonic acid (kapa) synthase biof | 0.9365 | 29 | 373 |
| 3tqx-assembly1.cif.gz_B | structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii | 0.9336 | 4 | 372 |
| 7bxs-assembly1.cif.gz_B | 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form | 0.9304 | 2 | 372 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58694_46_273_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.958 | 46 | 273 | 3.40.640.10 |
| af_Q5A325_172_409_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9383 | 44 | 274 | 3.40.640.10 |
| af_Q58694_46_273_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9375 | 46 | 273 | 3.40.640.10 |
| 1bs0A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9375 | 44 | 275 | 3.40.640.10 |
| af_Q2G0M8_60_294_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9348 | 44 | 277 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H6VTL7-F1-model_v4 | 8-amino-7-oxononanoate synthase | 0.9978 | 1 | 374 |
GO:0008710
GO:0009102 GO:0030170 |
| AF-A0A1H6VTL7-F1-model_v4 | 8-amino-7-oxononanoate synthase | 0.9952 | 1 | 374 |
GO:0008710
GO:0009102 GO:0030170 |
| AF-A0A177PIH5-F1-model_v4 | 8-amino-7-oxononanoate synthase | 0.9901 | 3 | 373 |
GO:0008710
GO:0009102 GO:0030170 |
| AF-A0A6A5KVV0-F1-model_v4 | deleted | 0.9877 | 3 | 329 |
|
| AF-A0A1H9YRW0-F1-model_v4 | 8-amino-7-oxononanoate synthase (EC 2.3.1.47) (7-keto-8-amino-pelargonic acid synthase) (8-amino-7-ketopelargonate synthase) | 0.9829 | 3 | 374 |
GO:0008710
GO:0009102 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar