F492888

General Info

Members Datasets Scaffolds Average Seq Length
1312 658 2624 262

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0093406|Ga0373946_0093406_376_1185
Length 264
Sequence MSRPLRILAVLAGLFAALLLASCSKPDNGYQGWIEANLIFVAPDEVGRVQTLSVREGDTVKFTVDDDLQRADLDQIKASVTNAQQTYDRASMLLKSGSGTQKDYDAALAVLRDAQARLNSAQTRLTRRSVFSAVDGSVQQIYYRPGEMVPAGRPVLSLLPPGNIKVRFYIPETALPTIAYGDTVKVTCDGCAGDLTARVSFIARQSEFTPPVIYSLEERSKLVFLIEALPEKPGELRVGQPVDVTRLPRKTAAPAPVPPPQASR

Samples

Sample ID Description Type Environment
1 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
85 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
114 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
115 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
116 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
189 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
190 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
198 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
199 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
398 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
402 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
403 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
404 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
405 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
408 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
409 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
410 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
411 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
412 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
413 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
414 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
415 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
416 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
417 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
418 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
423 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
424 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
425 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
426 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
427 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
431 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
432 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
433 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
434 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
435 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
436 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
437 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
438 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
439 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
440 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
441 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
442 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
443 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
444 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
445 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
446 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
447 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
448 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
449 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
450 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
451 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
452 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
453 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
454 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
455 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
456 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
457 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
458 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
459 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
460 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
461 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
462 2643221651 Afipia sp. Root123D2 Isolate Unclassified
463 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
464 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
465 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
466 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
467 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
468 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
469 2791355199
470 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
471 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
472 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
473 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
474 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
475 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
476 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
477 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
478 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
479 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
480 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
481 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
482 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
483 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
484 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
485 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
486 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
487 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
488 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
489 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
490 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
491 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
492 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
493 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
494 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
495 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
496 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
497 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
498 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
499 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
500 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
501 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
502 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
503 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
504 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
505 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
506 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
507 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
508 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
509 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
510 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
511 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
512 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
513 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
514 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
515 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
516 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
517 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
518 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
519 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
520 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
521 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
522 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
523 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
524 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
525 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
526 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
527 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
528 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
529 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
530 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
531 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
532 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
533 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
534 2904699407
535 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
536 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
537 2906610324
538 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
539 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
540 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
541 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
542 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
543 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
544 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
545 2922368715
546 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
547 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
548 2922425934
549 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
550 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
551 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
552 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
553 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
554 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
555 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
556 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
557 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
558 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
559 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
560 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
561 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
562 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
563 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
564 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
565 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
566 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
567 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
568 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
569 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
570 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
571 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
572 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
573 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
574 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
575 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
576 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
577 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
578 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
579 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
580 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
581 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
582 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
583 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
584 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
585 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
586 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
587 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
588 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
589 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
590 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
591 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
592 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
593 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
594 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
595 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
596 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
597 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
598 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
599 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
600 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
601 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
602 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
603 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
604 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
605 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
606 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
607 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
608 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
609 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
610 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
611 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
612 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
613 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
614 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
615 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
616 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
617 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
618 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
619 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
620 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
621 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
622 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
623 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
624 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
625 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
626 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
627 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
628 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
629 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
630 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
631 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
632 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
633 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
634 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
635 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
636 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
637 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
638 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
639 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
640 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
641 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
642 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
643 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
644 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
645 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
646 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
647 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
648 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
649 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
650 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
651 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
652 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
653 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
654 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
655 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
656 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
657 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
658 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.4
Metatranscriptomes 0.08
Isolates 16.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.73
Nodule 13.87
Rhizoplane 4.19
Rhizosphere 57.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373946_0093406 3300035171 Bacteria 1337
2 JGI24740J21852_10003304 3300001979 Bacteria 7104
3 JGI24737J22298_10025634 3300001990 Bacteria 1863
4 JGI24735J21928_10092333 3300002067 Bacteria 868
5 JGI25406J46586_10000101 3300003203 Bacteria 38086
6 JGI25406J46586_10002540 3300003203 Bacteria 8633
7 JGI25153J46596_10000920 3300003215 Bacteria 17882
8 JGI25153J46596_10001125 3300003215 Bacteria 16201
9 JGI25153J46596_10002262 3300003215 Bacteria 11217
10 JGI25153J46596_10068834 3300003215 Bacteria 926
11 JGI25160J50197_1000504 3300003354 Bacteria 23228
12 JGI25160J50197_1014144 3300003354 Bacteria 2683
13 JGI25404J52841_10002538 3300003659 Bacteria 3470
14 JGI25404J52841_10030577 3300003659 Bacteria 1152
15 Ga0055531_10013451 3300003794 Bacteria 3768
16 Ga0055543_1004165 3300004625 Bacteria 4014
17 Ga0065165_1000278 3300005262 Bacteria 87353
18 Ga0065165_1002349 3300005262 Bacteria 16429
19 Ga0065165_1010257 3300005262 Bacteria 4077
20 Ga0070658_10016558 3300005327 Bacteria 5899
21 Ga0070658_10346108 3300005327 Bacteria 1272
22 Ga0070676_10426997 3300005328 Bacteria 927
23 Ga0070677_10207238 3300005333 Bacteria 950
24 Ga0068869_100208541 3300005334 Bacteria 1544
25 Ga0068869_100278067 3300005334 Bacteria 1345
26 Ga0070666_10196433 3300005335 Bacteria 1419
27 Ga0070680_100010020 3300005336 Bacteria 7301
28 Ga0070680_100063416 3300005336 Bacteria 3027
29 Ga0070680_100120406 3300005336 Bacteria 2191
30 Ga0070680_100139204 3300005336 Bacteria 2035
31 Ga0070680_100145706 3300005336 Bacteria 1987
32 Ga0070680_100149993 3300005336 Bacteria 1957
33 Ga0070682_100115283 3300005337 Bacteria 1796
34 Ga0070682_100219209 3300005337 Bacteria 1353
35 Ga0068868_100007309 3300005338 Bacteria 7860
36 Ga0068868_100298072 3300005338 Bacteria 1369
37 Ga0070660_100010789 3300005339 Bacteria 6468
38 Ga0070661_100051599 3300005344 Bacteria 3010
39 Ga0070661_100150550 3300005344 Bacteria 1759
40 Ga0070692_10234681 3300005345 Bacteria 1091
41 Ga0070668_100084053 3300005347 Bacteria 2499
42 Ga0070668_100206163 3300005347 Bacteria 1615
43 Ga0070668_100456393 3300005347 Bacteria 1099
44 Ga0070669_100598264 3300005353 Bacteria 924
45 Ga0070671_100140224 3300005355 Bacteria 2040
46 Ga0070671_100371400 3300005355 Bacteria 1222
47 Ga0070671_100734254 3300005355 Bacteria 858
48 Ga0070674_100033463 3300005356 Bacteria 3422
49 Ga0070674_100189648 3300005356 Bacteria 1581
50 Ga0070673_100783117 3300005364 Bacteria 880
51 Ga0070659_100211116 3300005366 Bacteria 1600
52 Ga0070659_100376179 3300005366 Bacteria 1196
53 Ga0070667_100111593 3300005367 Bacteria 2372
54 Ga0070703_10097965 3300005406 Bacteria 1029
55 Ga0070709_10027043 3300005434 Bacteria 3408
56 Ga0070709_10127581 3300005434 Bacteria 1733
57 Ga0070709_10150700 3300005434 Bacteria 1607
58 Ga0070714_100026363 3300005435 Bacteria 4803
59 Ga0070714_100029873 3300005435 Bacteria 4534
60 Ga0070714_100067379 3300005435 Bacteria 3086
61 Ga0070714_100068810 3300005435 Bacteria 3056
62 Ga0070714_100133927 3300005435 Bacteria 2217
63 Ga0070714_100206316 3300005435 Bacteria 1800
64 Ga0070714_100241907 3300005435 Bacteria 1666
65 Ga0070714_100294968 3300005435 Bacteria 1510
66 Ga0070713_100011005 3300005436 Bacteria 6566
67 Ga0070713_100046773 3300005436 Bacteria 3552
68 Ga0070713_100078015 3300005436 Bacteria 2818
69 Ga0070713_100117812 3300005436 Bacteria 2324
70 Ga0070713_100227044 3300005436 Bacteria 1696
71 Ga0070713_100497733 3300005436 Bacteria 1150
72 Ga0070710_10002809 3300005437 Bacteria 8299
73 Ga0070710_10018760 3300005437 Bacteria 3564
74 Ga0070710_10086023 3300005437 Bacteria 1845
75 Ga0070711_100010148 3300005439 Bacteria 5819
76 Ga0070711_100026294 3300005439 Bacteria 3813
77 Ga0070711_100079282 3300005439 Bacteria 2335
78 Ga0070711_100146439 3300005439 Bacteria 1777
79 Ga0070663_100034529 3300005455 Bacteria 3503
80 Ga0070663_100064499 3300005455 Bacteria 2647
81 Ga0070663_100209802 3300005455 Bacteria 1524
82 Ga0070678_100258776 3300005456 Bacteria 1462
83 Ga0070678_100480983 3300005456 Bacteria 1093
84 Ga0070662_100367559 3300005457 Bacteria 1182
85 Ga0070662_100572248 3300005457 Bacteria 948
86 Ga0070681_10014211 3300005458 Bacteria 7922
87 Ga0070681_10028493 3300005458 Bacteria 5615
88 Ga0070681_10093653 3300005458 Bacteria 2953
89 Ga0070681_10142887 3300005458 Bacteria 2323
90 Ga0068867_100275095 3300005459 Bacteria 1379
91 Ga0070707_100021591 3300005468 Bacteria 6087
92 Ga0070707_100415373 3300005468 Bacteria 1306
93 Ga0070698_100047165 3300005471 Bacteria 4404
94 Ga0070698_100548312 3300005471 Bacteria 1096
95 Ga0070699_100117287 3300005518 Bacteria 2339
96 Ga0070679_100022437 3300005530 Bacteria 6169
97 Ga0070679_100026077 3300005530 Bacteria 5737
98 Ga0070679_100036844 3300005530 Bacteria 4855
99 Ga0070679_100155995 3300005530 Bacteria 2258
100 Ga0070679_100203887 3300005530 Bacteria 1943
101 Ga0070679_100334595 3300005530 Bacteria 1462
102 Ga0070684_100010644 3300005535 Bacteria 7294
103 Ga0070684_100061181 3300005535 Bacteria 3295
104 Ga0070697_100044646 3300005536 Bacteria 3590
105 Ga0070697_100339034 3300005536 Bacteria 1297
106 Ga0068853_100012285 3300005539 Bacteria 6964
107 Ga0068853_100072867 3300005539 Bacteria 2994
108 Ga0068853_100187564 3300005539 Bacteria 1878
109 Ga0068853_100529269 3300005539 Bacteria 1115
110 Ga0068853_100581532 3300005539 Bacteria 1063
111 Ga0068853_100612287 3300005539 Bacteria 1035
112 Ga0068853_100660178 3300005539 Bacteria 996
113 Ga0070693_100463636 3300005547 Bacteria 892
114 Ga0070665_100013102 3300005548 Bacteria 8349
115 Ga0070665_100024103 3300005548 Bacteria 6128
116 Ga0070665_100148036 3300005548 Bacteria 2351
117 Ga0070665_100491339 3300005548 Bacteria 1238
118 Ga0070665_100569456 3300005548 Bacteria 1145
119 Ga0068855_100010086 3300005563 Bacteria 11386
120 Ga0068855_100036244 3300005563 Bacteria 5872
121 Ga0068855_100047278 3300005563 Bacteria 5084
122 Ga0068855_100118622 3300005563 Bacteria 3030
123 Ga0068855_100132169 3300005563 Bacteria 2849
124 Ga0068855_100451627 3300005563 Bacteria 1402
125 Ga0070664_100237681 3300005564 Bacteria 1634
126 Ga0068857_100010033 3300005577 Bacteria 8226
127 Ga0068857_100022544 3300005577 Bacteria 5540
128 Ga0068857_100126674 3300005577 Bacteria 2301
129 Ga0068854_100003033 3300005578 Bacteria 10440
130 Ga0068854_100019460 3300005578 Bacteria 4576
131 Ga0068854_100195077 3300005578 Bacteria 1589
132 Ga0068854_100450737 3300005578 Bacteria 1074
133 Ga0068856_100070767 3300005614 Bacteria 3452
134 Ga0068856_100105344 3300005614 Bacteria 2814
135 Ga0068856_100283437 3300005614 Bacteria 1674
136 Ga0068856_100403416 3300005614 Bacteria 1387
137 Ga0068856_100404988 3300005614 Bacteria 1384
138 Ga0068856_100442980 3300005614 Bacteria 1319
139 Ga0068856_100709376 3300005614 Bacteria 1026
140 Ga0068852_100027381 3300005616 Bacteria 4645
141 Ga0068852_100030886 3300005616 Bacteria 4414
142 Ga0068852_100056917 3300005616 Bacteria 3381
143 Ga0068852_100324728 3300005616 Bacteria 1495
144 Ga0068852_100378208 3300005616 Bacteria 1389
145 Ga0068852_100787386 3300005616 Bacteria 964
146 Ga0068859_100275287 3300005617 Bacteria 1776
147 Ga0068859_100394884 3300005617 Bacteria 1479
148 Ga0068859_100943234 3300005617 Bacteria 946
149 Ga0068864_100071864 3300005618 Bacteria 3014
150 Ga0068864_100161691 3300005618 Bacteria 2036
151 Ga0068864_100839222 3300005618 Bacteria 905
152 Ga0068851_10008597 3300005834 Bacteria 4723
153 Ga0068851_10096112 3300005834 Bacteria 1566
154 Ga0068851_10123672 3300005834 Bacteria 1393
155 Ga0068851_10136836 3300005834 Bacteria 1329
156 Ga0068863_100209522 3300005841 Bacteria 1877
157 Ga0068858_100142967 3300005842 Bacteria 2246
158 Ga0068858_100244348 3300005842 Bacteria 1704
159 Ga0068858_100293844 3300005842 Bacteria 1549
160 Ga0068862_100253094 3300005844 Bacteria 1606
161 Ga0068862_100500627 3300005844 Bacteria 1153
162 Ga0081455_10002972 3300005937 Bacteria 19820
163 Ga0081455_10021663 3300005937 Bacteria 6022
164 Ga0081455_10031781 3300005937 Bacteria 4769
165 Ga0081455_10221033 3300005937 Bacteria 1404
166 Ga0081538_10050307 3300005981 Bacteria 2518
167 Ga0081540_1001242 3300005983 Bacteria 22254
168 Ga0081540_1003729 3300005983 Bacteria 11938
169 Ga0081540_1004658 3300005983 Bacteria 10380
170 Ga0081540_1009086 3300005983 Bacteria 6865
171 Ga0081540_1011415 3300005983 Bacteria 5938
172 Ga0081540_1032112 3300005983 Bacteria 2872
173 Ga0081540_1079305 3300005983 Bacteria 1485
174 Ga0081539_10000008 3300005985 Bacteria 525071
175 Ga0081539_10007751 3300005985 Bacteria 9622
176 Ga0081539_10043237 3300005985 Bacteria 2614
177 Ga0081539_10094697 3300005985 Bacteria 1536
178 Ga0070717_10012564 3300006028 Bacteria 6459
179 Ga0070717_10019407 3300006028 Bacteria 5330
180 Ga0070717_10122998 3300006028 Bacteria 2225
181 Ga0070717_10517194 3300006028 Bacteria 1080
182 Ga0075365_10000993 3300006038 Bacteria 12114
183 Ga0075365_10004283 3300006038 Bacteria 7534
184 Ga0075365_10007056 3300006038 Bacteria 6256
185 Ga0075365_10043659 3300006038 Bacteria 2935
186 Ga0075365_10046896 3300006038 Bacteria 2839
187 Ga0075365_10068065 3300006038 Bacteria 2392
188 Ga0075365_10137422 3300006038 Bacteria 1695
189 Ga0075365_10185794 3300006038 Bacteria 1454
190 Ga0075368_10003136 3300006042 Bacteria 5487
191 Ga0075368_10007174 3300006042 Bacteria 3927
192 Ga0075363_100001650 3300006048 Bacteria 8628
193 Ga0075363_100043364 3300006048 Bacteria 2380
194 Ga0075363_100104311 3300006048 Bacteria 1571
195 Ga0075363_100163791 3300006048 Bacteria 1260
196 Ga0075363_100172707 3300006048 Bacteria 1227
197 Ga0075364_10045002 3300006051 Bacteria 2872
198 Ga0075364_10048434 3300006051 Bacteria 2769
199 Ga0075364_10054632 3300006051 Bacteria 2612
200 Ga0075364_10077696 3300006051 Bacteria 2191
201 Ga0070716_100011343 3300006173 Bacteria 4486
202 Ga0070716_100031431 3300006173 Bacteria 2887
203 Ga0070712_100018443 3300006175 Bacteria 4534
204 Ga0070712_100032286 3300006175 Bacteria 3534
205 Ga0070712_100154089 3300006175 Bacteria 1767
206 Ga0070712_100400401 3300006175 Bacteria 1134
207 Ga0070712_100579238 3300006175 Bacteria 948
208 Ga0075362_10052926 3300006177 Bacteria 1821
209 Ga0075362_10150429 3300006177 Bacteria 1116
210 Ga0075367_10018402 3300006178 Bacteria 3854
211 Ga0075367_10048788 3300006178 Bacteria 2495
212 Ga0075369_10019487 3300006186 Bacteria 2770
213 Ga0075369_10035065 3300006186 Bacteria 2131
214 Ga0075369_10042387 3300006186 Bacteria 1951
215 Ga0075369_10056550 3300006186 Bacteria 1705
216 Ga0075369_10074744 3300006186 Bacteria 1495
217 Ga0075366_10018104 3300006195 Bacteria 4067
218 Ga0075366_10213882 3300006195 Bacteria 1174
219 Ga0075366_10237425 3300006195 Bacteria 1111
220 Ga0075366_10301998 3300006195 Bacteria 979
221 Ga0097621_100490521 3300006237 Bacteria 1112
222 Ga0075370_10030260 3300006353 Bacteria 3020
223 Ga0075370_10131503 3300006353 Bacteria 1460
224 Ga0075370_10155959 3300006353 Bacteria 1339
225 Ga0075370_10163292 3300006353 Bacteria 1308
226 Ga0075428_100218508 3300006844 Bacteria 2058
227 Ga0075434_100712958 3300006871 Bacteria 1020
228 Ga0097620_100275272 3300006931 Bacteria 1776
229 Ga0097620_100394909 3300006931 Bacteria 1479
230 Ga0097620_100943218 3300006931 Bacteria 946
231 Ga0099825_1024340 3300006941 Bacteria 3557
232 Ga0099825_1032271 3300006941 Bacteria 2140
233 Ga0099824_1017617 3300006942 Bacteria 6127
234 Ga0099824_1020569 3300006942 Bacteria 4819
235 Ga0099822_1002963 3300006943 Bacteria 21553
236 Ga0099822_1056819 3300006943 Bacteria 1412
237 Ga0099823_1027325 3300006944 Bacteria 4980
238 Ga0099795_10155846 3300007788 Bacteria 939
239 Ga0105240_10010891 3300009093 Bacteria 12739
240 Ga0105240_10096056 3300009093 Bacteria 3612
241 Ga0105240_10106508 3300009093 Bacteria 3400
242 Ga0105240_10170514 3300009093 Bacteria 2578
243 Ga0105240_10285146 3300009093 Bacteria 1896
244 Ga0111539_10239229 3300009094 Bacteria 2113
245 Ga0105245_10012748 3300009098 Bacteria 7320
246 Ga0105247_10017329 3300009101 Bacteria 4324
247 Ga0114129_10029906 3300009147 Bacteria 7713
248 Ga0105243_10048108 3300009148 Bacteria 3360
249 Ga0105241_10000872 3300009174 Bacteria 22829
250 Ga0105241_10096562 3300009174 Bacteria 2341
251 Ga0105242_10247940 3300009176 Bacteria 1603
252 Ga0105248_10095487 3300009177 Bacteria 3347
253 Ga0105248_10363872 3300009177 Bacteria 1628
254 Ga0105237_10001564 3300009545 Bacteria 29835
255 Ga0105237_10003312 3300009545 Bacteria 19195
256 Ga0105237_10012234 3300009545 Bacteria 9045
257 Ga0105237_10180959 3300009545 Bacteria 2108
258 Ga0105237_10350806 3300009545 Bacteria 1480
259 Ga0105237_10366559 3300009545 Bacteria 1445
260 Ga0105237_10539736 3300009545 Bacteria 1173
261 Ga0105238_10003952 3300009551 Bacteria 14709
262 Ga0105238_10032844 3300009551 Bacteria 5282
263 Ga0105238_10048562 3300009551 Bacteria 4276
264 Ga0105238_10259677 3300009551 Bacteria 1716
265 Ga0105249_10093461 3300009553 Bacteria 2817
266 Ga0105239_10023669 3300010375 Bacteria 6761
267 Ga0105239_10030698 3300010375 Bacteria 5911
268 Ga0105239_10074080 3300010375 Bacteria 3743
269 Ga0105239_10102926 3300010375 Bacteria 3160
270 Ga0105239_10349578 3300010375 Bacteria 1669
271 Ga0105239_10475918 3300010375 Bacteria 1419
272 Ga0105239_10485725 3300010375 Bacteria 1403
273 Ga0105239_10976221 3300010375 Bacteria 974
274 Ga0105246_10010537 3300011119 Bacteria 5725
275 Ga0157373_10147701 3300013100 Bacteria 1654
276 Ga0157371_10030194 3300013102 Bacteria 3911
277 Ga0157370_10058101 3300013104 Bacteria 3676
278 Ga0157370_10124966 3300013104 Bacteria 2402
279 Ga0157369_10033485 3300013105 Bacteria 5646
280 Ga0157369_10052550 3300013105 Bacteria 4408
281 Ga0157369_10069916 3300013105 Bacteria 3771
282 Ga0157369_11030631 3300013105 Bacteria 842
283 Ga0157374_10106318 3300013296 Bacteria 2696
284 Ga0157374_10973065 3300013296 Bacteria 867
285 Ga0157374_11002873 3300013296 Bacteria 854
286 Ga0157378_10931581 3300013297 Bacteria 901
287 Ga0163162_10015868 3300013306 Bacteria 7361
288 Ga0163162_10216906 3300013306 Bacteria 2043
289 Ga0163162_10752189 3300013306 Bacteria 1094
290 Ga0157372_10574109 3300013307 Bacteria 1314
291 Ga0157375_10315060 3300013308 Bacteria 1729
292 Ga0157375_10650541 3300013308 Bacteria 1210
293 Ga0163163_10017661 3300014325 Bacteria 6660
294 Ga0163163_10038191 3300014325 Bacteria 4677
295 Ga0163163_10153121 3300014325 Bacteria 2349
296 Ga0163163_10390407 3300014325 Bacteria 1450
297 Ga0163163_10417349 3300014325 Bacteria 1401
298 Ga0157379_10283781 3300014968 Bacteria 1507
299 Ga0157376_10048343 3300014969 Bacteria 3517
300 Ga0157376_10743673 3300014969 Bacteria 989
301 Ga0214544_1000020 3300021320 Bacteria 178560
302 Ga0214542_1000024 3300021321 Bacteria 191218
303 Ga0214545_1000011 3300021324 Bacteria 190550
304 Ga0214543_1000033 3300021327 Bacteria 190419
305 Ga0213874_10044299 3300021377 Bacteria 1344
306 Ga0213876_10006667 3300021384 Bacteria 6301
307 Ga0213876_10078625 3300021384 Bacteria 1743
308 Ga0213875_10101900 3300021388 Bacteria 1340
309 Ga0213875_10108817 3300021388 Bacteria 1294
310 Ga0213871_10008517 3300021441 Bacteria 2265
311 Ga0209563_103359 3300025230 Bacteria 3332
312 Ga0209677_100890 3300025253 Bacteria 14633
313 Ga0209677_105274 3300025253 Bacteria 3422
314 Ga0209148_1000574 3300025254 Bacteria 34124
315 Ga0209148_1007369 3300025254 Bacteria 2293
316 Ga0209233_1001934 3300025261 Bacteria 7910
317 Ga0209233_1004212 3300025261 Bacteria 4931
318 Ga0209233_1010224 3300025261 Bacteria 2822
319 Ga0209455_1000834 3300025272 Bacteria 16636
320 Ga0209455_1008239 3300025272 Bacteria 2852
321 Ga0209564_1023458 3300025295 Bacteria 2142
322 Ga0209564_1038617 3300025295 Bacteria 1325
323 Ga0209758_1000065 3300025297 Bacteria 306288
324 Ga0209758_1000498 3300025297 Bacteria 64011
325 Ga0209758_1000560 3300025297 Bacteria 58586
326 Ga0209758_1002030 3300025297 Bacteria 21763
327 Ga0209758_1015655 3300025297 Bacteria 3910
328 Ga0209758_1027726 3300025297 Bacteria 2414
329 Ga0209758_1057022 3300025297 Bacteria 1315
330 Ga0209256_1011226 3300025299 Bacteria 3613
331 Ga0209256_1024358 3300025299 Bacteria 1783
332 Ga0207426_1000721 3300025302 Bacteria 38161
333 Ga0207426_1000728 3300025302 Bacteria 37754
334 Ga0207426_1002233 3300025302 Bacteria 12914
335 Ga0207426_1015834 3300025302 Bacteria 2726
336 Ga0209051_1035572 3300025303 Bacteria 1851
337 Ga0209257_1001031 3300025304 Bacteria 37368
338 Ga0209257_1035165 3300025304 Bacteria 1553
339 Ga0207656_10063036 3300025321 Bacteria 1631
340 Ga0207656_10099051 3300025321 Bacteria 1334
341 Ga0207656_10176149 3300025321 Bacteria 1024
342 Ga0207692_10000702 3300025898 Bacteria 11780
343 Ga0207692_10002139 3300025898 Bacteria 7544
344 Ga0207710_10037989 3300025900 Bacteria 2128
345 Ga0207710_10078884 3300025900 Bacteria 1524
346 Ga0207688_10032649 3300025901 Bacteria 2878
347 Ga0207688_10112037 3300025901 Bacteria 1585
348 Ga0207680_10344036 3300025903 Bacteria 1047
349 Ga0207647_10000486 3300025904 Bacteria 31906
350 Ga0207647_10011713 3300025904 Bacteria 6138
351 Ga0207685_10006684 3300025905 Bacteria 3161
352 Ga0207699_10001397 3300025906 Bacteria 11471
353 Ga0207699_10023930 3300025906 Bacteria 3331
354 Ga0207699_10034967 3300025906 Bacteria 2855
355 Ga0207645_10129401 3300025907 Bacteria 1642
356 Ga0207643_10026833 3300025908 Bacteria 3191
357 Ga0207643_10076823 3300025908 Bacteria 1930
358 Ga0207643_10282845 3300025908 Bacteria 1029
359 Ga0207705_10017045 3300025909 Bacteria 5203
360 Ga0207705_10168146 3300025909 Bacteria 1650
361 Ga0207705_10197379 3300025909 Bacteria 1524
362 Ga0207684_10559718 3300025910 Bacteria 978
363 Ga0207654_10007503 3300025911 Bacteria 5496
364 Ga0207707_10002451 3300025912 Bacteria 16695
365 Ga0207707_10005454 3300025912 Bacteria 11118
366 Ga0207707_10075753 3300025912 Bacteria 2936
367 Ga0207707_10159724 3300025912 Bacteria 1971
368 Ga0207695_10000029 3300025913 Bacteria 548364
369 Ga0207695_10001179 3300025913 Bacteria 45082
370 Ga0207695_10072034 3300025913 Bacteria 3528
371 Ga0207695_10135866 3300025913 Bacteria 2412
372 Ga0207671_10003068 3300025914 Bacteria 17080
373 Ga0207671_10054717 3300025914 Bacteria 2956
374 Ga0207671_10060487 3300025914 Bacteria 2810
375 Ga0207671_10061185 3300025914 Bacteria 2794
376 Ga0207671_10146523 3300025914 Bacteria 1822
377 Ga0207671_10553991 3300025914 Bacteria 917
378 Ga0207693_10000723 3300025915 Bacteria 29753
379 Ga0207693_10016800 3300025915 Bacteria 5842
380 Ga0207693_10055703 3300025915 Bacteria 3102
381 Ga0207663_10008872 3300025916 Bacteria 5287
382 Ga0207663_10009924 3300025916 Bacteria 5041
383 Ga0207663_10071461 3300025916 Bacteria 2240
384 Ga0207660_10003233 3300025917 Bacteria 10662
385 Ga0207660_10122451 3300025917 Bacteria 1971
386 Ga0207660_10124137 3300025917 Bacteria 1959
387 Ga0207660_10153603 3300025917 Bacteria 1771
388 Ga0207657_10009870 3300025919 Bacteria 9559
389 Ga0207649_10038698 3300025920 Bacteria 2888
390 Ga0207649_10126757 3300025920 Bacteria 1729
391 Ga0207652_10001798 3300025921 Bacteria 18633
392 Ga0207652_10009823 3300025921 Bacteria 7702
393 Ga0207652_10017746 3300025921 Bacteria 5829
394 Ga0207652_10203677 3300025921 Bacteria 1781
395 Ga0207652_10325887 3300025921 Bacteria 1387
396 Ga0207646_10308362 3300025922 Bacteria 1430
397 Ga0207694_10000131 3300025924 Bacteria 76343
398 Ga0207694_10156005 3300025924 Bacteria 1841
399 Ga0207650_10038362 3300025925 Bacteria 3498
400 Ga0207650_10242077 3300025925 Bacteria 1458
401 Ga0207687_10322470 3300025927 Bacteria 1251
402 Ga0207700_10006382 3300025928 Bacteria 7116
403 Ga0207700_10021767 3300025928 Bacteria 4385
404 Ga0207700_10065414 3300025928 Bacteria 2774
405 Ga0207700_10192709 3300025928 Bacteria 1714
406 Ga0207700_10334081 3300025928 Bacteria 1316
407 Ga0207700_10403486 3300025928 Bacteria 1198
408 Ga0207700_10440561 3300025928 Bacteria 1147
409 Ga0207664_10029323 3300025929 Bacteria 4190
410 Ga0207664_10030728 3300025929 Bacteria 4104
411 Ga0207664_10687644 3300025929 Bacteria 920
412 Ga0207644_10009377 3300025931 Bacteria 6429
413 Ga0207644_10134362 3300025931 Bacteria 1898
414 Ga0207644_10360211 3300025931 Bacteria 1183
415 Ga0207690_10185300 3300025932 Bacteria 1570
416 Ga0207690_10284180 3300025932 Bacteria 1289
417 Ga0207706_10027406 3300025933 Bacteria 5094
418 Ga0207706_10074343 3300025933 Bacteria 2988
419 Ga0207686_10162813 3300025934 Bacteria 1565
420 Ga0207709_10078643 3300025935 Bacteria 2118
421 Ga0207669_10006776 3300025937 Bacteria 5262
422 Ga0207704_10102781 3300025938 Bacteria 1910
423 Ga0207704_10282610 3300025938 Bacteria 1262
424 Ga0207665_10000064 3300025939 Bacteria 68931
425 Ga0207665_10004907 3300025939 Bacteria 8915
426 Ga0207711_10063683 3300025941 Bacteria 3184
427 Ga0207711_10165633 3300025941 Bacteria 2003
428 Ga0207689_10451141 3300025942 Bacteria 1075
429 Ga0207661_10047386 3300025944 Bacteria 3411
430 Ga0207679_10527650 3300025945 Bacteria 1057
431 Ga0207667_10003470 3300025949 Bacteria 19454
432 Ga0207667_10007884 3300025949 Bacteria 12714
433 Ga0207667_10067637 3300025949 Bacteria 3721
434 Ga0207667_10151534 3300025949 Bacteria 2386
435 Ga0207667_10487481 3300025949 Bacteria 1251
436 Ga0207667_10706591 3300025949 Bacteria 1010
437 Ga0207712_10040241 3300025961 Bacteria 3207
438 Ga0207668_10399540 3300025972 Bacteria 1161
439 Ga0207668_10454776 3300025972 Bacteria 1093
440 Ga0207640_10045119 3300025981 Bacteria 2829
441 Ga0207677_10407172 3300026023 Bacteria 1155
442 Ga0207639_10004621 3300026041 Bacteria 9267
443 Ga0207639_10027307 3300026041 Bacteria 4157
444 Ga0207639_10033598 3300026041 Bacteria 3785
445 Ga0207639_10205758 3300026041 Bacteria 1691
446 Ga0207639_10263581 3300026041 Bacteria 1508
447 Ga0207678_10054454 3300026067 Bacteria 3445
448 Ga0207678_10072906 3300026067 Bacteria 2943
449 Ga0207678_10120813 3300026067 Bacteria 2236
450 Ga0207678_10354151 3300026067 Bacteria 1266
451 Ga0207678_10397685 3300026067 Bacteria 1193
452 Ga0207708_10431748 3300026075 Bacteria 1094
453 Ga0207702_10000005 3300026078 Bacteria 420296
454 Ga0207702_10000403 3300026078 Bacteria 49280
455 Ga0207702_10168093 3300026078 Bacteria 2008
456 Ga0207702_10363530 3300026078 Bacteria 1387
457 Ga0207702_10634712 3300026078 Bacteria 1050
458 Ga0207648_10245379 3300026089 Bacteria 1596
459 Ga0207676_10152803 3300026095 Bacteria 1990
460 Ga0207674_10001872 3300026116 Bacteria 26801
461 Ga0207674_10007797 3300026116 Bacteria 12452
462 Ga0207674_10011800 3300026116 Bacteria 9803
463 Ga0207674_10441353 3300026116 Bacteria 1258
464 Ga0207674_10797436 3300026116 Bacteria 911
465 Ga0207675_100012752 3300026118 Bacteria 7852
466 Ga0207675_100191979 3300026118 Bacteria 1959
467 Ga0207675_100327208 3300026118 Bacteria 1497
468 Ga0207683_10180078 3300026121 Bacteria 1916
469 Ga0207683_10501591 3300026121 Bacteria 1121
470 Ga0207698_10086772 3300026142 Bacteria 2546
471 Ga0207698_10216554 3300026142 Bacteria 1727
472 Ga0207698_10423534 3300026142 Bacteria 1278
473 Ga0207698_10536815 3300026142 Bacteria 1144
474 Ga0209389_1000011 3300027296 Bacteria 223265
475 Ga0209389_1000025 3300027296 Bacteria 149588
476 Ga0209589_1000018 3300027357 Bacteria 192614
477 Ga0209589_1000066 3300027357 Bacteria 100795
478 Ga0209489_100017 3300027361 Bacteria 223265
479 Ga0209489_100026 3300027361 Bacteria 192614
480 Ga0209489_100030 3300027361 Bacteria 185999
481 Ga0209700_100027 3300027363 Bacteria 223462
482 Ga0209700_100035 3300027363 Bacteria 192614
483 Ga0209813_10014372 3300027866 Bacteria 2131
484 Ga0209813_10017191 3300027866 Bacteria 1983
485 Ga0209813_10018563 3300027866 Bacteria 1924
486 Ga0207428_10277047 3300027907 Bacteria 1246
487 Ga0265357_1000522 3300028023 Bacteria 2292
488 Ga0268266_10003834 3300028379 Bacteria 14695
489 Ga0268266_10012714 3300028379 Bacteria 7274
490 Ga0268266_10027088 3300028379 Bacteria 4876
491 Ga0268266_10238536 3300028379 Bacteria 1677
492 Ga0268265_10288694 3300028380 Bacteria 1471
493 Ga0268264_10085874 3300028381 Bacteria 2702
494 Ga0268264_10383852 3300028381 Bacteria 1346
495 Ga0268264_10463123 3300028381 Bacteria 1230
496 Ga0265319_1013101 3300028563 Bacteria 3315
497 Ga0265334_10003572 3300028573 Bacteria 7046
498 Ga0265323_10002458 3300028653 Bacteria 8476
499 Ga0265336_10000843 3300028666 Bacteria 15963
500 Ga0307517_10003575 3300028786 Bacteria 24130
501 Ga0265338_10000065 3300028800 Bacteria 188966
502 Ga0265324_10009971 3300029957 Bacteria 3688
503 Ga0307511_10065964 3300030521 Bacteria 2702
504 Ga0307511_10081777 3300030521 Bacteria 2264
505 Ga0265763_1000333 3300030763 Bacteria 2692
506 Ga0265330_10059075 3300031235 Bacteria 1670
507 Ga0265332_10081976 3300031238 Bacteria 1368
508 Ga0265325_10099265 3300031241 Bacteria 1427
509 Ga0265329_10068196 3300031242 Bacteria 1126
510 Ga0265340_10001672 3300031247 Bacteria 12757
511 Ga0265340_10218290 3300031247 Bacteria 855
512 Ga0265339_10003005 3300031249 Bacteria 11888
513 Ga0265339_10164157 3300031249 Bacteria 1116
514 Ga0265331_10094640 3300031250 Bacteria 1379
515 Ga0307513_10024303 3300031456 Bacteria 7052
516 Ga0307513_10245449 3300031456 Bacteria 1592
517 Ga0307513_10305881 3300031456 Bacteria 1354
518 Ga0307513_10323244 3300031456 Bacteria 1300
519 Ga0307513_10377107 3300031456 Bacteria 1159
520 Ga0307509_10007153 3300031507 Bacteria 14704
521 Ga0307509_10191035 3300031507 Bacteria 1899
522 Ga0307408_100396994 3300031548 Bacteria 1183
523 Ga0265313_10064958 3300031595 Bacteria 1696
524 Ga0307508_10000521 3300031616 Bacteria 45797
525 Ga0307508_10121413 3300031616 Bacteria 2215
526 Ga0307508_10150727 3300031616 Bacteria 1930
527 Ga0307508_10157364 3300031616 Bacteria 1876
528 Ga0265314_10038916 3300031711 Bacteria 3431
529 Ga0265314_10081458 3300031711 Bacteria 2132
530 Ga0265314_10087153 3300031711 Bacteria 2042
531 Ga0265314_10110866 3300031711 Bacteria 1744
532 Ga0265342_10002787 3300031712 Bacteria 14791
533 Ga0265342_10160466 3300031712 Bacteria 1243
534 Ga0307516_10006534 3300031730 Bacteria 13649
535 Ga0307516_10008532 3300031730 Bacteria 11575
536 Ga0307516_10010831 3300031730 Bacteria 9978
537 Ga0307516_10146099 3300031730 Bacteria 2130
538 Ga0307405_10338377 3300031731 Bacteria 1156
539 Ga0307406_10652378 3300031901 Bacteria 874
540 Ga0307412_10291645 3300031911 Bacteria 1285
541 Ga0307409_100452597 3300031995 Bacteria 1239
542 Ga0307416_100075188 3300032002 Bacteria 2826
543 Ga0307416_100423675 3300032002 Bacteria 1376
544 Ga0307414_10587028 3300032004 Bacteria 998
545 Ga0307411_10217575 3300032005 Bacteria 1480
546 Ga0307415_100180367 3300032126 Bacteria 1656
547 Ga0307415_100249973 3300032126 Bacteria 1440
548 Ga0307507_10037444 3300033179 Bacteria 4937
549 Ga0307510_10018544 3300033180 Bacteria 8187
550 Ga0307510_10072144 3300033180 Bacteria 3432
551 Ga0307510_10142887 3300033180 Bacteria 2032
552 Ga0307510_10231122 3300033180 Bacteria 1352
553 Ga0315911_1000011 3300033442 Bacteria 264678
554 Ga0373926_0046578 3300035083 Bacteria 1556
555 Ga0373926_0092286 3300035083 Bacteria 1127
556 Ga0373934_0030323 3300035086 Bacteria 2115
557 Ga0373934_0037065 3300035086 Bacteria 1920
558 Ga0373923_0003639 3300035111 Bacteria 4980
559 Ga0373923_0039268 3300035111 Bacteria 1943
560 Ga0373936_0002935 3300035113 Bacteria 6373
561 Ga0373945_0042158 3300035116 Bacteria 1653
562 Ga0373953_0000420 3300035117 Bacteria 11547
563 Ga0373954_0000663 3300035118 Bacteria 13181
564 Ga0373954_0010613 3300035118 Bacteria 4067
565 Ga0373954_0014139 3300035118 Bacteria 3557
566 Ga0373954_0236113 3300035118 Bacteria 900
567 Ga0373956_0000275 3300035119 Bacteria 20650
568 Ga0373957_0000426 3300035120 Bacteria 10649
569 Ga0373957_0042157 3300035120 Bacteria 1721
570 Ga0373943_0002244 3300035170 Bacteria 8781
571 Ga0373943_0002327 3300035170 Bacteria 8638
572 Ga0373943_0020053 3300035170 Bacteria 3079
573 Ga0373943_0058892 3300035170 Bacteria 1913
574 Ga0373946_0008126 3300035171 Bacteria 3852
575 Ga0373946_0140402 3300035171 Bacteria 1119
576 Ga0373955_0000510 3300035172 Bacteria 16513
577 Ga0373955_0019046 3300035172 Bacteria 3423
578 Ga0373955_0145188 3300035172 Bacteria 1393
579 Ga0373924_0013575 3300035410 Bacteria 3062
580 Ga0373924_0031154 3300035410 Bacteria 2143
581 Ga0373924_0083534 3300035410 Bacteria 1360
582 Ga0373931_0141343 3300035691 Bacteria 1394
583 Ga0373931_0156641 3300035691 Bacteria 1332
584 Ga0373935_0000344 3300035692 Bacteria 23571
585 Ga0373935_0002403 3300035692 Bacteria 10712
586 Ga0373935_0037526 3300035692 Bacteria 3033
587 Ga0373927_0000535 3300035695 Bacteria 28908
588 Ga0373927_0000665 3300035695 Bacteria 26133
589 Ga0373927_0011552 3300035695 Bacteria 5883
590 Ga0373927_0036697 3300035695 Bacteria 3187
591 Ga0373927_0041290 3300035695 Bacteria 2992
592 Ga0373927_0320531 3300035695 Bacteria 1020
593 Ga0373933_0000405 3300035724 Bacteria 27323
594 Ga0373933_0003239 3300035724 Bacteria 9087
595 Ga0373933_0094983 3300035724 Bacteria 1844
596 Ga0373933_0137136 3300035724 Bacteria 1542
597 Ga0373933_0281984 3300035724 Bacteria 1073
598 Ga0373947_0003567 3300035725 Bacteria 9185
599 Ga0373947_0005129 3300035725 Bacteria 7671
600 Ga0373947_0032291 3300035725 Bacteria 3085
601 Ga0373947_0051406 3300035725 Bacteria 2479
602 Ga0373937_0016746 3300036401 Bacteria 6514
603 Ga0373937_0019554 3300036401 Bacteria 6060
604 Ga0373937_0038342 3300036401 Bacteria 4366
605 Ga0373937_0077111 3300036401 Bacteria 3079
606 Ga0373937_0157610 3300036401 Bacteria 2128
607 Ga0373937_0161959 3300036401 Bacteria 2097
608 Ga0373925_0008976 3300037068 Bacteria 7286
609 Ga0373925_0052343 3300037068 Bacteria 3050
610 Ga0373925_0091409 3300037068 Bacteria 2327
611 Ga0373925_0273105 3300037068 Bacteria 1360
612 Ga0395900_0001369 3300037418 Bacteria 29330
613 Ga0395900_0011842 3300037418 Bacteria 8919
614 Ga0395898_0037847 3300037466 Bacteria 4783
615 Ga0395898_0083798 3300037466 Bacteria 3073
616 Ga0395898_0110036 3300037466 Bacteria 2641
617 Ga0395898_0132467 3300037466 Bacteria 2387
618 Ga0395905_0019296 3300037471 Bacteria 6464
619 Ga0395905_0028187 3300037471 Bacteria 5293
620 Ga0395905_0060245 3300037471 Bacteria 3550
621 Ga0395905_0590869 3300037471 Bacteria 1012
622 Ga0436364_0299669 3300037853 Bacteria 1653
623 Ga0436364_0782463 3300037853 Bacteria 1795
624 Ga0395901_0235053 3300038443 Bacteria 1913
625 Ga0436365_0042657 3300039437 Bacteria 1078
626 Ga0436365_0063867 3300039437 Bacteria 4920
627 Ga0436365_0722166 3300039437 Bacteria 4126
628 Ga0436365_1063789 3300039437 Bacteria 4896
629 Ga0436360_0323822 3300039438 Bacteria 2745
630 Ga0436360_0496502 3300039438 Bacteria 1271
631 Ga0436360_1129815 3300039438 Bacteria 1062
632 Ga0436361_0126094 3300039447 Bacteria 5267
633 Ga0436361_0600203 3300039447 Bacteria 1125
634 Ga0436363_0188494 3300039450 Bacteria 1986
635 Ga0436363_0375693 3300039450 Bacteria 869
636 Ga0436363_0533929 3300039450 Bacteria 1191
637 Ga0436363_0618196 3300039450 Bacteria 1566
638 Ga0436363_1243410 3300039450 Bacteria 3829
639 Ga0436363_1419910 3300039450 Bacteria 1625
640 Ga0436362_0493194 3300039453 Bacteria 3289
641 Ga0451853_2794660 3300041512 Bacteria 1124
642 Ga0466972_0000807 3300044658 Bacteria 14916
643 Ga0466972_0001683 3300044658 Bacteria 10830
644 Ga0466965_0224184 3300044683 Bacteria 1002
645 Ga0466966_0001348 3300044684 Bacteria 15776
646 Ga0466966_0031942 3300044684 Bacteria 3415
647 Ga0466961_0000120 3300044693 Bacteria 52569
648 Ga0466963_0011705 3300044694 Bacteria 5348
649 Ga0466964_0063140 3300044706 Bacteria 1546
650 Ga0466968_0003445 3300044735 Bacteria 5854
651 Ga0466957_0140446 3300044842 Bacteria 1556
652 Ga0466960_0037601 3300044901 Bacteria 2272
653 Ga0466960_0051743 3300044901 Bacteria 1985
654 Ga0466960_0089949 3300044901 Bacteria 1563
655 Ga0466960_0105690 3300044901 Bacteria 1455
656 Ga0466958_0225122 3300045836 Bacteria 1197
657 Ga0466967_0039448 3300045976 Bacteria 4060
658 Ga0466967_0054533 3300045976 Bacteria 3519
659 Ga0466967_0297279 3300045976 Bacteria 1553
660 Ga0466967_0366390 3300045976 Bacteria 1397
661 Ga0495592_0003383 3300046454 Bacteria 11439
662 Ga0495592_0039077 3300046454 Bacteria 3567
663 Ga0495603_0000094 3300046455 Bacteria 40636
664 Ga0495603_0002935 3300046455 Bacteria 10082
665 Ga0495603_0059188 3300046455 Bacteria 2265
666 Ga0495603_0270305 3300046455 Bacteria 978
667 Ga0495629_0000612 3300046459 Bacteria 29083
668 Ga0495629_0001119 3300046459 Bacteria 21231
669 Ga0495629_0016050 3300046459 Bacteria 5381
670 Ga0495629_0143782 3300046459 Bacteria 1659
671 Ga0495629_0188944 3300046459 Bacteria 1426
672 Ga0495638_0004073 3300046460 Bacteria 11197
673 Ga0495638_0042140 3300046460 Bacteria 2884
674 Ga0495641_0003738 3300046461 Bacteria 11192
675 Ga0495651_0000889 3300046462 Bacteria 23256
676 Ga0495651_0009999 3300046462 Bacteria 7292
677 Ga0495651_0048662 3300046462 Bacteria 3273
678 Ga0495651_0129445 3300046462 Bacteria 1844
679 Ga0495651_0278233 3300046462 Bacteria 1132
680 Ga0495653_0000399 3300046463 Bacteria 34847
681 Ga0495653_0131341 3300046463 Bacteria 1772
682 Ga0495580_0002084 3300046472 Bacteria 17548
683 Ga0495580_0028605 3300046472 Bacteria 4050
684 Ga0495582_0000256 3300046473 Bacteria 29694
685 Ga0495605_0171927 3300046474 Bacteria 957
686 Ga0495639_0000114 3300046475 Bacteria 40307
687 Ga0495639_0022425 3300046475 Bacteria 2770
688 Ga0495639_0037488 3300046475 Bacteria 2173
689 Ga0495639_0088828 3300046475 Bacteria 1447
690 Ga0495662_0003498 3300046476 Bacteria 7946
691 Ga0495662_0063636 3300046476 Bacteria 1782
692 Ga0495664_0007385 3300046477 Bacteria 6103
693 Ga0495664_0007443 3300046477 Bacteria 6082
694 Ga0495664_0027650 3300046477 Bacteria 3308
695 Ga0495664_0262354 3300046477 Bacteria 1044
696 Ga0495584_0224638 3300046491 Bacteria 954
697 Ga0495585_0047154 3300046492 Bacteria 2400
698 Ga0495585_0092179 3300046492 Bacteria 1631
699 Ga0495594_0000393 3300046499 Bacteria 22014
700 Ga0495596_0117317 3300046500 Bacteria 1034
701 Ga0495606_0072155 3300046507 Bacteria 2170
702 Ga0495608_0001226 3300046511 Bacteria 18178
703 Ga0495608_0016044 3300046511 Bacteria 5183
704 Ga0495608_0059203 3300046511 Bacteria 2524
705 Ga0495616_0085568 3300046513 Bacteria 1501
706 Ga0495618_0027003 3300046514 Bacteria 3573
707 Ga0495618_0248478 3300046514 Bacteria 1116
708 Ga0495628_0021333 3300046516 Bacteria 5331
709 Ga0495628_0026173 3300046516 Bacteria 4762
710 Ga0495628_0039835 3300046516 Bacteria 3757
711 Ga0495628_0042972 3300046516 Bacteria 3602
712 Ga0495628_0054021 3300046516 Bacteria 3167
713 Ga0495630_0000459 3300046517 Bacteria 30805
714 Ga0495630_0007072 3300046517 Bacteria 7994
715 Ga0495630_0118558 3300046517 Bacteria 2007
716 Ga0495631_0042585 3300046518 Bacteria 2006
717 Ga0495637_0047602 3300046520 Bacteria 1809
718 Ga0495648_0030954 3300046524 Bacteria 3531
719 Ga0495648_0122179 3300046524 Bacteria 1398
720 Ga0495666_0013950 3300046526 Bacteria 4008
721 Ga0495652_0006874 3300046529 Bacteria 10531
722 Ga0495652_0017641 3300046529 Bacteria 6370
723 Ga0495652_0040916 3300046529 Bacteria 4003
724 Ga0495652_0080772 3300046529 Bacteria 2684
725 Ga0495652_0134319 3300046529 Bacteria 1954
726 Ga0495665_0000130 3300046531 Bacteria 35880
727 Ga0495640_0007646 3300046533 Bacteria 8498
728 Ga0495640_0016287 3300046533 Bacteria 5564
729 Ga0495640_0027589 3300046533 Bacteria 4093
730 Ga0495640_0077117 3300046533 Bacteria 2222
731 Ga0495640_0113738 3300046533 Bacteria 1765
732 Ga0495640_0193036 3300046533 Bacteria 1293
733 Ga0495587_0001432 3300046536 Bacteria 15878
734 Ga0495587_0008425 3300046536 Bacteria 6629
735 Ga0495587_0026974 3300046536 Bacteria 3498
736 Ga0495587_0106342 3300046536 Bacteria 1614
737 Ga0495645_0001776 3300046543 Bacteria 14687
738 Ga0495645_0078572 3300046543 Bacteria 2371
739 Ga0495645_0110527 3300046543 Bacteria 1945
740 Ga0495645_0114562 3300046543 Bacteria 1905
741 Ga0495622_0005481 3300046557 Bacteria 5885
742 Ga0495622_0036395 3300046557 Bacteria 2295
743 Ga0495622_0070664 3300046557 Bacteria 1611
744 Ga0495622_0081412 3300046557 Bacteria 1490
745 Ga0495667_0001452 3300046559 Bacteria 15607
746 Ga0495667_0005133 3300046559 Bacteria 8844
747 Ga0495667_0020287 3300046559 Bacteria 4485
748 Ga0495667_0106426 3300046559 Bacteria 1813
749 Ga0495667_0173540 3300046559 Bacteria 1385
750 Ga0495668_0068142 3300046616 Bacteria 1957
751 Ga0495634_0002801 3300046642 Bacteria 14322
752 Ga0495634_0044277 3300046642 Bacteria 3013
753 Ga0495634_0044727 3300046642 Bacteria 2995
754 Ga0495634_0060641 3300046642 Bacteria 2517
755 Ga0495634_0075739 3300046642 Bacteria 2209
756 Ga0495634_0186380 3300046642 Bacteria 1296
757 Ga0495611_0073528 3300046648 Bacteria 1565
758 Ga0495625_0040578 3300046660 Bacteria 3392
759 Ga0495625_0217043 3300046660 Bacteria 1255
760 Ga0495635_0000088 3300046663 Bacteria 54355
761 Ga0495635_0006280 3300046663 Bacteria 8276
762 Ga0495635_0015324 3300046663 Bacteria 5362
763 Ga0495635_0016162 3300046663 Bacteria 5210
764 Ga0495635_0032791 3300046663 Bacteria 3603
765 Ga0495635_0110742 3300046663 Bacteria 1875
766 Ga0495659_0167096 3300046664 Bacteria 891
767 Ga0495588_0004028 3300046674 Bacteria 6463
768 Ga0495657_0001352 3300046675 Bacteria 21318
769 Ga0495657_0003974 3300046675 Bacteria 11866
770 Ga0495657_0056422 3300046675 Bacteria 2615
771 Ga0495657_0061896 3300046675 Bacteria 2475
772 Ga0495657_0083063 3300046675 Bacteria 2068
773 Ga0495599_0001137 3300046678 Bacteria 15035
774 Ga0495599_0024026 3300046678 Bacteria 3811
775 Ga0495599_0044471 3300046678 Bacteria 2785
776 Ga0495623_0006628 3300046679 Bacteria 7538
777 Ga0495623_0023524 3300046679 Bacteria 3976
778 Ga0495623_0039776 3300046679 Bacteria 3004
779 Ga0495646_0002433 3300046680 Bacteria 11422
780 Ga0495646_0124375 3300046680 Bacteria 1457
781 Ga0495646_0154023 3300046680 Bacteria 1276
782 Ga0495647_0000070 3300046681 Bacteria 24847
783 Ga0495658_0002227 3300046683 Bacteria 9802
784 Ga0495658_0114829 3300046683 Bacteria 1623
785 Ga0495658_0186102 3300046683 Bacteria 1289
786 Ga0495658_0319241 3300046683 Bacteria 984
787 Ga0495613_0004685 3300046689 Bacteria 10263
788 Ga0495613_0019706 3300046689 Bacteria 5027
789 Ga0495613_0023847 3300046689 Bacteria 4559
790 Ga0495613_0357445 3300046689 Bacteria 1002
791 Ga0495624_0000079 3300046690 Bacteria 63196
792 Ga0495624_0084679 3300046690 Bacteria 1959
793 Ga0495589_0155230 3300046794 Bacteria 1092
794 Ga0495600_0000484 3300046809 Bacteria 20528
795 Ga0495600_0000715 3300046809 Bacteria 17456
796 Ga0495600_0006880 3300046809 Bacteria 6935
797 Ga0495581_0000082 3300047315 Bacteria 38294
798 Ga0495581_0012706 3300047315 Bacteria 4876
799 Ga0495581_0029743 3300047315 Bacteria 3166
800 Ga0495604_0001221 3300047317 Bacteria 21092
801 Ga0495604_0002253 3300047317 Bacteria 15447
802 Ga0495604_0076032 3300047317 Bacteria 2527
803 Ga0495604_0199846 3300047317 Bacteria 1387
804 Ga0495636_0066657 3300047318 Bacteria 1531
805 Ga0495674_0001729 3300047319 Bacteria 21443
806 Ga0495674_0023969 3300047319 Bacteria 5614
807 Ga0495674_0028341 3300047319 Bacteria 5108
808 Ga0495674_0029949 3300047319 Bacteria 4952
809 Ga0495674_0312630 3300047319 Bacteria 1281
810 Ga0495672_0010291 3300047320 Bacteria 6682
811 Ga0495672_0108294 3300047320 Bacteria 1495
812 Ga0495676_0016546 3300047321 Bacteria 6540
813 Ga0495676_0043358 3300047321 Bacteria 3683
814 Ga0495680_0004231 3300047322 Bacteria 13778
815 Ga0495680_0006059 3300047322 Bacteria 11303
816 Ga0495680_0029180 3300047322 Bacteria 4518
817 Ga0495683_0021360 3300047323 Bacteria 3336
818 Ga0495687_011038 3300047443 Bacteria 4891
819 Ga0495675_0000977 3300047444 Bacteria 17351
820 Ga0495675_0022872 3300047444 Bacteria 3985
821 Ga0495675_0026026 3300047444 Bacteria 3728
822 Ga0495673_0104984 3300047469 Bacteria 1137
823 Ga0495684_0001326 3300047471 Bacteria 19921
824 Ga0495684_0003018 3300047471 Bacteria 13255
825 Ga0495684_0015114 3300047471 Bacteria 5945
826 Ga0495684_0019004 3300047471 Bacteria 5290
827 Ga0495684_0030487 3300047471 Bacteria 4141
828 Ga0495684_0172823 3300047471 Bacteria 1606
829 Ga0495684_0206334 3300047471 Bacteria 1447
830 Ga0495686_0143564 3300047472 Bacteria 1407
831 Ga0495686_0149809 3300047472 Bacteria 1370
832 Ga0495686_0190187 3300047472 Bacteria 1184
833 Ga0495593_0000206 3300047673 Bacteria 31187
834 Ga0495593_0004711 3300047673 Bacteria 8109
835 Ga0495593_0012582 3300047673 Bacteria 4832
836 Ga0495593_0194861 3300047673 Bacteria 1019
837 Ga0495602_0004704 3300048088 Bacteria 14269
838 Ga0495602_0170231 3300048088 Bacteria 1691
839 Ga0495602_0247217 3300048088 Bacteria 1331
840 Ga0495602_0324010 3300048088 Bacteria 1120
841 Ga0495614_0008940 3300048089 Bacteria 4444
842 Ga0496100_0075447 3300048903 Bacteria 2261
843 Ga0496100_0342022 3300048903 Bacteria 1128
844 Ga0496100_0374086 3300048903 Bacteria 1081
845 Ga0496100_0417555 3300048903 Bacteria 1024
846 Ga0496101_0061473 3300048904 Bacteria 2728
847 Ga0496101_0203599 3300048904 Bacteria 1531
848 Ga0496101_0467368 3300048904 Bacteria 996
849 Ga0496102_0055892 3300048905 Bacteria 3600
850 Ga0496102_0167171 3300048905 Bacteria 2070
851 Ga0496102_0272117 3300048905 Bacteria 1597
852 Ga0496102_0451418 3300048905 Bacteria 1206
853 Ga0496103_0002701 3300048906 Bacteria 11067
854 Ga0496103_0214676 3300048906 Bacteria 1237
855 Ga0496103_0221676 3300048906 Bacteria 1216
856 Ga0496104_0009468 3300048907 Bacteria 8667
857 Ga0496104_0022665 3300048907 Bacteria 5769
858 Ga0496104_0200689 3300048907 Bacteria 1906
859 Ga0496104_0466486 3300048907 Bacteria 1174
860 Ga0496105_0007364 3300048908 Bacteria 8515
861 Ga0496105_0119412 3300048908 Bacteria 2174
862 Ga0496105_0152283 3300048908 Bacteria 1900
863 Ga0496105_0173456 3300048908 Bacteria 1767
864 Ga0496105_0266128 3300048908 Bacteria 1385
865 Ga0496105_0419343 3300048908 Bacteria 1060
866 Ga0496106_0000339 3300048909 Bacteria 32893
867 Ga0496106_0316249 3300048909 Bacteria 1253
868 Ga0496107_0193016 3300048910 Bacteria 1513
869 Ga0496107_0354358 3300048910 Bacteria 1092
870 Ga0496107_0501462 3300048910 Bacteria 900
871 Ga0496108_0010794 3300048911 Bacteria 7414
872 Ga0496108_0079281 3300048911 Bacteria 2780
873 Ga0496108_0164368 3300048911 Bacteria 1919
874 Ga0496108_0366992 3300048911 Bacteria 1257
875 Ga0496109_0007049 3300048912 Bacteria 9483
876 Ga0496109_0190448 3300048912 Bacteria 1927
877 Ga0496110_0013109 3300048913 Bacteria 6842
878 Ga0496110_0120580 3300048913 Bacteria 2362
879 Ga0496110_0164573 3300048913 Bacteria 2011
880 Ga0496110_0558381 3300048913 Bacteria 1040
881 Ga0496111_0047598 3300048914 Bacteria 3088
882 Ga0496111_0058993 3300048914 Bacteria 2780
883 Ga0496111_0365830 3300048914 Bacteria 1067
884 Ga0496111_0503050 3300048914 Bacteria 892
885 Ga0496112_0000016 3300048915 Bacteria 194634
886 Ga0496112_0011247 3300048915 Bacteria 8163
887 Ga0496112_0025092 3300048915 Bacteria 5720
888 Ga0496112_0241370 3300048915 Bacteria 1759
889 Ga0496113_0007542 3300048916 Bacteria 7013
890 Ga0496114_0333288 3300048917 Bacteria 1341
891 Ga0496115_0001214 3300048918 Bacteria 18485
892 Ga0496115_0170716 3300048918 Bacteria 1799
893 Ga0496115_0302491 3300048918 Bacteria 1310
894 Ga0496115_0344924 3300048918 Bacteria 1215
895 Ga0496116_0000887 3300048919 Bacteria 37313
896 Ga0496116_0178804 3300048919 Bacteria 1139
897 Ga0496117_0017537 3300048920 Bacteria 5975
898 Ga0496117_0032645 3300048920 Bacteria 3952
899 Ga0496117_0034591 3300048920 Bacteria 3805
900 Ga0496117_0116132 3300048920 Bacteria 1655
901 Ga0496118_0002852 3300048921 Bacteria 22557
902 Ga0496118_0018021 3300048921 Bacteria 6394
903 Ga0496118_0020586 3300048921 Bacteria 5844
904 Ga0496118_0026254 3300048921 Bacteria 4969
905 Ga0496118_0040800 3300048921 Bacteria 3685
906 Ga0496118_0088933 3300048921 Bacteria 2134
907 Ga0496119_0035460 3300048922 Bacteria 3268
908 Ga0496119_0087671 3300048922 Bacteria 1776
909 Ga0496120_0081167 3300048923 Bacteria 1755
910 Ga0496120_0175464 3300048923 Bacteria 1057
911 Ga0496120_0218288 3300048923 Bacteria 913
912 Ga0496121_0000041 3300048924 Bacteria 346686
913 Ga0496121_0002334 3300048924 Bacteria 29308
914 Ga0496121_0017977 3300048924 Bacteria 7166
915 Ga0496121_0029418 3300048924 Bacteria 5079
916 Ga0496121_0034794 3300048924 Bacteria 4527
917 Ga0496121_0074310 3300048924 Bacteria 2720
918 Ga0496121_0082833 3300048924 Bacteria 2534
919 Ga0496121_0149206 3300048924 Bacteria 1723
920 Ga0496121_0179531 3300048924 Bacteria 1529
921 Ga0496121_0180778 3300048924 Bacteria 1522
922 Ga0496121_0204272 3300048924 Bacteria 1405
923 Ga0496121_0237516 3300048924 Bacteria 1272
924 Ga0496122_0077657 3300048925 Bacteria 2330
925 Ga0496123_0090210 3300048926 Bacteria 1823
926 Ga0496123_0155646 3300048926 Bacteria 1226
927 Ga0496124_0003141 3300048927 Bacteria 20452
928 Ga0496124_0097583 3300048927 Bacteria 2386
929 Ga0496124_0126991 3300048927 Bacteria 2030
930 Ga0496124_0145296 3300048927 Bacteria 1867
931 Ga0496124_0168241 3300048927 Bacteria 1701
932 Ga0496124_0206326 3300048927 Bacteria 1490
933 Ga0496125_0016125 3300048928 Bacteria 7189
934 Ga0496125_0029890 3300048928 Bacteria 4885
935 Ga0496125_0036649 3300048928 Bacteria 4277
936 Ga0496125_0057028 3300048928 Bacteria 3167
937 Ga0496125_0069446 3300048928 Bacteria 2765
938 Ga0496125_0194159 3300048928 Bacteria 1337
939 Ga0496126_0002727 3300048929 Bacteria 23333
940 Ga0496126_0017256 3300048929 Bacteria 7193
941 Ga0496126_0060274 3300048929 Bacteria 3414
942 Ga0496126_0063564 3300048929 Bacteria 3309
943 Ga0496126_0107255 3300048929 Bacteria 2436
944 Ga0496126_0242967 3300048929 Bacteria 1503
945 Ga0496126_0251185 3300048929 Bacteria 1474
946 Ga0496126_0331880 3300048929 Bacteria 1248
947 Ga0496126_0514171 3300048929 Bacteria 955
948 Ga0495682_0046724 3300049460 Bacteria 1580
949 Ga0501031_0034444 3300049568 Bacteria 3305
950 Ga0501031_0152892 3300049568 Bacteria 1508
951 Ga0501032_0080492 3300049569 Bacteria 2167
952 Ga0501032_0140621 3300049569 Bacteria 1589
953 Ga0501033_0104929 3300049570 Bacteria 2060
954 Ga0501034_0184480 3300049571 Bacteria 2050
955 Ga0501034_0202175 3300049571 Bacteria 1944
956 Ga0501034_0433259 3300049571 Bacteria 1234
957 Ga0501036_0152596 3300049572 Bacteria 1948
958 Ga0501037_0005109 3300049573 Bacteria 9545
959 Ga0501037_0173165 3300049573 Bacteria 1533
960 Ga0501037_0302011 3300049573 Bacteria 1111
961 Ga0501037_0486132 3300049573 Bacteria 839
962 Ga0501038_0002061 3300049574 Bacteria 18607
963 Ga0501038_0020851 3300049574 Bacteria 5890
964 Ga0501038_0036755 3300049574 Bacteria 4298
965 Ga0501038_0162834 3300049574 Bacteria 1811
966 Ga0501038_0184975 3300049574 Bacteria 1679
967 Ga0501039_0020658 3300049575 Bacteria 5046
968 Ga0501039_0059349 3300049575 Bacteria 2963
969 Ga0501039_0127742 3300049575 Bacteria 1994
970 Ga0501039_0560725 3300049575 Bacteria 896
971 Ga0501041_0049716 3300049577 Bacteria 2554
972 Ga0501043_0023413 3300049579 Bacteria 4844
973 Ga0501043_0111313 3300049579 Bacteria 2150
974 Ga0501046_0390270 3300049580 Bacteria 1006
975 Ga0501047_0015793 3300049581 Bacteria 7197
976 Ga0501047_0016756 3300049581 Bacteria 7001
977 Ga0501067_0000194 3300049583 Bacteria 34364
978 Ga0501067_0018127 3300049583 Bacteria 3899
979 Ga0501067_0312561 3300049583 Bacteria 875
980 Ga0501070_0033613 3300049586 Bacteria 4292
981 Ga0501073_0100745 3300049589 Bacteria 2006
982 Ga0501080_0012678 3300049742 Bacteria 7730
983 Ga0501080_0543280 3300049742 Bacteria 1035
984 Ga0501035_0059083 3300049822 Bacteria 3415
985 Ga0501044_0006258 3300049823 Bacteria 13161
986 Ga0501044_0066876 3300049823 Bacteria 3663
987 Ga0501044_0563141 3300049823 Bacteria 1036
988 nmdc:mga03n38_146363_c1 3300050490 Bacteria 1185
989 nmdc:mga03n38_64791_c1 3300050490 Bacteria 1674
990 nmdc:mga03n38_67077_c1 3300050490 Bacteria 1650
991 nmdc:mga00v17_3731_c1 3300050491 Bacteria 7336
992 nmdc:mga00v17_66331_c1 3300050491 Bacteria 2228
993 nmdc:mga00v17_68828_c1 3300050491 Bacteria 2189
994 nmdc:mga0yw44_11489_c1 3300050492 Bacteria 4575
995 nmdc:mga0yw44_11693_c1 3300050492 Bacteria 4545
996 nmdc:mga0yw44_125880_c1 3300050492 Bacteria 1655
997 nmdc:mga0yw44_206771_c1 3300050492 Bacteria 1298
998 nmdc:mga0yw44_282108_c1 3300050492 Bacteria 1110
999 nmdc:mga0yw44_41175_c1 3300050492 Bacteria 2749
1000 nmdc:mga0yw44_73938_c1 3300050492 Bacteria 2122
1001 nmdc:mga0k408_165095_c1 3300050493 Bacteria 1319
1002 nmdc:mga0k408_301811_c1 3300050493 Bacteria 956
1003 nmdc:mga0k408_82041_c1 3300050493 Bacteria 1889
1004 nmdc:mga06z11_45243_c1 3300050494 Bacteria 2225
1005 nmdc:mga06z11_89707_c1 3300050494 Bacteria 1667
1006 nmdc:mga07m45_18789_c2 3300050496 Bacteria 3344
1007 nmdc:mga07m45_237757_c1 3300050496 Bacteria 1060
1008 nmdc:mga07m45_32758_c1 3300050496 Bacteria 2883
1009 nmdc:mga09592_377795_c1 3300050508 Bacteria 1225
1010 nmdc:mga08y16_497623_c1 3300050511 Bacteria 1239
1011 nmdc:mga0n895_358038_c1 3300050512 Bacteria 1478
1012 nmdc:mga0sz30_16917_c1 3300050516 Bacteria 2902
1013 nmdc:mga0sz30_34331_c1 3300050516 Bacteria 2111
1014 nmdc:mga0sz30_43025_c1 3300050516 Bacteria 1901
1015 nmdc:mga0sz30_90865_c1 3300050516 Bacteria 1328
1016 nmdc:mga0sz30_92464_c1 3300050516 Bacteria 1317
1017 Ga0495601_0083860 3300053077 Bacteria 2047
1018 Ga0495601_0164530 3300053077 Bacteria 1450
1019 Ga0495601_0223726 3300053077 Bacteria 1229
1020 Ga0495601_0336318 3300053077 Bacteria 982
1021 Ga0495612_0032764 3300053078 Bacteria 2100
1022 Ga0500635_0004194 3300053080 Bacteria 3693
1023 Ga0495595_0000480 3300053084 Bacteria 15215
1024 Ga0495595_0150001 3300053084 Bacteria 1147
1025 Ga0495619_0000332 3300053085 Bacteria 33066
1026 Ga0495619_0046663 3300053085 Bacteria 2849
1027 Ga0495619_0093865 3300053085 Bacteria 2034
1028 Ga0495619_0172647 3300053085 Bacteria 1495
1029 Ga0500643_000019 3300053087 Bacteria 294301
1030 Ga0500647_0028200 3300053091 Bacteria 2656
1031 Ga0500651_0018718 3300053093 Bacteria 4290
1032 Ga0500566_0000537 3300053094 Bacteria 21255
1033 Ga0500566_0000554 3300053094 Bacteria 20984
1034 Ga0500566_0000601 3300053094 Bacteria 20208
1035 Ga0500640_001185 3300053095 Bacteria 7640
1036 Ga0500641_0024233 3300053096 Bacteria 2338
1037 Ga0500648_056006 3300053097 Bacteria 2236
1038 Ga0500650_0129240 3300053098 Bacteria 1175
1039 Ga0500555_002869 3300053103 Bacteria 4941
1040 Ga0500556_0057130 3300053104 Bacteria 1427
1041 Ga0500556_0109430 3300053104 Bacteria 1070
1042 Ga0500557_000090 3300053105 Bacteria 31022
1043 Ga0500569_122819 3300053109 Bacteria 865
1044 Ga0500572_002533 3300053111 Bacteria 4365
1045 Ga0500572_003911 3300053111 Bacteria 3387
1046 Ga0500595_000286 3300053119 Bacteria 33353
1047 Ga0500595_000540 3300053119 Bacteria 22705
1048 Ga0500595_020891 3300053119 Bacteria 2346
1049 Ga0500595_025025 3300053119 Bacteria 2076
1050 Ga0500595_029581 3300053119 Bacteria 1857
1051 Ga0500595_034020 3300053119 Bacteria 1688
1052 Ga0500595_076656 3300053119 Bacteria 984
1053 Ga0500607_011476 3300053121 Bacteria 5240
1054 Ga0500608_003545 3300053122 Bacteria 5873
1055 Ga0500608_082372 3300053122 Bacteria 1516
1056 Ga0500614_001061 3300053123 Bacteria 6833
1057 Ga0500642_0000063 3300053130 Bacteria 58680
1058 Ga0500658_0108623 3300053134 Bacteria 1219
1059 Ga0500559_0000521 3300053136 Bacteria 27007
1060 Ga0500559_0000985 3300053136 Bacteria 17756
1061 Ga0500559_0012812 3300053136 Bacteria 3558
1062 Ga0500559_0014002 3300053136 Bacteria 3390
1063 Ga0500568_0006442 3300053139 Bacteria 5890
1064 Ga0500616_0026754 3300053153 Bacteria 3190
1065 Ga0500622_0009099 3300053156 Bacteria 5515
1066 Ga0500630_006610 3300053159 Bacteria 5683
1067 Ga0500633_0013201 3300053160 Bacteria 2307
1068 Ga0500638_000725 3300053162 Bacteria 8877
1069 Ga0500638_073483 3300053162 Bacteria 1632
1070 Ga0500639_000166 3300053163 Bacteria 32001
1071 Ga0500639_041883 3300053163 Bacteria 2406
1072 Ga0500636_0000076 3300053177 Bacteria 48321
1073 Ga0500636_0004010 3300053177 Bacteria 8301
1074 Ga0500636_0049444 3300053177 Bacteria 2474
1075 Ga0500636_0050783 3300053177 Bacteria 2439
1076 Ga0500636_0090924 3300053177 Bacteria 1747
1077 Ga0500636_0126137 3300053177 Bacteria 1431
1078 Ga0500637_0000135 3300053178 Bacteria 27083
1079 Ga0500637_0047678 3300053178 Bacteria 2435
1080 Ga0500637_0061006 3300053178 Bacteria 2159
1081 Ga0500576_070075 3300053725 Bacteria 1509
1082 Ga0500645_013736 3300053730 Bacteria 2593
1083 Ga0500645_038405 3300053730 Bacteria 1421
1084 Ga0500609_009693 3300053731 Bacteria 1297
1085 Ga0500552_002169 3300053733 Bacteria 1895
1086 Ga0500596_000426 3300053735 Bacteria 7768
1087 Ga0500596_000771 3300053735 Bacteria 6316
1088 Ga0500601_000939 3300053737 Bacteria 3456
1089 Ga0500661_003826 3300055283 Bacteria 2827
1090 Ga0500661_008194 3300055283 Bacteria 1922
1091 Ga0530510_0124412 3300061734 Bacteria 1895
1092 2507510021 2507262055 Bacteria 8048963
1093 2508544023 2508501009 Bacteria 7784016
1094 2509147570 2508501128 Bacteria 8613869
1095 2513628182 2513237092 Bacteria 8341956
1096 2513643551 2513237094 Bacteria 8789602
1097 2513660097 2513237096 Bacteria 8722461
1098 2513676415 2513237098 Bacteria 9902361
1099 2513696918 2513237101 Bacteria 7952346
1100 2513720534 2513237104 Bacteria 10034502
1101 2513858274 2513237137 Bacteria 9558895
1102 2513878129 2513237139 Bacteria 8737671
1103 2513893312 2513237141 Bacteria 8496279
1104 2513922093 2513237145 Bacteria 8979722
1105 2514012575 2513237161 Bacteria 8871253
1106 2515629474 2515154112 Bacteria 8294334
1107 2517107516 2517093001 Bacteria 9002274
1108 2517893837 2517572143 Bacteria 9484767
1109 2524439047 2524023205 Bacteria 8918781
1110 2524469456 2524023210 Bacteria 9029266
1111 2524537790 2524023228 Bacteria 10118060
1112 2528849594 2528768022 Bacteria 10457665
1113 2603861061 2602042107 Bacteria 6226103
1114 2617353085 2617270735 Bacteria 9163226
1115 2617378944 2617270741 Bacteria 8201522
1116 2644287827 2643221651 Bacteria 4798932
1117 2671122833 2667528175 Bacteria 7532676
1118 2723846368 2721755755 Bacteria 8322773
1119 2728747955 2728368998 Bacteria 8720350
1120 2745078840 2744054633 Bacteria 8678936
1121 2793060000 2791355196 Bacteria 7323613
1122 2793072527 2791355197 Bacteria 8420563
1123 2793081165
1124 2805920090 2802429603 Bacteria 8777136
1125 2818241583 2816332527 Bacteria 8933356
1126 2824605613 2824600985 Bacteria 8488197
1127 2824609863 2824609381 Bacteria 8672835
1128 2824625351 2824617872 Bacteria 8814715
1129 2824633838 2824626560 Bacteria 8813858
1130 2824641558 2824635225 Bacteria 8785348
1131 2824649783 2824644064 Bacteria 8743947
1132 2824655738 2824653114 Bacteria 8493680
1133 2824669447 2824661429 Bacteria 9877870
1134 2824674195 2824671348 Bacteria 8369588
1135 2824686183 2824679649 Bacteria 8248951
1136 2824693025 2824687955 Bacteria 8360029
1137 2824698908 2824696289 Bacteria 8335049
1138 2824711487 2824704595 Bacteria 9667483
1139 2824720960 2824714736 Bacteria 8717648
1140 2824729003 2824723954 Bacteria 8758240
1141 2824758038 2824753945 Bacteria 9787441
1142 2824766176 2824763712 Bacteria 9792355
1143 2824781059 2824773399 Bacteria 8360218
1144 2838127538 2838122688 Bacteria 8803140
1145 2841941509 2841941048 Bacteria 8688029
1146 2841952477 2841949485 Bacteria 8680857
1147 2841959498 2841957949 Bacteria 8652217
1148 2841967652 2841966195 Bacteria 8673214
1149 2841982181 2841974524 Bacteria 8931498
1150 2841986499 2841983080 Bacteria 8395090
1151 2842038264 2842038055 Bacteria 8002051
1152 2842048791 2842045827 Bacteria 8006841
1153 2844317744 2844315083 Bacteria 8138177
1154 2847934533 2847930680 Bacteria 9342022
1155 2847945140 2847939898 Bacteria 8606328
1156 2849080679 2849076700 Bacteria 7039503
1157 2857509959 2857509624 Bacteria 7472071
1158 2874596767 2874590934 Bacteria 8299676
1159 2874610667 2874604998 Bacteria 7834745
1160 2874618231 2874612657 Bacteria 8252029
1161 2874623220 2874620515 Bacteria 8290088
1162 2874636032 2874628541 Bacteria 8630250
1163 2874653003 2874645413 Bacteria 8214782
1164 2876766684 2876761206 Bacteria 10111113
1165 2876776937 2876771140 Bacteria 8287509
1166 2876825313 2876818435 Bacteria 8274608
1167 2879081074 2879074833 Bacteria 8279565
1168 2879089724 2879083081 Bacteria 8587928
1169 2879107738 2879099564 Bacteria 10442239
1170 2879118737 2879110137 Bacteria 8907982
1171 2879130812 2879127579 Bacteria 8294491
1172 2879147598 2879142872 Bacteria 8267021
1173 2881365667 2881364244 Bacteria 7710352
1174 2881671730 2881665667 Bacteria 8175609
1175 2885368942 2885366525 Bacteria 8326213
1176 2885382515 2885374607 Bacteria 8927485
1177 2885387435 2885383462 Bacteria 9473874
1178 2885414469 2885409591 Bacteria 9235467
1179 2888388219 2888388044 Bacteria 7304136
1180 2888423050 2888419890 Bacteria 7857137
1181 2889039128 2889033259 Bacteria 9099371
1182 2893069006 2893066018 Bacteria 6158120
1183 2903735423 2903727486 Bacteria 8281579
1184 2903751850 2903748898 Bacteria 9972761
1185 2903777406 2903768456 Bacteria 9749579
1186 2904670040 2904666416 Bacteria 8226587
1187 2904691612 2904690495 Bacteria 9412302
1188 2904705115
1189 2904718472 2904711408 Bacteria 9771557
1190 2906608658 2906602504 Bacteria 8295279
1191 2906610720
1192 2906633554 2906626472 Bacteria 8826946
1193 2906635882 2906635258 Bacteria 8601019
1194 2906649927 2906643746 Bacteria 8722424
1195 2906664022 2906660503 Bacteria 8595048
1196 2908744239 2908739725 Bacteria 8628932
1197 2908761855 2908756301 Bacteria 8864324
1198 2922362182 2922361189 Bacteria 7436256
1199 2922375496
1200 2922388067 2922386360 Bacteria 7017218
1201 2922394991 2922393267 Bacteria 8285685
1202 2922428598
1203 2929616231 2929615660 Bacteria 9193770
1204 2929624975 2929624759 Bacteria 9339455
1205 2932787102 2932784394 Bacteria 9704911
1206 2932797329 2932794094 Bacteria 7915132
1207 2932804786 2932801729 Bacteria 7987968
1208 2932811297 2932809354 Bacteria 9135765
1209 2932819830 2932818245 Bacteria 9955613
1210 2932832308 2932828146 Bacteria 9745859
1211 2933578485 2933577622 Bacteria 9116884
1212 2935611074 2935608549 Bacteria 8203142
1213 2935619018 2935616580 Bacteria 9032984
1214 2935634575 2935630451 Bacteria 8169952
1215 2935643165 2935638405 Bacteria 10015038
1216 2935648511 2935648319 Bacteria 8801166
1217 2935657501 2935656913 Bacteria 8965014
1218 2935669791 2935665750 Bacteria 9571747
1219 2935677069 2935675223 Bacteria 9928132
1220 2935695401 2935694250 Bacteria 9291695
1221 2935709490 2935703347 Bacteria 10242284
1222 2935719716 2935713505 Bacteria 9608509
1223 2935729517 2935722832 Bacteria 9608746
1224 2935739599 2935732158 Bacteria 9706831
1225 2935748637 2935741537 Bacteria 9707219
1226 2935756776 2935750917 Bacteria 9590372
1227 2935761236 2935760218 Bacteria 9817913
1228 2935771489 2935769743 Bacteria 7878163
1229 2935779178 2935777560 Bacteria 8077691
1230 2935790853 2935785616 Bacteria 7962367
1231 2935799206 2935793552 Bacteria 8012592
1232 2935807309 2935801545 Bacteria 9301974
1233 2935812448 2935810662 Bacteria 9401221
1234 2935820559 2935819856 Bacteria 8261050
1235 2935832691 2935827899 Bacteria 10038562
1236 2935839230 2935837841 Bacteria 9454360
1237 2935849432 2935847175 Bacteria 8228321
1238 2935857383 2935855204 Bacteria 9035059
1239 2935864912 2935864058 Bacteria 9784707
1240 2935876690 2935873716 Bacteria 9632195
1241 2935884978 2935883170 Bacteria 7964738
1242 2935911794 2935908558 Bacteria 8568796
1243 2935919449 2935916978 Bacteria 9113783
1244 2935928823 2935926038 Bacteria 8601059
1245 2935938468 2935934488 Bacteria 8602579
1246 2935945640 2935942939 Bacteria 8599779
1247 2935954753 2935951376 Bacteria 8602333
1248 2935963352 2935959822 Bacteria 7869783
1249 2935970640 2935967501 Bacteria 8603075
1250 2935979123 2935975950 Bacteria 8347125
1251 2935987867 2935984226 Bacteria 8302647
1252 2935998959 2935992306 Bacteria 9802711
1253 2936008283 2936002035 Bacteria 9362176
1254 2936011421 2936011229 Bacteria 8801034
1255 2936020016 2936019824 Bacteria 8804134
1256 2936028612 2936028420 Bacteria 8965941
1257 2936039041 2936037263 Bacteria 9446081
1258 2936046739 2936046547 Bacteria 8903709
1259 2936058386 2936055302 Bacteria 8785755
1260 2940562690 2940556831 Bacteria 9590747
1261 2941509061 2941507105 Bacteria 8166816
1262 2941516890 2941515067 Bacteria 8166720
1263 2941525015 2941523033 Bacteria 8169134
1264 2941536382 2941531003 Bacteria 7653939
1265 2941539920 2941538514 Bacteria 9402094
1266 3005478728 3005474847 Bacteria 9259049
1267 3005487942 3005483717 Bacteria 7877331
1268 3005508736 3005506211 Bacteria 6943378
1269 3005589450 3005587118 Bacteria 7794411
1270 3005597478 3005594810 Bacteria 8716512
1271 3005713508 3005710791 Bacteria 7622528
1272 3005720914 3005718088 Bacteria 8283608
1273 8006930239 8006926726 Bacteria 6749210
1274 8006942616 8006933436 Bacteria 10410654
1275 8006964747 8006964411 Bacteria 8966052
1276 8006982344 8006973647 Bacteria 10679141
1277 8006991882 8006984368 Bacteria 9651211
1278 8006995484 8006994254 Bacteria 8309700
1279 8016515104 8016511872 Bacteria 9921665
1280 8016522893 8016522445 Bacteria 8156687
1281 8016540630 8016539877 Bacteria 8155419
1282 8016552613 8016548790 Bacteria 8155074
1283 8016560992 8016557553 Bacteria 8154380
1284 8016574715 8016566248 Bacteria 8158151
1285 8016578790 8016575299 Bacteria 8154085
1286 8016590857 8016583857 Bacteria 10421953
1287 8016598855 8016595262 Bacteria 8149947
1288 8016612222 8016603502 Bacteria 8731218
1289 8016621581 8016613128 Bacteria 8794220
1290 8016628377 8016622563 Bacteria 7999408
1291 8016632575 8016630954 Bacteria 9217207
1292 8017061349 8017057580 Bacteria 10023680
1293 8019536074 8019530166 Bacteria 8155624
1294 8019543396 8019538911 Bacteria 7872763
1295 8019555458 8019547302 Bacteria 7996444
1296 8019558390 8019555841 Bacteria 9642137
1297 8019566906 8019565922 Bacteria 9639779
1298 8019580820 8019576017 Bacteria 10049540
1299 8019588557 8019586578 Bacteria 10212056
1300 8019602780 8019597564 Bacteria 10041141
1301 8019626518 8019619141 Bacteria 9218857
1302 8019635970 8019629233 Bacteria 8687553
1303 8019643694 8019638758 Bacteria 9062356
1304 8019656475 8019648815 Bacteria 10014479
1305 8019663738 8019659431 Bacteria 8577854
1306 8019673369 8019668869 Bacteria 8791617
1307 8019682758 8019678201 Bacteria 8863603
1308 8019688446 8019687851 Bacteria 8712826
1309 8055747878 8055742211 Bacteria 9226248
1310 8056687972 8056681323 Bacteria 8472857
1311 8056695904 8056689827 Bacteria 6712655
1312 8056969543 8056967851 Bacteria 9038162
1313 Ga0373946_0093406
1314 JGI24740J21852_10003304
1315 JGI24737J22298_10025634
1316 JGI24735J21928_10092333
1317 JGI25406J46586_10000101
1318 JGI25406J46586_10002540
1319 JGI25153J46596_10000920
1320 JGI25153J46596_10001125
1321 JGI25153J46596_10002262
1322 JGI25153J46596_10068834
1323 JGI25160J50197_1000504
1324 JGI25160J50197_1014144
1325 JGI25404J52841_10002538
1326 JGI25404J52841_10030577
1327 Ga0055531_10013451
1328 Ga0055543_1004165
1329 Ga0065165_1000278
1330 Ga0065165_1002349
1331 Ga0065165_1010257
1332 Ga0070658_10016558
1333 Ga0070658_10346108
1334 Ga0070676_10426997
1335 Ga0070677_10207238
1336 Ga0068869_100208541
1337 Ga0068869_100278067
1338 Ga0070666_10196433
1339 Ga0070680_100010020
1340 Ga0070680_100063416
1341 Ga0070680_100120406
1342 Ga0070680_100139204
1343 Ga0070680_100145706
1344 Ga0070680_100149993
1345 Ga0070682_100115283
1346 Ga0070682_100219209
1347 Ga0068868_100007309
1348 Ga0068868_100298072
1349 Ga0070660_100010789
1350 Ga0070661_100051599
1351 Ga0070661_100150550
1352 Ga0070692_10234681
1353 Ga0070668_100084053
1354 Ga0070668_100206163
1355 Ga0070668_100456393
1356 Ga0070669_100598264
1357 Ga0070671_100140224
1358 Ga0070671_100371400
1359 Ga0070671_100734254
1360 Ga0070674_100033463
1361 Ga0070674_100189648
1362 Ga0070673_100783117
1363 Ga0070659_100211116
1364 Ga0070659_100376179
1365 Ga0070667_100111593
1366 Ga0070703_10097965
1367 Ga0070709_10027043
1368 Ga0070709_10127581
1369 Ga0070709_10150700
1370 Ga0070714_100026363
1371 Ga0070714_100029873
1372 Ga0070714_100067379
1373 Ga0070714_100068810
1374 Ga0070714_100133927
1375 Ga0070714_100206316
1376 Ga0070714_100241907
1377 Ga0070714_100294968
1378 Ga0070713_100011005
1379 Ga0070713_100046773
1380 Ga0070713_100078015
1381 Ga0070713_100117812
1382 Ga0070713_100227044
1383 Ga0070713_100497733
1384 Ga0070710_10002809
1385 Ga0070710_10018760
1386 Ga0070710_10086023
1387 Ga0070711_100010148
1388 Ga0070711_100026294
1389 Ga0070711_100079282
1390 Ga0070711_100146439
1391 Ga0070663_100034529
1392 Ga0070663_100064499
1393 Ga0070663_100209802
1394 Ga0070678_100258776
1395 Ga0070678_100480983
1396 Ga0070662_100367559
1397 Ga0070662_100572248
1398 Ga0070681_10014211
1399 Ga0070681_10028493
1400 Ga0070681_10093653
1401 Ga0070681_10142887
1402 Ga0068867_100275095
1403 Ga0070707_100021591
1404 Ga0070707_100415373
1405 Ga0070698_100047165
1406 Ga0070698_100548312
1407 Ga0070699_100117287
1408 Ga0070679_100022437
1409 Ga0070679_100026077
1410 Ga0070679_100036844
1411 Ga0070679_100155995
1412 Ga0070679_100203887
1413 Ga0070679_100334595
1414 Ga0070684_100010644
1415 Ga0070684_100061181
1416 Ga0070697_100044646
1417 Ga0070697_100339034
1418 Ga0068853_100012285
1419 Ga0068853_100072867
1420 Ga0068853_100187564
1421 Ga0068853_100529269
1422 Ga0068853_100581532
1423 Ga0068853_100612287
1424 Ga0068853_100660178
1425 Ga0070693_100463636
1426 Ga0070665_100013102
1427 Ga0070665_100024103
1428 Ga0070665_100148036
1429 Ga0070665_100491339
1430 Ga0070665_100569456
1431 Ga0068855_100010086
1432 Ga0068855_100036244
1433 Ga0068855_100047278
1434 Ga0068855_100118622
1435 Ga0068855_100132169
1436 Ga0068855_100451627
1437 Ga0070664_100237681
1438 Ga0068857_100010033
1439 Ga0068857_100022544
1440 Ga0068857_100126674
1441 Ga0068854_100003033
1442 Ga0068854_100019460
1443 Ga0068854_100195077
1444 Ga0068854_100450737
1445 Ga0068856_100070767
1446 Ga0068856_100105344
1447 Ga0068856_100283437
1448 Ga0068856_100403416
1449 Ga0068856_100404988
1450 Ga0068856_100442980
1451 Ga0068856_100709376
1452 Ga0068852_100027381
1453 Ga0068852_100030886
1454 Ga0068852_100056917
1455 Ga0068852_100324728
1456 Ga0068852_100378208
1457 Ga0068852_100787386
1458 Ga0068859_100275287
1459 Ga0068859_100394884
1460 Ga0068859_100943234
1461 Ga0068864_100071864
1462 Ga0068864_100161691
1463 Ga0068864_100839222
1464 Ga0068851_10008597
1465 Ga0068851_10096112
1466 Ga0068851_10123672
1467 Ga0068851_10136836
1468 Ga0068863_100209522
1469 Ga0068858_100142967
1470 Ga0068858_100244348
1471 Ga0068858_100293844
1472 Ga0068862_100253094
1473 Ga0068862_100500627
1474 Ga0081455_10002972
1475 Ga0081455_10021663
1476 Ga0081455_10031781
1477 Ga0081455_10221033
1478 Ga0081538_10050307
1479 Ga0081540_1001242
1480 Ga0081540_1003729
1481 Ga0081540_1004658
1482 Ga0081540_1009086
1483 Ga0081540_1011415
1484 Ga0081540_1032112
1485 Ga0081540_1079305
1486 Ga0081539_10000008
1487 Ga0081539_10007751
1488 Ga0081539_10043237
1489 Ga0081539_10094697
1490 Ga0070717_10012564
1491 Ga0070717_10019407
1492 Ga0070717_10122998
1493 Ga0070717_10517194
1494 Ga0075365_10000993
1495 Ga0075365_10004283
1496 Ga0075365_10007056
1497 Ga0075365_10043659
1498 Ga0075365_10046896
1499 Ga0075365_10068065
1500 Ga0075365_10137422
1501 Ga0075365_10185794
1502 Ga0075368_10003136
1503 Ga0075368_10007174
1504 Ga0075363_100001650
1505 Ga0075363_100043364
1506 Ga0075363_100104311
1507 Ga0075363_100163791
1508 Ga0075363_100172707
1509 Ga0075364_10045002
1510 Ga0075364_10048434
1511 Ga0075364_10054632
1512 Ga0075364_10077696
1513 Ga0070716_100011343
1514 Ga0070716_100031431
1515 Ga0070712_100018443
1516 Ga0070712_100032286
1517 Ga0070712_100154089
1518 Ga0070712_100400401
1519 Ga0070712_100579238
1520 Ga0075362_10052926
1521 Ga0075362_10150429
1522 Ga0075367_10018402
1523 Ga0075367_10048788
1524 Ga0075369_10019487
1525 Ga0075369_10035065
1526 Ga0075369_10042387
1527 Ga0075369_10056550
1528 Ga0075369_10074744
1529 Ga0075366_10018104
1530 Ga0075366_10213882
1531 Ga0075366_10237425
1532 Ga0075366_10301998
1533 Ga0097621_100490521
1534 Ga0075370_10030260
1535 Ga0075370_10131503
1536 Ga0075370_10155959
1537 Ga0075370_10163292
1538 Ga0075428_100218508
1539 Ga0075434_100712958
1540 Ga0097620_100275272
1541 Ga0097620_100394909
1542 Ga0097620_100943218
1543 Ga0099825_1024340
1544 Ga0099825_1032271
1545 Ga0099824_1017617
1546 Ga0099824_1020569
1547 Ga0099822_1002963
1548 Ga0099822_1056819
1549 Ga0099823_1027325
1550 Ga0099795_10155846
1551 Ga0105240_10010891
1552 Ga0105240_10096056
1553 Ga0105240_10106508
1554 Ga0105240_10170514
1555 Ga0105240_10285146
1556 Ga0111539_10239229
1557 Ga0105245_10012748
1558 Ga0105247_10017329
1559 Ga0114129_10029906
1560 Ga0105243_10048108
1561 Ga0105241_10000872
1562 Ga0105241_10096562
1563 Ga0105242_10247940
1564 Ga0105248_10095487
1565 Ga0105248_10363872
1566 Ga0105237_10001564
1567 Ga0105237_10003312
1568 Ga0105237_10012234
1569 Ga0105237_10180959
1570 Ga0105237_10350806
1571 Ga0105237_10366559
1572 Ga0105237_10539736
1573 Ga0105238_10003952
1574 Ga0105238_10032844
1575 Ga0105238_10048562
1576 Ga0105238_10259677
1577 Ga0105249_10093461
1578 Ga0105239_10023669
1579 Ga0105239_10030698
1580 Ga0105239_10074080
1581 Ga0105239_10102926
1582 Ga0105239_10349578
1583 Ga0105239_10475918
1584 Ga0105239_10485725
1585 Ga0105239_10976221
1586 Ga0105246_10010537
1587 Ga0157373_10147701
1588 Ga0157371_10030194
1589 Ga0157370_10058101
1590 Ga0157370_10124966
1591 Ga0157369_10033485
1592 Ga0157369_10052550
1593 Ga0157369_10069916
1594 Ga0157369_11030631
1595 Ga0157374_10106318
1596 Ga0157374_10973065
1597 Ga0157374_11002873
1598 Ga0157378_10931581
1599 Ga0163162_10015868
1600 Ga0163162_10216906
1601 Ga0163162_10752189
1602 Ga0157372_10574109
1603 Ga0157375_10315060
1604 Ga0157375_10650541
1605 Ga0163163_10017661
1606 Ga0163163_10038191
1607 Ga0163163_10153121
1608 Ga0163163_10390407
1609 Ga0163163_10417349
1610 Ga0157379_10283781
1611 Ga0157376_10048343
1612 Ga0157376_10743673
1613 Ga0214544_1000020
1614 Ga0214542_1000024
1615 Ga0214545_1000011
1616 Ga0214543_1000033
1617 Ga0213874_10044299
1618 Ga0213876_10006667
1619 Ga0213876_10078625
1620 Ga0213875_10101900
1621 Ga0213875_10108817
1622 Ga0213871_10008517
1623 Ga0209563_103359
1624 Ga0209677_100890
1625 Ga0209677_105274
1626 Ga0209148_1000574
1627 Ga0209148_1007369
1628 Ga0209233_1001934
1629 Ga0209233_1004212
1630 Ga0209233_1010224
1631 Ga0209455_1000834
1632 Ga0209455_1008239
1633 Ga0209564_1023458
1634 Ga0209564_1038617
1635 Ga0209758_1000065
1636 Ga0209758_1000498
1637 Ga0209758_1000560
1638 Ga0209758_1002030
1639 Ga0209758_1015655
1640 Ga0209758_1027726
1641 Ga0209758_1057022
1642 Ga0209256_1011226
1643 Ga0209256_1024358
1644 Ga0207426_1000721
1645 Ga0207426_1000728
1646 Ga0207426_1002233
1647 Ga0207426_1015834
1648 Ga0209051_1035572
1649 Ga0209257_1001031
1650 Ga0209257_1035165
1651 Ga0207656_10063036
1652 Ga0207656_10099051
1653 Ga0207656_10176149
1654 Ga0207692_10000702
1655 Ga0207692_10002139
1656 Ga0207710_10037989
1657 Ga0207710_10078884
1658 Ga0207688_10032649
1659 Ga0207688_10112037
1660 Ga0207680_10344036
1661 Ga0207647_10000486
1662 Ga0207647_10011713
1663 Ga0207685_10006684
1664 Ga0207699_10001397
1665 Ga0207699_10023930
1666 Ga0207699_10034967
1667 Ga0207645_10129401
1668 Ga0207643_10026833
1669 Ga0207643_10076823
1670 Ga0207643_10282845
1671 Ga0207705_10017045
1672 Ga0207705_10168146
1673 Ga0207705_10197379
1674 Ga0207684_10559718
1675 Ga0207654_10007503
1676 Ga0207707_10002451
1677 Ga0207707_10005454
1678 Ga0207707_10075753
1679 Ga0207707_10159724
1680 Ga0207695_10000029
1681 Ga0207695_10001179
1682 Ga0207695_10072034
1683 Ga0207695_10135866
1684 Ga0207671_10003068
1685 Ga0207671_10054717
1686 Ga0207671_10060487
1687 Ga0207671_10061185
1688 Ga0207671_10146523
1689 Ga0207671_10553991
1690 Ga0207693_10000723
1691 Ga0207693_10016800
1692 Ga0207693_10055703
1693 Ga0207663_10008872
1694 Ga0207663_10009924
1695 Ga0207663_10071461
1696 Ga0207660_10003233
1697 Ga0207660_10122451
1698 Ga0207660_10124137
1699 Ga0207660_10153603
1700 Ga0207657_10009870
1701 Ga0207649_10038698
1702 Ga0207649_10126757
1703 Ga0207652_10001798
1704 Ga0207652_10009823
1705 Ga0207652_10017746
1706 Ga0207652_10203677
1707 Ga0207652_10325887
1708 Ga0207646_10308362
1709 Ga0207694_10000131
1710 Ga0207694_10156005
1711 Ga0207650_10038362
1712 Ga0207650_10242077
1713 Ga0207687_10322470
1714 Ga0207700_10006382
1715 Ga0207700_10021767
1716 Ga0207700_10065414
1717 Ga0207700_10192709
1718 Ga0207700_10334081
1719 Ga0207700_10403486
1720 Ga0207700_10440561
1721 Ga0207664_10029323
1722 Ga0207664_10030728
1723 Ga0207664_10687644
1724 Ga0207644_10009377
1725 Ga0207644_10134362
1726 Ga0207644_10360211
1727 Ga0207690_10185300
1728 Ga0207690_10284180
1729 Ga0207706_10027406
1730 Ga0207706_10074343
1731 Ga0207686_10162813
1732 Ga0207709_10078643
1733 Ga0207669_10006776
1734 Ga0207704_10102781
1735 Ga0207704_10282610
1736 Ga0207665_10000064
1737 Ga0207665_10004907
1738 Ga0207711_10063683
1739 Ga0207711_10165633
1740 Ga0207689_10451141
1741 Ga0207661_10047386
1742 Ga0207679_10527650
1743 Ga0207667_10003470
1744 Ga0207667_10007884
1745 Ga0207667_10067637
1746 Ga0207667_10151534
1747 Ga0207667_10487481
1748 Ga0207667_10706591
1749 Ga0207712_10040241
1750 Ga0207668_10399540
1751 Ga0207668_10454776
1752 Ga0207640_10045119
1753 Ga0207677_10407172
1754 Ga0207639_10004621
1755 Ga0207639_10027307
1756 Ga0207639_10033598
1757 Ga0207639_10205758
1758 Ga0207639_10263581
1759 Ga0207678_10054454
1760 Ga0207678_10072906
1761 Ga0207678_10120813
1762 Ga0207678_10354151
1763 Ga0207678_10397685
1764 Ga0207708_10431748
1765 Ga0207702_10000005
1766 Ga0207702_10000403
1767 Ga0207702_10168093
1768 Ga0207702_10363530
1769 Ga0207702_10634712
1770 Ga0207648_10245379
1771 Ga0207676_10152803
1772 Ga0207674_10001872
1773 Ga0207674_10007797
1774 Ga0207674_10011800
1775 Ga0207674_10441353
1776 Ga0207674_10797436
1777 Ga0207675_100012752
1778 Ga0207675_100191979
1779 Ga0207675_100327208
1780 Ga0207683_10180078
1781 Ga0207683_10501591
1782 Ga0207698_10086772
1783 Ga0207698_10216554
1784 Ga0207698_10423534
1785 Ga0207698_10536815
1786 Ga0209389_1000011
1787 Ga0209389_1000025
1788 Ga0209589_1000018
1789 Ga0209589_1000066
1790 Ga0209489_100017
1791 Ga0209489_100026
1792 Ga0209489_100030
1793 Ga0209700_100027
1794 Ga0209700_100035
1795 Ga0209813_10014372
1796 Ga0209813_10017191
1797 Ga0209813_10018563
1798 Ga0207428_10277047
1799 Ga0265357_1000522
1800 Ga0268266_10003834
1801 Ga0268266_10012714
1802 Ga0268266_10027088
1803 Ga0268266_10238536
1804 Ga0268265_10288694
1805 Ga0268264_10085874
1806 Ga0268264_10383852
1807 Ga0268264_10463123
1808 Ga0265319_1013101
1809 Ga0265334_10003572
1810 Ga0265323_10002458
1811 Ga0265336_10000843
1812 Ga0307517_10003575
1813 Ga0265338_10000065
1814 Ga0265324_10009971
1815 Ga0307511_10065964
1816 Ga0307511_10081777
1817 Ga0265763_1000333
1818 Ga0265330_10059075
1819 Ga0265332_10081976
1820 Ga0265325_10099265
1821 Ga0265329_10068196
1822 Ga0265340_10001672
1823 Ga0265340_10218290
1824 Ga0265339_10003005
1825 Ga0265339_10164157
1826 Ga0265331_10094640
1827 Ga0307513_10024303
1828 Ga0307513_10245449
1829 Ga0307513_10305881
1830 Ga0307513_10323244
1831 Ga0307513_10377107
1832 Ga0307509_10007153
1833 Ga0307509_10191035
1834 Ga0307408_100396994
1835 Ga0265313_10064958
1836 Ga0307508_10000521
1837 Ga0307508_10121413
1838 Ga0307508_10150727
1839 Ga0307508_10157364
1840 Ga0265314_10038916
1841 Ga0265314_10081458
1842 Ga0265314_10087153
1843 Ga0265314_10110866
1844 Ga0265342_10002787
1845 Ga0265342_10160466
1846 Ga0307516_10006534
1847 Ga0307516_10008532
1848 Ga0307516_10010831
1849 Ga0307516_10146099
1850 Ga0307405_10338377
1851 Ga0307406_10652378
1852 Ga0307412_10291645
1853 Ga0307409_100452597
1854 Ga0307416_100075188
1855 Ga0307416_100423675
1856 Ga0307414_10587028
1857 Ga0307411_10217575
1858 Ga0307415_100180367
1859 Ga0307415_100249973
1860 Ga0307507_10037444
1861 Ga0307510_10018544
1862 Ga0307510_10072144
1863 Ga0307510_10142887
1864 Ga0307510_10231122
1865 Ga0315911_1000011
1866 Ga0373926_0046578
1867 Ga0373926_0092286
1868 Ga0373934_0030323
1869 Ga0373934_0037065
1870 Ga0373923_0003639
1871 Ga0373923_0039268
1872 Ga0373936_0002935
1873 Ga0373945_0042158
1874 Ga0373953_0000420
1875 Ga0373954_0000663
1876 Ga0373954_0010613
1877 Ga0373954_0014139
1878 Ga0373954_0236113
1879 Ga0373956_0000275
1880 Ga0373957_0000426
1881 Ga0373957_0042157
1882 Ga0373943_0002244
1883 Ga0373943_0002327
1884 Ga0373943_0020053
1885 Ga0373943_0058892
1886 Ga0373946_0008126
1887 Ga0373946_0140402
1888 Ga0373955_0000510
1889 Ga0373955_0019046
1890 Ga0373955_0145188
1891 Ga0373924_0013575
1892 Ga0373924_0031154
1893 Ga0373924_0083534
1894 Ga0373931_0141343
1895 Ga0373931_0156641
1896 Ga0373935_0000344
1897 Ga0373935_0002403
1898 Ga0373935_0037526
1899 Ga0373927_0000535
1900 Ga0373927_0000665
1901 Ga0373927_0011552
1902 Ga0373927_0036697
1903 Ga0373927_0041290
1904 Ga0373927_0320531
1905 Ga0373933_0000405
1906 Ga0373933_0003239
1907 Ga0373933_0094983
1908 Ga0373933_0137136
1909 Ga0373933_0281984
1910 Ga0373947_0003567
1911 Ga0373947_0005129
1912 Ga0373947_0032291
1913 Ga0373947_0051406
1914 Ga0373937_0016746
1915 Ga0373937_0019554
1916 Ga0373937_0038342
1917 Ga0373937_0077111
1918 Ga0373937_0157610
1919 Ga0373937_0161959
1920 Ga0373925_0008976
1921 Ga0373925_0052343
1922 Ga0373925_0091409
1923 Ga0373925_0273105
1924 Ga0395900_0001369
1925 Ga0395900_0011842
1926 Ga0395898_0037847
1927 Ga0395898_0083798
1928 Ga0395898_0110036
1929 Ga0395898_0132467
1930 Ga0395905_0019296
1931 Ga0395905_0028187
1932 Ga0395905_0060245
1933 Ga0395905_0590869
1934 Ga0436364_0299669
1935 Ga0436364_0782463
1936 Ga0395901_0235053
1937 Ga0436365_0042657
1938 Ga0436365_0063867
1939 Ga0436365_0722166
1940 Ga0436365_1063789
1941 Ga0436360_0323822
1942 Ga0436360_0496502
1943 Ga0436360_1129815
1944 Ga0436361_0126094
1945 Ga0436361_0600203
1946 Ga0436363_0188494
1947 Ga0436363_0375693
1948 Ga0436363_0533929
1949 Ga0436363_0618196
1950 Ga0436363_1243410
1951 Ga0436363_1419910
1952 Ga0436362_0493194
1953 Ga0451853_2794660
1954 Ga0466972_0000807
1955 Ga0466972_0001683
1956 Ga0466965_0224184
1957 Ga0466966_0001348
1958 Ga0466966_0031942
1959 Ga0466961_0000120
1960 Ga0466963_0011705
1961 Ga0466964_0063140
1962 Ga0466968_0003445
1963 Ga0466957_0140446
1964 Ga0466960_0037601
1965 Ga0466960_0051743
1966 Ga0466960_0089949
1967 Ga0466960_0105690
1968 Ga0466958_0225122
1969 Ga0466967_0039448
1970 Ga0466967_0054533
1971 Ga0466967_0297279
1972 Ga0466967_0366390
1973 Ga0495592_0003383
1974 Ga0495592_0039077
1975 Ga0495603_0000094
1976 Ga0495603_0002935
1977 Ga0495603_0059188
1978 Ga0495603_0270305
1979 Ga0495629_0000612
1980 Ga0495629_0001119
1981 Ga0495629_0016050
1982 Ga0495629_0143782
1983 Ga0495629_0188944
1984 Ga0495638_0004073
1985 Ga0495638_0042140
1986 Ga0495641_0003738
1987 Ga0495651_0000889
1988 Ga0495651_0009999
1989 Ga0495651_0048662
1990 Ga0495651_0129445
1991 Ga0495651_0278233
1992 Ga0495653_0000399
1993 Ga0495653_0131341
1994 Ga0495580_0002084
1995 Ga0495580_0028605
1996 Ga0495582_0000256
1997 Ga0495605_0171927
1998 Ga0495639_0000114
1999 Ga0495639_0022425
2000 Ga0495639_0037488
2001 Ga0495639_0088828
2002 Ga0495662_0003498
2003 Ga0495662_0063636
2004 Ga0495664_0007385
2005 Ga0495664_0007443
2006 Ga0495664_0027650
2007 Ga0495664_0262354
2008 Ga0495584_0224638
2009 Ga0495585_0047154
2010 Ga0495585_0092179
2011 Ga0495594_0000393
2012 Ga0495596_0117317
2013 Ga0495606_0072155
2014 Ga0495608_0001226
2015 Ga0495608_0016044
2016 Ga0495608_0059203
2017 Ga0495616_0085568
2018 Ga0495618_0027003
2019 Ga0495618_0248478
2020 Ga0495628_0021333
2021 Ga0495628_0026173
2022 Ga0495628_0039835
2023 Ga0495628_0042972
2024 Ga0495628_0054021
2025 Ga0495630_0000459
2026 Ga0495630_0007072
2027 Ga0495630_0118558
2028 Ga0495631_0042585
2029 Ga0495637_0047602
2030 Ga0495648_0030954
2031 Ga0495648_0122179
2032 Ga0495666_0013950
2033 Ga0495652_0006874
2034 Ga0495652_0017641
2035 Ga0495652_0040916
2036 Ga0495652_0080772
2037 Ga0495652_0134319
2038 Ga0495665_0000130
2039 Ga0495640_0007646
2040 Ga0495640_0016287
2041 Ga0495640_0027589
2042 Ga0495640_0077117
2043 Ga0495640_0113738
2044 Ga0495640_0193036
2045 Ga0495587_0001432
2046 Ga0495587_0008425
2047 Ga0495587_0026974
2048 Ga0495587_0106342
2049 Ga0495645_0001776
2050 Ga0495645_0078572
2051 Ga0495645_0110527
2052 Ga0495645_0114562
2053 Ga0495622_0005481
2054 Ga0495622_0036395
2055 Ga0495622_0070664
2056 Ga0495622_0081412
2057 Ga0495667_0001452
2058 Ga0495667_0005133
2059 Ga0495667_0020287
2060 Ga0495667_0106426
2061 Ga0495667_0173540
2062 Ga0495668_0068142
2063 Ga0495634_0002801
2064 Ga0495634_0044277
2065 Ga0495634_0044727
2066 Ga0495634_0060641
2067 Ga0495634_0075739
2068 Ga0495634_0186380
2069 Ga0495611_0073528
2070 Ga0495625_0040578
2071 Ga0495625_0217043
2072 Ga0495635_0000088
2073 Ga0495635_0006280
2074 Ga0495635_0015324
2075 Ga0495635_0016162
2076 Ga0495635_0032791
2077 Ga0495635_0110742
2078 Ga0495659_0167096
2079 Ga0495588_0004028
2080 Ga0495657_0001352
2081 Ga0495657_0003974
2082 Ga0495657_0056422
2083 Ga0495657_0061896
2084 Ga0495657_0083063
2085 Ga0495599_0001137
2086 Ga0495599_0024026
2087 Ga0495599_0044471
2088 Ga0495623_0006628
2089 Ga0495623_0023524
2090 Ga0495623_0039776
2091 Ga0495646_0002433
2092 Ga0495646_0124375
2093 Ga0495646_0154023
2094 Ga0495647_0000070
2095 Ga0495658_0002227
2096 Ga0495658_0114829
2097 Ga0495658_0186102
2098 Ga0495658_0319241
2099 Ga0495613_0004685
2100 Ga0495613_0019706
2101 Ga0495613_0023847
2102 Ga0495613_0357445
2103 Ga0495624_0000079
2104 Ga0495624_0084679
2105 Ga0495589_0155230
2106 Ga0495600_0000484
2107 Ga0495600_0000715
2108 Ga0495600_0006880
2109 Ga0495581_0000082
2110 Ga0495581_0012706
2111 Ga0495581_0029743
2112 Ga0495604_0001221
2113 Ga0495604_0002253
2114 Ga0495604_0076032
2115 Ga0495604_0199846
2116 Ga0495636_0066657
2117 Ga0495674_0001729
2118 Ga0495674_0023969
2119 Ga0495674_0028341
2120 Ga0495674_0029949
2121 Ga0495674_0312630
2122 Ga0495672_0010291
2123 Ga0495672_0108294
2124 Ga0495676_0016546
2125 Ga0495676_0043358
2126 Ga0495680_0004231
2127 Ga0495680_0006059
2128 Ga0495680_0029180
2129 Ga0495683_0021360
2130 Ga0495687_011038
2131 Ga0495675_0000977
2132 Ga0495675_0022872
2133 Ga0495675_0026026
2134 Ga0495673_0104984
2135 Ga0495684_0001326
2136 Ga0495684_0003018
2137 Ga0495684_0015114
2138 Ga0495684_0019004
2139 Ga0495684_0030487
2140 Ga0495684_0172823
2141 Ga0495684_0206334
2142 Ga0495686_0143564
2143 Ga0495686_0149809
2144 Ga0495686_0190187
2145 Ga0495593_0000206
2146 Ga0495593_0004711
2147 Ga0495593_0012582
2148 Ga0495593_0194861
2149 Ga0495602_0004704
2150 Ga0495602_0170231
2151 Ga0495602_0247217
2152 Ga0495602_0324010
2153 Ga0495614_0008940
2154 Ga0496100_0075447
2155 Ga0496100_0342022
2156 Ga0496100_0374086
2157 Ga0496100_0417555
2158 Ga0496101_0061473
2159 Ga0496101_0203599
2160 Ga0496101_0467368
2161 Ga0496102_0055892
2162 Ga0496102_0167171
2163 Ga0496102_0272117
2164 Ga0496102_0451418
2165 Ga0496103_0002701
2166 Ga0496103_0214676
2167 Ga0496103_0221676
2168 Ga0496104_0009468
2169 Ga0496104_0022665
2170 Ga0496104_0200689
2171 Ga0496104_0466486
2172 Ga0496105_0007364
2173 Ga0496105_0119412
2174 Ga0496105_0152283
2175 Ga0496105_0173456
2176 Ga0496105_0266128
2177 Ga0496105_0419343
2178 Ga0496106_0000339
2179 Ga0496106_0316249
2180 Ga0496107_0193016
2181 Ga0496107_0354358
2182 Ga0496107_0501462
2183 Ga0496108_0010794
2184 Ga0496108_0079281
2185 Ga0496108_0164368
2186 Ga0496108_0366992
2187 Ga0496109_0007049
2188 Ga0496109_0190448
2189 Ga0496110_0013109
2190 Ga0496110_0120580
2191 Ga0496110_0164573
2192 Ga0496110_0558381
2193 Ga0496111_0047598
2194 Ga0496111_0058993
2195 Ga0496111_0365830
2196 Ga0496111_0503050
2197 Ga0496112_0000016
2198 Ga0496112_0011247
2199 Ga0496112_0025092
2200 Ga0496112_0241370
2201 Ga0496113_0007542
2202 Ga0496114_0333288
2203 Ga0496115_0001214
2204 Ga0496115_0170716
2205 Ga0496115_0302491
2206 Ga0496115_0344924
2207 Ga0496116_0000887
2208 Ga0496116_0178804
2209 Ga0496117_0017537
2210 Ga0496117_0032645
2211 Ga0496117_0034591
2212 Ga0496117_0116132
2213 Ga0496118_0002852
2214 Ga0496118_0018021
2215 Ga0496118_0020586
2216 Ga0496118_0026254
2217 Ga0496118_0040800
2218 Ga0496118_0088933
2219 Ga0496119_0035460
2220 Ga0496119_0087671
2221 Ga0496120_0081167
2222 Ga0496120_0175464
2223 Ga0496120_0218288
2224 Ga0496121_0000041
2225 Ga0496121_0002334
2226 Ga0496121_0017977
2227 Ga0496121_0029418
2228 Ga0496121_0034794
2229 Ga0496121_0074310
2230 Ga0496121_0082833
2231 Ga0496121_0149206
2232 Ga0496121_0179531
2233 Ga0496121_0180778
2234 Ga0496121_0204272
2235 Ga0496121_0237516
2236 Ga0496122_0077657
2237 Ga0496123_0090210
2238 Ga0496123_0155646
2239 Ga0496124_0003141
2240 Ga0496124_0097583
2241 Ga0496124_0126991
2242 Ga0496124_0145296
2243 Ga0496124_0168241
2244 Ga0496124_0206326
2245 Ga0496125_0016125
2246 Ga0496125_0029890
2247 Ga0496125_0036649
2248 Ga0496125_0057028
2249 Ga0496125_0069446
2250 Ga0496125_0194159
2251 Ga0496126_0002727
2252 Ga0496126_0017256
2253 Ga0496126_0060274
2254 Ga0496126_0063564
2255 Ga0496126_0107255
2256 Ga0496126_0242967
2257 Ga0496126_0251185
2258 Ga0496126_0331880
2259 Ga0496126_0514171
2260 Ga0495682_0046724
2261 Ga0501031_0034444
2262 Ga0501031_0152892
2263 Ga0501032_0080492
2264 Ga0501032_0140621
2265 Ga0501033_0104929
2266 Ga0501034_0184480
2267 Ga0501034_0202175
2268 Ga0501034_0433259
2269 Ga0501036_0152596
2270 Ga0501037_0005109
2271 Ga0501037_0173165
2272 Ga0501037_0302011
2273 Ga0501037_0486132
2274 Ga0501038_0002061
2275 Ga0501038_0020851
2276 Ga0501038_0036755
2277 Ga0501038_0162834
2278 Ga0501038_0184975
2279 Ga0501039_0020658
2280 Ga0501039_0059349
2281 Ga0501039_0127742
2282 Ga0501039_0560725
2283 Ga0501041_0049716
2284 Ga0501043_0023413
2285 Ga0501043_0111313
2286 Ga0501046_0390270
2287 Ga0501047_0015793
2288 Ga0501047_0016756
2289 Ga0501067_0000194
2290 Ga0501067_0018127
2291 Ga0501067_0312561
2292 Ga0501070_0033613
2293 Ga0501073_0100745
2294 Ga0501080_0012678
2295 Ga0501080_0543280
2296 Ga0501035_0059083
2297 Ga0501044_0006258
2298 Ga0501044_0066876
2299 Ga0501044_0563141
2300 nmdc:mga03n38_146363_c1
2301 nmdc:mga03n38_64791_c1
2302 nmdc:mga03n38_67077_c1
2303 nmdc:mga00v17_3731_c1
2304 nmdc:mga00v17_66331_c1
2305 nmdc:mga00v17_68828_c1
2306 nmdc:mga0yw44_11489_c1
2307 nmdc:mga0yw44_11693_c1
2308 nmdc:mga0yw44_125880_c1
2309 nmdc:mga0yw44_206771_c1
2310 nmdc:mga0yw44_282108_c1
2311 nmdc:mga0yw44_41175_c1
2312 nmdc:mga0yw44_73938_c1
2313 nmdc:mga0k408_165095_c1
2314 nmdc:mga0k408_301811_c1
2315 nmdc:mga0k408_82041_c1
2316 nmdc:mga06z11_45243_c1
2317 nmdc:mga06z11_89707_c1
2318 nmdc:mga07m45_18789_c2
2319 nmdc:mga07m45_237757_c1
2320 nmdc:mga07m45_32758_c1
2321 nmdc:mga09592_377795_c1
2322 nmdc:mga08y16_497623_c1
2323 nmdc:mga0n895_358038_c1
2324 nmdc:mga0sz30_16917_c1
2325 nmdc:mga0sz30_34331_c1
2326 nmdc:mga0sz30_43025_c1
2327 nmdc:mga0sz30_90865_c1
2328 nmdc:mga0sz30_92464_c1
2329 Ga0495601_0083860
2330 Ga0495601_0164530
2331 Ga0495601_0223726
2332 Ga0495601_0336318
2333 Ga0495612_0032764
2334 Ga0500635_0004194
2335 Ga0495595_0000480
2336 Ga0495595_0150001
2337 Ga0495619_0000332
2338 Ga0495619_0046663
2339 Ga0495619_0093865
2340 Ga0495619_0172647
2341 Ga0500643_000019
2342 Ga0500647_0028200
2343 Ga0500651_0018718
2344 Ga0500566_0000537
2345 Ga0500566_0000554
2346 Ga0500566_0000601
2347 Ga0500640_001185
2348 Ga0500641_0024233
2349 Ga0500648_056006
2350 Ga0500650_0129240
2351 Ga0500555_002869
2352 Ga0500556_0057130
2353 Ga0500556_0109430
2354 Ga0500557_000090
2355 Ga0500569_122819
2356 Ga0500572_002533
2357 Ga0500572_003911
2358 Ga0500595_000286
2359 Ga0500595_000540
2360 Ga0500595_020891
2361 Ga0500595_025025
2362 Ga0500595_029581
2363 Ga0500595_034020
2364 Ga0500595_076656
2365 Ga0500607_011476
2366 Ga0500608_003545
2367 Ga0500608_082372
2368 Ga0500614_001061
2369 Ga0500642_0000063
2370 Ga0500658_0108623
2371 Ga0500559_0000521
2372 Ga0500559_0000985
2373 Ga0500559_0012812
2374 Ga0500559_0014002
2375 Ga0500568_0006442
2376 Ga0500616_0026754
2377 Ga0500622_0009099
2378 Ga0500630_006610
2379 Ga0500633_0013201
2380 Ga0500638_000725
2381 Ga0500638_073483
2382 Ga0500639_000166
2383 Ga0500639_041883
2384 Ga0500636_0000076
2385 Ga0500636_0004010
2386 Ga0500636_0049444
2387 Ga0500636_0050783
2388 Ga0500636_0090924
2389 Ga0500636_0126137
2390 Ga0500637_0000135
2391 Ga0500637_0047678
2392 Ga0500637_0061006
2393 Ga0500576_070075
2394 Ga0500645_013736
2395 Ga0500645_038405
2396 Ga0500609_009693
2397 Ga0500552_002169
2398 Ga0500596_000426
2399 Ga0500596_000771
2400 Ga0500601_000939
2401 Ga0500661_003826
2402 Ga0500661_008194
2403 Ga0530510_0124412
2404 2507510021
2405 2508544023
2406 2509147570
2407 2513628182
2408 2513643551
2409 2513660097
2410 2513676415
2411 2513696918
2412 2513720534
2413 2513858274
2414 2513878129
2415 2513893312
2416 2513922093
2417 2514012575
2418 2515629474
2419 2517107516
2420 2517893837
2421 2524439047
2422 2524469456
2423 2524537790
2424 2528849594
2425 2603861061
2426 2617353085
2427 2617378944
2428 2644287827
2429 2671122833
2430 2723846368
2431 2728747955
2432 2745078840
2433 2793060000
2434 2793072527
2435 2793081165
2436 2805920090
2437 2818241583
2438 2824605613
2439 2824609863
2440 2824625351
2441 2824633838
2442 2824641558
2443 2824649783
2444 2824655738
2445 2824669447
2446 2824674195
2447 2824686183
2448 2824693025
2449 2824698908
2450 2824711487
2451 2824720960
2452 2824729003
2453 2824758038
2454 2824766176
2455 2824781059
2456 2838127538
2457 2841941509
2458 2841952477
2459 2841959498
2460 2841967652
2461 2841982181
2462 2841986499
2463 2842038264
2464 2842048791
2465 2844317744
2466 2847934533
2467 2847945140
2468 2849080679
2469 2857509959
2470 2874596767
2471 2874610667
2472 2874618231
2473 2874623220
2474 2874636032
2475 2874653003
2476 2876766684
2477 2876776937
2478 2876825313
2479 2879081074
2480 2879089724
2481 2879107738
2482 2879118737
2483 2879130812
2484 2879147598
2485 2881365667
2486 2881671730
2487 2885368942
2488 2885382515
2489 2885387435
2490 2885414469
2491 2888388219
2492 2888423050
2493 2889039128
2494 2893069006
2495 2903735423
2496 2903751850
2497 2903777406
2498 2904670040
2499 2904691612
2500 2904705115
2501 2904718472
2502 2906608658
2503 2906610720
2504 2906633554
2505 2906635882
2506 2906649927
2507 2906664022
2508 2908744239
2509 2908761855
2510 2922362182
2511 2922375496
2512 2922388067
2513 2922394991
2514 2922428598
2515 2929616231
2516 2929624975
2517 2932787102
2518 2932797329
2519 2932804786
2520 2932811297
2521 2932819830
2522 2932832308
2523 2933578485
2524 2935611074
2525 2935619018
2526 2935634575
2527 2935643165
2528 2935648511
2529 2935657501
2530 2935669791
2531 2935677069
2532 2935695401
2533 2935709490
2534 2935719716
2535 2935729517
2536 2935739599
2537 2935748637
2538 2935756776
2539 2935761236
2540 2935771489
2541 2935779178
2542 2935790853
2543 2935799206
2544 2935807309
2545 2935812448
2546 2935820559
2547 2935832691
2548 2935839230
2549 2935849432
2550 2935857383
2551 2935864912
2552 2935876690
2553 2935884978
2554 2935911794
2555 2935919449
2556 2935928823
2557 2935938468
2558 2935945640
2559 2935954753
2560 2935963352
2561 2935970640
2562 2935979123
2563 2935987867
2564 2935998959
2565 2936008283
2566 2936011421
2567 2936020016
2568 2936028612
2569 2936039041
2570 2936046739
2571 2936058386
2572 2940562690
2573 2941509061
2574 2941516890
2575 2941525015
2576 2941536382
2577 2941539920
2578 3005478728
2579 3005487942
2580 3005508736
2581 3005589450
2582 3005597478
2583 3005713508
2584 3005720914
2585 8006930239
2586 8006942616
2587 8006964747
2588 8006982344
2589 8006991882
2590 8006995484
2591 8016515104
2592 8016522893
2593 8016540630
2594 8016552613
2595 8016560992
2596 8016574715
2597 8016578790
2598 8016590857
2599 8016598855
2600 8016612222
2601 8016621581
2602 8016628377
2603 8016632575
2604 8017061349
2605 8019536074
2606 8019543396
2607 8019555458
2608 8019558390
2609 8019566906
2610 8019580820
2611 8019588557
2612 8019602780
2613 8019626518
2614 8019635970
2615 8019643694
2616 8019656475
2617 8019663738
2618 8019673369
2619 8019682758
2620 8019688446
2621 8055747878
2622 8056687972
2623 8056695904
2624 8056969543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13437

HlyD_3

HlyD family secretion protein

129

239

0.85

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

29

208

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tul-assembly5.cif.gz_A crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226) 0.9566 70 131
2ic9-assembly2.cif.gz_B the coiled-coil domain (residues 1-93) structure of the sin nombre virus nucleocapsid protein 0.944 70 129
3tul-assembly5.cif.gz_C crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226) 0.9109 70 131
3qwe-assembly1.cif.gz_A-2 crystal structure of the n-terminal domain of the gem interacting protein 0.8989 70 131
4k34-assembly1.cif.gz_A crystal structures of cusc review conformational changes accompanying folding and transmembrane channel formation 0.8914 70 131
ID Description Score Start End Superfamily
af_D4A584_1_269_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9779 70 129 1.20.1270.60
af_P75830_95_182_6.10.140.1990 Special;Helix non-globular;Helix Hairpins; 0.9775 70 131 6.10.140.1990
5azsA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9615 76 131 1.20.1600.10
1t5eH03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9607 71 128 1.10.287.470
3tulA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.9566 70 131 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A7V5FP10-F1-model_v4 Biotin/lipoyl-binding protein 0.9534 45 132 GO:0016020
AF-A0A432G4S3-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8925 28 249 GO:0015562
GO:1990281
AF-A0A2W6SXP6-F1-model_v4 deleted 0.889 27 249
AF-A0A6G7VQU5-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.8711 27 248 GO:0030313
AF-A0A498DDC4-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.8661 28 249 GO:0030313

Map