F492890

General Info

Members Datasets Scaffolds Average Seq Length
1312 653 1086 374

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0051791|Ga0495648_0051791_696_1979
Length 427
Sequence MDHALSPVNRPFSALSAAQQNFQHRYKNDNICGKYAKLSARLPLSPAGLIARSMTAEPFRSQLAALEQRGRLRRLSPRAGRDFASNDYLALAGDPMIAQAVADAVARGVPLGSGGSRLLRGNAPEHEGLEAKAADFFRTQAALFVANGYVGNLALFSTLPQRGDLIVADELIHASAHDGMRMSKAAAVFARHNDVQSFADLIAAFRAEGGKGRIWIAVETLYSMDGDMAPLADLAKLAAQHDAMLLLDEAHGTGVFGPGGRGLSAGLDGLHNVITLHTCGKAMGAEGALICGPRIHIDYLVNRARAFIFSTAPSPLMAVAVSAALDRIERADDLRERLKTLRQDAAEEICAPLGLPSPRSQILPVILGDDPRAMAAAAALQEAGFDVRGIRPPTVPPGTSRLRISLTLNASRSDVAALGRELQRVMR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
4 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
9 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
10 2516143018 Ensifer sp. BR816 Isolate Nodule
11 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
12 2534681786 Brucella suis 92/29 Isolate Unclassified
13 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
14 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
15 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
16 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
17 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
18 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
19 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
20 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
21 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
22 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
23 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
24 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
25 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
26 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
27 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
28 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
29 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
30 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
31 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
32 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
33 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
34 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
35 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
36 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
37 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
38 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
39 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
40 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
41 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
42 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
43 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
44 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
45 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
46 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
47 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
48 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
49 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
50 2643221558 Rhizobium sp. Root149 Isolate Unclassified
51 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
52 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
53 2643221582 Rhizobium sp. Root651 Isolate Unclassified
54 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
55 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
56 2643221607 Rhizobium sp. Root73 Isolate Unclassified
57 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
58 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
59 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
60 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
61 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
62 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
63 2643221693 Rhizobium sp. Root491 Isolate Unclassified
64 2643221723 Ensifer sp. Root278 Isolate Unclassified
65 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
66 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
67 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
68 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
69 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
70 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
71 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
72 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
73 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
74 2751185800 Brucella pituitosa AA2 Isolate Unclassified
75 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
76 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
77 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
78 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
79 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
80 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
81 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
82 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
83 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
84 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
85 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
86 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
87 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
88 2791355263 Rhizobium chutanense C5 Isolate Nodule
89 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
90 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
91 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
92 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
93 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
94 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
95 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
96 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
97 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
98 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
99 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
100 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
101 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
102 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
103 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
104 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
105 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
106 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
107 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
108 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
109 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
110 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
111 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
112 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
113 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
114 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
115 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
116 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
117 2844163670 Ensifer sp. 1H6 Isolate Unclassified
118 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
119 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
120 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
121 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
122 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
123 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
124 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
125 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
126 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
127 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
128 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
129 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
130 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
131 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
132 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
133 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
134 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
135 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
136 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
137 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
138 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
139 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
140 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
141 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
142 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
143 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
144 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
145 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
146 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
147 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
148 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
149 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
150 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
151 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
152 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
153 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
154 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
155 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
156 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
157 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
158 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
159 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
160 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
161 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
162 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
163 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
164 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
165 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
166 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
167 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
168 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
169 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
170 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
171 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
172 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
173 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
174 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
175 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
176 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
177 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
178 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
179 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
180 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
181 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
182 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
183 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
184 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
185 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
186 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
187 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
188 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
189 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
190 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
191 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
192 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
193 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
194 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
195 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
196 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
197 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
198 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
199 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
200 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
201 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
202 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
203 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
204 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
205 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
206 2996887358 Rhizobium sp. R711 Isolate Nodule
207 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
208 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
209 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
210 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
211 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
212 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
213 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
214 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
215 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
216 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
217 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
218 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
219 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
220 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
221 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
222 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
223 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
224 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
225 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
226 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
227 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
228 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
229 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
230 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
231 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
232 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
233 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
234 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
235 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
236 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
237 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
238 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
239 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
240 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
241 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
242 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
243 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
244 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
245 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
246 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
247 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
248 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
249 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
250 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
251 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
252 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
253 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
254 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
255 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
256 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
257 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
258 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
259 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
260 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
261 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
262 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
263 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
264 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
265 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
266 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
267 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
268 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
269 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
270 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
271 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
272 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
273 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
274 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
275 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
276 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
277 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
278 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
279 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
280 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
281 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
282 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
283 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
284 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
285 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
286 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
287 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
288 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
289 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
290 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
291 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
292 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
293 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
294 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
295 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
296 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
297 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
298 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
299 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
300 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
301 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
302 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
303 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
304 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
305 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
306 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
307 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
308 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
309 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
310 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
311 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
312 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
313 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
314 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
315 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
316 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
317 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
318 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
319 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
320 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
321 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
322 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
323 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
324 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
325 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
326 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
327 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
328 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
329 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
330 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
331 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
332 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
333 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
334 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
335 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
336 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
337 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
338 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
339 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
340 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
343 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
346 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
347 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
348 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
350 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
351 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
352 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
354 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
356 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
359 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
412 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
413 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
414 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
418 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
419 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
420 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
421 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
422 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
423 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
424 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
425 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
426 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
427 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
428 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
429 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
430 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
431 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
432 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
433 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
434 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
435 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
436 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
437 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
438 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
439 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
440 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
441 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
442 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
443 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
444 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
445 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
446 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
447 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
448 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
449 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
450 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
451 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
452 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
453 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
454 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
455 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
456 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
457 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
458 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
459 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
460 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
461 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
462 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
463 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
464 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
465 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
466 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
467 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
468 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
469 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
470 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
471 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
472 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
473 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
474 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
475 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
476 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
477 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
478 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
479 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
480 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
481 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
482 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
483 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
484 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
485 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
486 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
487 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
488 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
489 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
490 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
491 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
492 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
493 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
494 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
495 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
496 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
497 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
498 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
499 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
500 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
501 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
502 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
503 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
504 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
505 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
506 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
507 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
508 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
509 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
510 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
511 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
512 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
513 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
514 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
515 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
516 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
517 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
518 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
519 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
520 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
521 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
522 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
523 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
524 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
525 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
526 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
527 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
528 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
529 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
530 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
531 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
532 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
533 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
534 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
535 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
536 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
537 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
538 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
539 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
540 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
541 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
542 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
543 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
544 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
545 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
546 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
547 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
548 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
549 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
550 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
552 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
553 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
556 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
559 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
564 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
565 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
566 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
567 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
568 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
569 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
570 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
571 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
572 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
573 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
574 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
575 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
576 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
577 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
578 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
579 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
580 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
581 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
582 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
583 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
584 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
585 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
586 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
587 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
588 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
589 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
590 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
591 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
595 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
596 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
597 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
598 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
599 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
600 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
601 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
602 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
603 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
604 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
605 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
606 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
607 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
608 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
609 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
610 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
611 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
612 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
613 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
614 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
615 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
616 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
617 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
618 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
619 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
620 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
621 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
622 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
623 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
624 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
625 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
626 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
627 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
628 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
629 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
630 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
631 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
632 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
633 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
634 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
635 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
636 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
637 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
638 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
639 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
640 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
641 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
642 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
643 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
644 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
645 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
646 8005258706 Rhizobium sp. R693 Isolate Nodule
647 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
648 8005321885 Rhizobium sp. R72 Isolate Nodule
649 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
650 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
651 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
652 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
653 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.7
Metatranscriptomes 0
Isolates 17.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 15.78
Nodule 7.24
Rhizoplane 2.52
Rhizosphere 61.43
Stem 0
Stem Tuber 0.08
Unclassified 12.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_544056 2162886007 Bacteria 7056
2 JGI24736J21556_1015781 3300001904 Bacteria 1208
3 JGI24741J21665_1000689 3300001915 Bacteria 10201
4 JGI24741J21665_1005930 3300001915 Bacteria 2501
5 JGI24752J21851_1000602 3300001976 Bacteria 4796
6 JGI24752J21851_1000987 3300001976 Bacteria 3888
7 JGI24740J21852_10000308 3300001979 Bacteria 20760
8 JGI24740J21852_10000942 3300001979 Bacteria 12938
9 JGI24739J22299_10003198 3300001989 Bacteria 6246
10 JGI24739J22299_10006801 3300001989 Bacteria 4303
11 JGI24737J22298_10001465 3300001990 Bacteria 8407
12 JGI24737J22298_10003438 3300001990 Bacteria 5597
13 JGI24737J22298_10008136 3300001990 Bacteria 3523
14 JGI24735J21928_10001446 3300002067 Bacteria 8392
15 JGI24738J21930_10001077 3300002075 Bacteria 7736
16 JGI24749J21850_1007117 3300002076 Bacteria 1556
17 JGI24751J29686_10000062 3300002459 Bacteria 61661
18 JGI24751J29686_10009347 3300002459 Bacteria 2014
19 JGI25152J39213_1002260 3300002773 Bacteria 7440
20 JGI25150J39212_1000838 3300002774 Bacteria 10284
21 JGI25159J45721_1000783 3300002987 Bacteria 13825
22 JGI25151J46595_10004404 3300003187 Bacteria 7460
23 JGI25151J46595_10024486 3300003187 Bacteria 2469
24 JGI25165J46597_1000104 3300003214 Bacteria 152363
25 JGI25153J46596_10000008 3300003215 Bacteria 376808
26 JGI25153J46596_10000064 3300003215 Bacteria 125642
27 JGI25153J46596_10003643 3300003215 Bacteria 8534
28 JGI25153J46596_10004902 3300003215 Bacteria 7113
29 rootH2_10028904 3300003320 Bacteria 1410
30 rootH2_10108382 3300003320 Bacteria 3344
31 rootH2_10236114 3300003320 Bacteria 4078
32 rootL2_10109219 3300003322 Bacteria 2184
33 rootL2_10163604 3300003322 Bacteria 2975
34 rootL2_10261820 3300003322 Bacteria 1464
35 rootH1_10009808 3300003323 Bacteria 4490
36 rootH1_10009809 3300003316 Bacteria 30543
37 rootH1_10009809 3300003323 Bacteria 2798
38 rootH1_10172432 3300003323 Bacteria 6353
39 rootH1_10193712 3300003323 Bacteria 3284
40 JGI25160J50197_1000005 3300003354 Bacteria 417280
41 JGI25160J50197_1000103 3300003354 Bacteria 80968
42 JGI25160J50197_1003719 3300003354 Bacteria 6731
43 JGI25161J50226_1000010 3300003374 Bacteria 214823
44 JGI25161J50226_1000090 3300003374 Bacteria 73647
45 JGI25161J50226_1001080 3300003374 Bacteria 9210
46 Ga0055525_1000063 3300003759 Bacteria 198877
47 Ga0055525_1000064 3300003759 Bacteria 198750
48 Ga0055542_1000123 3300003762 Bacteria 101557
49 Ga0055529_1000144 3300003763 Bacteria 101557
50 Ga0055526_1002619 3300003771 Bacteria 12029
51 Ga0055526_1005251 3300003771 Bacteria 7512
52 Ga0055536_1002718 3300003781 Bacteria 9812
53 Ga0055536_1011770 3300003781 Bacteria 3309
54 Ga0055536_1014539 3300003781 Bacteria 2753
55 Ga0055534_1002619 3300003784 Bacteria 6129
56 Ga0055528_1004834 3300003790 Bacteria 6405
57 Ga0055530_10000024 3300003791 Bacteria 135706
58 Ga0055530_10000344 3300003791 Bacteria 42089
59 Ga0055540_1002224 3300003792 Bacteria 10514
60 Ga0055531_10000012 3300003794 Bacteria 191187
61 Ga0055531_10000164 3300003794 Bacteria 75390
62 Ga0058692_1001612 3300003856 Bacteria 8099
63 Ga0055543_1000064 3300004625 Bacteria 97355
64 Ga0055543_1000087 3300004625 Bacteria 81157
65 Ga0055543_1000863 3300004625 Bacteria 14563
66 Ga0065165_1000002 3300005262 Bacteria 444192
67 Ga0065165_1000776 3300005262 Bacteria 42909
68 Ga0065165_1001281 3300005262 Bacteria 28374
69 Ga0065165_1001556 3300005262 Bacteria 23823
70 Ga0065165_1007851 3300005262 Bacteria 5134
71 Ga0065165_1009795 3300005262 Bacteria 4237
72 Ga0065165_1011637 3300005262 Bacteria 3646
73 Ga0065704_10001031 3300005289 Bacteria 10014
74 Ga0065704_10073124 3300005289 Bacteria 7559
75 Ga0065704_10074376 3300005289 Bacteria 6327
76 Ga0065704_10086442 3300005289 Bacteria 3119
77 Ga0070658_10001705 3300005327 Bacteria 18552
78 Ga0070658_10017194 3300005327 Bacteria 5787
79 Ga0070658_10169902 3300005327 Bacteria 1831
80 Ga0070676_10017191 3300005328 Bacteria 4001
81 Ga0070683_100000962 3300005329 Bacteria 21403
82 Ga0070670_100000005 3300005331 Bacteria 351569
83 Ga0070670_100000169 3300005331 Bacteria 59093
84 Ga0070670_100042311 3300005331 Bacteria 3916
85 Ga0070670_100099495 3300005331 Bacteria 2502
86 Ga0070666_10000054 3300005335 Bacteria 95458
87 Ga0070666_10007041 3300005335 Bacteria 6932
88 Ga0070666_10044443 3300005335 Bacteria 2975
89 Ga0070666_10046068 3300005335 Bacteria 2924
90 Ga0070666_10089550 3300005335 Bacteria 2112
91 Ga0070682_100001250 3300005337 Bacteria 14430
92 Ga0068868_100221914 3300005338 Bacteria 1583
93 Ga0068868_100358336 3300005338 Bacteria 1251
94 Ga0070660_100034716 3300005339 Bacteria 3812
95 Ga0070660_100054269 3300005339 Bacteria 3094
96 Ga0070660_100244572 3300005339 Bacteria 1462
97 Ga0070661_100015865 3300005344 Bacteria 5315
98 Ga0070668_100000020 3300005347 Bacteria 98203
99 Ga0070668_100000061 3300005347 Bacteria 66924
100 Ga0070668_100001209 3300005347 Bacteria 18347
101 Ga0070668_100041319 3300005347 Bacteria 3533
102 Ga0070668_100118204 3300005347 Bacteria 2116
103 Ga0070668_100164162 3300005347 Bacteria 1804
104 Ga0070668_100187455 3300005347 Bacteria 1693
105 Ga0070669_100000060 3300005353 Bacteria 108287
106 Ga0070669_100000097 3300005353 Bacteria 86804
107 Ga0070669_100124102 3300005353 Bacteria 1974
108 Ga0070669_100191849 3300005353 Bacteria 1603
109 Ga0070669_100212821 3300005353 Bacteria 1526
110 Ga0070669_100324816 3300005353 Bacteria 1243
111 Ga0070675_100132388 3300005354 Bacteria 2126
112 Ga0070671_100000350 3300005355 Bacteria 31605
113 Ga0070671_100000854 3300005355 Bacteria 22207
114 Ga0070671_100003166 3300005355 Bacteria 12836
115 Ga0070671_100004846 3300005355 Bacteria 10698
116 Ga0070671_100103294 3300005355 Bacteria 2391
117 Ga0070671_100330526 3300005355 Bacteria 1299
118 Ga0070673_100064021 3300005364 Bacteria 2928
119 Ga0070659_100020104 3300005366 Bacteria 5070
120 Ga0070659_100022429 3300005366 Bacteria 4820
121 Ga0070659_100054816 3300005366 Bacteria 3141
122 Ga0070659_100057665 3300005366 Bacteria 3063
123 Ga0070667_100000055 3300005367 Bacteria 151072
124 Ga0070667_100000322 3300005367 Bacteria 53499
125 Ga0070667_100001030 3300005367 Bacteria 25481
126 Ga0070667_100001092 3300005367 Bacteria 24859
127 Ga0070711_100017006 3300005439 Bacteria 4625
128 Ga0070705_100043596 3300005440 Bacteria 2572
129 Ga0070663_100026232 3300005455 Bacteria 3944
130 Ga0070663_100029469 3300005455 Bacteria 3751
131 Ga0070663_100116814 3300005455 Bacteria 2011
132 Ga0070678_100000413 3300005456 Bacteria 20163
133 Ga0070678_100006179 3300005456 Bacteria 7000
134 Ga0070678_100066125 3300005456 Bacteria 2687
135 Ga0070678_100168357 3300005456 Bacteria 1782
136 Ga0070681_10011283 3300005458 Bacteria 8837
137 Ga0070681_10246910 3300005458 Bacteria 1698
138 Ga0068867_100078471 3300005459 Bacteria 2484
139 Ga0070679_100002275 3300005530 Bacteria 17356
140 Ga0070679_100004658 3300005530 Bacteria 12655
141 Ga0070679_100056063 3300005530 Bacteria 3925
142 Ga0070679_100135681 3300005530 Bacteria 2442
143 Ga0070679_100259665 3300005530 Bacteria 1692
144 Ga0070684_100000297 3300005535 Bacteria 34479
145 Ga0070684_100092842 3300005535 Bacteria 2686
146 Ga0070684_100095686 3300005535 Bacteria 2646
147 Ga0070697_100239459 3300005536 Bacteria 1549
148 Ga0068853_100089918 3300005539 Bacteria 2698
149 Ga0070686_100094573 3300005544 Bacteria 2006
150 Ga0070695_100005196 3300005545 Bacteria 7682
151 Ga0070696_100000797 3300005546 Bacteria 20306
152 Ga0070696_100005838 3300005546 Bacteria 8212
153 Ga0070665_100000023 3300005548 Bacteria 375278
154 Ga0070665_100001971 3300005548 Bacteria 23078
155 Ga0070665_100003281 3300005548 Bacteria 17362
156 Ga0070665_100014237 3300005548 Bacteria 7990
157 Ga0070665_100060637 3300005548 Bacteria 3792
158 Ga0070665_100169754 3300005548 Bacteria 2183
159 Ga0070704_100073247 3300005549 Bacteria 2495
160 Ga0068855_100017039 3300005563 Bacteria 8741
161 Ga0068855_100098645 3300005563 Bacteria 3365
162 Ga0068855_100145628 3300005563 Bacteria 2697
163 Ga0068855_100182749 3300005563 Bacteria 2370
164 Ga0070664_100037558 3300005564 Bacteria 4073
165 Ga0070664_100045092 3300005564 Bacteria 3724
166 Ga0070664_100350905 3300005564 Bacteria 1342
167 Ga0068857_100007564 3300005577 Bacteria 9353
168 Ga0068857_100072443 3300005577 Bacteria 3070
169 Ga0068854_100009241 3300005578 Bacteria 6359
170 Ga0068854_100195991 3300005578 Bacteria 1585
171 Ga0068856_100000581 3300005614 Bacteria 39928
172 Ga0068856_100139383 3300005614 Bacteria 2432
173 Ga0068856_100535407 3300005614 Bacteria 1192
174 Ga0068852_100226879 3300005616 Bacteria 1779
175 Ga0068859_100000847 3300005617 Bacteria 31136
176 Ga0068859_100021274 3300005617 Bacteria 6509
177 Ga0068859_100075652 3300005617 Bacteria 3407
178 Ga0068859_100174343 3300005617 Bacteria 2232
179 Ga0068864_100000004 3300005618 Bacteria 489341
180 Ga0068864_100000011 3300005618 Bacteria 350056
181 Ga0068864_100000870 3300005618 Bacteria 25428
182 Ga0068864_100014218 3300005618 Bacteria 6609
183 Ga0068864_100049297 3300005618 Bacteria 3623
184 Ga0068864_100084553 3300005618 Bacteria 2788
185 Ga0068864_100099687 3300005618 Bacteria 2574
186 Ga0068864_100263181 3300005618 Bacteria 1605
187 Ga0068863_100000002 3300005841 Bacteria 489510
188 Ga0068863_100000030 3300005841 Bacteria 176023
189 Ga0068863_100000053 3300005841 Bacteria 125195
190 Ga0068863_100002111 3300005841 Bacteria 19717
191 Ga0068863_100038845 3300005841 Bacteria 4528
192 Ga0068863_100069839 3300005841 Bacteria 3321
193 Ga0068863_100114929 3300005841 Bacteria 2564
194 Ga0068858_100000022 3300005842 Bacteria 169718
195 Ga0068858_100000186 3300005842 Bacteria 65965
196 Ga0068858_100000222 3300005842 Bacteria 61633
197 Ga0068858_100028145 3300005842 Bacteria 5222
198 Ga0068858_100076465 3300005842 Bacteria 3109
199 Ga0068860_100000090 3300005843 Bacteria 151520
200 Ga0068860_100091566 3300005843 Bacteria 2897
201 Ga0068860_100094572 3300005843 Bacteria 2848
202 Ga0068860_100165043 3300005843 Bacteria 2137
203 Ga0068860_100290841 3300005843 Bacteria 1599
204 Ga0068862_100000002 3300005844 Bacteria 489341
205 Ga0068862_100000104 3300005844 Bacteria 100182
206 Ga0068862_100001021 3300005844 Bacteria 26923
207 Ga0068862_100001485 3300005844 Bacteria 21504
208 Ga0068862_100411861 3300005844 Bacteria 1267
209 Ga0075365_10015345 3300006038 Bacteria 4633
210 Ga0075368_10003978 3300006042 Bacteria 4977
211 Ga0075368_10022290 3300006042 Bacteria 2410
212 Ga0075363_100003818 3300006048 Bacteria 6495
213 Ga0075363_100004343 3300006048 Bacteria 6181
214 Ga0075363_100063969 3300006048 Bacteria 1987
215 Ga0075364_10015635 3300006051 Bacteria 4709
216 Ga0075364_10097247 3300006051 Bacteria 1958
217 Ga0070716_100030220 3300006173 Bacteria 2937
218 Ga0070716_100070279 3300006173 Bacteria 2055
219 Ga0070712_100003369 3300006175 Bacteria 9825
220 Ga0075362_10000064 3300006177 Bacteria 30699
221 Ga0075362_10004725 3300006177 Bacteria 4919
222 Ga0075367_10000664 3300006178 Bacteria 13170
223 Ga0075367_10002499 3300006178 Bacteria 8425
224 Ga0075367_10024153 3300006178 Bacteria 3428
225 Ga0075367_10042598 3300006178 Bacteria 2657
226 Ga0075367_10176015 3300006178 Bacteria 1333
227 Ga0075369_10009043 3300006186 Bacteria 3857
228 Ga0075366_10000133 3300006195 Bacteria 31068
229 Ga0075366_10006964 3300006195 Bacteria 6224
230 Ga0097621_100000498 3300006237 Bacteria 27559
231 Ga0097621_100013282 3300006237 Bacteria 6133
232 Ga0097621_100144718 3300006237 Bacteria 2034
233 Ga0097621_100166468 3300006237 Bacteria 1898
234 Ga0075370_10000015 3300006353 Bacteria 62164
235 Ga0068871_100000406 3300006358 Bacteria 29738
236 Ga0068871_100010613 3300006358 Bacteria 6731
237 Ga0068871_100018177 3300006358 Bacteria 5338
238 Ga0097620_100000847 3300006931 Bacteria 31136
239 Ga0097620_100021274 3300006931 Bacteria 6509
240 Ga0097620_100075651 3300006931 Bacteria 3407
241 Ga0097620_100174356 3300006931 Bacteria 2232
242 Ga0105251_10000342 3300009011 Bacteria 46221
243 Ga0105251_10003145 3300009011 Bacteria 12252
244 Ga0105244_10000058 3300009036 Bacteria 128877
245 Ga0105245_10001826 3300009098 Bacteria 19371
246 Ga0105245_10010667 3300009098 Bacteria 7993
247 Ga0105245_10221379 3300009098 Bacteria 1826
248 Ga0105247_10000840 3300009101 Bacteria 23345
249 Ga0105247_10086235 3300009101 Bacteria 1987
250 Ga0105247_10108412 3300009101 Bacteria 1784
251 Ga0105243_10000090 3300009148 Bacteria 102483
252 Ga0105243_10000192 3300009148 Bacteria 71429
253 Ga0105243_10026130 3300009148 Bacteria 4467
254 Ga0105243_10030367 3300009148 Bacteria 4160
255 Ga0105241_10020587 3300009174 Bacteria 4875
256 Ga0105241_10101590 3300009174 Bacteria 2286
257 Ga0105241_10140905 3300009174 Bacteria 1963
258 Ga0105248_10000229 3300009177 Bacteria 64280
259 Ga0105248_10001858 3300009177 Bacteria 23422
260 Ga0105248_10037315 3300009177 Bacteria 5436
261 Ga0105248_10043322 3300009177 Bacteria 5046
262 Ga0105248_10067604 3300009177 Bacteria 4012
263 Ga0105248_10409215 3300009177 Bacteria 1527
264 Ga0105237_10092985 3300009545 Bacteria 3005
265 Ga0105238_10008814 3300009551 Bacteria 10092
266 Ga0105238_10039059 3300009551 Bacteria 4816
267 Ga0105238_10153934 3300009551 Bacteria 2274
268 Ga0105249_10000106 3300009553 Bacteria 115526
269 Ga0105249_10011772 3300009553 Bacteria 7691
270 Ga0105249_10069094 3300009553 Bacteria 3260
271 Ga0105249_10101973 3300009553 Bacteria 2700
272 Ga0105249_10108871 3300009553 Bacteria 2616
273 Ga0105249_10149886 3300009553 Bacteria 2245
274 Ga0105249_10159348 3300009553 Bacteria 2179
275 Ga0123341_1015241 3300009765 Bacteria 6858
276 Ga0123341_1026276 3300009765 Bacteria 4625
277 Ga0123342_1016039 3300009766 Bacteria 6622
278 Ga0105239_10352621 3300010375 Bacteria 1661
279 Ga0105246_10000491 3300011119 Bacteria 21441
280 Ga0105246_10024573 3300011119 Bacteria 3916
281 Ga0157373_10000019 3300013100 Bacteria 166579
282 Ga0157371_10000138 3300013102 Bacteria 105621
283 Ga0157371_10000187 3300013102 Bacteria 91186
284 Ga0157371_10055251 3300013102 Bacteria 2817
285 Ga0157370_10000037 3300013104 Bacteria 136803
286 Ga0157370_10000289 3300013104 Bacteria 63849
287 Ga0157370_10014403 3300013104 Bacteria 8086
288 Ga0157370_10015069 3300013104 Bacteria 7877
289 Ga0157370_10027971 3300013104 Bacteria 5552
290 Ga0157370_10030229 3300013104 Bacteria 5309
291 Ga0157370_10188461 3300013104 Bacteria 1915
292 Ga0157370_10218841 3300013104 Bacteria 1764
293 Ga0157369_10001685 3300013105 Bacteria 26974
294 Ga0157369_10410859 3300013105 Bacteria 1404
295 Ga0171463_1002 3300013249 Bacteria 1274851
296 Ga0157378_10049262 3300013297 Bacteria 3747
297 Ga0163162_10001728 3300013306 Bacteria 20466
298 Ga0163162_10009006 3300013306 Bacteria 9703
299 Ga0163162_10070659 3300013306 Bacteria 3542
300 Ga0157375_10000313 3300013308 Bacteria 43467
301 Ga0157375_10094894 3300013308 Bacteria 3053
302 Ga0163163_10116377 3300014325 Bacteria 2704
303 Ga0157380_10000083 3300014326 Bacteria 52136
304 Ga0182008_10000015 3300014497 Bacteria 243121
305 Ga0157379_10067349 3300014968 Bacteria 3200
306 Ga0157379_10068223 3300014968 Bacteria 3180
307 Ga0157379_10073045 3300014968 Bacteria 3070
308 Ga0157376_10075409 3300014969 Bacteria 2878
309 Ga0182006_1000011 3300015261 Bacteria 408647
310 Ga0183363_1007 3300015690 Bacteria 315687
311 Ga0183363_1030 3300015690 Bacteria 49061
312 Ga0183361_10078 3300016635 Bacteria 2971
313 Ga0163161_10057497 3300017792 Bacteria 2826
314 Ga0163161_10098300 3300017792 Bacteria 2175
315 Ga0214544_1000158 3300021320 Bacteria 101943
316 Ga0214542_1001567 3300021321 Bacteria 47020
317 Ga0214543_1000234 3300021327 Bacteria 84243
318 Ga0214543_1001418 3300021327 Bacteria 46073
319 Ga0213876_10015478 3300021384 Bacteria 4036
320 Ga0213876_10163503 3300021384 Bacteria 1184
321 Ga0213871_10006084 3300021441 Bacteria 2534
322 Ga0209436_100126 3300025208 Bacteria 37591
323 Ga0209436_100556 3300025208 Bacteria 16119
324 Ga0209147_101850 3300025229 Bacteria 6493
325 Ga0209563_100066 3300025230 Bacteria 257382
326 Ga0207425_1000228 3300025245 Bacteria 43864
327 Ga0209677_102327 3300025253 Bacteria 7293
328 Ga0209148_1000011 3300025254 Bacteria 1196503
329 Ga0209129_1000082 3300025258 Bacteria 183436
330 Ga0209129_1000424 3300025258 Bacteria 32069
331 Ga0209129_1001242 3300025258 Bacteria 14638
332 Ga0209129_1002843 3300025258 Bacteria 8009
333 Ga0209233_1000164 3300025261 Bacteria 152430
334 Ga0209233_1014593 3300025261 Bacteria 2209
335 Ga0209565_1000166 3300025263 Bacteria 85898
336 Ga0209455_1000006 3300025272 Bacteria 1196503
337 Ga0209455_1002862 3300025272 Bacteria 6387
338 Ga0209455_1009694 3300025272 Bacteria 2509
339 Ga0209673_1004601 3300025273 Bacteria 7314
340 Ga0209673_1011852 3300025273 Bacteria 3560
341 Ga0209130_1000001 3300025284 Bacteria 831557
342 Ga0209130_1000010 3300025284 Bacteria 444920
343 Ga0209130_1000098 3300025284 Bacteria 142506
344 Ga0209675_1000033 3300025291 Bacteria 271576
345 Ga0209675_1004347 3300025291 Bacteria 6341
346 Ga0209676_1000138 3300025292 Bacteria 178932
347 Ga0209676_1000148 3300025292 Bacteria 172161
348 Ga0209676_1001403 3300025292 Bacteria 23290
349 Ga0209676_1020842 3300025292 Bacteria 2213
350 Ga0209676_1022758 3300025292 Bacteria 2068
351 Ga0209676_1031134 3300025292 Bacteria 1622
352 Ga0209025_1000172 3300025294 Bacteria 160407
353 Ga0209025_1000234 3300025294 Bacteria 130341
354 Ga0209025_1000304 3300025294 Bacteria 109508
355 Ga0209025_1000689 3300025294 Bacteria 57945
356 Ga0209564_1000025 3300025295 Bacteria 520535
357 Ga0209564_1002096 3300025295 Bacteria 17065
358 Ga0209564_1003037 3300025295 Bacteria 11946
359 Ga0209564_1007547 3300025295 Bacteria 5600
360 Ga0209758_1000013 3300025297 Bacteria 873003
361 Ga0209758_1000017 3300025297 Bacteria 754393
362 Ga0209758_1000019 3300025297 Bacteria 743682
363 Ga0209758_1004381 3300025297 Bacteria 11797
364 Ga0209758_1006462 3300025297 Bacteria 8406
365 Ga0209758_1018335 3300025297 Bacteria 3434
366 Ga0209758_1039302 3300025297 Bacteria 1801
367 Ga0209050_1000001 3300025298 Bacteria 3563507
368 Ga0209050_1000039 3300025298 Bacteria 410069
369 Ga0209050_1000047 3300025298 Bacteria 380561
370 Ga0209050_1004457 3300025298 Bacteria 9446
371 Ga0209050_1023211 3300025298 Bacteria 2190
372 Ga0209256_1000311 3300025299 Bacteria 84751
373 Ga0209256_1011274 3300025299 Bacteria 3601
374 Ga0207426_1000036 3300025302 Bacteria 444920
375 Ga0207426_1000045 3300025302 Bacteria 422847
376 Ga0207426_1000069 3300025302 Bacteria 334513
377 Ga0207426_1000968 3300025302 Bacteria 28326
378 Ga0209051_1000415 3300025303 Bacteria 58919
379 Ga0209051_1023758 3300025303 Bacteria 2540
380 Ga0209257_1000051 3300025304 Bacteria 434166
381 Ga0209257_1000076 3300025304 Bacteria 324617
382 Ga0209257_1000130 3300025304 Bacteria 212188
383 Ga0209257_1004707 3300025304 Bacteria 10238
384 Ga0209257_1004726 3300025304 Bacteria 10196
385 Ga0209257_1005137 3300025304 Bacteria 9463
386 Ga0207655_1000693 3300025728 Bacteria 39160
387 Ga0207713_1008759 3300025735 Bacteria 5767
388 Ga0207710_10000606 3300025900 Bacteria 20949
389 Ga0207688_10041105 3300025901 Bacteria 2571
390 Ga0207680_10003164 3300025903 Bacteria 7735
391 Ga0207680_10004498 3300025903 Bacteria 6613
392 Ga0207680_10013481 3300025903 Bacteria 4201
393 Ga0207647_10116069 3300025904 Bacteria 1580
394 Ga0207645_10032980 3300025907 Bacteria 3329
395 Ga0207705_10000120 3300025909 Bacteria 87080
396 Ga0207705_10002397 3300025909 Bacteria 14472
397 Ga0207705_10005207 3300025909 Bacteria 9750
398 Ga0207654_10005355 3300025911 Bacteria 6482
399 Ga0207707_10246650 3300025912 Bacteria 1552
400 Ga0207695_10078679 3300025913 Bacteria 3345
401 Ga0207695_10147102 3300025913 Bacteria 2299
402 Ga0207671_10009634 3300025914 Bacteria 8052
403 Ga0207671_10124641 3300025914 Bacteria 1972
404 Ga0207693_10009341 3300025915 Bacteria 7995
405 Ga0207657_10227081 3300025919 Bacteria 1494
406 Ga0207649_10002019 3300025920 Bacteria 11541
407 Ga0207649_10104952 3300025920 Bacteria 1877
408 Ga0207652_10001588 3300025921 Bacteria 20009
409 Ga0207652_10088169 3300025921 Bacteria 2722
410 Ga0207652_10114658 3300025921 Bacteria 2393
411 Ga0207652_10133510 3300025921 Bacteria 2215
412 Ga0207681_10000001 3300025923 Bacteria 1105841
413 Ga0207681_10000030 3300025923 Bacteria 173766
414 Ga0207681_10013391 3300025923 Bacteria 5076
415 Ga0207681_10094045 3300025923 Bacteria 2147
416 Ga0207694_10011664 3300025924 Bacteria 6629
417 Ga0207694_10014727 3300025924 Bacteria 5896
418 Ga0207650_10000018 3300025925 Bacteria 352120
419 Ga0207650_10000294 3300025925 Bacteria 50141
420 Ga0207650_10024163 3300025925 Bacteria 4317
421 Ga0207650_10147411 3300025925 Bacteria 1855
422 Ga0207659_10111542 3300025926 Bacteria 2080
423 Ga0207687_10001337 3300025927 Bacteria 16848
424 Ga0207687_10077549 3300025927 Bacteria 2390
425 Ga0207700_10133081 3300025928 Bacteria 2033
426 Ga0207644_10000050 3300025931 Bacteria 93772
427 Ga0207644_10000096 3300025931 Bacteria 63618
428 Ga0207644_10000944 3300025931 Bacteria 18531
429 Ga0207644_10123833 3300025931 Bacteria 1971
430 Ga0207644_10130713 3300025931 Bacteria 1922
431 Ga0207690_10007651 3300025932 Bacteria 6409
432 Ga0207690_10187969 3300025932 Bacteria 1560
433 Ga0207706_10019021 3300025933 Bacteria 6178
434 Ga0207706_10072781 3300025933 Bacteria 3022
435 Ga0207709_10000364 3300025935 Bacteria 45576
436 Ga0207709_10000503 3300025935 Bacteria 34770
437 Ga0207709_10013050 3300025935 Bacteria 4580
438 Ga0207709_10026116 3300025935 Bacteria 3351
439 Ga0207709_10035978 3300025935 Bacteria 2931
440 Ga0207709_10155844 3300025935 Bacteria 1587
441 Ga0207669_10000100 3300025937 Bacteria 43316
442 Ga0207669_10000461 3300025937 Bacteria 17704
443 Ga0207665_10045233 3300025939 Bacteria 2947
444 Ga0207711_10001356 3300025941 Bacteria 23103
445 Ga0207711_10003309 3300025941 Bacteria 13998
446 Ga0207711_10007985 3300025941 Bacteria 8853
447 Ga0207711_10011245 3300025941 Bacteria 7436
448 Ga0207711_10014920 3300025941 Bacteria 6455
449 Ga0207711_10123872 3300025941 Bacteria 2310
450 Ga0207689_10139464 3300025942 Bacteria 1997
451 Ga0207661_10002325 3300025944 Bacteria 13094
452 Ga0207679_10006553 3300025945 Bacteria 7359
453 Ga0207679_10051529 3300025945 Bacteria 3013
454 Ga0207679_10203629 3300025945 Bacteria 1655
455 Ga0207667_10000002 3300025949 Bacteria 895662
456 Ga0207667_10127428 3300025949 Bacteria 2622
457 Ga0207667_10129082 3300025949 Bacteria 2604
458 Ga0207667_10157687 3300025949 Bacteria 2335
459 Ga0207667_10318729 3300025949 Bacteria 1588
460 Ga0207651_10045874 3300025960 Bacteria 2934
461 Ga0207712_10000224 3300025961 Bacteria 55674
462 Ga0207712_10071451 3300025961 Bacteria 2496
463 Ga0207712_10082993 3300025961 Bacteria 2338
464 Ga0207712_10208815 3300025961 Bacteria 1553
465 Ga0207668_10000027 3300025972 Bacteria 125575
466 Ga0207668_10000048 3300025972 Bacteria 100390
467 Ga0207668_10000832 3300025972 Bacteria 18652
468 Ga0207668_10004020 3300025972 Bacteria 8659
469 Ga0207668_10020257 3300025972 Bacteria 4222
470 Ga0207668_10060594 3300025972 Bacteria 2657
471 Ga0207668_10136003 3300025972 Bacteria 1883
472 Ga0207640_10074572 3300025981 Bacteria 2296
473 Ga0207640_10161164 3300025981 Bacteria 1660
474 Ga0207658_10000090 3300025986 Bacteria 100143
475 Ga0207658_10000853 3300025986 Bacteria 25495
476 Ga0207658_10003610 3300025986 Bacteria 10935
477 Ga0207658_10003728 3300025986 Bacteria 10731
478 Ga0207703_10000048 3300026035 Bacteria 151143
479 Ga0207703_10000231 3300026035 Bacteria 63888
480 Ga0207703_10000428 3300026035 Bacteria 44367
481 Ga0207703_10001069 3300026035 Bacteria 26141
482 Ga0207703_10027853 3300026035 Bacteria 4451
483 Ga0207703_10141440 3300026035 Bacteria 2089
484 Ga0207639_10001044 3300026041 Bacteria 18817
485 Ga0207639_10001988 3300026041 Bacteria 13760
486 Ga0207678_10001105 3300026067 Bacteria 24731
487 Ga0207678_10001352 3300026067 Bacteria 22581
488 Ga0207678_10008945 3300026067 Bacteria 8818
489 Ga0207678_10030824 3300026067 Bacteria 4683
490 Ga0207708_10168730 3300026075 Bacteria 1732
491 Ga0207702_10000922 3300026078 Bacteria 30419
492 Ga0207702_10003624 3300026078 Bacteria 14015
493 Ga0207702_10005099 3300026078 Bacteria 11548
494 Ga0207702_10137145 3300026078 Bacteria 2209
495 Ga0207641_10000001 3300026088 Bacteria 1180841
496 Ga0207641_10000002 3300026088 Bacteria 981004
497 Ga0207641_10000093 3300026088 Bacteria 125747
498 Ga0207641_10005852 3300026088 Bacteria 10434
499 Ga0207648_10112303 3300026089 Bacteria 2393
500 Ga0207676_10000004 3300026095 Bacteria 725417
501 Ga0207676_10000040 3300026095 Bacteria 167947
502 Ga0207676_10000270 3300026095 Bacteria 44974
503 Ga0207676_10000658 3300026095 Bacteria 27657
504 Ga0207676_10128951 3300026095 Bacteria 2147
505 Ga0207674_10012575 3300026116 Bacteria 9457
506 Ga0207674_10078586 3300026116 Bacteria 3304
507 Ga0207674_10154662 3300026116 Bacteria 2249
508 Ga0207675_100002408 3300026118 Bacteria 18527
509 Ga0207675_100014882 3300026118 Bacteria 7261
510 Ga0207683_10009115 3300026121 Bacteria 8456
511 Ga0207683_10016012 3300026121 Bacteria 6382
512 Ga0207683_10227772 3300026121 Bacteria 1699
513 Ga0207698_10001069 3300026142 Bacteria 15923
514 Ga0209371_1000035 3300027312 Bacteria 368979
515 Ga0209371_1000901 3300027312 Bacteria 23610
516 Ga0209998_10020384 3300027717 Bacteria 1418
517 Ga0209813_10000240 3300027866 Bacteria 16302
518 Ga0209813_10002387 3300027866 Bacteria 4306
519 Ga0268266_10000002 3300028379 Bacteria 3059047
520 Ga0268266_10000505 3300028379 Bacteria 55387
521 Ga0268266_10008793 3300028379 Bacteria 8949
522 Ga0268266_10129411 3300028379 Bacteria 2256
523 Ga0268266_10132273 3300028379 Bacteria 2232
524 Ga0268266_10317952 3300028379 Bacteria 1456
525 Ga0268265_10000002 3300028380 Bacteria 1035381
526 Ga0268265_10000003 3300028380 Bacteria 949201
527 Ga0268265_10000970 3300028380 Bacteria 26248
528 Ga0268265_10001609 3300028380 Bacteria 18629
529 Ga0268264_10000075 3300028381 Bacteria 256011
530 Ga0268264_10000288 3300028381 Bacteria 84755
531 Ga0268264_10016089 3300028381 Bacteria 6129
532 Ga0268264_10020758 3300028381 Bacteria 5368
533 Ga0265337_1003505 3300028556 Bacteria 6779
534 Ga0265337_1018245 3300028556 Bacteria 2232
535 Ga0265319_1012596 3300028563 Bacteria 3412
536 Ga0265334_10001203 3300028573 Bacteria 12660
537 Ga0265334_10003663 3300028573 Bacteria 6953
538 Ga0265323_10000276 3300028653 Bacteria 29667
539 Ga0265336_10000268 3300028666 Bacteria 36633
540 Ga0307517_10039586 3300028786 Bacteria 5171
541 Ga0307517_10066936 3300028786 Bacteria 3297
542 Ga0307517_10108979 3300028786 Bacteria 2122
543 Ga0307517_10123559 3300028786 Bacteria 1901
544 Ga0307515_10001309 3300028794 Bacteria 56564
545 Ga0307515_10011735 3300028794 Bacteria 16580
546 Ga0307515_10178793 3300028794 Bacteria 2081
547 Ga0265338_10000280 3300028800 Bacteria 91942
548 Ga0265338_10002006 3300028800 Bacteria 31607
549 Ga0265324_10006739 3300029957 Bacteria 4745
550 Ga0268256_1000037 3300030500 Bacteria 367024
551 Ga0268256_1003747 3300030500 Bacteria 6672
552 Ga0316181_1184579 3300030744 Bacteria 2553
553 Ga0265328_10000046 3300031239 Bacteria 81288
554 Ga0265328_10000374 3300031239 Bacteria 20850
555 Ga0265325_10001237 3300031241 Bacteria 18224
556 Ga0265325_10078699 3300031241 Bacteria 1642
557 Ga0265339_10004888 3300031249 Bacteria 9039
558 Ga0265339_10058837 3300031249 Bacteria 2074
559 Ga0265331_10000005 3300031250 Bacteria 465192
560 Ga0265331_10000710 3300031250 Bacteria 28344
561 Ga0265331_10006726 3300031250 Bacteria 6740
562 Ga0265331_10021328 3300031250 Bacteria 3317
563 Ga0265327_10007316 3300031251 Bacteria 8557
564 Ga0265316_10000099 3300031344 Bacteria 95020
565 Ga0307513_10002506 3300031456 Bacteria 25411
566 Ga0307513_10047620 3300031456 Bacteria 4661
567 Ga0307513_10058104 3300031456 Bacteria 4114
568 Ga0307408_100020170 3300031548 Bacteria 4494
569 Ga0307408_100029929 3300031548 Bacteria 3777
570 Ga0307408_100137872 3300031548 Bacteria 1911
571 Ga0265313_10003964 3300031595 Bacteria 11628
572 Ga0265313_10021233 3300031595 Bacteria 3556
573 Ga0307508_10002027 3300031616 Bacteria 21969
574 Ga0265314_10004906 3300031711 Bacteria 12225
575 Ga0265314_10013928 3300031711 Bacteria 6469
576 Ga0265342_10122872 3300031712 Bacteria 1460
577 Ga0307516_10000075 3300031730 Bacteria 107790
578 Ga0307516_10000405 3300031730 Bacteria 56495
579 Ga0307405_10080332 3300031731 Bacteria 2128
580 Ga0307405_10136541 3300031731 Bacteria 1703
581 Ga0307406_10031537 3300031901 Bacteria 3228
582 Ga0307412_10000012 3300031911 Bacteria 404180
583 Ga0307412_10002385 3300031911 Bacteria 10434
584 Ga0307412_10015694 3300031911 Bacteria 4496
585 Ga0307412_10024561 3300031911 Bacteria 3721
586 Ga0307412_10025707 3300031911 Bacteria 3650
587 Ga0307412_10081056 3300031911 Bacteria 2243
588 Ga0307412_10089214 3300031911 Bacteria 2152
589 Ga0307412_10106867 3300031911 Bacteria 1990
590 Ga0307409_100020314 3300031995 Bacteria 4523
591 Ga0307416_100000010 3300032002 Bacteria 320243
592 Ga0307416_100016318 3300032002 Bacteria 5158
593 Ga0307414_10003589 3300032004 Bacteria 8306
594 Ga0307414_10057339 3300032004 Bacteria 2737
595 Ga0307414_10098008 3300032004 Bacteria 2198
596 Ga0307414_10124383 3300032004 Bacteria 1989
597 Ga0307411_10259531 3300032005 Bacteria 1371
598 Ga0307415_100346861 3300032126 Bacteria 1248
599 Ga0373936_0009423 3300035113 Bacteria 3681
600 Ga0373927_0012559 3300035695 Bacteria 5640
601 Ga0373933_0070230 3300035724 Bacteria 2130
602 Ga0373937_0110950 3300036401 Bacteria 2551
603 Ga0395898_0011345 3300037466 Bacteria 9259
604 Ga0395905_0000022 3300037471 Bacteria 321527
605 Ga0395905_0029458 3300037471 Bacteria 5172
606 Ga0395905_0043737 3300037471 Bacteria 4201
607 Ga0395905_0213062 3300037471 Bacteria 1809
608 Ga0436364_1153948 3300037853 Bacteria 5332
609 Ga0436365_0458255 3300039437 Bacteria 5602
610 Ga0436360_0100021 3300039438 Bacteria 1846
611 Ga0436360_0660683 3300039438 Bacteria 1335
612 Ga0436362_0301465 3300039453 Bacteria 1820
613 Ga0439436_0002588 3300041404 Bacteria 5446
614 Ga0439461_0001983 3300041410 Bacteria 3235
615 Ga0439465_0000135 3300041413 Bacteria 18045
616 Ga0439465_0004120 3300041413 Bacteria 4729
617 Ga0439465_0004263 3300041413 Bacteria 4651
618 Ga0451849_1264891 3300041505 Bacteria 8051
619 Ga0439445_0002086 3300042004 Bacteria 4426
620 Ga0439445_0007629 3300042004 Bacteria 2517
621 Ga0439432_004445 3300042006 Bacteria 5121
622 Ga0439449_0032077 3300042007 Bacteria 1958
623 Ga0439449_0044226 3300042007 Bacteria 1652
624 Ga0439462_0001400 3300042015 Bacteria 5347
625 Ga0450905_008293 3300042142 Bacteria 1421
626 Ga0439434_0000065 3300042435 Bacteria 25739
627 Ga0450918_001885 3300042531 Bacteria 4056
628 Ga0466969_0001849 3300044656 Bacteria 11316
629 Ga0466966_0000273 3300044684 Bacteria 33831
630 Ga0466963_0006909 3300044694 Bacteria 6751
631 Ga0453684_0000062 3300044712 Bacteria 487590
632 Ga0453684_0000071 3300044712 Bacteria 448904
633 Ga0466957_0007115 3300044842 Bacteria 6328
634 Ga0466957_0129265 3300044842 Bacteria 1617
635 Ga0466957_0206626 3300044842 Bacteria 1292
636 Ga0466959_0000621 3300045049 Bacteria 20577
637 Ga0466959_0071675 3300045049 Bacteria 2509
638 Ga0466958_0095231 3300045836 Bacteria 1845
639 Ga0466967_0026329 3300045976 Bacteria 4816
640 Ga0495617_001529 3300046452 Bacteria 10042
641 Ga0495617_015587 3300046452 Bacteria 2574
642 Ga0495627_000003 3300046453 Bacteria 704557
643 Ga0495627_000225 3300046453 Bacteria 60005
644 Ga0495627_000324 3300046453 Bacteria 46576
645 Ga0495627_010260 3300046453 Bacteria 3412
646 Ga0495592_0066709 3300046454 Bacteria 2633
647 Ga0495592_0196937 3300046454 Bacteria 1362
648 Ga0495638_0000012 3300046460 Bacteria 435577
649 Ga0495650_0000172 3300046471 Bacteria 142776
650 Ga0495650_0003357 3300046471 Bacteria 11747
651 Ga0495605_0001337 3300046474 Bacteria 16311
652 Ga0495662_0048142 3300046476 Bacteria 2058
653 Ga0495664_0157937 3300046477 Bacteria 1376
654 Ga0495584_0022076 3300046491 Bacteria 3230
655 Ga0495584_0046587 3300046491 Bacteria 2187
656 Ga0495585_0006200 3300046492 Bacteria 7451
657 Ga0495585_0015028 3300046492 Bacteria 4501
658 Ga0495596_0005171 3300046500 Bacteria 6214
659 Ga0495607_0080002 3300046501 Bacteria 1799
660 Ga0495583_0001198 3300046506 Bacteria 27870
661 Ga0495583_0001819 3300046506 Bacteria 20011
662 Ga0495583_0002397 3300046506 Bacteria 16123
663 Ga0495583_0012705 3300046506 Bacteria 4744
664 Ga0495583_0029817 3300046506 Bacteria 2665
665 Ga0495583_0033366 3300046506 Bacteria 2476
666 Ga0495606_0002807 3300046507 Bacteria 19394
667 Ga0495606_0013347 3300046507 Bacteria 6497
668 Ga0495606_0032790 3300046507 Bacteria 3593
669 Ga0495606_0067291 3300046507 Bacteria 2269
670 Ga0495610_0000001 3300046512 Bacteria 1620061
671 Ga0495610_0000085 3300046512 Bacteria 112390
672 Ga0495616_0000192 3300046513 Bacteria 50986
673 Ga0495616_0026474 3300046513 Bacteria 3086
674 Ga0495631_0001421 3300046518 Bacteria 14544
675 Ga0495631_0012838 3300046518 Bacteria 4079
676 Ga0495632_0000013 3300046519 Bacteria 247879
677 Ga0495632_0000612 3300046519 Bacteria 32954
678 Ga0495632_0011139 3300046519 Bacteria 5267
679 Ga0495632_0032939 3300046519 Bacteria 2665
680 Ga0495637_0000100 3300046520 Bacteria 65373
681 Ga0495637_0007164 3300046520 Bacteria 5551
682 Ga0495637_0015444 3300046520 Bacteria 3581
683 Ga0495643_0000010 3300046522 Bacteria 341431
684 Ga0495643_0009885 3300046522 Bacteria 5897
685 Ga0495643_0011121 3300046522 Bacteria 5501
686 Ga0495643_0020159 3300046522 Bacteria 3850
687 Ga0495643_0029986 3300046522 Bacteria 3041
688 Ga0495648_0000038 3300046524 Bacteria 191612
689 Ga0495648_0000933 3300046524 Bacteria 30373
690 Ga0495648_0000993 3300046524 Bacteria 29167
691 Ga0495648_0051791 3300046524 Bacteria 2498
692 Ga0495648_0077423 3300046524 Bacteria 1906
693 Ga0495663_0000004 3300046525 Bacteria 355166
694 Ga0495663_0000010 3300046525 Bacteria 161009
695 Ga0495663_0004862 3300046525 Bacteria 3754
696 Ga0495663_0007071 3300046525 Bacteria 3098
697 Ga0495642_0035268 3300046528 Bacteria 2018
698 Ga0495654_0000001 3300046530 Bacteria 1513197
699 Ga0495654_0000224 3300046530 Bacteria 52709
700 Ga0495654_0092421 3300046530 Bacteria 1402
701 Ga0495654_0108064 3300046530 Bacteria 1272
702 Ga0495609_0020647 3300046538 Bacteria 3042
703 Ga0495609_0044694 3300046538 Bacteria 1986
704 Ga0495597_0067954 3300046542 Bacteria 1541
705 Ga0495622_0004872 3300046557 Bacteria 6215
706 Ga0495633_0000008 3300046558 Bacteria 301830
707 Ga0495633_0000092 3300046558 Bacteria 121446
708 Ga0495633_0001757 3300046558 Bacteria 16080
709 Ga0495633_0003754 3300046558 Bacteria 9986
710 Ga0495633_0004038 3300046558 Bacteria 9495
711 Ga0495633_0005139 3300046558 Bacteria 8110
712 Ga0495633_0006121 3300046558 Bacteria 7204
713 Ga0495633_0018058 3300046558 Bacteria 3588
714 Ga0495633_0020674 3300046558 Bacteria 3306
715 Ga0495633_0023728 3300046558 Bacteria 3037
716 Ga0495633_0050884 3300046558 Bacteria 1952
717 Ga0495668_0000024 3300046616 Bacteria 359469
718 Ga0495668_0000080 3300046616 Bacteria 157259
719 Ga0495668_0001200 3300046616 Bacteria 26319
720 Ga0495668_0015691 3300046616 Bacteria 4416
721 Ga0495668_0017970 3300046616 Bacteria 4093
722 Ga0495668_0040440 3300046616 Bacteria 2600
723 Ga0495668_0063372 3300046616 Bacteria 2036
724 Ga0495668_0068429 3300046616 Bacteria 1953
725 Ga0495668_0143433 3300046616 Bacteria 1307
726 Ga0495625_0000621 3300046660 Bacteria 51568
727 Ga0495625_0000727 3300046660 Bacteria 46264
728 Ga0495625_0001091 3300046660 Bacteria 35271
729 Ga0495625_0010254 3300046660 Bacteria 7769
730 Ga0495625_0039111 3300046660 Bacteria 3466
731 Ga0495625_0039189 3300046660 Bacteria 3462
732 Ga0495588_0001528 3300046674 Bacteria 9899
733 Ga0495588_0023967 3300046674 Bacteria 3028
734 Ga0495588_0047113 3300046674 Bacteria 2213
735 Ga0495588_0095861 3300046674 Bacteria 1556
736 Ga0495669_0000214 3300046684 Bacteria 34972
737 Ga0495669_0007253 3300046684 Bacteria 4645
738 Ga0495670_0000005 3300046691 Bacteria 289725
739 Ga0495670_0010251 3300046691 Bacteria 4604
740 Ga0495671_0000014 3300046692 Bacteria 341431
741 Ga0495671_0000034 3300046692 Bacteria 195385
742 Ga0495671_0046736 3300046692 Bacteria 2164
743 Ga0495671_0160411 3300046692 Bacteria 1094
744 Ga0495649_0039161 3300046694 Bacteria 2599
745 Ga0495649_0058484 3300046694 Bacteria 2077
746 Ga0495600_0012916 3300046809 Bacteria 5234
747 Ga0495660_0021376 3300046810 Bacteria 3706
748 Ga0495672_0032885 3300047320 Bacteria 3219
749 Ga0495687_001639 3300047443 Bacteria 20146
750 Ga0495687_006734 3300047443 Bacteria 6956
751 Ga0495677_0006070 3300047445 Bacteria 4567
752 Ga0495673_0000013 3300047469 Bacteria 612902
753 Ga0495673_0009404 3300047469 Bacteria 5410
754 Ga0495681_0000013 3300047470 Bacteria 189155
755 Ga0495681_0000725 3300047470 Bacteria 25287
756 Ga0495681_0008616 3300047470 Bacteria 6369
757 Ga0495681_0010003 3300047470 Bacteria 5778
758 Ga0495686_0000416 3300047472 Bacteria 67601
759 Ga0495686_0000701 3300047472 Bacteria 45238
760 Ga0495686_0009517 3300047472 Bacteria 6991
761 Ga0495686_0019667 3300047472 Bacteria 4510
762 Ga0495686_0020937 3300047472 Bacteria 4355
763 Ga0495686_0051336 3300047472 Bacteria 2588
764 Ga0495686_0054829 3300047472 Bacteria 2495
765 Ga0495602_0124838 3300048088 Bacteria 2064
766 Ga0496101_0040605 3300048904 Bacteria 3314
767 Ga0496101_0061414 3300048904 Bacteria 2729
768 Ga0496102_0000213 3300048905 Bacteria 76751
769 Ga0496102_0062782 3300048905 Bacteria 3402
770 Ga0496102_0173771 3300048905 Bacteria 2028
771 Ga0496102_0213611 3300048905 Bacteria 1819
772 Ga0496103_0000782 3300048906 Bacteria 23417
773 Ga0496104_0012047 3300048907 Bacteria 7762
774 Ga0496104_0023140 3300048907 Bacteria 5712
775 Ga0496104_0031887 3300048907 Bacteria 4903
776 Ga0496104_0174409 3300048907 Bacteria 2060
777 Ga0496106_0022487 3300048909 Bacteria 4685
778 Ga0496108_0003150 3300048911 Bacteria 13268
779 Ga0496108_0003651 3300048911 Bacteria 12345
780 Ga0496108_0166028 3300048911 Bacteria 1909
781 Ga0496109_0014694 3300048912 Bacteria 6814
782 Ga0496109_0181853 3300048912 Bacteria 1975
783 Ga0496110_0091815 3300048913 Bacteria 2717
784 Ga0496110_0189422 3300048913 Bacteria 1868
785 Ga0496110_0383103 3300048913 Bacteria 1281
786 Ga0496111_0128100 3300048914 Bacteria 1877
787 Ga0496112_0029831 3300048915 Bacteria 5277
788 Ga0496112_0088648 3300048915 Bacteria 3062
789 Ga0496113_0038568 3300048916 Bacteria 3514
790 Ga0496114_0001667 3300048917 Bacteria 16851
791 Ga0496114_0025240 3300048917 Bacteria 4857
792 Ga0496114_0174339 3300048917 Bacteria 1876
793 Ga0496115_0000785 3300048918 Bacteria 23300
794 Ga0496115_0005734 3300048918 Bacteria 9040
795 Ga0496116_0000053 3300048919 Bacteria 291837
796 Ga0496116_0006359 3300048919 Bacteria 10745
797 Ga0496116_0073291 3300048919 Bacteria 2160
798 Ga0496116_0092699 3300048919 Bacteria 1831
799 Ga0496117_0000066 3300048920 Bacteria 253534
800 Ga0496117_0000089 3300048920 Bacteria 210551
801 Ga0496117_0002444 3300048920 Bacteria 23397
802 Ga0496117_0006220 3300048920 Bacteria 12173
803 Ga0496117_0066710 3300048920 Bacteria 2439
804 Ga0496117_0114070 3300048920 Bacteria 1676
805 Ga0496118_0000207 3300048921 Bacteria 102753
806 Ga0496118_0000221 3300048921 Bacteria 99682
807 Ga0496118_0007705 3300048921 Bacteria 11319
808 Ga0496118_0018005 3300048921 Bacteria 6399
809 Ga0496118_0021302 3300048921 Bacteria 5712
810 Ga0496119_0000038 3300048922 Bacteria 209546
811 Ga0496119_0006920 3300048922 Bacteria 10344
812 Ga0496119_0012665 3300048922 Bacteria 6825
813 Ga0496119_0022050 3300048922 Bacteria 4577
814 Ga0496119_0050725 3300048922 Bacteria 2555
815 Ga0496119_0087073 3300048922 Bacteria 1783
816 Ga0496120_0000100 3300048923 Bacteria 143064
817 Ga0496120_0014878 3300048923 Bacteria 5159
818 Ga0496120_0073387 3300048923 Bacteria 1873
819 Ga0496121_0000542 3300048924 Bacteria 71767
820 Ga0496121_0002040 3300048924 Bacteria 31978
821 Ga0496121_0002349 3300048924 Bacteria 29176
822 Ga0496121_0010693 3300048924 Bacteria 10299
823 Ga0496121_0013808 3300048924 Bacteria 8645
824 Ga0496121_0034219 3300048924 Bacteria 4577
825 Ga0496121_0049074 3300048924 Bacteria 3584
826 Ga0496122_0000057 3300048925 Bacteria 253452
827 Ga0496122_0000109 3300048925 Bacteria 190828
828 Ga0496122_0000118 3300048925 Bacteria 182789
829 Ga0496122_0000700 3300048925 Bacteria 66410
830 Ga0496122_0003899 3300048925 Bacteria 19105
831 Ga0496122_0003976 3300048925 Bacteria 18866
832 Ga0496122_0009972 3300048925 Bacteria 9892
833 Ga0496122_0010527 3300048925 Bacteria 9507
834 Ga0496122_0029086 3300048925 Bacteria 4671
835 Ga0496122_0033274 3300048925 Bacteria 4244
836 Ga0496122_0103514 3300048925 Bacteria 1894
837 Ga0496122_0122712 3300048925 Bacteria 1671
838 Ga0496123_0000096 3300048926 Bacteria 173914
839 Ga0496123_0000930 3300048926 Bacteria 45779
840 Ga0496123_0005631 3300048926 Bacteria 12506
841 Ga0496123_0007098 3300048926 Bacteria 10645
842 Ga0496123_0007161 3300048926 Bacteria 10587
843 Ga0496123_0010458 3300048926 Bacteria 8199
844 Ga0496123_0011663 3300048926 Bacteria 7586
845 Ga0496123_0063861 3300048926 Bacteria 2349
846 Ga0496123_0159903 3300048926 Bacteria 1202
847 Ga0496124_0001031 3300048927 Bacteria 44122
848 Ga0496124_0012788 3300048927 Bacteria 8247
849 Ga0496124_0019580 3300048927 Bacteria 6290
850 Ga0496124_0039779 3300048927 Bacteria 4072
851 Ga0496125_0000145 3300048928 Bacteria 156267
852 Ga0496125_0000547 3300048928 Bacteria 64865
853 Ga0496125_0002742 3300048928 Bacteria 22289
854 Ga0496125_0003355 3300048928 Bacteria 19500
855 Ga0496125_0024786 3300048928 Bacteria 5507
856 Ga0496125_0032349 3300048928 Bacteria 4647
857 Ga0496125_0033622 3300048928 Bacteria 4534
858 Ga0496125_0047287 3300048928 Bacteria 3600
859 Ga0496126_0001041 3300048929 Bacteria 46865
860 Ga0496126_0002687 3300048929 Bacteria 23498
861 Ga0496126_0003357 3300048929 Bacteria 20298
862 Ga0496126_0012770 3300048929 Bacteria 8585
863 Ga0496126_0021273 3300048929 Bacteria 6339
864 Ga0496126_0034512 3300048929 Bacteria 4751
865 Ga0496126_0050780 3300048929 Bacteria 3778
866 Ga0496126_0085797 3300048929 Bacteria 2775
867 Ga0495678_007036 3300049459 Bacteria 5895
868 Ga0495678_023424 3300049459 Bacteria 2683
869 Ga0501290_000012 3300049513 Bacteria 28888
870 Ga0501292_000043 3300049515 Bacteria 28998
871 Ga0501300_000322 3300049523 Bacteria 7249
872 Ga0501031_0003517 3300049568 Bacteria 10051
873 Ga0501032_0002875 3300049569 Bacteria 13394
874 Ga0501032_0016935 3300049569 Bacteria 5122
875 Ga0501032_0049585 3300049569 Bacteria 2832
876 Ga0501032_0072177 3300049569 Bacteria 2301
877 Ga0501032_0087427 3300049569 Bacteria 2070
878 Ga0501033_0008378 3300049570 Bacteria 8007
879 Ga0501033_0009071 3300049570 Bacteria 7673
880 Ga0501033_0015281 3300049570 Bacteria 5823
881 Ga0501033_0016189 3300049570 Bacteria 5646
882 Ga0501033_0017174 3300049570 Bacteria 5468
883 Ga0501033_0050570 3300049570 Bacteria 3082
884 Ga0501033_0052332 3300049570 Bacteria 3026
885 Ga0501033_0055294 3300049570 Bacteria 2935
886 Ga0501033_0299043 3300049570 Bacteria 1133
887 Ga0501034_0000413 3300049571 Bacteria 71861
888 Ga0501034_0006169 3300049571 Bacteria 12922
889 Ga0501034_0009021 3300049571 Bacteria 10474
890 Ga0501034_0037717 3300049571 Bacteria 4895
891 Ga0501034_0049702 3300049571 Bacteria 4231
892 Ga0501034_0060477 3300049571 Bacteria 3805
893 Ga0501034_0134285 3300049571 Bacteria 2456
894 Ga0501034_0209105 3300049571 Bacteria 1907
895 Ga0501034_0211938 3300049571 Bacteria 1892
896 Ga0501036_0001251 3300049572 Bacteria 19465
897 Ga0501036_0017675 3300049572 Bacteria 5967
898 Ga0501036_0027231 3300049572 Bacteria 4829
899 Ga0501036_0041128 3300049572 Bacteria 3912
900 Ga0501036_0126744 3300049572 Bacteria 2156
901 Ga0501037_0003285 3300049573 Bacteria 11744
902 Ga0501037_0011305 3300049573 Bacteria 6570
903 Ga0501037_0069024 3300049573 Bacteria 2573
904 Ga0501037_0167128 3300049573 Bacteria 1566
905 Ga0501038_0002993 3300049574 Bacteria 15751
906 Ga0501038_0059869 3300049574 Bacteria 3260
907 Ga0501038_0208230 3300049574 Bacteria 1566
908 Ga0501038_0225527 3300049574 Bacteria 1493
909 Ga0501038_0308854 3300049574 Bacteria 1239
910 Ga0501039_0005059 3300049575 Bacteria 9996
911 Ga0501039_0022121 3300049575 Bacteria 4879
912 Ga0501039_0030137 3300049575 Bacteria 4182
913 Ga0501039_0128969 3300049575 Bacteria 1984
914 Ga0501039_0203291 3300049575 Bacteria 1557
915 Ga0501042_0006147 3300049578 Bacteria 7785
916 Ga0501042_0015292 3300049578 Bacteria 5253
917 Ga0501043_0014567 3300049579 Bacteria 6157
918 Ga0501043_0021795 3300049579 Bacteria 5024
919 Ga0501043_0045792 3300049579 Bacteria 3439
920 Ga0501043_0058613 3300049579 Bacteria 3022
921 Ga0501043_0092094 3300049579 Bacteria 2383
922 Ga0501043_0128969 3300049579 Bacteria 1982
923 Ga0501046_0000035 3300049580 Bacteria 161495
924 Ga0501046_0001206 3300049580 Bacteria 25105
925 Ga0501046_0036342 3300049580 Bacteria 3964
926 Ga0501046_0088409 3300049580 Bacteria 2386
927 Ga0501047_0007678 3300049581 Bacteria 10159
928 Ga0501047_0012927 3300049581 Bacteria 7906
929 Ga0501047_0027525 3300049581 Bacteria 5477
930 Ga0501047_0056294 3300049581 Bacteria 3802
931 Ga0501047_0153398 3300049581 Bacteria 2178
932 Ga0501047_0156664 3300049581 Bacteria 2151
933 Ga0501047_0189155 3300049581 Bacteria 1923
934 Ga0501048_0002015 3300049582 Bacteria 15430
935 Ga0501048_0008779 3300049582 Bacteria 7616
936 Ga0501048_0175560 3300049582 Bacteria 1518
937 Ga0501067_0000260 3300049583 Bacteria 28874
938 Ga0501067_0006624 3300049583 Bacteria 6425
939 Ga0501068_0007179 3300049584 Bacteria 6171
940 Ga0501068_0066584 3300049584 Bacteria 2194
941 Ga0501069_0002372 3300049585 Bacteria 9550
942 Ga0501069_0025616 3300049585 Bacteria 3225
943 Ga0501070_0007427 3300049586 Bacteria 9306
944 Ga0501070_0106630 3300049586 Bacteria 2316
945 Ga0501070_0181658 3300049586 Bacteria 1731
946 Ga0501071_0087456 3300049587 Bacteria 2286
947 Ga0501072_0025799 3300049588 Bacteria 4579
948 Ga0501072_0216776 3300049588 Bacteria 1525
949 Ga0501073_0007949 3300049589 Bacteria 7870
950 Ga0501073_0061825 3300049589 Bacteria 2612
951 Ga0501076_0187738 3300049592 Bacteria 1686
952 Ga0501206_000178 3300049653 Bacteria 7066
953 Ga0501222_000195 3300049662 Bacteria 10908
954 Ga0501223_000008 3300049663 Bacteria 117828
955 Ga0501223_000033 3300049663 Bacteria 49156
956 Ga0501223_001464 3300049663 Bacteria 5463
957 Ga0501224_000026 3300049664 Bacteria 54620
958 Ga0501224_000252 3300049664 Bacteria 6122
959 Ga0501233_000479 3300049668 Bacteria 6377
960 Ga0501235_012715 3300049669 Bacteria 1852
961 Ga0501249_000111 3300049679 Bacteria 25221
962 Ga0501259_000261 3300049688 Bacteria 8281
963 Ga0501261_000028 3300049690 Bacteria 32508
964 Ga0501221_012623 3300049704 Bacteria 1540
965 Ga0501225_0000018 3300049705 Bacteria 59791
966 Ga0501225_0000046 3300049705 Bacteria 41537
967 Ga0501225_0000335 3300049705 Bacteria 14740
968 Ga0501225_0020238 3300049705 Bacteria 1840
969 Ga0501079_0024088 3300049741 Bacteria 4670
970 Ga0501080_0009913 3300049742 Bacteria 8704
971 Ga0501080_0146125 3300049742 Bacteria 2185
972 Ga0501083_0016907 3300049744 Bacteria 5095
973 Ga0501241_000019 3300049758 Bacteria 88612
974 Ga0501241_000189 3300049758 Bacteria 13925
975 Ga0501279_000030 3300049775 Bacteria 37693
976 Ga0501280_000040 3300049776 Bacteria 38251
977 Ga0501281_00088 3300049777 Bacteria 10781
978 Ga0501282_000136 3300049778 Bacteria 8648
979 Ga0501283_000528 3300049779 Bacteria 5020
980 Ga0501035_0005333 3300049822 Bacteria 12163
981 Ga0501035_0012722 3300049822 Bacteria 7777
982 Ga0501035_0017828 3300049822 Bacteria 6548
983 Ga0501035_0034127 3300049822 Bacteria 4624
984 Ga0501035_0101787 3300049822 Bacteria 2521
985 Ga0501035_0136614 3300049822 Bacteria 2134
986 Ga0501035_0175436 3300049822 Bacteria 1849
987 Ga0501035_0181510 3300049822 Bacteria 1813
988 Ga0501044_0002233 3300049823 Bacteria 22166
989 Ga0501044_0007604 3300049823 Bacteria 11913
990 Ga0501044_0027397 3300049823 Bacteria 6023
991 Ga0501044_0052375 3300049823 Bacteria 4206
992 Ga0501044_0056167 3300049823 Bacteria 4042
993 Ga0501044_0095863 3300049823 Bacteria 2989
994 Ga0501044_0106881 3300049823 Bacteria 2810
995 Ga0501044_0204246 3300049823 Bacteria 1933
996 Ga0501044_0239057 3300049823 Bacteria 1760
997 Ga0501044_0384524 3300049823 Bacteria 1318
998 Ga0501045_0035107 3300049824 Bacteria 3640
999 Ga0501226_000066 3300049853 Bacteria 34204
1000 nmdc:mga03683_113_c1 3300050489 Bacteria 27805
1001 nmdc:mga03n38_2972_c1 3300050490 Bacteria 5359
1002 nmdc:mga03n38_3514_c1 3300050490 Bacteria 5049
1003 nmdc:mga00v17_128953_c1 3300050491 Bacteria 1615
1004 nmdc:mga00v17_17_c1 3300050491 Bacteria 121949
1005 nmdc:mga00v17_47940_c1 3300050491 Bacteria 2589
1006 nmdc:mga0k408_38443_c1 3300050493 Bacteria 2746
1007 nmdc:mga0k408_9_c2 3300050493 Bacteria 64937
1008 nmdc:mga06z11_134103_c1 3300050494 Bacteria 1394
1009 nmdc:mga06z11_136_c1 3300050494 Bacteria 29270
1010 nmdc:mga06z11_601_c1 3300050494 Bacteria 13143
1011 nmdc:mga06z11_7485_c1 3300050494 Bacteria 4496
1012 nmdc:mga04h51_18_c1 3300050495 Bacteria 74460
1013 nmdc:mga04h51_22235_c1 3300050495 Bacteria 1917
1014 nmdc:mga04h51_2380_c1 3300050495 Bacteria 4456
1015 nmdc:mga04h51_26340_c1 3300050495 Bacteria 1797
1016 nmdc:mga07m45_13_c1 3300050496 Bacteria 65600
1017 nmdc:mga07m45_391_c1 3300050496 Bacteria 18042
1018 nmdc:mga0sz30_121_c1 3300050516 Bacteria 29087
1019 nmdc:mga0sz30_24246_c1 3300050516 Bacteria 2474
1020 nmdc:mga0sz30_253_c2 3300050516 Bacteria 8672
1021 Ga0500610_0000034 3300053079 Bacteria 49152
1022 Ga0500610_0013892 3300053079 Bacteria 3762
1023 Ga0500643_000003 3300053087 Bacteria 876659
1024 Ga0500643_000577 3300053087 Bacteria 25463
1025 Ga0500643_001255 3300053087 Bacteria 15032
1026 Ga0500643_005656 3300053087 Bacteria 5346
1027 Ga0500643_030126 3300053087 Bacteria 1664
1028 Ga0500647_0011154 3300053091 Bacteria 4001
1029 Ga0500647_0014081 3300053091 Bacteria 3630
1030 Ga0500651_0003100 3300053093 Bacteria 9004
1031 Ga0500566_0000771 3300053094 Bacteria 18098
1032 Ga0500566_0008535 3300053094 Bacteria 6058
1033 Ga0500641_0014493 3300053096 Bacteria 2911
1034 Ga0500560_000810 3300053107 Bacteria 4814
1035 Ga0500560_001662 3300053107 Bacteria 3964
1036 Ga0500569_018439 3300053109 Bacteria 1802
1037 Ga0500572_016322 3300053111 Bacteria 1889
1038 Ga0500592_000077 3300053116 Bacteria 24748
1039 Ga0500592_000537 3300053116 Bacteria 6266
1040 Ga0500595_001745 3300053119 Bacteria 11341
1041 Ga0500607_000098 3300053121 Bacteria 65919
1042 Ga0500614_001221 3300053123 Bacteria 6255
1043 Ga0500618_004495 3300053125 Bacteria 4430
1044 Ga0500652_000014 3300053131 Bacteria 147740
1045 Ga0500655_000307 3300053133 Bacteria 11138
1046 Ga0500559_0012414 3300053136 Bacteria 3621
1047 Ga0500559_0099150 3300053136 Bacteria 1341
1048 Ga0500559_0116722 3300053136 Bacteria 1239
1049 Ga0500561_0000278 3300053137 Bacteria 8944
1050 Ga0500568_0000872 3300053139 Bacteria 21157
1051 Ga0500568_0014517 3300053139 Bacteria 3554
1052 Ga0500568_0067331 3300053139 Bacteria 1376
1053 Ga0500573_0000015 3300053140 Bacteria 192264
1054 Ga0500573_0000037 3300053140 Bacteria 107603
1055 Ga0500590_000114 3300053148 Bacteria 21825
1056 Ga0500590_000841 3300053148 Bacteria 11538
1057 Ga0500590_002695 3300053148 Bacteria 7983
1058 Ga0500604_0001472 3300053151 Bacteria 6574
1059 Ga0500622_0001565 3300053156 Bacteria 18093
1060 Ga0500624_000003 3300053157 Bacteria 253364
1061 Ga0500624_000011 3300053157 Bacteria 168125
1062 Ga0500624_000443 3300053157 Bacteria 12488
1063 Ga0500627_0000043 3300053158 Bacteria 65441
1064 Ga0500627_0000278 3300053158 Bacteria 14608
1065 Ga0500627_0002274 3300053158 Bacteria 5642
1066 Ga0500627_0012802 3300053158 Bacteria 3157
1067 Ga0500627_0029037 3300053158 Bacteria 2303
1068 Ga0500634_0008457 3300053161 Bacteria 5147
1069 Ga0500636_0006352 3300053177 Bacteria 6782
1070 Ga0500636_0012009 3300053177 Bacteria 5073
1071 Ga0500636_0085951 3300053177 Bacteria 1807
1072 Ga0500637_0000045 3300053178 Bacteria 44699
1073 Ga0500637_0089187 3300053178 Bacteria 1785
1074 Ga0500570_000053 3300053724 Bacteria 28643
1075 Ga0500645_000001 3300053730 Bacteria 455558
1076 Ga0500645_011886 3300053730 Bacteria 2828
1077 Ga0500645_034139 3300053730 Bacteria 1519
1078 Ga0500596_002101 3300053735 Bacteria 3966
1079 Ga0501084_0009365 3300054114 Bacteria 8103
1080 Ga0501084_0052635 3300054114 Bacteria 3406
1081 Ga0500661_000046 3300055283 Bacteria 18860
1082 Ga0501082_0001610 3300060353 Bacteria 19885
1083 Ga0501082_0032979 3300060353 Bacteria 4466
1084 Ga0501082_0060202 3300060353 Bacteria 3271
1085 Ga0466962_0014907 3300061719 Bacteria 3746
1086 Ga0466962_0039032 3300061719 Bacteria 2274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0128969 Ga0501039_0128969_997_1935 300
2 3300025921 Ga0207652_10088169 Ga0207652_100881691 302
3 3300053730 Ga0500645_034139 Ga0500645_034139_540_1502 318
4 3300048925 Ga0496122_0122712 Ga0496122_0122712_498_1499 322
5 3300049570 Ga0501033_0299043 Ga0501033_0299043_37_1023 326
6 3300039438 Ga0436360_0660683 Ga0436360_0660683_23_1039 329
7 3300046522 Ga0495643_0009885 Ga0495643_0009885_2467_3456 329
8 3300005289 Ga0065704_10073124 Ga0065704_100731243 332
9 3300054114 Ga0501084_0052635 Ga0501084_0052635_1472_2488 332
10 3300005530 Ga0070679_100135681 Ga0070679_1001356813 335
11 3300049569 Ga0501032_0002875 Ga0501032_0002875_8085_9215 335
12 3300049570 Ga0501033_0015281 Ga0501033_0015281_1665_2795 335
13 3300049571 Ga0501034_0006169 Ga0501034_0006169_5615_6745 335
14 3300049572 Ga0501036_0001251 Ga0501036_0001251_8027_9157 335
15 3300049573 Ga0501037_0003285 Ga0501037_0003285_6775_7905 335
16 3300049575 Ga0501039_0005059 Ga0501039_0005059_4824_5954 335
17 3300049578 Ga0501042_0006147 Ga0501042_0006147_4383_5513 335
18 3300049579 Ga0501043_0045792 Ga0501043_0045792_517_1647 335
19 3300049580 Ga0501046_0001206 Ga0501046_0001206_11680_12810 335
20 3300049581 Ga0501047_0007678 Ga0501047_0007678_3029_4159 335
21 3300049582 Ga0501048_0008779 Ga0501048_0008779_5158_6288 335
22 3300049583 Ga0501067_0000260 Ga0501067_0000260_15965_17095 335
23 3300049584 Ga0501068_0066584 Ga0501068_0066584_967_2097 335
24 3300049585 Ga0501069_0002372 Ga0501069_0002372_5318_6448 335
25 3300049586 Ga0501070_0007427 Ga0501070_0007427_8086_9216 335
26 3300049588 Ga0501072_0216776 Ga0501072_0216776_97_1227 335
27 3300049589 Ga0501073_0061825 Ga0501073_0061825_1179_2309 335
28 3300049741 Ga0501079_0024088 Ga0501079_0024088_2832_3962 335
29 3300049742 Ga0501080_0009913 Ga0501080_0009913_4418_5548 335
30 3300049822 Ga0501035_0017828 Ga0501035_0017828_4240_5370 335
31 3300054114 Ga0501084_0009365 Ga0501084_0009365_1665_2795 335
32 3300060353 Ga0501082_0001610 Ga0501082_0001610_5244_6374 335
33 3300005339 Ga0070660_100034716 Ga0070660_1000347163 337
34 3300005366 Ga0070659_100057665 Ga0070659_1000576653 337
35 3300005563 Ga0068855_100145628 Ga0068855_1001456283 337
36 3300013104 Ga0157370_10030229 Ga0157370_100302292 337
37 3300025949 Ga0207667_10127428 Ga0207667_101274282 337
38 3300003322 rootL2_10109219 rootL2_101092192 343
39 3300013308 Ga0157375_10000313 Ga0157375_1000031320 343
40 3300009098 Ga0105245_10221379 Ga0105245_102213792 344
41 3300047472 Ga0495686_0000701 Ga0495686_0000701_13781_14854 345
42 3300049758 Ga0501241_000189 Ga0501241_000189_10775_11845 345
43 3300041505 Ga0451849_1264891 Ga0451849_1264891_3381_4454 346
44 3300046674 Ga0495588_0047113 Ga0495588_0047113_266_1339 346
45 3300049823 Ga0501044_0384524 Ga0501044_0384524_262_1308 346
46 3300046692 Ga0495671_0160411 Ga0495671_0160411_10_1065 347
47 3300005289 Ga0065704_10074376 Ga0065704_100743764 350
48 3300025272 Ga0209455_1009694 Ga0209455_10096942 350
49 3300005262 Ga0065165_1001556 Ga0065165_10015561 351
50 3300026118 Ga0207675_100014882 Ga0207675_1000148828 351
51 3300009101 Ga0105247_10108412 Ga0105247_101084123 352
52 3300009177 Ga0105248_10037315 Ga0105248_100373154 352
53 3300009553 Ga0105249_10011772 Ga0105249_100117724 352
54 3300013102 Ga0157371_10055251 Ga0157371_100552513 352
55 3300025961 Ga0207712_10208815 Ga0207712_102088151 352
56 3300060353 Ga0501082_0060202 Ga0501082_0060202_1210_2367 352
57 3300005355 Ga0070671_100330526 Ga0070671_1003305261 353
58 3300049571 Ga0501034_0209105 Ga0501034_0209105_97_1167 353
59 3300025921 Ga0207652_10001588 Ga0207652_1000158817 354
60 3300046525 Ga0495663_0000010 Ga0495663_0000010_142693_143802 354
61 3300053148 Ga0500590_002695 Ga0500590_002695_304_1434 354
62 3300005327 Ga0070658_10017194 Ga0070658_100171945 355
63 3300005329 Ga0070683_100000962 Ga0070683_1000009629 355
64 3300005535 Ga0070684_100000297 Ga0070684_1000002978 355
65 3300005564 Ga0070664_100037558 Ga0070664_1000375582 355
66 3300005577 Ga0068857_100007564 Ga0068857_1000075645 355
67 3300005614 Ga0068856_100000581 Ga0068856_10000058113 355
68 3300013105 Ga0157369_10001685 Ga0157369_100016853 355
69 3300025944 Ga0207661_10002325 Ga0207661_100023253 355
70 3300025945 Ga0207679_10006553 Ga0207679_100065532 355
71 3300026078 Ga0207702_10000922 Ga0207702_100009225 355
72 3300026116 Ga0207674_10012575 Ga0207674_100125757 355
73 3300009545 Ga0105237_10092985 Ga0105237_100929852 357
74 3300013104 Ga0157370_10027971 Ga0157370_100279711 357
75 3300031595 Ga0265313_10003964 Ga0265313_100039644 357
76 3300048929 Ga0496126_0021273 Ga0496126_0021273_2154_3287 357
77 3300053140 Ga0500573_0000037 Ga0500573_0000037_43130_44290 357
78 iso_pu_bacteria 2582581278 2585141511 357
79 iso_pu_bacteria 2582581873 2585424712 357
80 iso_pu_bacteria 2585428045 2587680445 357
81 iso_pu_bacteria 2585428060 2587749467 357
82 iso_pu_bacteria 2585428095 2587866752 357
83 iso_pu_bacteria 2585428182 2588208111 357
84 iso_pu_bacteria 2585428183 2588213307 357
85 iso_pu_bacteria 2585428184 2588219924 357
86 iso_pu_bacteria 2585428185 2588223807 357
87 iso_pu_bacteria 2588253712 2588446566 357
88 iso_pu_bacteria 2588254255 2590600725 357
89 iso_pu_bacteria 2588254257 2590612021 357
90 iso_pu_bacteria 2728369107 2729198698 357
91 iso_pu_bacteria 2751185877 2753672579 357
92 iso_pu_bacteria 2765235839 2765572699 357
93 iso_pu_bacteria 2772190705 2772603938 357
94 iso_pu_bacteria 2775506739 2775672858 357
95 iso_pu_bacteria 2816332188 2816873053 357
96 iso_pu_bacteria 2842083920 2842084301 357
97 iso_pu_bacteria 2871720351 2871723858 357
98 iso_pu_bacteria 2889290771 2889291575 357
99 iso_pu_bacteria 2905999023 2906000702 357
100 iso_pu_bacteria 2919097161 2919099276 357
101 iso_pu_bacteria 2919399522 2919402996 357
102 iso_pu_bacteria 2919692658 2919695220 357
103 iso_pu_bacteria 2946019816 2946021526 357
104 iso_pu_bacteria 2977243572 2977246138 357
105 iso_pu_bacteria 2993372514 2993373451 357
106 iso_pu_bacteria 2993480792 2993484136 357
107 3300015261 Ga0182006_1000011 Ga0182006_1000011353 358
108 3300031911 Ga0307412_10000012 Ga0307412_1000001282 358
109 3300032002 Ga0307416_100000010 Ga0307416_10000001057 358
110 3300032004 Ga0307414_10124383 Ga0307414_101243833 358
111 3300042142 Ga0450905_008293 Ga0450905_008293_25_1125 358
112 3300046512 Ga0495610_0000001 Ga0495610_0000001_1565984_1567084 358
113 3300048925 Ga0496122_0033274 Ga0496122_0033274_647_1747 358
114 iso_pu_bacteria 2945924605 2945927216 358
115 3300003320 rootH2_10108382 rootH2_101083822 359
116 3300003322 rootL2_10261820 rootL2_102618202 359
117 3300003323 rootH1_10172432 rootH1_101724324 359
118 3300003323 rootH1_10193712 rootH1_101937123 359
119 3300003759 Ga0055525_1000063 Ga0055525_1000063138 359
120 3300003759 Ga0055525_1000064 Ga0055525_1000064138 359
121 3300003784 Ga0055534_1002619 Ga0055534_10026194 359
122 3300005335 Ga0070666_10044443 Ga0070666_100444431 359
123 3300005337 Ga0070682_100001250 Ga0070682_10000125015 359
124 3300005455 Ga0070663_100116814 Ga0070663_1001168141 359
125 3300005546 Ga0070696_100000797 Ga0070696_10000079718 359
126 3300005563 Ga0068855_100182749 Ga0068855_1001827493 359
127 3300005618 Ga0068864_100263181 Ga0068864_1002631812 359
128 3300005841 Ga0068863_100038845 Ga0068863_1000388453 359
129 3300005843 Ga0068860_100290841 Ga0068860_1002908412 359
130 3300009036 Ga0105244_10000058 Ga0105244_1000005838 359
131 3300009148 Ga0105243_10000090 Ga0105243_1000009016 359
132 3300009148 Ga0105243_10030367 Ga0105243_100303674 359
133 3300013100 Ga0157373_10000019 Ga0157373_10000019120 359
134 3300013104 Ga0157370_10014403 Ga0157370_100144034 359
135 3300013104 Ga0157370_10015069 Ga0157370_100150694 359
136 3300014497 Ga0182008_10000015 Ga0182008_1000001530 359
137 3300025230 Ga0209563_100066 Ga0209563_100066198 359
138 3300025728 Ga0207655_1000693 Ga0207655_100069326 359
139 3300025935 Ga0207709_10000364 Ga0207709_1000036422 359
140 3300025935 Ga0207709_10035978 Ga0207709_100359781 359
141 3300025941 Ga0207711_10003309 Ga0207711_100033093 359
142 3300025949 Ga0207667_10129082 Ga0207667_101290823 359
143 3300025961 Ga0207712_10071451 Ga0207712_100714513 359
144 3300026067 Ga0207678_10030824 Ga0207678_100308241 359
145 3300041413 Ga0439465_0004263 Ga0439465_0004263_1613_2722 359
146 3300042004 Ga0439445_0002086 Ga0439445_0002086_2299_3408 359
147 3300044712 Ga0453684_0000062 Ga0453684_0000062_362145_363257 359
148 3300044842 Ga0466957_0129265 Ga0466957_0129265_436_1578 359
149 3300046453 Ga0495627_000003 Ga0495627_000003_324300_325409 359
150 3300046453 Ga0495627_010260 Ga0495627_010260_1621_2730 359
151 3300046500 Ga0495596_0005171 Ga0495596_0005171_2076_3185 359
152 3300046522 Ga0495643_0029986 Ga0495643_0029986_1433_2542 359
153 3300046525 Ga0495663_0007071 Ga0495663_0007071_1042_2154 359
154 3300046530 Ga0495654_0000001 Ga0495654_0000001_795600_796709 359
155 3300046558 Ga0495633_0000008 Ga0495633_0000008_251231_252340 359
156 3300046558 Ga0495633_0003754 Ga0495633_0003754_4397_5506 359
157 3300047472 Ga0495686_0000416 Ga0495686_0000416_10083_11192 359
158 3300048905 Ga0496102_0062782 Ga0496102_0062782_1230_2339 359
159 3300048916 Ga0496113_0038568 Ga0496113_0038568_1600_2709 359
160 3300048919 Ga0496116_0000053 Ga0496116_0000053_33539_34648 359
161 3300048920 Ga0496117_0000089 Ga0496117_0000089_122002_123111 359
162 3300048921 Ga0496118_0000221 Ga0496118_0000221_50845_51954 359
163 3300048922 Ga0496119_0000038 Ga0496119_0000038_121995_123104 359
164 3300048925 Ga0496122_0000109 Ga0496122_0000109_56919_58028 359
165 3300048925 Ga0496122_0000118 Ga0496122_0000118_114070_115179 359
166 3300048925 Ga0496122_0000700 Ga0496122_0000700_7442_8551 359
167 3300048925 Ga0496122_0003899 Ga0496122_0003899_12985_14094 359
168 3300048926 Ga0496123_0000930 Ga0496123_0000930_3126_4235 359
169 3300048926 Ga0496123_0007098 Ga0496123_0007098_1235_2344 359
170 3300048926 Ga0496123_0011663 Ga0496123_0011663_3824_4933 359
171 3300048928 Ga0496125_0000547 Ga0496125_0000547_3634_4743 359
172 3300048928 Ga0496125_0003355 Ga0496125_0003355_34_1143 359
173 3300048928 Ga0496125_0032349 Ga0496125_0032349_2953_4062 359
174 3300048929 Ga0496126_0001041 Ga0496126_0001041_9401_10510 359
175 iso_pu_bacteria 2511231000 2511231265 359
176 iso_pu_bacteria 2582581281 2585156727 359
177 iso_pu_bacteria 2582581282 2585160970 359
178 3300001915 JGI24741J21665_1000689 JGI24741J21665_10006897 360
179 3300005327 Ga0070658_10001705 Ga0070658_100017058 360
180 3300025291 Ga0209675_1000033 Ga0209675_1000033142 360
181 3300025909 Ga0207705_10000120 Ga0207705_1000012024 360
182 3300025911 Ga0207654_10005355 Ga0207654_100053552 360
183 3300025924 Ga0207694_10011664 Ga0207694_100116646 360
184 3300026078 Ga0207702_10003624 Ga0207702_100036243 360
185 3300026142 Ga0207698_10001069 Ga0207698_1000106916 360
186 3300031911 Ga0307412_10002385 Ga0307412_100023852 360
187 3300031911 Ga0307412_10024561 Ga0307412_100245613 360
188 3300046691 Ga0495670_0000005 Ga0495670_0000005_49579_50694 360
189 3300048917 Ga0496114_0001667 Ga0496114_0001667_5297_6454 360
190 3300049581 Ga0501047_0189155 Ga0501047_0189155_764_1897 360
191 3300049758 Ga0501241_000019 Ga0501241_000019_75874_76986 360
192 iso_pu_bacteria 3003233435 3003236392 360
193 3300001979 JGI24740J21852_10000942 JGI24740J21852_1000094210 361
194 3300003320 rootH2_10236114 rootH2_102361143 361
195 3300006173 Ga0070716_100070279 Ga0070716_1000702793 361
196 3300027717 Ga0209998_10020384 Ga0209998_100203842 361
197 iso_pu_bacteria 2585428115 2587942835 361
198 iso_pu_bacteria 2585428187 2588233394 361
199 3300003791 Ga0055530_10000344 Ga0055530_100003448 362
200 3300003794 Ga0055531_10000012 Ga0055531_1000001278 362
201 3300025298 Ga0209050_1000039 Ga0209050_1000039278 362
202 3300025304 Ga0209257_1000051 Ga0209257_1000051278 362
203 3300035113 Ga0373936_0009423 Ga0373936_0009423_1792_2925 362
204 3300042006 Ga0439432_004445 Ga0439432_004445_2346_3458 362
205 3300046452 Ga0495617_001529 Ga0495617_001529_7796_8884 362
206 3300046691 Ga0495670_0010251 Ga0495670_0010251_2333_3454 362
207 3300049572 Ga0501036_0041128 Ga0501036_0041128_302_1432 362
208 3300049572 Ga0501036_0126744 Ga0501036_0126744_287_1417 362
209 3300049574 Ga0501038_0002993 Ga0501038_0002993_2971_4101 362
210 3300049574 Ga0501038_0059869 Ga0501038_0059869_611_1741 362
211 3300049575 Ga0501039_0203291 Ga0501039_0203291_34_1164 362
212 3300049579 Ga0501043_0021795 Ga0501043_0021795_2860_3990 362
213 3300049581 Ga0501047_0056294 Ga0501047_0056294_972_2102 362
214 3300049586 Ga0501070_0106630 Ga0501070_0106630_33_1163 362
215 3300049823 Ga0501044_0007604 Ga0501044_0007604_7475_8605 362
216 3300053091 Ga0500647_0014081 Ga0500647_0014081_2256_3389 362
217 3300053094 Ga0500566_0000771 Ga0500566_0000771_4508_5641 362
218 3300053111 Ga0500572_016322 Ga0500572_016322_96_1229 362
219 3300053123 Ga0500614_001221 Ga0500614_001221_3705_4838 362
220 3300053735 Ga0500596_002101 Ga0500596_002101_1418_2551 362
221 3300005536 Ga0070697_100239459 Ga0070697_1002394591 363
222 3300015690 Ga0183363_1007 Ga0183363_100790 363
223 3300016635 Ga0183361_10078 Ga0183361_100783 363
224 3300021441 Ga0213871_10006084 Ga0213871_100060841 363
225 3300025261 Ga0209233_1014593 Ga0209233_10145931 363
226 3300025272 Ga0209455_1002862 Ga0209455_10028622 363
227 3300031250 Ga0265331_10021328 Ga0265331_100213283 363
228 3300031911 Ga0307412_10015694 Ga0307412_100156945 363
229 3300039438 Ga0436360_0100021 Ga0436360_0100021_281_1405 363
230 3300039453 Ga0436362_0301465 Ga0436362_0301465_325_1449 363
231 3300049570 Ga0501033_0052332 Ga0501033_0052332_30_1160 363
232 3300049573 Ga0501037_0069024 Ga0501037_0069024_732_1862 363
233 3300049579 Ga0501043_0058613 Ga0501043_0058613_1672_2802 363
234 3300049580 Ga0501046_0000035 Ga0501046_0000035_25812_26945 363
235 3300049582 Ga0501048_0175560 Ga0501048_0175560_143_1273 363
236 3300049583 Ga0501067_0006624 Ga0501067_0006624_4837_5967 363
237 3300049584 Ga0501068_0007179 Ga0501068_0007179_2524_3654 363
238 3300049585 Ga0501069_0025616 Ga0501069_0025616_282_1412 363
239 3300049587 Ga0501071_0087456 Ga0501071_0087456_820_1950 363
240 3300049588 Ga0501072_0025799 Ga0501072_0025799_1737_2867 363
241 3300049589 Ga0501073_0007949 Ga0501073_0007949_4401_5531 363
242 3300049592 Ga0501076_0187738 Ga0501076_0187738_98_1228 363
243 3300049744 Ga0501083_0016907 Ga0501083_0016907_451_1581 363
244 3300049824 Ga0501045_0035107 Ga0501045_0035107_1505_2635 363
245 3300053177 Ga0500636_0012009 Ga0500636_0012009_595_1728 363
246 3300053178 Ga0500637_0089187 Ga0500637_0089187_14_1147 363
247 3300001976 JGI24752J21851_1000602 JGI24752J21851_10006022 364
248 3300002459 JGI24751J29686_10009347 JGI24751J29686_100093472 364
249 3300003320 rootH2_10028904 rootH2_100289041 364
250 3300003323 rootH1_10009808 rootH1_100098084 364
251 3300003323 rootH1_10009809 rootH1_100098091 364
252 3300005331 Ga0070670_100099495 Ga0070670_1000994953 364
253 3300005335 Ga0070666_10000054 Ga0070666_100000542 364
254 3300005353 Ga0070669_100000097 Ga0070669_1000000978 364
255 3300005440 Ga0070705_100043596 Ga0070705_1000435963 364
256 3300005544 Ga0070686_100094573 Ga0070686_1000945732 364
257 3300005614 Ga0068856_100139383 Ga0068856_1001393832 364
258 3300005617 Ga0068859_100000847 Ga0068859_1000008473 364
259 3300005843 Ga0068860_100094572 Ga0068860_1000945723 364
260 3300005844 Ga0068862_100001021 Ga0068862_1000010218 364
261 3300006931 Ga0097620_100000847 Ga0097620_1000008473 364
262 3300009101 Ga0105247_10000840 Ga0105247_1000084012 364
263 3300013249 Ga0171463_1002 Ga0171463_10021004 364
264 3300013306 Ga0163162_10009006 Ga0163162_100090061 364
265 3300015690 Ga0183363_1030 Ga0183363_103043 364
266 3300025900 Ga0207710_10000606 Ga0207710_1000060612 364
267 3300025903 Ga0207680_10003164 Ga0207680_100031642 364
268 3300025923 Ga0207681_10000030 Ga0207681_100000308 364
269 3300025925 Ga0207650_10024163 Ga0207650_100241635 364
270 3300025941 Ga0207711_10014920 Ga0207711_100149203 364
271 3300025972 Ga0207668_10004020 Ga0207668_100040202 364
272 3300025986 Ga0207658_10003610 Ga0207658_1000361011 364
273 3300026035 Ga0207703_10001069 Ga0207703_100010693 364
274 3300026078 Ga0207702_10137145 Ga0207702_101371452 364
275 3300028380 Ga0268265_10000970 Ga0268265_100009709 364
276 3300028381 Ga0268264_10000288 Ga0268264_1000028837 364
277 3300037471 Ga0395905_0000022 Ga0395905_0000022_112743_113849 364
278 3300037471 Ga0395905_0029458 Ga0395905_0029458_1339_2439 364
279 3300044656 Ga0466969_0001849 Ga0466969_0001849_3287_4387 364
280 3300044684 Ga0466966_0000273 Ga0466966_0000273_11494_12594 364
281 3300044842 Ga0466957_0007115 Ga0466957_0007115_352_1452 364
282 3300045049 Ga0466959_0000621 Ga0466959_0000621_7984_9084 364
283 3300045049 Ga0466959_0071675 Ga0466959_0071675_118_1224 364
284 3300045836 Ga0466958_0095231 Ga0466958_0095231_222_1322 364
285 3300046477 Ga0495664_0157937 Ga0495664_0157937_136_1281 364
286 3300046506 Ga0495583_0002397 Ga0495583_0002397_9301_10446 364
287 3300047472 Ga0495686_0051336 Ga0495686_0051336_1300_2430 364
288 3300048907 Ga0496104_0012047 Ga0496104_0012047_3284_4411 364
289 3300048909 Ga0496106_0022487 Ga0496106_0022487_2027_3154 364
290 3300048911 Ga0496108_0003150 Ga0496108_0003150_8154_9281 364
291 3300048912 Ga0496109_0014694 Ga0496109_0014694_1892_3019 364
292 3300048913 Ga0496110_0091815 Ga0496110_0091815_844_1971 364
293 3300048915 Ga0496112_0029831 Ga0496112_0029831_3694_4821 364
294 3300048924 Ga0496121_0000542 Ga0496121_0000542_17110_18234 364
295 3300061719 Ga0466962_0014907 Ga0466962_0014907_1673_2773 364
296 3300061719 Ga0466962_0039032 Ga0466962_0039032_793_1905 364
297 3300005355 Ga0070671_100000350 Ga0070671_10000035031 365
298 3300005841 Ga0068863_100000030 Ga0068863_100000030114 365
299 3300005844 Ga0068862_100411861 Ga0068862_1004118611 365
300 3300025931 Ga0207644_10000096 Ga0207644_1000009675 365
301 3300026088 Ga0207641_10000001 Ga0207641_10000001169 365
302 3300028381 Ga0268264_10016089 Ga0268264_100160892 365
303 3300031731 Ga0307405_10136541 Ga0307405_101365412 365
304 3300046454 Ga0495592_0066709 Ga0495592_0066709_1162_2307 365
305 3300046530 Ga0495654_0000224 Ga0495654_0000224_7777_8877 365
306 3300046538 Ga0495609_0044694 Ga0495609_0044694_76_1191 365
307 3300046616 Ga0495668_0001200 Ga0495668_0001200_6323_7423 365
308 3300046674 Ga0495588_0095861 Ga0495588_0095861_375_1520 365
309 3300049571 Ga0501034_0134285 Ga0501034_0134285_194_1324 365
310 3300049823 Ga0501044_0027397 Ga0501044_0027397_621_1751 365
311 3300053158 Ga0500627_0000278 Ga0500627_0000278_3351_4451 365
312 iso_pu_bacteria 2643221541 2643728911 365
313 iso_pu_bacteria 2643221605 2644038166 365
314 iso_pu_bacteria 2643221606 2644044926 365
315 iso_pu_bacteria 2643221671 2644391099 365
316 iso_pu_bacteria 2928027323 2928029416 365
317 iso_pu_bacteria 2984555340 2984556613 365
318 iso_pu_bacteria 2984564862 2984565214 365
319 iso_pu_bacteria 2993356040 2993356290 365
320 3300003781 Ga0055536_1002718 Ga0055536_10027185 366
321 3300003791 Ga0055530_10000024 Ga0055530_1000002471 366
322 3300003794 Ga0055531_10000164 Ga0055531_1000016462 366
323 3300025258 Ga0209129_1000424 Ga0209129_10004243 366
324 3300025304 Ga0209257_1000130 Ga0209257_1000130152 366
325 3300025928 Ga0207700_10133081 Ga0207700_101330812 366
326 3300035724 Ga0373933_0070230 Ga0373933_0070230_546_1655 366
327 3300036401 Ga0373937_0110950 Ga0373937_0110950_669_1778 366
328 3300046538 Ga0495609_0020647 Ga0495609_0020647_760_1905 366
329 3300028556 Ga0265337_1003505 Ga0265337_10035054 367
330 3300028573 Ga0265334_10001203 Ga0265334_1000120311 367
331 3300031595 Ga0265313_10021233 Ga0265313_100212335 367
332 3300031712 Ga0265342_10122872 Ga0265342_101228722 367
333 3300044712 Ga0453684_0000071 Ga0453684_0000071_158032_159144 367
334 3300046454 Ga0495592_0196937 Ga0495592_0196937_85_1230 367
335 3300048905 Ga0496102_0173771 Ga0496102_0173771_614_1738 367
336 3300002076 JGI24749J21850_1007117 JGI24749J21850_10071172 368
337 3300002459 JGI24751J29686_10000062 JGI24751J29686_1000006240 368
338 3300005331 Ga0070670_100000005 Ga0070670_100000005275 368
339 3300005347 Ga0070668_100000020 Ga0070668_10000002085 368
340 3300005347 Ga0070668_100041319 Ga0070668_1000413194 368
341 3300005347 Ga0070668_100164162 Ga0070668_1001641622 368
342 3300005353 Ga0070669_100000060 Ga0070669_10000006014 368
343 3300005353 Ga0070669_100124102 Ga0070669_1001241022 368
344 3300005355 Ga0070671_100000854 Ga0070671_10000085418 368
345 3300005367 Ga0070667_100000055 Ga0070667_10000005559 368
346 3300005367 Ga0070667_100001092 Ga0070667_10000109229 368
347 3300005616 Ga0068852_100226879 Ga0068852_1002268792 368
348 3300005617 Ga0068859_100174343 Ga0068859_1001743432 368
349 3300005618 Ga0068864_100000011 Ga0068864_100000011272 368
350 3300005618 Ga0068864_100014218 Ga0068864_1000142187 368
351 3300005841 Ga0068863_100002111 Ga0068863_10000211115 368
352 3300005842 Ga0068858_100000186 Ga0068858_10000018665 368
353 3300005843 Ga0068860_100000090 Ga0068860_10000009060 368
354 3300005844 Ga0068862_100000104 Ga0068862_10000010465 368
355 3300005844 Ga0068862_100001485 Ga0068862_1000014858 368
356 3300006195 Ga0075366_10006964 Ga0075366_100069645 368
357 3300006931 Ga0097620_100174356 Ga0097620_1001743562 368
358 3300009177 Ga0105248_10000229 Ga0105248_100002296 368
359 3300009553 Ga0105249_10149886 Ga0105249_101498862 368
360 3300014326 Ga0157380_10000083 Ga0157380_100000834 368
361 3300017792 Ga0163161_10098300 Ga0163161_100983002 368
362 3300021384 Ga0213876_10015478 Ga0213876_100154783 368
363 3300025923 Ga0207681_10000001 Ga0207681_10000001385 368
364 3300025923 Ga0207681_10013391 Ga0207681_100133915 368
365 3300025925 Ga0207650_10000018 Ga0207650_10000018272 368
366 3300025931 Ga0207644_10000050 Ga0207644_1000005074 368
367 3300025941 Ga0207711_10001356 Ga0207711_100013567 368
368 3300025972 Ga0207668_10000048 Ga0207668_100000486 368
369 3300025972 Ga0207668_10020257 Ga0207668_100202575 368
370 3300025972 Ga0207668_10136003 Ga0207668_101360032 368
371 3300025986 Ga0207658_10000090 Ga0207658_10000090102 368
372 3300025986 Ga0207658_10003728 Ga0207658_1000372811 368
373 3300026035 Ga0207703_10000231 Ga0207703_100002319 368
374 3300026088 Ga0207641_10005852 Ga0207641_100058525 368
375 3300026095 Ga0207676_10000004 Ga0207676_10000004665 368
376 3300026095 Ga0207676_10000658 Ga0207676_100006588 368
377 3300026118 Ga0207675_100002408 Ga0207675_10000240816 368
378 3300028380 Ga0268265_10000002 Ga0268265_10000002391 368
379 3300028380 Ga0268265_10001609 Ga0268265_100016098 368
380 3300028381 Ga0268264_10000075 Ga0268264_10000075102 368
381 3300031911 Ga0307412_10081056 Ga0307412_100810562 368
382 3300039437 Ga0436365_0458255 Ga0436365_0458255_2339_3469 368
383 3300046474 Ga0495605_0001337 Ga0495605_0001337_9951_11096 368
384 3300046492 Ga0495585_0006200 Ga0495585_0006200_5041_6186 368
385 3300046501 Ga0495607_0080002 Ga0495607_0080002_576_1721 368
386 3300046506 Ga0495583_0029817 Ga0495583_0029817_1257_2402 368
387 3300046513 Ga0495616_0026474 Ga0495616_0026474_959_2104 368
388 3300046518 Ga0495631_0001421 Ga0495631_0001421_9455_10600 368
389 3300046519 Ga0495632_0011139 Ga0495632_0011139_3039_4184 368
390 3300046530 Ga0495654_0108064 Ga0495654_0108064_93_1238 368
391 3300046616 Ga0495668_0017970 Ga0495668_0017970_2009_3154 368
392 3300046660 Ga0495625_0000621 Ga0495625_0000621_1478_2623 368
393 3300046810 Ga0495660_0021376 Ga0495660_0021376_566_1711 368
394 3300048917 Ga0496114_0174339 Ga0496114_0174339_201_1346 368
395 3300049459 Ga0495678_007036 Ga0495678_007036_1513_2658 368
396 3300049569 Ga0501032_0087427 Ga0501032_0087427_320_1429 368
397 3300049571 Ga0501034_0049702 Ga0501034_0049702_938_2047 368
398 3300049579 Ga0501043_0128969 Ga0501043_0128969_826_1935 368
399 3300049581 Ga0501047_0012927 Ga0501047_0012927_2472_3581 368
400 3300049679 Ga0501249_000111 Ga0501249_000111_2834_3943 368
401 3300049823 Ga0501044_0204246 Ga0501044_0204246_57_1166 368
402 3300050493 nmdc:mga0k408_38443_c1 nmdc:mga0k408_38443_c1_1600_2709 368
403 3300053079 Ga0500610_0013892 Ga0500610_0013892_1264_2409 368
404 3300053109 Ga0500569_018439 Ga0500569_018439_302_1447 368
405 3300053730 Ga0500645_011886 Ga0500645_011886_310_1419 368
406 iso_pu_bacteria 2713897090 2715499777 368
407 3300041410 Ga0439461_0001983 Ga0439461_0001983_1200_2312 369
408 3300041413 Ga0439465_0000135 Ga0439465_0000135_15324_16436 369
409 3300042015 Ga0439462_0001400 Ga0439462_0001400_1945_3057 369
410 3300042435 Ga0439434_0000065 Ga0439434_0000065_15072_16184 369
411 3300048924 Ga0496121_0013808 Ga0496121_0013808_2444_3568 369
412 3300049569 Ga0501032_0072177 Ga0501032_0072177_537_1664 369
413 3300049570 Ga0501033_0016189 Ga0501033_0016189_63_1190 369
414 3300049570 Ga0501033_0017174 Ga0501033_0017174_3738_4865 369
415 3300049586 Ga0501070_0181658 Ga0501070_0181658_157_1284 369
416 3300049822 Ga0501035_0175436 Ga0501035_0175436_103_1230 369
417 iso_pu_bacteria 2738541275 2738712837 369
418 iso_pu_bacteria 2738541301 2738851261 369
419 iso_pu_bacteria 2738541304 2738866991 369
420 iso_pu_bacteria 2738543022 2739299508 369
421 iso_pu_bacteria 2738543033 2739361187 369
422 iso_pu_bacteria 2915650412 2915653581 369
423 3300003215 JGI25153J46596_10003643 JGI25153J46596_100036433 370
424 3300005327 Ga0070658_10169902 Ga0070658_101699022 370
425 3300005530 Ga0070679_100004658 Ga0070679_1000046582 370
426 3300005530 Ga0070679_100259665 Ga0070679_1002596651 370
427 3300005535 Ga0070684_100095686 Ga0070684_1000956862 370
428 3300005564 Ga0070664_100350905 Ga0070664_1003509051 370
429 3300005843 Ga0068860_100165043 Ga0068860_1001650433 370
430 3300006358 Ga0068871_100018177 Ga0068871_1000181773 370
431 3300009177 Ga0105248_10001858 Ga0105248_1000185813 370
432 3300021384 Ga0213876_10163503 Ga0213876_101635031 370
433 3300025253 Ga0209677_102327 Ga0209677_1023276 370
434 3300025297 Ga0209758_1000013 Ga0209758_1000013169 370
435 3300025304 Ga0209257_1005137 Ga0209257_100513711 370
436 3300025909 Ga0207705_10002397 Ga0207705_1000239710 370
437 3300025920 Ga0207649_10104952 Ga0207649_101049522 370
438 3300025921 Ga0207652_10133510 Ga0207652_101335102 370
439 3300028800 Ga0265338_10002006 Ga0265338_1000200621 370
440 3300031239 Ga0265328_10000046 Ga0265328_1000004622 370
441 3300031241 Ga0265325_10078699 Ga0265325_100786992 370
442 3300031249 Ga0265339_10058837 Ga0265339_100588372 370
443 3300031250 Ga0265331_10000710 Ga0265331_1000071016 370
444 3300031251 Ga0265327_10007316 Ga0265327_100073167 370
445 3300031344 Ga0265316_10000099 Ga0265316_1000009921 370
446 3300031711 Ga0265314_10004906 Ga0265314_100049063 370
447 3300037853 Ga0436364_1153948 Ga0436364_1153948_377_1507 370
448 3300046530 Ga0495654_0092421 Ga0495654_0092421_189_1331 370
449 3300048088 Ga0495602_0124838 Ga0495602_0124838_496_1626 370
450 3300048911 Ga0496108_0166028 Ga0496108_0166028_113_1255 370
451 3300048929 Ga0496126_0034512 Ga0496126_0034512_1437_2564 370
452 3300049570 Ga0501033_0009071 Ga0501033_0009071_4561_5748 370
453 3300049571 Ga0501034_0009021 Ga0501034_0009021_6617_7753 370
454 3300049571 Ga0501034_0211938 Ga0501034_0211938_733_1869 370
455 3300049573 Ga0501037_0167128 Ga0501037_0167128_178_1305 370
456 3300049581 Ga0501047_0027525 Ga0501047_0027525_1791_2978 370
457 3300049581 Ga0501047_0153398 Ga0501047_0153398_474_1601 370
458 3300049581 Ga0501047_0156664 Ga0501047_0156664_879_2006 370
459 3300049822 Ga0501035_0181510 Ga0501035_0181510_137_1264 370
460 3300049823 Ga0501044_0095863 Ga0501044_0095863_1214_2401 370
461 3300049823 Ga0501044_0239057 Ga0501044_0239057_561_1688 370
462 3300050496 nmdc:mga07m45_391_c1 nmdc:mga07m45_391_c1_14142_15284 370
463 3300053087 Ga0500643_000003 Ga0500643_000003_692909_694036 370
464 3300053087 Ga0500643_030126 Ga0500643_030126_44_1177 370
465 3300053121 Ga0500607_000098 Ga0500607_000098_26861_28000 370
466 3300053139 Ga0500568_0014517 Ga0500568_0014517_683_1810 370
467 iso_pu_bacteria 2512564014 2512645079 370
468 iso_pu_bacteria 2534681786 2535486463 370
469 iso_pu_bacteria 2643221560 2643822442 370
470 iso_pu_bacteria 2643221563 2643833547 370
471 iso_pu_bacteria 2643221608 2644054474 370
472 iso_pu_bacteria 2751185897 2753766794 370
473 iso_pu_bacteria 2775507255 2778125796 370
474 iso_pu_bacteria 2808606401 2809063405 370
475 iso_pu_bacteria 2808606404 2809079159 370
476 iso_pu_bacteria 2808606405 2809083467 370
477 iso_pu_bacteria 2852653556 2852656750 370
478 iso_pu_bacteria 2852680915 2852682046 370
479 iso_pu_bacteria 2880518877 2880520675 370
480 iso_pu_bacteria 2885409591 2885413892 370
481 iso_pu_bacteria 2919709256 2919711231 370
482 iso_pu_bacteria 8057132660 8057133743 370
483 3300002774 JGI25150J39212_1000838 JGI25150J39212_10008382 371
484 3300003215 JGI25153J46596_10000064 JGI25153J46596_10000064102 371
485 3300003771 Ga0055526_1002619 Ga0055526_10026193 371
486 3300003792 Ga0055540_1002224 Ga0055540_10022243 371
487 3300005353 Ga0070669_100191849 Ga0070669_1001918492 371
488 3300005364 Ga0070673_100064021 Ga0070673_1000640213 371
489 3300005439 Ga0070711_100017006 Ga0070711_1000170065 371
490 3300005456 Ga0070678_100168357 Ga0070678_1001683572 371
491 3300005458 Ga0070681_10011283 Ga0070681_100112836 371
492 3300005539 Ga0068853_100089918 Ga0068853_1000899182 371
493 3300005545 Ga0070695_100005196 Ga0070695_1000051969 371
494 3300005549 Ga0070704_100073247 Ga0070704_1000732473 371
495 3300005564 Ga0070664_100045092 Ga0070664_1000450922 371
496 3300005842 Ga0068858_100076465 Ga0068858_1000764653 371
497 3300006038 Ga0075365_10015345 Ga0075365_100153452 371
498 3300006042 Ga0075368_10003978 Ga0075368_100039785 371
499 3300006042 Ga0075368_10022290 Ga0075368_100222903 371
500 3300006048 Ga0075363_100003818 Ga0075363_1000038184 371
501 3300006048 Ga0075363_100063969 Ga0075363_1000639692 371
502 3300006051 Ga0075364_10015635 Ga0075364_100156352 371
503 3300006173 Ga0070716_100030220 Ga0070716_1000302201 371
504 3300006175 Ga0070712_100003369 Ga0070712_1000033698 371
505 3300006178 Ga0075367_10002499 Ga0075367_100024993 371
506 3300006237 Ga0097621_100166468 Ga0097621_1001664682 371
507 3300009101 Ga0105247_10086235 Ga0105247_100862352 371
508 3300009148 Ga0105243_10026130 Ga0105243_100261302 371
509 3300009174 Ga0105241_10101590 Ga0105241_101015902 371
510 3300009174 Ga0105241_10140905 Ga0105241_101409052 371
511 3300009551 Ga0105238_10008814 Ga0105238_100088147 371
512 3300011119 Ga0105246_10024573 Ga0105246_100245734 371
513 3300013105 Ga0157369_10410859 Ga0157369_104108591 371
514 3300014968 Ga0157379_10067349 Ga0157379_100673493 371
515 3300025245 Ga0207425_1000228 Ga0207425_100022843 371
516 3300025258 Ga0209129_1001242 Ga0209129_10012422 371
517 3300025263 Ga0209565_1000166 Ga0209565_100016634 371
518 3300025273 Ga0209673_1004601 Ga0209673_100460110 371
519 3300025292 Ga0209676_1022758 Ga0209676_10227582 371
520 3300025294 Ga0209025_1000304 Ga0209025_100030496 371
521 3300025295 Ga0209564_1003037 Ga0209564_10030379 371
522 3300025297 Ga0209758_1000019 Ga0209758_1000019210 371
523 3300025298 Ga0209050_1000001 Ga0209050_10000011272 371
524 3300025303 Ga0209051_1000415 Ga0209051_100041519 371
525 3300025304 Ga0209257_1004707 Ga0209257_10047074 371
526 3300025304 Ga0209257_1004726 Ga0209257_10047264 371
527 3300025915 Ga0207693_10009341 Ga0207693_100093414 371
528 3300025931 Ga0207644_10130713 Ga0207644_101307131 371
529 3300025932 Ga0207690_10187969 Ga0207690_101879692 371
530 3300025935 Ga0207709_10155844 Ga0207709_101558442 371
531 3300025939 Ga0207665_10045233 Ga0207665_100452331 371
532 3300025942 Ga0207689_10139464 Ga0207689_101394643 371
533 3300025945 Ga0207679_10203629 Ga0207679_102036292 371
534 3300025960 Ga0207651_10045874 Ga0207651_100458742 371
535 3300026035 Ga0207703_10141440 Ga0207703_101414402 371
536 3300026067 Ga0207678_10001352 Ga0207678_1000135218 371
537 3300026075 Ga0207708_10168730 Ga0207708_101687302 371
538 3300026121 Ga0207683_10227772 Ga0207683_102277723 371
539 3300027866 Ga0209813_10002387 Ga0209813_100023872 371
540 3300031239 Ga0265328_10000374 Ga0265328_1000037410 371
541 3300031250 Ga0265331_10000005 Ga0265331_10000005256 371
542 3300031730 Ga0307516_10000405 Ga0307516_100004053 371
543 3300044842 Ga0466957_0206626 Ga0466957_0206626_131_1264 371
544 3300046616 Ga0495668_0040440 Ga0495668_0040440_921_2066 371
545 3300047472 Ga0495686_0054829 Ga0495686_0054829_1271_2404 371
546 3300048904 Ga0496101_0061414 Ga0496101_0061414_1257_2390 371
547 3300048907 Ga0496104_0174409 Ga0496104_0174409_686_1819 371
548 3300048918 Ga0496115_0005734 Ga0496115_0005734_317_1450 371
549 3300048924 Ga0496121_0010693 Ga0496121_0010693_3382_4512 371
550 3300048925 Ga0496122_0010527 Ga0496122_0010527_7745_8878 371
551 3300048928 Ga0496125_0000145 Ga0496125_0000145_83066_84199 371
552 3300048929 Ga0496126_0003357 Ga0496126_0003357_7308_8438 371
553 3300049568 Ga0501031_0003517 Ga0501031_0003517_7561_8697 371
554 3300049569 Ga0501032_0049585 Ga0501032_0049585_1686_2822 371
555 3300049570 Ga0501033_0008378 Ga0501033_0008378_4103_5239 371
556 3300049572 Ga0501036_0027231 Ga0501036_0027231_926_2062 371
557 3300049573 Ga0501037_0011305 Ga0501037_0011305_5413_6549 371
558 3300049574 Ga0501038_0225527 Ga0501038_0225527_347_1483 371
559 3300049574 Ga0501038_0308854 Ga0501038_0308854_22_1158 371
560 3300049575 Ga0501039_0022121 Ga0501039_0022121_2458_3594 371
561 3300049578 Ga0501042_0015292 Ga0501042_0015292_1568_2704 371
562 3300049579 Ga0501043_0014567 Ga0501043_0014567_2015_3151 371
563 3300049580 Ga0501046_0036342 Ga0501046_0036342_1543_2679 371
564 3300049582 Ga0501048_0002015 Ga0501048_0002015_3635_4768 371
565 3300049742 Ga0501080_0146125 Ga0501080_0146125_352_1488 371
566 3300049822 Ga0501035_0034127 Ga0501035_0034127_2203_3339 371
567 3300049822 Ga0501035_0136614 Ga0501035_0136614_104_1240 371
568 3300049823 Ga0501044_0106881 Ga0501044_0106881_1401_2537 371
569 3300050490 nmdc:mga03n38_3514_c1 nmdc:mga03n38_3514_c1_3288_4433 371
570 3300050491 nmdc:mga00v17_47940_c1 nmdc:mga00v17_47940_c1_877_2022 371
571 3300050494 nmdc:mga06z11_134103_c1 nmdc:mga06z11_134103_c1_108_1253 371
572 3300050494 nmdc:mga06z11_601_c1 nmdc:mga06z11_601_c1_3639_4784 371
573 3300050495 nmdc:mga04h51_2380_c1 nmdc:mga04h51_2380_c1_505_1650 371
574 3300050495 nmdc:mga04h51_26340_c1 nmdc:mga04h51_26340_c1_37_1182 371
575 iso_pu_bacteria 2510917028 2511186182 371
576 iso_pu_bacteria 2513237088 2513595103 371
577 iso_pu_bacteria 2513237138 2513867407 371
578 iso_pu_bacteria 2513237144 2513910805 371
579 iso_pu_bacteria 2513237146 2513927238 371
580 iso_pu_bacteria 2513237159 2513999155 371
581 iso_pu_bacteria 2516143018 2516206024 371
582 iso_pu_bacteria 2524023209 2524461992 371
583 iso_pu_bacteria 2537561587 2537875322 371
584 iso_pu_bacteria 2554235003 2554244958 371
585 iso_pu_bacteria 2558860100 2558866881 371
586 iso_pu_bacteria 2558860242 2559297209 371
587 iso_pu_bacteria 2582581283 2585164876 371
588 iso_pu_bacteria 2582581298 2585226262 371
589 iso_pu_bacteria 2582581299 2585230340 371
590 iso_pu_bacteria 2582581305 2585260947 371
591 iso_pu_bacteria 2582581306 2585265254 371
592 iso_pu_bacteria 2582581865 2585385612 371
593 iso_pu_bacteria 2582581866 2585396999 371
594 iso_pu_bacteria 2582581867 2585401642 371
595 iso_pu_bacteria 2585427529 2585548818 371
596 iso_pu_bacteria 2585427590 2585821336 371
597 iso_pu_bacteria 2588253730 2588513652 371
598 iso_pu_bacteria 2599185170 2599415321 371
599 iso_pu_bacteria 2599185210 2599605172 371
600 iso_pu_bacteria 2599185352 2600196506 371
601 iso_pu_bacteria 2600255279 2601611690 371
602 iso_pu_bacteria 2600255308 2601748758 371
603 iso_pu_bacteria 2643221558 2643812594 371
604 iso_pu_bacteria 2643221582 2643921751 371
605 iso_pu_bacteria 2643221607 2644047277 371
606 iso_pu_bacteria 2643221634 2644191887 371
607 iso_pu_bacteria 2643221636 2644199648 371
608 iso_pu_bacteria 2643221686 2644480066 371
609 iso_pu_bacteria 2643221689 2644496880 371
610 iso_pu_bacteria 2643221693 2644520418 371
611 iso_pu_bacteria 2643221723 2644674948 371
612 iso_pu_bacteria 2657244999 2657685096 371
613 iso_pu_bacteria 2751185800 2753361054 371
614 iso_pu_bacteria 2758568016 2758637817 371
615 iso_pu_bacteria 2775506902 2776268044 371
616 iso_pu_bacteria 2775506904 2776283391 371
617 iso_pu_bacteria 2791355091 2792620433 371
618 iso_pu_bacteria 2791355092 2792625791 371
619 iso_pu_bacteria 2791355094 2792638736 371
620 iso_pu_bacteria 2791355094 2792642912 371
621 iso_pu_bacteria 2791355123 2792750992 371
622 iso_pu_bacteria 2791355263 2793344653 371
623 iso_pu_bacteria 2802429268 2804754929 371
624 iso_pu_bacteria 2808606387 2808988833 371
625 iso_pu_bacteria 2818991439 2819561301 371
626 iso_pu_bacteria 2838035591 2838038954 371
627 iso_pu_bacteria 2838661181 2838664454 371
628 iso_pu_bacteria 2838675328 2838679547 371
629 iso_pu_bacteria 2838714209 2838718904 371
630 iso_pu_bacteria 2838719591 2838723903 371
631 iso_pu_bacteria 2838724970 2838729225 371
632 iso_pu_bacteria 2841846520 2841851005 371
633 iso_pu_bacteria 2841859092 2841863813 371
634 iso_pu_bacteria 2842124991 2842129924 371
635 iso_pu_bacteria 2842130223 2842134334 371
636 iso_pu_bacteria 2842152218 2842156330 371
637 iso_pu_bacteria 2842170452 2842175150 371
638 iso_pu_bacteria 2842175837 2842180066 371
639 iso_pu_bacteria 2842187318 2842191515 371
640 iso_pu_bacteria 2842211629 2842215832 371
641 iso_pu_bacteria 2842224351 2842228668 371
642 iso_pu_bacteria 2842298080 2842303339 371
643 iso_pu_bacteria 2842357229 2842362062 371
644 iso_pu_bacteria 2842515876 2842520595 371
645 iso_pu_bacteria 2842521101 2842524900 371
646 iso_pu_bacteria 2844163670 2844168838 371
647 iso_pu_bacteria 2847417321 2847419812 371
648 iso_pu_bacteria 2848992105 2848994828 371
649 iso_pu_bacteria 2855872281 2855877328 371
650 iso_pu_bacteria 2856356410 2856360667 371
651 iso_pu_bacteria 2856364286 2856368382 371
652 iso_pu_bacteria 2857349434 2857350107 371
653 iso_pu_bacteria 2869285874 2869289943 371
654 iso_pu_bacteria 2871429161 2871434162 371
655 iso_pu_bacteria 2874146452 2874152115 371
656 iso_pu_bacteria 2874155637 2874158781 371
657 iso_pu_bacteria 2876363079 2876365294 371
658 iso_pu_bacteria 2876413966 2876418105 371
659 iso_pu_bacteria 2878745973 2878749088 371
660 iso_pu_bacteria 2881147464 2881154544 371
661 iso_pu_bacteria 2881845957 2881852336 371
662 iso_pu_bacteria 2885318864 2885324567 371
663 iso_pu_bacteria 2899275550 2899276798 371
664 iso_pu_bacteria 2899792073 2899793252 371
665 iso_pu_bacteria 2899845264 2899850513 371
666 iso_pu_bacteria 2903448605 2903455848 371
667 iso_pu_bacteria 2903492973 2903505053 371
668 iso_pu_bacteria 2903528002 2903529945 371
669 iso_pu_bacteria 2904659560 2904662714 371
670 iso_pu_bacteria 2906308376 2906311413 371
671 iso_pu_bacteria 2906321335 2906326859 371
672 iso_pu_bacteria 2919114240 2919118721 371
673 iso_pu_bacteria 2920822456 2920827749 371
674 iso_pu_bacteria 2923556063 2923556768 371
675 iso_pu_bacteria 2926754445 2926758271 371
676 iso_pu_bacteria 2926760298 2926764177 371
677 iso_pu_bacteria 2933006813 2933011104 371
678 iso_pu_bacteria 2933011516 2933016356 371
679 iso_pu_bacteria 2933016740 2933021554 371
680 iso_pu_bacteria 2933594066 2933599070 371
681 iso_pu_bacteria 2937813078 2937816768 371
682 iso_pu_bacteria 2958100919 2958107768 371
683 iso_pu_bacteria 2958130278 2958134315 371
684 iso_pu_bacteria 2958144490 2958150337 371
685 iso_pu_bacteria 2958172287 2958172517 371
686 iso_pu_bacteria 2958179912 2958183167 371
687 iso_pu_bacteria 2960637947 2960643146 371
688 iso_pu_bacteria 2961077736 2961081134 371
689 iso_pu_bacteria 2961114664 2961117694 371
690 iso_pu_bacteria 2964628898 2964629397 371
691 iso_pu_bacteria 2964719344 2964724875 371
692 iso_pu_bacteria 2968083720 2968085766 371
693 iso_pu_bacteria 2968091066 2968091121 371
694 iso_pu_bacteria 2968110612 2968113789 371
695 iso_pu_bacteria 2968128360 2968134371 371
696 iso_pu_bacteria 2977828996 2977834573 371
697 iso_pu_bacteria 2977843712 2977844035 371
698 iso_pu_bacteria 2977864932 2977867279 371
699 iso_pu_bacteria 2977942078 2977947212 371
700 iso_pu_bacteria 2979089926 2979090724 371
701 iso_pu_bacteria 2979095461 2979096247 371
702 iso_pu_bacteria 2979100975 2979101794 371
703 iso_pu_bacteria 2979710463 2979717417 371
704 iso_pu_bacteria 2984509177 2984510271 371
705 iso_pu_bacteria 2984518228 2984519024 371
706 iso_pu_bacteria 2984537506 2984538620 371
707 iso_pu_bacteria 2984601300 2984605328 371
708 iso_pu_bacteria 2987636660 2987637254 371
709 iso_pu_bacteria 2996887358 2996888614 371
710 iso_pu_bacteria 3002141150 3002145731 371
711 iso_pu_bacteria 3004203850 3004204145 371
712 iso_pu_bacteria 3005416602 3005423545 371
713 iso_pu_bacteria 637000159 637077896 371
714 iso_pu_bacteria 637000159 637080195 371
715 iso_pu_bacteria 643692032 643826708 371
716 iso_pu_bacteria 650716007 650843636 371
717 iso_pu_bacteria 8002060224 8002060712 371
718 iso_pu_bacteria 8003570095 8003574099 371
719 iso_pu_bacteria 8004387939 8004392128 371
720 iso_pu_bacteria 8004703790 8004705248 371
721 iso_pu_bacteria 8004714634 8004717769 371
722 iso_pu_bacteria 8005258706 8005264461 371
723 iso_pu_bacteria 8005314921 8005321091 371
724 iso_pu_bacteria 8005321885 8005323141 371
725 iso_pu_bacteria 8005484373 8005487926 371
726 iso_pu_bacteria 8046767195 8046770595 371
727 iso_pu_bacteria 8049293176 8049298053 371
728 iso_pu_bacteria 8057575449 8057578381 371
729 3300001989 JGI24739J22299_10003198 JGI24739J22299_100031983 372
730 3300001990 JGI24737J22298_10003438 JGI24737J22298_100034382 372
731 3300001990 JGI24737J22298_10008136 JGI24737J22298_100081363 372
732 3300002773 JGI25152J39213_1002260 JGI25152J39213_10022607 372
733 3300002987 JGI25159J45721_1000783 JGI25159J45721_100078311 372
734 3300003215 JGI25153J46596_10000008 JGI25153J46596_10000008335 372
735 3300003215 JGI25153J46596_10004902 JGI25153J46596_100049024 372
736 3300003322 rootL2_10163604 rootL2_101636043 372
737 3300003354 JGI25160J50197_1003719 JGI25160J50197_10037195 372
738 3300003374 JGI25161J50226_1000010 JGI25161J50226_1000010102 372
739 3300003762 Ga0055542_1000123 Ga0055542_100012336 372
740 3300003763 Ga0055529_1000144 Ga0055529_100014436 372
741 3300003771 Ga0055526_1005251 Ga0055526_10052514 372
742 3300004625 Ga0055543_1000064 Ga0055543_100006441 372
743 3300005262 Ga0065165_1009795 Ga0065165_10097953 372
744 3300005328 Ga0070676_10017191 Ga0070676_100171912 372
745 3300005331 Ga0070670_100042311 Ga0070670_1000423114 372
746 3300005335 Ga0070666_10046068 Ga0070666_100460683 372
747 3300005335 Ga0070666_10089550 Ga0070666_100895503 372
748 3300005338 Ga0068868_100221914 Ga0068868_1002219141 372
749 3300005338 Ga0068868_100358336 Ga0068868_1003583361 372
750 3300005339 Ga0070660_100054269 Ga0070660_1000542692 372
751 3300005339 Ga0070660_100244572 Ga0070660_1002445721 372
752 3300005344 Ga0070661_100015865 Ga0070661_1000158654 372
753 3300005347 Ga0070668_100118204 Ga0070668_1001182042 372
754 3300005354 Ga0070675_100132388 Ga0070675_1001323882 372
755 3300005366 Ga0070659_100054816 Ga0070659_1000548162 372
756 3300005456 Ga0070678_100000413 Ga0070678_1000004136 372
757 3300005456 Ga0070678_100006179 Ga0070678_1000061794 372
758 3300005456 Ga0070678_100066125 Ga0070678_1000661253 372
759 3300005458 Ga0070681_10246910 Ga0070681_102469101 372
760 3300005459 Ga0068867_100078471 Ga0068867_1000784712 372
761 3300005530 Ga0070679_100002275 Ga0070679_1000022754 372
762 3300005530 Ga0070679_100056063 Ga0070679_1000560634 372
763 3300005535 Ga0070684_100092842 Ga0070684_1000928422 372
764 3300005548 Ga0070665_100000023 Ga0070665_10000002366 372
765 3300005548 Ga0070665_100001971 Ga0070665_1000019719 372
766 3300005548 Ga0070665_100014237 Ga0070665_1000142377 372
767 3300005548 Ga0070665_100169754 Ga0070665_1001697543 372
768 3300005563 Ga0068855_100098645 Ga0068855_1000986453 372
769 3300005577 Ga0068857_100072443 Ga0068857_1000724433 372
770 3300005578 Ga0068854_100009241 Ga0068854_1000092419 372
771 3300005614 Ga0068856_100535407 Ga0068856_1005354071 372
772 3300006048 Ga0075363_100004343 Ga0075363_1000043435 372
773 3300006051 Ga0075364_10097247 Ga0075364_100972472 372
774 3300006177 Ga0075362_10000064 Ga0075362_100000643 372
775 3300006186 Ga0075369_10009043 Ga0075369_100090433 372
776 3300006195 Ga0075366_10000133 Ga0075366_100001338 372
777 3300006237 Ga0097621_100000498 Ga0097621_10000049820 372
778 3300006237 Ga0097621_100013282 Ga0097621_1000132822 372
779 3300006237 Ga0097621_100144718 Ga0097621_1001447183 372
780 3300006353 Ga0075370_10000015 Ga0075370_1000001554 372
781 3300006358 Ga0068871_100000406 Ga0068871_10000040621 372
782 3300006358 Ga0068871_100010613 Ga0068871_1000106133 372
783 3300009148 Ga0105243_10000192 Ga0105243_1000019269 372
784 3300009553 Ga0105249_10159348 Ga0105249_101593482 372
785 3300013102 Ga0157371_10000138 Ga0157371_1000013859 372
786 3300013104 Ga0157370_10218841 Ga0157370_102188412 372
787 3300014969 Ga0157376_10075409 Ga0157376_100754092 372
788 3300017792 Ga0163161_10057497 Ga0163161_100574972 372
789 3300025208 Ga0209436_100126 Ga0209436_10012621 372
790 3300025254 Ga0209148_1000011 Ga0209148_1000011799 372
791 3300025258 Ga0209129_1002843 Ga0209129_10028437 372
792 3300025272 Ga0209455_1000006 Ga0209455_1000006394 372
793 3300025284 Ga0209130_1000001 Ga0209130_1000001525 372
794 3300025295 Ga0209564_1007547 Ga0209564_10075475 372
795 3300025297 Ga0209758_1000017 Ga0209758_1000017692 372
796 3300025297 Ga0209758_1004381 Ga0209758_10043819 372
797 3300025299 Ga0209256_1011274 Ga0209256_10112742 372
798 3300025302 Ga0207426_1000045 Ga0207426_1000045134 372
799 3300025901 Ga0207688_10041105 Ga0207688_100411052 372
800 3300025903 Ga0207680_10013481 Ga0207680_100134813 372
801 3300025904 Ga0207647_10116069 Ga0207647_101160692 372
802 3300025907 Ga0207645_10032980 Ga0207645_100329803 372
803 3300025909 Ga0207705_10005207 Ga0207705_100052077 372
804 3300025912 Ga0207707_10246650 Ga0207707_102466501 372
805 3300025913 Ga0207695_10147102 Ga0207695_101471022 372
806 3300025914 Ga0207671_10009634 Ga0207671_100096347 372
807 3300025919 Ga0207657_10227081 Ga0207657_102270812 372
808 3300025920 Ga0207649_10002019 Ga0207649_100020193 372
809 3300025921 Ga0207652_10114658 Ga0207652_101146582 372
810 3300025925 Ga0207650_10147411 Ga0207650_101474112 372
811 3300025926 Ga0207659_10111542 Ga0207659_101115422 372
812 3300025932 Ga0207690_10007651 Ga0207690_100076516 372
813 3300025933 Ga0207706_10019021 Ga0207706_100190213 372
814 3300025935 Ga0207709_10000503 Ga0207709_100005036 372
815 3300025937 Ga0207669_10000100 Ga0207669_1000010044 372
816 3300025937 Ga0207669_10000461 Ga0207669_1000046114 372
817 3300025945 Ga0207679_10051529 Ga0207679_100515292 372
818 3300025949 Ga0207667_10000002 Ga0207667_10000002524 372
819 3300025949 Ga0207667_10157687 Ga0207667_101576873 372
820 3300025972 Ga0207668_10060594 Ga0207668_100605943 372
821 3300025981 Ga0207640_10074572 Ga0207640_100745723 372
822 3300026041 Ga0207639_10001988 Ga0207639_100019886 372
823 3300026067 Ga0207678_10001105 Ga0207678_1000110513 372
824 3300026089 Ga0207648_10112303 Ga0207648_101123032 372
825 3300026116 Ga0207674_10078586 Ga0207674_100785863 372
826 3300026121 Ga0207683_10009115 Ga0207683_100091156 372
827 3300026121 Ga0207683_10016012 Ga0207683_100160122 372
828 3300028379 Ga0268266_10000002 Ga0268266_100000021412 372
829 3300028379 Ga0268266_10000505 Ga0268266_1000050515 372
830 3300028379 Ga0268266_10008793 Ga0268266_100087939 372
831 3300028379 Ga0268266_10132273 Ga0268266_101322732 372
832 3300028379 Ga0268266_10317952 Ga0268266_103179522 372
833 3300028786 Ga0307517_10066936 Ga0307517_100669362 372
834 3300028786 Ga0307517_10123559 Ga0307517_101235592 372
835 3300031456 Ga0307513_10047620 Ga0307513_100476202 372
836 3300041413 Ga0439465_0004120 Ga0439465_0004120_3285_4427 372
837 3300044694 Ga0466963_0006909 Ga0466963_0006909_136_1287 372
838 3300045976 Ga0466967_0026329 Ga0466967_0026329_3045_4196 372
839 3300046471 Ga0495650_0000172 Ga0495650_0000172_4797_5948 372
840 3300046491 Ga0495584_0046587 Ga0495584_0046587_124_1275 372
841 3300046492 Ga0495585_0015028 Ga0495585_0015028_2238_3389 372
842 3300046506 Ga0495583_0001819 Ga0495583_0001819_2088_3239 372
843 3300046506 Ga0495583_0012705 Ga0495583_0012705_1617_2768 372
844 3300046506 Ga0495583_0033366 Ga0495583_0033366_839_1990 372
845 3300046507 Ga0495606_0002807 Ga0495606_0002807_4804_5955 372
846 3300046507 Ga0495606_0013347 Ga0495606_0013347_3432_4583 372
847 3300046507 Ga0495606_0032790 Ga0495606_0032790_965_2116 372
848 3300046518 Ga0495631_0012838 Ga0495631_0012838_2317_3468 372
849 3300046522 Ga0495643_0011121 Ga0495643_0011121_2340_3491 372
850 3300046524 Ga0495648_0000993 Ga0495648_0000993_4867_6018 372
851 3300046524 Ga0495648_0077423 Ga0495648_0077423_49_1200 372
852 3300046525 Ga0495663_0004862 Ga0495663_0004862_1877_3028 372
853 3300046528 Ga0495642_0035268 Ga0495642_0035268_260_1411 372
854 3300046557 Ga0495622_0004872 Ga0495622_0004872_1429_2580 372
855 3300046558 Ga0495633_0004038 Ga0495633_0004038_5129_6280 372
856 3300046558 Ga0495633_0023728 Ga0495633_0023728_1808_2974 372
857 3300046616 Ga0495668_0000080 Ga0495668_0000080_111941_113092 372
858 3300046616 Ga0495668_0143433 Ga0495668_0143433_124_1275 372
859 3300046660 Ga0495625_0001091 Ga0495625_0001091_5870_7021 372
860 3300046660 Ga0495625_0010254 Ga0495625_0010254_911_2062 372
861 3300046684 Ga0495669_0000214 Ga0495669_0000214_29502_30653 372
862 3300046694 Ga0495649_0039161 Ga0495649_0039161_174_1325 372
863 3300046809 Ga0495600_0012916 Ga0495600_0012916_927_2078 372
864 3300047443 Ga0495687_001639 Ga0495687_001639_4971_6122 372
865 3300047443 Ga0495687_006734 Ga0495687_006734_3609_4760 372
866 3300047445 Ga0495677_0006070 Ga0495677_0006070_1845_2996 372
867 3300047470 Ga0495681_0010003 Ga0495681_0010003_2203_3354 372
868 3300048905 Ga0496102_0000213 Ga0496102_0000213_53769_54920 372
869 3300048906 Ga0496103_0000782 Ga0496103_0000782_3722_4873 372
870 3300048907 Ga0496104_0023140 Ga0496104_0023140_1985_3136 372
871 3300048917 Ga0496114_0025240 Ga0496114_0025240_3629_4780 372
872 3300048918 Ga0496115_0000785 Ga0496115_0000785_18514_19665 372
873 3300048919 Ga0496116_0006359 Ga0496116_0006359_9584_10735 372
874 3300048920 Ga0496117_0002444 Ga0496117_0002444_3681_4832 372
875 3300048921 Ga0496118_0000207 Ga0496118_0000207_47117_48268 372
876 3300048922 Ga0496119_0012665 Ga0496119_0012665_851_2002 372
877 3300048923 Ga0496120_0014878 Ga0496120_0014878_1624_2775 372
878 3300048924 Ga0496121_0002349 Ga0496121_0002349_3668_4819 372
879 3300048925 Ga0496122_0029086 Ga0496122_0029086_1571_2722 372
880 3300048926 Ga0496123_0010458 Ga0496123_0010458_4555_5706 372
881 3300048927 Ga0496124_0001031 Ga0496124_0001031_39295_40446 372
882 3300048928 Ga0496125_0002742 Ga0496125_0002742_4647_5798 372
883 3300048929 Ga0496126_0002687 Ga0496126_0002687_18678_19829 372
884 3300049569 Ga0501032_0016935 Ga0501032_0016935_3114_4250 372
885 3300049570 Ga0501033_0050570 Ga0501033_0050570_1916_3058 372
886 3300049571 Ga0501034_0037717 Ga0501034_0037717_2435_3571 372
887 3300049572 Ga0501036_0017675 Ga0501036_0017675_3206_4342 372
888 3300049575 Ga0501039_0030137 Ga0501039_0030137_1049_2185 372
889 3300049579 Ga0501043_0092094 Ga0501043_0092094_1201_2343 372
890 3300049580 Ga0501046_0088409 Ga0501046_0088409_878_2020 372
891 3300049822 Ga0501035_0005333 Ga0501035_0005333_2885_4021 372
892 3300049822 Ga0501035_0012722 Ga0501035_0012722_6028_7170 372
893 3300049823 Ga0501044_0002233 Ga0501044_0002233_11368_12504 372
894 3300050489 nmdc:mga03683_113_c1 nmdc:mga03683_113_c1_23803_24951 372
895 3300050490 nmdc:mga03n38_2972_c1 nmdc:mga03n38_2972_c1_1080_2228 372
896 3300050491 nmdc:mga00v17_128953_c1 nmdc:mga00v17_128953_c1_398_1546 372
897 3300050493 nmdc:mga0k408_9_c2 nmdc:mga0k408_9_c2_15803_16951 372
898 3300050496 nmdc:mga07m45_13_c1 nmdc:mga07m45_13_c1_48078_49226 372
899 3300050516 nmdc:mga0sz30_253_c2 nmdc:mga0sz30_253_c2_3765_4913 372
900 3300053079 Ga0500610_0000034 Ga0500610_0000034_24901_26052 372
901 3300053094 Ga0500566_0008535 Ga0500566_0008535_1317_2450 372
902 3300053096 Ga0500641_0014493 Ga0500641_0014493_295_1449 372
903 3300053119 Ga0500595_001745 Ga0500595_001745_5734_6885 372
904 3300053136 Ga0500559_0116722 Ga0500559_0116722_102_1223 372
905 3300053140 Ga0500573_0000015 Ga0500573_0000015_153283_154407 372
906 3300053177 Ga0500636_0006352 Ga0500636_0006352_2319_3485 372
907 3300053730 Ga0500645_000001 Ga0500645_000001_48366_49517 372
908 3300060353 Ga0501082_0032979 Ga0501082_0032979_39_1175 372
909 iso_pu_bacteria 2891088606 2891093134 372
910 3300001976 JGI24752J21851_1000987 JGI24752J21851_10009871 373
911 3300003187 JGI25151J46595_10004404 JGI25151J46595_100044042 373
912 3300003187 JGI25151J46595_10024486 JGI25151J46595_100244861 373
913 3300003214 JGI25165J46597_1000104 JGI25165J46597_100010446 373
914 3300003354 JGI25160J50197_1000005 JGI25160J50197_1000005264 373
915 3300003354 JGI25160J50197_1000103 JGI25160J50197_100010346 373
916 3300003374 JGI25161J50226_1000090 JGI25161J50226_100009044 373
917 3300003374 JGI25161J50226_1001080 JGI25161J50226_10010807 373
918 3300003781 Ga0055536_1011770 Ga0055536_10117703 373
919 3300003781 Ga0055536_1014539 Ga0055536_10145393 373
920 3300003790 Ga0055528_1004834 Ga0055528_10048347 373
921 3300003856 Ga0058692_1001612 Ga0058692_10016129 373
922 3300004625 Ga0055543_1000087 Ga0055543_100008736 373
923 3300004625 Ga0055543_1000863 Ga0055543_10008638 373
924 3300005262 Ga0065165_1000002 Ga0065165_1000002127 373
925 3300005262 Ga0065165_1000776 Ga0065165_100077636 373
926 3300005262 Ga0065165_1001281 Ga0065165_10012813 373
927 3300005262 Ga0065165_1007851 Ga0065165_10078515 373
928 3300005262 Ga0065165_1011637 Ga0065165_10116374 373
929 3300005289 Ga0065704_10086442 Ga0065704_100864423 373
930 3300005331 Ga0070670_100000169 Ga0070670_10000016916 373
931 3300005347 Ga0070668_100001209 Ga0070668_10000120921 373
932 3300005353 Ga0070669_100212821 Ga0070669_1002128211 373
933 3300005353 Ga0070669_100324816 Ga0070669_1003248161 373
934 3300005355 Ga0070671_100003166 Ga0070671_1000031666 373
935 3300005355 Ga0070671_100103294 Ga0070671_1001032943 373
936 3300005366 Ga0070659_100020104 Ga0070659_1000201043 373
937 3300005367 Ga0070667_100000322 Ga0070667_10000032254 373
938 3300005455 Ga0070663_100029469 Ga0070663_1000294693 373
939 3300005546 Ga0070696_100005838 Ga0070696_1000058386 373
940 3300005548 Ga0070665_100060637 Ga0070665_1000606373 373
941 3300005563 Ga0068855_100017039 Ga0068855_1000170392 373
942 3300005578 Ga0068854_100195991 Ga0068854_1001959912 373
943 3300005617 Ga0068859_100021274 Ga0068859_1000212742 373
944 3300005617 Ga0068859_100075652 Ga0068859_1000756523 373
945 3300005618 Ga0068864_100000004 Ga0068864_100000004402 373
946 3300005618 Ga0068864_100000870 Ga0068864_10000087021 373
947 3300005618 Ga0068864_100049297 Ga0068864_1000492974 373
948 3300005618 Ga0068864_100084553 Ga0068864_1000845531 373
949 3300005618 Ga0068864_100099687 Ga0068864_1000996872 373
950 3300005841 Ga0068863_100000002 Ga0068863_100000002403 373
951 3300005841 Ga0068863_100069839 Ga0068863_1000698392 373
952 3300005841 Ga0068863_100114929 Ga0068863_1001149293 373
953 3300005842 Ga0068858_100000022 Ga0068858_100000022139 373
954 3300005842 Ga0068858_100000222 Ga0068858_10000022229 373
955 3300005844 Ga0068862_100000002 Ga0068862_10000000299 373
956 3300006177 Ga0075362_10004725 Ga0075362_100047253 373
957 3300006178 Ga0075367_10000664 Ga0075367_100006642 373
958 3300006178 Ga0075367_10024153 Ga0075367_100241533 373
959 3300006178 Ga0075367_10176015 Ga0075367_101760152 373
960 3300006931 Ga0097620_100021274 Ga0097620_1000212742 373
961 3300006931 Ga0097620_100075651 Ga0097620_1000756513 373
962 3300009011 Ga0105251_10000342 Ga0105251_1000034217 373
963 3300009098 Ga0105245_10001826 Ga0105245_100018265 373
964 3300009098 Ga0105245_10010667 Ga0105245_100106672 373
965 3300009177 Ga0105248_10067604 Ga0105248_100676045 373
966 3300009177 Ga0105248_10409215 Ga0105248_104092151 373
967 3300009551 Ga0105238_10039059 Ga0105238_100390593 373
968 3300009553 Ga0105249_10000106 Ga0105249_1000010624 373
969 3300009553 Ga0105249_10069094 Ga0105249_100690942 373
970 3300009765 Ga0123341_1015241 Ga0123341_10152413 373
971 3300009765 Ga0123341_1026276 Ga0123341_10262762 373
972 3300009766 Ga0123342_1016039 Ga0123342_10160393 373
973 3300011119 Ga0105246_10000491 Ga0105246_1000049114 373
974 3300013102 Ga0157371_10000187 Ga0157371_1000018772 373
975 3300013104 Ga0157370_10000037 Ga0157370_1000003776 373
976 3300013104 Ga0157370_10000289 Ga0157370_1000028915 373
977 3300013297 Ga0157378_10049262 Ga0157378_100492624 373
978 3300013306 Ga0163162_10001728 Ga0163162_1000172814 373
979 3300013306 Ga0163162_10070659 Ga0163162_100706591 373
980 3300013308 Ga0157375_10094894 Ga0157375_100948942 373
981 3300014325 Ga0163163_10116377 Ga0163163_101163771 373
982 3300014968 Ga0157379_10068223 Ga0157379_100682232 373
983 3300014968 Ga0157379_10073045 Ga0157379_100730452 373
984 3300021320 Ga0214544_1000158 Ga0214544_1000158108 373
985 3300021321 Ga0214542_1001567 Ga0214542_10015675 373
986 3300021327 Ga0214543_1000234 Ga0214543_100023420 373
987 3300021327 Ga0214543_1001418 Ga0214543_100141819 373
988 3300025208 Ga0209436_100556 Ga0209436_1005564 373
989 3300025258 Ga0209129_1000082 Ga0209129_100008292 373
990 3300025261 Ga0209233_1000164 Ga0209233_100016496 373
991 3300025273 Ga0209673_1011852 Ga0209673_10118522 373
992 3300025284 Ga0209130_1000010 Ga0209130_1000010125 373
993 3300025284 Ga0209130_1000098 Ga0209130_100009845 373
994 3300025291 Ga0209675_1004347 Ga0209675_10043472 373
995 3300025292 Ga0209676_1000138 Ga0209676_100013849 373
996 3300025292 Ga0209676_1000148 Ga0209676_100014873 373
997 3300025292 Ga0209676_1001403 Ga0209676_10014038 373
998 3300025292 Ga0209676_1020842 Ga0209676_10208422 373
999 3300025292 Ga0209676_1031134 Ga0209676_10311342 373
1000 3300025294 Ga0209025_1000172 Ga0209025_1000172151 373
1001 3300025294 Ga0209025_1000234 Ga0209025_10002349 373
1002 3300025294 Ga0209025_1000689 Ga0209025_100068929 373
1003 3300025295 Ga0209564_1000025 Ga0209564_1000025271 373
1004 3300025295 Ga0209564_1002096 Ga0209564_10020968 373
1005 3300025297 Ga0209758_1006462 Ga0209758_10064623 373
1006 3300025297 Ga0209758_1018335 Ga0209758_10183352 373
1007 3300025297 Ga0209758_1039302 Ga0209758_10393022 373
1008 3300025298 Ga0209050_1000047 Ga0209050_1000047114 373
1009 3300025298 Ga0209050_1004457 Ga0209050_10044579 373
1010 3300025298 Ga0209050_1023211 Ga0209050_10232112 373
1011 3300025299 Ga0209256_1000311 Ga0209256_100031111 373
1012 3300025302 Ga0207426_1000036 Ga0207426_1000036125 373
1013 3300025302 Ga0207426_1000069 Ga0207426_1000069215 373
1014 3300025302 Ga0207426_1000968 Ga0207426_100096818 373
1015 3300025303 Ga0209051_1023758 Ga0209051_10237582 373
1016 3300025304 Ga0209257_1000076 Ga0209257_100007670 373
1017 3300025735 Ga0207713_1008759 Ga0207713_10087592 373
1018 3300025924 Ga0207694_10014727 Ga0207694_100147274 373
1019 3300025925 Ga0207650_10000294 Ga0207650_1000029446 373
1020 3300025927 Ga0207687_10001337 Ga0207687_100013375 373
1021 3300025927 Ga0207687_10077549 Ga0207687_100775493 373
1022 3300025931 Ga0207644_10000944 Ga0207644_100009445 373
1023 3300025933 Ga0207706_10072781 Ga0207706_100727811 373
1024 3300025935 Ga0207709_10013050 Ga0207709_100130504 373
1025 3300025935 Ga0207709_10026116 Ga0207709_100261163 373
1026 3300025941 Ga0207711_10007985 Ga0207711_1000798512 373
1027 3300025941 Ga0207711_10011245 Ga0207711_100112452 373
1028 3300025941 Ga0207711_10123872 Ga0207711_101238723 373
1029 3300025949 Ga0207667_10318729 Ga0207667_103187292 373
1030 3300025961 Ga0207712_10000224 Ga0207712_1000022413 373
1031 3300025961 Ga0207712_10082993 Ga0207712_100829933 373
1032 3300025972 Ga0207668_10000832 Ga0207668_1000083221 373
1033 3300025981 Ga0207640_10161164 Ga0207640_101611641 373
1034 3300026035 Ga0207703_10000048 Ga0207703_1000004874 373
1035 3300026035 Ga0207703_10000428 Ga0207703_1000042831 373
1036 3300026088 Ga0207641_10000002 Ga0207641_10000002883 373
1037 3300026095 Ga0207676_10000040 Ga0207676_1000004078 373
1038 3300026095 Ga0207676_10000270 Ga0207676_1000027014 373
1039 3300026095 Ga0207676_10128951 Ga0207676_101289512 373
1040 3300027312 Ga0209371_1000035 Ga0209371_1000035174 373
1041 3300027312 Ga0209371_1000901 Ga0209371_10009012 373
1042 3300028380 Ga0268265_10000003 Ga0268265_10000003107 373
1043 3300028556 Ga0265337_1018245 Ga0265337_10182452 373
1044 3300028563 Ga0265319_1012596 Ga0265319_10125962 373
1045 3300028573 Ga0265334_10003663 Ga0265334_100036638 373
1046 3300028653 Ga0265323_10000276 Ga0265323_1000027610 373
1047 3300028666 Ga0265336_10000268 Ga0265336_100002688 373
1048 3300028786 Ga0307517_10039586 Ga0307517_100395861 373
1049 3300028786 Ga0307517_10108979 Ga0307517_101089792 373
1050 3300028794 Ga0307515_10001309 Ga0307515_1000130945 373
1051 3300028794 Ga0307515_10011735 Ga0307515_1001173517 373
1052 3300028794 Ga0307515_10178793 Ga0307515_101787932 373
1053 3300028800 Ga0265338_10000280 Ga0265338_1000028061 373
1054 3300029957 Ga0265324_10006739 Ga0265324_100067392 373
1055 3300030500 Ga0268256_1000037 Ga0268256_1000037173 373
1056 3300030500 Ga0268256_1003747 Ga0268256_10037477 373
1057 3300030744 Ga0316181_1184579 Ga0316181_11845792 373
1058 3300031241 Ga0265325_10001237 Ga0265325_1000123713 373
1059 3300031249 Ga0265339_10004888 Ga0265339_100048885 373
1060 3300031250 Ga0265331_10006726 Ga0265331_100067263 373
1061 3300031456 Ga0307513_10002506 Ga0307513_1000250620 373
1062 3300031456 Ga0307513_10058104 Ga0307513_100581043 373
1063 3300031548 Ga0307408_100020170 Ga0307408_1000201703 373
1064 3300031548 Ga0307408_100029929 Ga0307408_1000299293 373
1065 3300031616 Ga0307508_10002027 Ga0307508_100020273 373
1066 3300031711 Ga0265314_10013928 Ga0265314_100139282 373
1067 3300031730 Ga0307516_10000075 Ga0307516_1000007518 373
1068 3300031901 Ga0307406_10031537 Ga0307406_100315373 373
1069 3300031911 Ga0307412_10025707 Ga0307412_100257072 373
1070 3300032002 Ga0307416_100016318 Ga0307416_1000163183 373
1071 3300032004 Ga0307414_10003589 Ga0307414_100035893 373
1072 3300032004 Ga0307414_10098008 Ga0307414_100980082 373
1073 3300037466 Ga0395898_0011345 Ga0395898_0011345_7148_8314 373
1074 3300037471 Ga0395905_0043737 Ga0395905_0043737_2590_3714 373
1075 3300037471 Ga0395905_0213062 Ga0395905_0213062_181_1326 373
1076 3300041404 Ga0439436_0002588 Ga0439436_0002588_1286_2431 373
1077 3300042004 Ga0439445_0007629 Ga0439445_0007629_794_1942 373
1078 3300042007 Ga0439449_0032077 Ga0439449_0032077_461_1606 373
1079 3300042007 Ga0439449_0044226 Ga0439449_0044226_468_1616 373
1080 3300042531 Ga0450918_001885 Ga0450918_001885_1019_2164 373
1081 3300046476 Ga0495662_0048142 Ga0495662_0048142_594_1739 373
1082 3300046507 Ga0495606_0067291 Ga0495606_0067291_591_1715 373
1083 3300046522 Ga0495643_0020159 Ga0495643_0020159_2505_3650 373
1084 3300046542 Ga0495597_0067954 Ga0495597_0067954_86_1231 373
1085 3300046558 Ga0495633_0006121 Ga0495633_0006121_5903_7024 373
1086 3300046558 Ga0495633_0020674 Ga0495633_0020674_1871_3013 373
1087 3300046558 Ga0495633_0050884 Ga0495633_0050884_502_1644 373
1088 3300046616 Ga0495668_0000024 Ga0495668_0000024_128043_129179 373
1089 3300046660 Ga0495625_0000727 Ga0495625_0000727_10773_11909 373
1090 3300046660 Ga0495625_0039111 Ga0495625_0039111_1002_2126 373
1091 3300046660 Ga0495625_0039189 Ga0495625_0039189_1765_2910 373
1092 3300046674 Ga0495588_0001528 Ga0495588_0001528_5769_6911 373
1093 3300046674 Ga0495588_0023967 Ga0495588_0023967_1772_2917 373
1094 3300046692 Ga0495671_0046736 Ga0495671_0046736_43_1185 373
1095 3300046694 Ga0495649_0058484 Ga0495649_0058484_188_1315 373
1096 3300047470 Ga0495681_0008616 Ga0495681_0008616_2572_3714 373
1097 3300048904 Ga0496101_0040605 Ga0496101_0040605_1086_2231 373
1098 3300048905 Ga0496102_0213611 Ga0496102_0213611_365_1522 373
1099 3300048907 Ga0496104_0031887 Ga0496104_0031887_913_2058 373
1100 3300048912 Ga0496109_0181853 Ga0496109_0181853_733_1887 373
1101 3300048914 Ga0496111_0128100 Ga0496111_0128100_67_1212 373
1102 3300048915 Ga0496112_0088648 Ga0496112_0088648_878_2002 373
1103 3300048919 Ga0496116_0092699 Ga0496116_0092699_558_1700 373
1104 3300048920 Ga0496117_0000066 Ga0496117_0000066_185294_186436 373
1105 3300048920 Ga0496117_0006220 Ga0496117_0006220_9388_10512 373
1106 3300048920 Ga0496117_0114070 Ga0496117_0114070_510_1655 373
1107 3300048921 Ga0496118_0007705 Ga0496118_0007705_6628_7770 373
1108 3300048921 Ga0496118_0018005 Ga0496118_0018005_751_1896 373
1109 3300048922 Ga0496119_0006920 Ga0496119_0006920_6170_7315 373
1110 3300048922 Ga0496119_0022050 Ga0496119_0022050_2955_4100 373
1111 3300048922 Ga0496119_0050725 Ga0496119_0050725_398_1543 373
1112 3300048922 Ga0496119_0087073 Ga0496119_0087073_528_1673 373
1113 3300048923 Ga0496120_0000100 Ga0496120_0000100_66073_67215 373
1114 3300048923 Ga0496120_0073387 Ga0496120_0073387_53_1198 373
1115 3300048924 Ga0496121_0049074 Ga0496121_0049074_1707_2852 373
1116 3300048925 Ga0496122_0000057 Ga0496122_0000057_66073_67215 373
1117 3300048925 Ga0496122_0003976 Ga0496122_0003976_4508_5653 373
1118 3300048926 Ga0496123_0000096 Ga0496123_0000096_106700_107842 373
1119 3300048926 Ga0496123_0005631 Ga0496123_0005631_4801_5946 373
1120 3300048926 Ga0496123_0063861 Ga0496123_0063861_453_1598 373
1121 3300048927 Ga0496124_0012788 Ga0496124_0012788_4246_5388 373
1122 3300048927 Ga0496124_0039779 Ga0496124_0039779_2364_3509 373
1123 3300048929 Ga0496126_0050780 Ga0496126_0050780_739_1884 373
1124 3300049513 Ga0501290_000012 Ga0501290_000012_17059_18183 373
1125 3300049515 Ga0501292_000043 Ga0501292_000043_12357_13481 373
1126 3300049523 Ga0501300_000322 Ga0501300_000322_5859_6983 373
1127 3300049570 Ga0501033_0055294 Ga0501033_0055294_154_1302 373
1128 3300049571 Ga0501034_0000413 Ga0501034_0000413_3531_4655 373
1129 3300049574 Ga0501038_0208230 Ga0501038_0208230_336_1460 373
1130 3300049653 Ga0501206_000178 Ga0501206_000178_3957_5081 373
1131 3300049662 Ga0501222_000195 Ga0501222_000195_1194_2318 373
1132 3300049663 Ga0501223_001464 Ga0501223_001464_1090_2214 373
1133 3300049664 Ga0501224_000252 Ga0501224_000252_3864_4988 373
1134 3300049688 Ga0501259_000261 Ga0501259_000261_5092_6216 373
1135 3300049690 Ga0501261_000028 Ga0501261_000028_19489_20613 373
1136 3300049705 Ga0501225_0000335 Ga0501225_0000335_6207_7331 373
1137 3300049775 Ga0501279_000030 Ga0501279_000030_23998_25122 373
1138 3300049776 Ga0501280_000040 Ga0501280_000040_24547_25671 373
1139 3300049777 Ga0501281_00088 Ga0501281_00088_7689_8813 373
1140 3300049778 Ga0501282_000136 Ga0501282_000136_7302_8426 373
1141 3300049779 Ga0501283_000528 Ga0501283_000528_1291_2415 373
1142 3300049822 Ga0501035_0101787 Ga0501035_0101787_806_1954 373
1143 3300049823 Ga0501044_0052375 Ga0501044_0052375_810_2009 373
1144 3300049823 Ga0501044_0056167 Ga0501044_0056167_975_2123 373
1145 3300050491 nmdc:mga00v17_17_c1 nmdc:mga00v17_17_c1_55819_56961 373
1146 3300050494 nmdc:mga06z11_7485_c1 nmdc:mga06z11_7485_c1_3177_4319 373
1147 3300050495 nmdc:mga04h51_22235_c1 nmdc:mga04h51_22235_c1_757_1899 373
1148 3300050516 nmdc:mga0sz30_121_c1 nmdc:mga0sz30_121_c1_19810_20952 373
1149 3300050516 nmdc:mga0sz30_24246_c1 nmdc:mga0sz30_24246_c1_839_1984 373
1150 3300053107 Ga0500560_000810 Ga0500560_000810_78_1220 373
1151 3300053107 Ga0500560_001662 Ga0500560_001662_624_1766 373
1152 3300053116 Ga0500592_000077 Ga0500592_000077_11162_12298 373
1153 3300053131 Ga0500652_000014 Ga0500652_000014_16904_18052 373
1154 3300053136 Ga0500559_0099150 Ga0500559_0099150_60_1184 373
1155 3300053137 Ga0500561_0000278 Ga0500561_0000278_6251_7393 373
1156 3300053139 Ga0500568_0000872 Ga0500568_0000872_5085_6221 373
1157 3300053139 Ga0500568_0067331 Ga0500568_0067331_139_1284 373
1158 3300053148 Ga0500590_000841 Ga0500590_000841_7457_8602 373
1159 3300053156 Ga0500622_0001565 Ga0500622_0001565_13445_14599 373
1160 3300053157 Ga0500624_000003 Ga0500624_000003_205679_206803 373
1161 3300053157 Ga0500624_000011 Ga0500624_000011_39427_40548 373
1162 3300053157 Ga0500624_000443 Ga0500624_000443_10725_11867 373
1163 3300053158 Ga0500627_0000043 Ga0500627_0000043_7080_8222 373
1164 3300053158 Ga0500627_0012802 Ga0500627_0012802_925_2052 373
1165 3300053158 Ga0500627_0029037 Ga0500627_0029037_1007_2143 373
1166 3300053161 Ga0500634_0008457 Ga0500634_0008457_431_1573 373
1167 3300053177 Ga0500636_0085951 Ga0500636_0085951_51_1199 373
1168 3300053178 Ga0500637_0000045 Ga0500637_0000045_16328_17452 373
1169 iso_pu_bacteria 2739367865 2740027423 373
1170 iso_pu_bacteria 2855020534 2855021162 373
1171 iso_pu_bacteria 2899259804 2899262073 373
1172 iso_pu_bacteria 2990265787 2990265916 373
1173 iso_pu_bacteria 2993693658 2993696293 373
1174 2162886007 SwRhRL2b_contig_544056 SwRhRL2b_0890.00002250 374
1175 3300001904 JGI24736J21556_1015781 JGI24736J21556_10157811 374
1176 3300001915 JGI24741J21665_1005930 JGI24741J21665_10059303 374
1177 3300001979 JGI24740J21852_10000308 JGI24740J21852_100003085 374
1178 3300001989 JGI24739J22299_10006801 JGI24739J22299_100068013 374
1179 3300001990 JGI24737J22298_10001465 JGI24737J22298_100014652 374
1180 3300002067 JGI24735J21928_10001446 JGI24735J21928_100014468 374
1181 3300002075 JGI24738J21930_10001077 JGI24738J21930_100010774 374
1182 3300005289 Ga0065704_10001031 Ga0065704_100010315 374
1183 3300005335 Ga0070666_10007041 Ga0070666_100070417 374
1184 3300005347 Ga0070668_100000061 Ga0070668_1000000617 374
1185 3300005347 Ga0070668_100187455 Ga0070668_1001874552 374
1186 3300005355 Ga0070671_100004846 Ga0070671_1000048463 374
1187 3300005366 Ga0070659_100022429 Ga0070659_1000224293 374
1188 3300005367 Ga0070667_100001030 Ga0070667_10000103017 374
1189 3300005455 Ga0070663_100026232 Ga0070663_1000262322 374
1190 3300005548 Ga0070665_100003281 Ga0070665_1000032817 374
1191 3300005841 Ga0068863_100000053 Ga0068863_100000053114 374
1192 3300005842 Ga0068858_100028145 Ga0068858_1000281454 374
1193 3300005843 Ga0068860_100091566 Ga0068860_1000915662 374
1194 3300006178 Ga0075367_10042598 Ga0075367_100425983 374
1195 3300009011 Ga0105251_10003145 Ga0105251_1000314515 374
1196 3300009174 Ga0105241_10020587 Ga0105241_100205873 374
1197 3300009177 Ga0105248_10043322 Ga0105248_100433223 374
1198 3300009551 Ga0105238_10153934 Ga0105238_101539342 374
1199 3300009553 Ga0105249_10101973 Ga0105249_101019733 374
1200 3300009553 Ga0105249_10108871 Ga0105249_101088711 374
1201 3300010375 Ga0105239_10352621 Ga0105239_103526211 374
1202 3300013104 Ga0157370_10188461 Ga0157370_101884611 374
1203 3300025229 Ga0209147_101850 Ga0209147_1018502 374
1204 3300025903 Ga0207680_10004498 Ga0207680_100044985 374
1205 3300025913 Ga0207695_10078679 Ga0207695_100786793 374
1206 3300025914 Ga0207671_10124641 Ga0207671_101246412 374
1207 3300025923 Ga0207681_10094045 Ga0207681_100940453 374
1208 3300025931 Ga0207644_10123833 Ga0207644_101238332 374
1209 3300025972 Ga0207668_10000027 Ga0207668_10000027114 374
1210 3300025986 Ga0207658_10000853 Ga0207658_1000085317 374
1211 3300026035 Ga0207703_10027853 Ga0207703_100278534 374
1212 3300026041 Ga0207639_10001044 Ga0207639_100010446 374
1213 3300026067 Ga0207678_10008945 Ga0207678_100089458 374
1214 3300026078 Ga0207702_10005099 Ga0207702_100050998 374
1215 3300026088 Ga0207641_10000093 Ga0207641_100000938 374
1216 3300026116 Ga0207674_10154662 Ga0207674_101546622 374
1217 3300027866 Ga0209813_10000240 Ga0209813_100002403 374
1218 3300028379 Ga0268266_10129411 Ga0268266_101294113 374
1219 3300028381 Ga0268264_10020758 Ga0268264_100207583 374
1220 3300031548 Ga0307408_100137872 Ga0307408_1001378722 374
1221 3300031731 Ga0307405_10080332 Ga0307405_100803322 374
1222 3300031911 Ga0307412_10089214 Ga0307412_100892142 374
1223 3300031911 Ga0307412_10106867 Ga0307412_101068672 374
1224 3300031995 Ga0307409_100020314 Ga0307409_1000203143 374
1225 3300032004 Ga0307414_10057339 Ga0307414_100573393 374
1226 3300032005 Ga0307411_10259531 Ga0307411_102595311 374
1227 3300032126 Ga0307415_100346861 Ga0307415_1003468611 374
1228 3300035695 Ga0373927_0012559 Ga0373927_0012559_3322_4455 374
1229 3300046452 Ga0495617_015587 Ga0495617_015587_509_1636 374
1230 3300046453 Ga0495627_000225 Ga0495627_000225_28128_29252 374
1231 3300046453 Ga0495627_000324 Ga0495627_000324_29240_30364 374
1232 3300046460 Ga0495638_0000012 Ga0495638_0000012_114828_115955 374
1233 3300046471 Ga0495650_0003357 Ga0495650_0003357_5595_6722 374
1234 3300046491 Ga0495584_0022076 Ga0495584_0022076_1363_2487 374
1235 3300046506 Ga0495583_0001198 Ga0495583_0001198_16833_17960 374
1236 3300046512 Ga0495610_0000085 Ga0495610_0000085_8162_9286 374
1237 3300046513 Ga0495616_0000192 Ga0495616_0000192_23722_24849 374
1238 3300046519 Ga0495632_0000013 Ga0495632_0000013_133454_134578 374
1239 3300046519 Ga0495632_0000612 Ga0495632_0000612_3803_4930 374
1240 3300046519 Ga0495632_0032939 Ga0495632_0032939_244_1368 374
1241 3300046520 Ga0495637_0000100 Ga0495637_0000100_17044_18168 374
1242 3300046520 Ga0495637_0007164 Ga0495637_0007164_4233_5357 374
1243 3300046520 Ga0495637_0015444 Ga0495637_0015444_1959_3092 374
1244 3300046522 Ga0495643_0000010 Ga0495643_0000010_271904_273028 374
1245 3300046524 Ga0495648_0000038 Ga0495648_0000038_75658_76785 374
1246 3300046524 Ga0495648_0000933 Ga0495648_0000933_7065_8189 374
1247 3300046524 Ga0495648_0051791 Ga0495648_0051791_696_1979 374
1248 3300046525 Ga0495663_0000004 Ga0495663_0000004_240718_241842 374
1249 3300046558 Ga0495633_0000092 Ga0495633_0000092_109133_110257 374
1250 3300046558 Ga0495633_0001757 Ga0495633_0001757_9593_10717 374
1251 3300046558 Ga0495633_0005139 Ga0495633_0005139_4943_6070 374
1252 3300046558 Ga0495633_0018058 Ga0495633_0018058_2102_3226 374
1253 3300046616 Ga0495668_0015691 Ga0495668_0015691_1866_2999 374
1254 3300046616 Ga0495668_0063372 Ga0495668_0063372_563_1696 374
1255 3300046616 Ga0495668_0068429 Ga0495668_0068429_738_1865 374
1256 3300046684 Ga0495669_0007253 Ga0495669_0007253_2844_3977 374
1257 3300046692 Ga0495671_0000014 Ga0495671_0000014_271904_273028 374
1258 3300046692 Ga0495671_0000034 Ga0495671_0000034_75092_76219 374
1259 3300047320 Ga0495672_0032885 Ga0495672_0032885_1417_2541 374
1260 3300047469 Ga0495673_0000013 Ga0495673_0000013_147793_148920 374
1261 3300047469 Ga0495673_0009404 Ga0495673_0009404_2974_4098 374
1262 3300047470 Ga0495681_0000013 Ga0495681_0000013_11205_12329 374
1263 3300047470 Ga0495681_0000725 Ga0495681_0000725_16726_17850 374
1264 3300047472 Ga0495686_0009517 Ga0495686_0009517_3059_4183 374
1265 3300047472 Ga0495686_0019667 Ga0495686_0019667_1111_2235 374
1266 3300047472 Ga0495686_0020937 Ga0495686_0020937_2718_3842 374
1267 3300048911 Ga0496108_0003651 Ga0496108_0003651_1712_2836 374
1268 3300048913 Ga0496110_0189422 Ga0496110_0189422_706_1830 374
1269 3300048913 Ga0496110_0383103 Ga0496110_0383103_68_1192 374
1270 3300048919 Ga0496116_0073291 Ga0496116_0073291_588_1712 374
1271 3300048920 Ga0496117_0066710 Ga0496117_0066710_492_1616 374
1272 3300048921 Ga0496118_0021302 Ga0496118_0021302_1467_2591 374
1273 3300048924 Ga0496121_0002040 Ga0496121_0002040_26753_27877 374
1274 3300048924 Ga0496121_0034219 Ga0496121_0034219_2428_3552 374
1275 3300048925 Ga0496122_0009972 Ga0496122_0009972_891_2015 374
1276 3300048925 Ga0496122_0103514 Ga0496122_0103514_77_1201 374
1277 3300048926 Ga0496123_0007161 Ga0496123_0007161_2705_3829 374
1278 3300048926 Ga0496123_0159903 Ga0496123_0159903_22_1146 374
1279 3300048927 Ga0496124_0019580 Ga0496124_0019580_4181_5305 374
1280 3300048928 Ga0496125_0024786 Ga0496125_0024786_3999_5123 374
1281 3300048928 Ga0496125_0033622 Ga0496125_0033622_2988_4112 374
1282 3300048928 Ga0496125_0047287 Ga0496125_0047287_882_2012 374
1283 3300048929 Ga0496126_0012770 Ga0496126_0012770_310_1434 374
1284 3300048929 Ga0496126_0085797 Ga0496126_0085797_1159_2283 374
1285 3300049459 Ga0495678_023424 Ga0495678_023424_561_1685 374
1286 3300049571 Ga0501034_0060477 Ga0501034_0060477_1650_2786 374
1287 3300049663 Ga0501223_000008 Ga0501223_000008_25500_26624 374
1288 3300049663 Ga0501223_000033 Ga0501223_000033_26918_28054 374
1289 3300049664 Ga0501224_000026 Ga0501224_000026_26553_27689 374
1290 3300049668 Ga0501233_000479 Ga0501233_000479_4766_5902 374
1291 3300049669 Ga0501235_012715 Ga0501235_012715_197_1333 374
1292 3300049704 Ga0501221_012623 Ga0501221_012623_39_1163 374
1293 3300049705 Ga0501225_0000018 Ga0501225_0000018_56796_57932 374
1294 3300049705 Ga0501225_0000046 Ga0501225_0000046_35348_36472 374
1295 3300049705 Ga0501225_0020238 Ga0501225_0020238_492_1616 374
1296 3300049853 Ga0501226_000066 Ga0501226_000066_11983_13119 374
1297 3300050494 nmdc:mga06z11_136_c1 nmdc:mga06z11_136_c1_27153_28277 374
1298 3300050495 nmdc:mga04h51_18_c1 nmdc:mga04h51_18_c1_61151_62275 374
1299 3300053087 Ga0500643_000577 Ga0500643_000577_20965_22104 374
1300 3300053087 Ga0500643_001255 Ga0500643_001255_3211_4338 374
1301 3300053087 Ga0500643_005656 Ga0500643_005656_2071_3201 374
1302 3300053091 Ga0500647_0011154 Ga0500647_0011154_115_1248 374
1303 3300053093 Ga0500651_0003100 Ga0500651_0003100_5528_6661 374
1304 3300053116 Ga0500592_000537 Ga0500592_000537_2250_3383 374
1305 3300053125 Ga0500618_004495 Ga0500618_004495_357_1490 374
1306 3300053133 Ga0500655_000307 Ga0500655_000307_1335_2468 374
1307 3300053136 Ga0500559_0012414 Ga0500559_0012414_668_1795 374
1308 3300053148 Ga0500590_000114 Ga0500590_000114_13031_14164 374
1309 3300053151 Ga0500604_0001472 Ga0500604_0001472_1770_2897 374
1310 3300053158 Ga0500627_0002274 Ga0500627_0002274_3428_4555 374
1311 3300053724 Ga0500570_000053 Ga0500570_000053_14645_15778 374
1312 3300055283 Ga0500661_000046 Ga0500661_000046_1642_2769 374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

80

418

0.94

PF01212

Beta_elim_lyase

Beta-eliminating lyase

104

251

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pob-assembly1.cif.gz_D an irreversible, promiscuous and highly thermostable claisen-condensation biocatalyst drives the synthesis of substituted pyrroles 0.938 5 372
7v5i-assembly1.cif.gz_B structural insights into the substrate selectivity of acyl-coa transferase 0.9367 2 372
3wy7-assembly2.cif.gz_C crystal structure of mycobacterium smegmatis 7-keto-8-aminopelargonic acid (kapa) synthase biof 0.9365 29 373
3tqx-assembly1.cif.gz_B structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii 0.9336 4 372
7bxs-assembly1.cif.gz_B 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form 0.9304 2 372
ID Description Score Start End Superfamily
af_Q58694_46_273_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.958 46 273 3.40.640.10
af_Q5A325_172_409_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9383 44 274 3.40.640.10
af_Q58694_46_273_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9375 46 273 3.40.640.10
1bs0A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9375 44 275 3.40.640.10
af_Q2G0M8_60_294_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9348 44 277 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A1H6VTL7-F1-model_v4 8-amino-7-oxononanoate synthase 0.9978 1 374 GO:0008710
GO:0009102
GO:0030170
AF-A0A1H6VTL7-F1-model_v4 8-amino-7-oxononanoate synthase 0.9952 1 374 GO:0008710
GO:0009102
GO:0030170
AF-A0A177PIH5-F1-model_v4 8-amino-7-oxononanoate synthase 0.9901 3 373 GO:0008710
GO:0009102
GO:0030170
AF-A0A6A5KVV0-F1-model_v4 deleted 0.9877 3 329
AF-A0A1H9YRW0-F1-model_v4 8-amino-7-oxononanoate synthase (EC 2.3.1.47) (7-keto-8-amino-pelargonic acid synthase) (8-amino-7-ketopelargonate synthase) 0.9829 3 374 GO:0008710
GO:0009102
GO:0030170

Feature Viewer

pLDDT pTM Quality
96.47 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map