F492831
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1307 | 487 | 1279 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300025986|Ga0207658_10737848|Ga0207658_107378481 |
| Length | 223 |
| Sequence | MLPRGGAQCPSGGRAGTGMTPMKLIILDRDGTINEDRDDFVKTPDEWVPIPGALEAIARLNHAGWHTVIATNQSGLGRGTFDMATLNAMHTKMNQMLAKQGGRIDAVFFCPHAPEDACQCRKPLPGLFEQIGERFGVPLSEVPVVGDSLRDLQAGVAVGCAPHLVRTGKGAAMSQAQLDALCAQVPGTIVHADLTAFADHMIRTERRDRAATGESDSGFGRLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 2 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 4 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 5 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 6 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 7 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 8 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 9 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 10 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 11 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 12 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 13 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 14 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 15 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 16 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 17 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 18 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 19 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 20 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 21 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 22 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 23 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 24 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 25 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 28 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 29 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 60 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 252 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 253 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 254 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 255 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 256 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 260 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 263 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 268 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 269 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 270 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 273 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 274 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 275 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 276 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 277 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 279 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 280 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 286 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 291 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 293 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 294 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 299 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 303 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 304 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 305 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 306 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 307 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 308 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 309 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 310 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 311 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 312 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 313 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 314 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 315 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 316 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 317 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 318 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 319 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 320 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 321 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 322 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 323 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 324 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 325 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 326 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 327 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 328 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 415 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 416 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 417 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 418 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 419 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 420 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 423 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 424 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 425 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 426 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 437 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 459 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 464 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 465 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 470 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 471 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 472 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 474 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 475 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 477 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 478 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 479 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 480 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 481 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 484 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 485 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 486 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 487 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.4 |
| Metatranscriptomes | 0.46 |
| Isolates | 2.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.1 |
| Nodule | 0.99 |
| Rhizoplane | 4.13 |
| Rhizosphere | 77.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000170 | 3300001979 | Bacteria | 26025 |
| 2 | JGI24740J21852_10000394 | 3300001979 | Bacteria | 18727 |
| 3 | JGI24735J21928_10002393 | 3300002067 | Bacteria | 6520 |
| 4 | JGI25156J39149_1009826 | 3300002705 | Bacteria | 2294 |
| 5 | JGI25151J46595_10003399 | 3300003187 | Bacteria | 8810 |
| 6 | JGI25151J46595_10015671 | 3300003187 | Bacteria | 3333 |
| 7 | JGI25151J46595_10029267 | 3300003187 | Bacteria | 2183 |
| 8 | rootH1_10012984 | 3300003316 | Bacteria | 1918 |
| 9 | rootH1_10059048 | 3300003316 | Bacteria | 1713 |
| 10 | rootH1_10097847 | 3300003316 | Bacteria | 1979 |
| 11 | rootL2_10258849 | 3300003322 | Bacteria | 2309 |
| 12 | rootL2_10285392 | 3300003322 | Bacteria | 1801 |
| 13 | rootH1_10137895 | 3300003323 | Bacteria | 1061 |
| 14 | Ga0055538_1007050 | 3300003751 | Bacteria | 1042 |
| 15 | Ga0055538_1007053 | 3300003751 | Bacteria | 1042 |
| 16 | Ga0055539_1000230 | 3300003752 | Bacteria | 39333 |
| 17 | Ga0055539_1000294 | 3300003752 | Bacteria | 27517 |
| 18 | Ga0055533_1007351 | 3300003756 | Bacteria | 1510 |
| 19 | Ga0055533_1007464 | 3300003756 | Bacteria | 1487 |
| 20 | Ga0055532_1000006 | 3300003758 | Bacteria | 451244 |
| 21 | Ga0055525_1000414 | 3300003759 | Bacteria | 26035 |
| 22 | Ga0055527_1002364 | 3300003760 | Bacteria | 3231 |
| 23 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 24 | Ga0055542_1001324 | 3300003762 | Bacteria | 12975 |
| 25 | Ga0055529_1000022 | 3300003763 | Bacteria | 320108 |
| 26 | Ga0055526_1000526 | 3300003771 | Bacteria | 30389 |
| 27 | Ga0055526_1015796 | 3300003771 | Bacteria | 3005 |
| 28 | Ga0055526_1025067 | 3300003771 | Bacteria | 1926 |
| 29 | Ga0055524_1000029 | 3300003775 | Bacteria | 201332 |
| 30 | Ga0055524_1000300 | 3300003775 | Bacteria | 47498 |
| 31 | Ga0055536_1000150 | 3300003781 | Bacteria | 59586 |
| 32 | Ga0055534_1002058 | 3300003784 | Bacteria | 7264 |
| 33 | Ga0055534_1007945 | 3300003784 | Bacteria | 2460 |
| 34 | Ga0055530_10046509 | 3300003791 | Bacteria | 1030 |
| 35 | Ga0055540_1001614 | 3300003792 | Bacteria | 13126 |
| 36 | Ga0055531_10002809 | 3300003794 | Bacteria | 11426 |
| 37 | Ga0055541_1002414 | 3300003841 | Bacteria | 3743 |
| 38 | Ga0055541_1007377 | 3300003841 | Bacteria | 1810 |
| 39 | Ga0055541_1014989 | 3300003841 | Bacteria | 1042 |
| 40 | Ga0065715_10166303 | 3300005293 | Bacteria | 1584 |
| 41 | Ga0070658_10369786 | 3300005327 | Bacteria | 1229 |
| 42 | Ga0070676_10032673 | 3300005328 | Bacteria | 2982 |
| 43 | Ga0070676_10072709 | 3300005328 | Bacteria | 2068 |
| 44 | Ga0070676_10120555 | 3300005328 | Bacteria | 1646 |
| 45 | Ga0070690_100296141 | 3300005330 | Bacteria | 1159 |
| 46 | Ga0070670_100003283 | 3300005331 | Bacteria | 13377 |
| 47 | Ga0070670_100035755 | 3300005331 | Bacteria | 4276 |
| 48 | Ga0070670_100074887 | 3300005331 | Bacteria | 2909 |
| 49 | Ga0070670_100116237 | 3300005331 | Bacteria | 2306 |
| 50 | Ga0070670_100280161 | 3300005331 | Bacteria | 1456 |
| 51 | Ga0070670_100472311 | 3300005331 | Bacteria | 1113 |
| 52 | Ga0070670_100501395 | 3300005331 | Bacteria | 1079 |
| 53 | Ga0070670_101023725 | 3300005331 | Bacteria | 751 |
| 54 | Ga0070677_10003148 | 3300005333 | Bacteria | 5305 |
| 55 | Ga0070677_10013848 | 3300005333 | Bacteria | 2831 |
| 56 | Ga0070677_10077985 | 3300005333 | Bacteria | 1410 |
| 57 | Ga0070677_10121295 | 3300005333 | Bacteria | 1181 |
| 58 | Ga0068869_100004113 | 3300005334 | Bacteria | 9017 |
| 59 | Ga0068869_100021949 | 3300005334 | Bacteria | 4394 |
| 60 | Ga0070666_10011342 | 3300005335 | Bacteria | 5592 |
| 61 | Ga0070666_10268319 | 3300005335 | Bacteria | 1211 |
| 62 | Ga0070666_10326700 | 3300005335 | Bacteria | 1095 |
| 63 | Ga0070666_10334021 | 3300005335 | Bacteria | 1083 |
| 64 | Ga0070666_10376314 | 3300005335 | Bacteria | 1019 |
| 65 | Ga0070680_100106872 | 3300005336 | Bacteria | 2327 |
| 66 | Ga0070680_100694378 | 3300005336 | Bacteria | 875 |
| 67 | Ga0070682_100119355 | 3300005337 | Bacteria | 1768 |
| 68 | Ga0070682_100780926 | 3300005337 | Bacteria | 774 |
| 69 | Ga0068868_100009310 | 3300005338 | Bacteria | 7062 |
| 70 | Ga0068868_100068111 | 3300005338 | Bacteria | 2834 |
| 71 | Ga0068868_100153350 | 3300005338 | Bacteria | 1899 |
| 72 | Ga0068868_100259058 | 3300005338 | Bacteria | 1466 |
| 73 | Ga0068868_100414072 | 3300005338 | Bacteria | 1166 |
| 74 | Ga0068868_100414319 | 3300005338 | Bacteria | 1165 |
| 75 | Ga0068868_100871305 | 3300005338 | Bacteria | 817 |
| 76 | Ga0070660_100010897 | 3300005339 | Bacteria | 6435 |
| 77 | Ga0070660_100085744 | 3300005339 | Bacteria | 2477 |
| 78 | Ga0070689_101314010 | 3300005340 | Bacteria | 651 |
| 79 | Ga0070687_100003995 | 3300005343 | Bacteria | 5816 |
| 80 | Ga0070687_100018067 | 3300005343 | Bacteria | 3254 |
| 81 | Ga0070687_100177157 | 3300005343 | Bacteria | 1274 |
| 82 | Ga0070687_100181456 | 3300005343 | Bacteria | 1261 |
| 83 | Ga0070661_100000012 | 3300005344 | Bacteria | 167998 |
| 84 | Ga0070661_100561211 | 3300005344 | Bacteria | 920 |
| 85 | Ga0070692_10072358 | 3300005345 | Bacteria | 1839 |
| 86 | Ga0070668_100019399 | 3300005347 | Bacteria | 5118 |
| 87 | Ga0070668_100105862 | 3300005347 | Bacteria | 2234 |
| 88 | Ga0070669_100008805 | 3300005353 | Bacteria | 7199 |
| 89 | Ga0070669_100013746 | 3300005353 | Bacteria | 5754 |
| 90 | Ga0070669_100050201 | 3300005353 | Bacteria | 3047 |
| 91 | Ga0070669_100096035 | 3300005353 | Bacteria | 2230 |
| 92 | Ga0070669_100484343 | 3300005353 | Bacteria | 1024 |
| 93 | Ga0070669_100520801 | 3300005353 | Bacteria | 988 |
| 94 | Ga0070669_100877275 | 3300005353 | Bacteria | 765 |
| 95 | Ga0070675_100002407 | 3300005354 | Bacteria | 13964 |
| 96 | Ga0070675_100013720 | 3300005354 | Bacteria | 6376 |
| 97 | Ga0070675_100019141 | 3300005354 | Bacteria | 5454 |
| 98 | Ga0070675_100022424 | 3300005354 | Bacteria | 5046 |
| 99 | Ga0070675_100024765 | 3300005354 | Bacteria | 4807 |
| 100 | Ga0070675_100044472 | 3300005354 | Bacteria | 3632 |
| 101 | Ga0070675_100170640 | 3300005354 | Bacteria | 1875 |
| 102 | Ga0070675_100250813 | 3300005354 | Bacteria | 1549 |
| 103 | Ga0070675_100422924 | 3300005354 | Bacteria | 1191 |
| 104 | Ga0070675_100978778 | 3300005354 | Bacteria | 776 |
| 105 | Ga0070671_100003297 | 3300005355 | Bacteria | 12596 |
| 106 | Ga0070671_100041344 | 3300005355 | Bacteria | 3831 |
| 107 | Ga0070671_100092436 | 3300005355 | Bacteria | 2535 |
| 108 | Ga0070671_100113636 | 3300005355 | Bacteria | 2275 |
| 109 | Ga0070671_100200288 | 3300005355 | Bacteria | 1693 |
| 110 | Ga0070671_100564749 | 3300005355 | Bacteria | 982 |
| 111 | Ga0070674_100017825 | 3300005356 | Bacteria | 4475 |
| 112 | Ga0070674_100031937 | 3300005356 | Bacteria | 3493 |
| 113 | Ga0070674_100178103 | 3300005356 | Bacteria | 1626 |
| 114 | Ga0070674_100180955 | 3300005356 | Bacteria | 1615 |
| 115 | Ga0070674_100209566 | 3300005356 | Bacteria | 1510 |
| 116 | Ga0070674_100635680 | 3300005356 | Bacteria | 906 |
| 117 | Ga0070673_100010706 | 3300005364 | Bacteria | 6220 |
| 118 | Ga0070673_100024640 | 3300005364 | Bacteria | 4415 |
| 119 | Ga0070673_100050212 | 3300005364 | Bacteria | 3261 |
| 120 | Ga0070673_100172901 | 3300005364 | Bacteria | 1845 |
| 121 | Ga0070673_100853708 | 3300005364 | Bacteria | 842 |
| 122 | Ga0070688_100225616 | 3300005365 | Bacteria | 1323 |
| 123 | Ga0070688_100425627 | 3300005365 | Bacteria | 988 |
| 124 | Ga0070659_100042824 | 3300005366 | Bacteria | 3540 |
| 125 | Ga0070659_100053565 | 3300005366 | Bacteria | 3176 |
| 126 | Ga0070659_100186400 | 3300005366 | Bacteria | 1704 |
| 127 | Ga0070659_100332166 | 3300005366 | Bacteria | 1272 |
| 128 | Ga0070667_100004664 | 3300005367 | Bacteria | 11504 |
| 129 | Ga0070667_100006816 | 3300005367 | Bacteria | 9488 |
| 130 | Ga0070667_100016316 | 3300005367 | Bacteria | 6144 |
| 131 | Ga0070667_100169310 | 3300005367 | Bacteria | 1928 |
| 132 | Ga0070701_10055247 | 3300005438 | Bacteria | 2073 |
| 133 | Ga0070711_100540174 | 3300005439 | Bacteria | 966 |
| 134 | Ga0070700_100003564 | 3300005441 | Bacteria | 8042 |
| 135 | Ga0070700_100231214 | 3300005441 | Bacteria | 1316 |
| 136 | Ga0070700_100448086 | 3300005441 | Bacteria | 982 |
| 137 | Ga0070694_100005915 | 3300005444 | Bacteria | 7415 |
| 138 | Ga0070694_100624671 | 3300005444 | Bacteria | 870 |
| 139 | Ga0070708_100438762 | 3300005445 | Bacteria | 1232 |
| 140 | Ga0070663_100000020 | 3300005455 | Bacteria | 112469 |
| 141 | Ga0070663_100000383 | 3300005455 | Bacteria | 23293 |
| 142 | Ga0070663_100018798 | 3300005455 | Bacteria | 4539 |
| 143 | Ga0070663_100106408 | 3300005455 | Bacteria | 2101 |
| 144 | Ga0070663_100340516 | 3300005455 | Bacteria | 1212 |
| 145 | Ga0070663_100557360 | 3300005455 | Bacteria | 959 |
| 146 | Ga0070678_100007678 | 3300005456 | Bacteria | 6412 |
| 147 | Ga0070678_100007693 | 3300005456 | Bacteria | 6407 |
| 148 | Ga0070678_100027275 | 3300005456 | Bacteria | 3877 |
| 149 | Ga0070678_100064007 | 3300005456 | Bacteria | 2724 |
| 150 | Ga0070678_100107343 | 3300005456 | Bacteria | 2177 |
| 151 | Ga0070678_100190872 | 3300005456 | Bacteria | 1684 |
| 152 | Ga0070678_100800847 | 3300005456 | Bacteria | 856 |
| 153 | Ga0070662_100018320 | 3300005457 | Bacteria | 4735 |
| 154 | Ga0070662_100171358 | 3300005457 | Bacteria | 1705 |
| 155 | Ga0070662_100282080 | 3300005457 | Bacteria | 1345 |
| 156 | Ga0070662_100463643 | 3300005457 | Bacteria | 1053 |
| 157 | Ga0070681_10763020 | 3300005458 | Bacteria | 884 |
| 158 | Ga0068867_100000021 | 3300005459 | Bacteria | 92798 |
| 159 | Ga0068867_100003201 | 3300005459 | Bacteria | 11543 |
| 160 | Ga0068867_100015559 | 3300005459 | Bacteria | 5397 |
| 161 | Ga0068867_100022723 | 3300005459 | Bacteria | 4486 |
| 162 | Ga0068867_100023593 | 3300005459 | Bacteria | 4404 |
| 163 | Ga0068867_100124684 | 3300005459 | Bacteria | 1994 |
| 164 | Ga0068867_100256997 | 3300005459 | Bacteria | 1423 |
| 165 | Ga0068867_100797100 | 3300005459 | Bacteria | 842 |
| 166 | Ga0070685_10027554 | 3300005466 | Bacteria | 3142 |
| 167 | Ga0070698_100079870 | 3300005471 | Bacteria | 3267 |
| 168 | Ga0068853_100324998 | 3300005539 | Bacteria | 1427 |
| 169 | Ga0068853_100391329 | 3300005539 | Bacteria | 1300 |
| 170 | Ga0068853_100410523 | 3300005539 | Bacteria | 1269 |
| 171 | Ga0070672_100006265 | 3300005543 | Bacteria | 7972 |
| 172 | Ga0070672_100017297 | 3300005543 | Bacteria | 5185 |
| 173 | Ga0070672_100048444 | 3300005543 | Bacteria | 3302 |
| 174 | Ga0070672_100112244 | 3300005543 | Bacteria | 2223 |
| 175 | Ga0070672_100259237 | 3300005543 | Bacteria | 1466 |
| 176 | Ga0070672_100259693 | 3300005543 | Bacteria | 1465 |
| 177 | Ga0070672_100297053 | 3300005543 | Bacteria | 1368 |
| 178 | Ga0070686_100106892 | 3300005544 | Bacteria | 1900 |
| 179 | Ga0070686_100161391 | 3300005544 | Bacteria | 1579 |
| 180 | Ga0070686_100685905 | 3300005544 | Bacteria | 816 |
| 181 | Ga0070695_100047148 | 3300005545 | Bacteria | 2751 |
| 182 | Ga0070696_100023627 | 3300005546 | Bacteria | 4178 |
| 183 | Ga0070696_100410035 | 3300005546 | Bacteria | 1062 |
| 184 | Ga0070665_100030125 | 3300005548 | Bacteria | 5460 |
| 185 | Ga0070665_100203381 | 3300005548 | Bacteria | 1981 |
| 186 | Ga0070665_100247846 | 3300005548 | Bacteria | 1782 |
| 187 | Ga0070665_100929479 | 3300005548 | Bacteria | 882 |
| 188 | Ga0070665_100992631 | 3300005548 | Bacteria | 852 |
| 189 | Ga0068855_100011895 | 3300005563 | Bacteria | 10522 |
| 190 | Ga0068855_100444873 | 3300005563 | Bacteria | 1415 |
| 191 | Ga0070664_100000003 | 3300005564 | Bacteria | 325604 |
| 192 | Ga0070664_100048588 | 3300005564 | Bacteria | 3585 |
| 193 | Ga0070664_100074018 | 3300005564 | Bacteria | 2923 |
| 194 | Ga0070664_100084721 | 3300005564 | Bacteria | 2736 |
| 195 | Ga0070664_100084786 | 3300005564 | Bacteria | 2735 |
| 196 | Ga0070664_100137572 | 3300005564 | Bacteria | 2149 |
| 197 | Ga0070664_100277793 | 3300005564 | Bacteria | 1510 |
| 198 | Ga0068857_100164971 | 3300005577 | Bacteria | 2011 |
| 199 | Ga0068854_100000352 | 3300005578 | Bacteria | 29570 |
| 200 | Ga0068854_100123104 | 3300005578 | Bacteria | 1972 |
| 201 | Ga0068854_100158888 | 3300005578 | Bacteria | 1749 |
| 202 | Ga0068854_100215157 | 3300005578 | Bacteria | 1518 |
| 203 | Ga0068854_100266048 | 3300005578 | Bacteria | 1374 |
| 204 | Ga0068856_100000011 | 3300005614 | Bacteria | 170419 |
| 205 | Ga0068856_100131758 | 3300005614 | Bacteria | 2505 |
| 206 | Ga0070702_100051490 | 3300005615 | Bacteria | 2357 |
| 207 | Ga0070702_100158970 | 3300005615 | Bacteria | 1459 |
| 208 | Ga0068852_100012412 | 3300005616 | Bacteria | 6468 |
| 209 | Ga0068852_100812430 | 3300005616 | Bacteria | 949 |
| 210 | Ga0068852_100859154 | 3300005616 | Bacteria | 923 |
| 211 | Ga0068852_100925034 | 3300005616 | Bacteria | 890 |
| 212 | Ga0068859_100018681 | 3300005617 | Bacteria | 6966 |
| 213 | Ga0068859_100053864 | 3300005617 | Bacteria | 4046 |
| 214 | Ga0068859_100319072 | 3300005617 | Bacteria | 1648 |
| 215 | Ga0068859_100692883 | 3300005617 | Bacteria | 1110 |
| 216 | Ga0068864_100008520 | 3300005618 | Bacteria | 8460 |
| 217 | Ga0068864_100008889 | 3300005618 | Bacteria | 8281 |
| 218 | Ga0068864_100014167 | 3300005618 | Bacteria | 6617 |
| 219 | Ga0068864_100034866 | 3300005618 | Bacteria | 4282 |
| 220 | Ga0068864_100088530 | 3300005618 | Bacteria | 2727 |
| 221 | Ga0068864_100090299 | 3300005618 | Bacteria | 2701 |
| 222 | Ga0068864_100207308 | 3300005618 | Bacteria | 1803 |
| 223 | Ga0068864_100227472 | 3300005618 | Bacteria | 1724 |
| 224 | Ga0068866_10004238 | 3300005718 | Bacteria | 5888 |
| 225 | Ga0068866_10071239 | 3300005718 | Bacteria | 1838 |
| 226 | Ga0068861_100003457 | 3300005719 | Bacteria | 10487 |
| 227 | Ga0068861_100029120 | 3300005719 | Bacteria | 4036 |
| 228 | Ga0068861_100203848 | 3300005719 | Bacteria | 1662 |
| 229 | Ga0068851_10037603 | 3300005834 | Bacteria | 2427 |
| 230 | Ga0068851_10095103 | 3300005834 | Bacteria | 1574 |
| 231 | Ga0068851_10239381 | 3300005834 | Bacteria | 1026 |
| 232 | Ga0068870_10129556 | 3300005840 | Bacteria | 1464 |
| 233 | Ga0068870_10183174 | 3300005840 | Bacteria | 1259 |
| 234 | Ga0068870_10340611 | 3300005840 | Bacteria | 959 |
| 235 | Ga0068870_10467270 | 3300005840 | Bacteria | 835 |
| 236 | Ga0068863_100006252 | 3300005841 | Bacteria | 11696 |
| 237 | Ga0068863_100017003 | 3300005841 | Bacteria | 6975 |
| 238 | Ga0068863_100045259 | 3300005841 | Bacteria | 4177 |
| 239 | Ga0068863_100062851 | 3300005841 | Bacteria | 3511 |
| 240 | Ga0068863_100275905 | 3300005841 | Bacteria | 1628 |
| 241 | Ga0068863_100294660 | 3300005841 | Bacteria | 1573 |
| 242 | Ga0068863_100802494 | 3300005841 | Bacteria | 939 |
| 243 | Ga0068858_100001814 | 3300005842 | Bacteria | 21735 |
| 244 | Ga0068858_100006288 | 3300005842 | Bacteria | 11568 |
| 245 | Ga0068858_100060157 | 3300005842 | Bacteria | 3511 |
| 246 | Ga0068858_100125379 | 3300005842 | Bacteria | 2404 |
| 247 | Ga0068860_100015915 | 3300005843 | Bacteria | 7340 |
| 248 | Ga0068860_100049997 | 3300005843 | Bacteria | 3981 |
| 249 | Ga0068860_100270691 | 3300005843 | Bacteria | 1658 |
| 250 | Ga0068862_100011607 | 3300005844 | Bacteria | 7268 |
| 251 | Ga0068862_100041368 | 3300005844 | Bacteria | 3920 |
| 252 | Ga0068862_100094400 | 3300005844 | Bacteria | 2609 |
| 253 | Ga0075365_10156624 | 3300006038 | Bacteria | 1586 |
| 254 | Ga0075368_10047088 | 3300006042 | Bacteria | 1706 |
| 255 | Ga0075363_100230892 | 3300006048 | Bacteria | 1062 |
| 256 | Ga0075363_100272563 | 3300006048 | Bacteria | 978 |
| 257 | Ga0075432_10036610 | 3300006058 | Bacteria | 1706 |
| 258 | Ga0075367_10037421 | 3300006178 | Bacteria | 2820 |
| 259 | Ga0075366_10006987 | 3300006195 | Bacteria | 6215 |
| 260 | Ga0075366_10008243 | 3300006195 | Bacteria | 5784 |
| 261 | Ga0075366_10064258 | 3300006195 | Bacteria | 2182 |
| 262 | Ga0075366_10083194 | 3300006195 | Bacteria | 1913 |
| 263 | Ga0075366_10115026 | 3300006195 | Bacteria | 1620 |
| 264 | Ga0075366_10203642 | 3300006195 | Bacteria | 1204 |
| 265 | Ga0097621_100054084 | 3300006237 | Bacteria | 3273 |
| 266 | Ga0097621_100163862 | 3300006237 | Bacteria | 1912 |
| 267 | Ga0097621_100209158 | 3300006237 | Bacteria | 1697 |
| 268 | Ga0097621_100289894 | 3300006237 | Bacteria | 1443 |
| 269 | Ga0097621_100411394 | 3300006237 | Bacteria | 1212 |
| 270 | Ga0075370_10001022 | 3300006353 | Bacteria | 11620 |
| 271 | Ga0075370_10008599 | 3300006353 | Bacteria | 5263 |
| 272 | Ga0075370_10022938 | 3300006353 | Bacteria | 3433 |
| 273 | Ga0068871_100055678 | 3300006358 | Bacteria | 3211 |
| 274 | Ga0068871_100104270 | 3300006358 | Bacteria | 2379 |
| 275 | Ga0068871_100168381 | 3300006358 | Bacteria | 1877 |
| 276 | Ga0068871_100571390 | 3300006358 | Bacteria | 1026 |
| 277 | Ga0075428_100109618 | 3300006844 | Bacteria | 3007 |
| 278 | Ga0075430_100000168 | 3300006846 | Bacteria | 43228 |
| 279 | Ga0075431_100044508 | 3300006847 | Bacteria | 4579 |
| 280 | Ga0075429_100784447 | 3300006880 | Bacteria | 835 |
| 281 | Ga0068865_100017387 | 3300006881 | Bacteria | 4625 |
| 282 | Ga0068865_100212659 | 3300006881 | Bacteria | 1508 |
| 283 | Ga0068865_100250844 | 3300006881 | Bacteria | 1397 |
| 284 | Ga0097620_100018680 | 3300006931 | Bacteria | 6966 |
| 285 | Ga0097620_100053863 | 3300006931 | Bacteria | 4046 |
| 286 | Ga0097620_100319058 | 3300006931 | Bacteria | 1648 |
| 287 | Ga0097620_100692914 | 3300006931 | Bacteria | 1110 |
| 288 | Ga0079104_1004880 | 3300006946 | Bacteria | 5545 |
| 289 | Ga0079104_1015257 | 3300006946 | Bacteria | 2283 |
| 290 | Ga0099826_10000014 | 3300006948 | Bacteria | 258520 |
| 291 | Ga0105251_10037988 | 3300009011 | Bacteria | 2360 |
| 292 | Ga0105240_10001844 | 3300009093 | Bacteria | 35489 |
| 293 | Ga0105240_10003122 | 3300009093 | Bacteria | 26091 |
| 294 | Ga0105240_10063637 | 3300009093 | Bacteria | 4587 |
| 295 | Ga0105240_10574098 | 3300009093 | Bacteria | 1245 |
| 296 | Ga0105240_10680036 | 3300009093 | Bacteria | 1125 |
| 297 | Ga0105240_11243043 | 3300009093 | Bacteria | 787 |
| 298 | Ga0111539_10133059 | 3300009094 | Bacteria | 2912 |
| 299 | Ga0111539_10272981 | 3300009094 | Bacteria | 1968 |
| 300 | Ga0111539_10397608 | 3300009094 | Bacteria | 1605 |
| 301 | Ga0111539_10591810 | 3300009094 | Bacteria | 1292 |
| 302 | Ga0111539_12489100 | 3300009094 | Bacteria | 600 |
| 303 | Ga0105245_10054536 | 3300009098 | Bacteria | 3590 |
| 304 | Ga0114129_10591848 | 3300009147 | Bacteria | 1438 |
| 305 | Ga0114129_10926740 | 3300009147 | Bacteria | 1102 |
| 306 | Ga0105243_10000295 | 3300009148 | Bacteria | 55066 |
| 307 | Ga0105243_10066339 | 3300009148 | Bacteria | 2902 |
| 308 | Ga0105243_10067185 | 3300009148 | Bacteria | 2885 |
| 309 | Ga0105243_10187960 | 3300009148 | Bacteria | 1802 |
| 310 | Ga0105243_11559356 | 3300009148 | Bacteria | 686 |
| 311 | Ga0105241_10105240 | 3300009174 | Bacteria | 2250 |
| 312 | Ga0105241_10148197 | 3300009174 | Bacteria | 1917 |
| 313 | Ga0105242_10032793 | 3300009176 | Bacteria | 4155 |
| 314 | Ga0105242_10571467 | 3300009176 | Bacteria | 1087 |
| 315 | Ga0105242_10674403 | 3300009176 | Bacteria | 1008 |
| 316 | Ga0105248_10007354 | 3300009177 | Bacteria | 12084 |
| 317 | Ga0105248_10071910 | 3300009177 | Bacteria | 3887 |
| 318 | Ga0105248_10106940 | 3300009177 | Bacteria | 3154 |
| 319 | Ga0105248_10237055 | 3300009177 | Bacteria | 2054 |
| 320 | Ga0105248_10542651 | 3300009177 | Bacteria | 1312 |
| 321 | Ga0105237_10000678 | 3300009545 | Bacteria | 47128 |
| 322 | Ga0105237_10237395 | 3300009545 | Bacteria | 1824 |
| 323 | Ga0105238_10003973 | 3300009551 | Bacteria | 14670 |
| 324 | Ga0105238_10290002 | 3300009551 | Bacteria | 1618 |
| 325 | Ga0105249_10159790 | 3300009553 | Bacteria | 2176 |
| 326 | Ga0105239_10000292 | 3300010375 | Bacteria | 73809 |
| 327 | Ga0105239_10101934 | 3300010375 | Bacteria | 3176 |
| 328 | Ga0105246_10387269 | 3300011119 | Bacteria | 1157 |
| 329 | Ga0157371_10000083 | 3300013102 | Bacteria | 149633 |
| 330 | Ga0157370_10000141 | 3300013104 | Bacteria | 87406 |
| 331 | Ga0157370_10000310 | 3300013104 | Bacteria | 60996 |
| 332 | Ga0157370_10004672 | 3300013104 | Bacteria | 15630 |
| 333 | Ga0157370_10049678 | 3300013104 | Bacteria | 4014 |
| 334 | Ga0157369_10000525 | 3300013105 | Bacteria | 50581 |
| 335 | Ga0157369_10003851 | 3300013105 | Bacteria | 17830 |
| 336 | Ga0157369_10210924 | 3300013105 | Bacteria | 2036 |
| 337 | Ga0157374_10000138 | 3300013296 | Bacteria | 65783 |
| 338 | Ga0157374_11232871 | 3300013296 | Bacteria | 769 |
| 339 | Ga0157378_10226603 | 3300013297 | Bacteria | 1779 |
| 340 | Ga0163162_10001494 | 3300013306 | Bacteria | 21792 |
| 341 | Ga0163162_10047420 | 3300013306 | Bacteria | 4306 |
| 342 | Ga0163162_10077078 | 3300013306 | Bacteria | 3397 |
| 343 | Ga0163162_10354497 | 3300013306 | Bacteria | 1600 |
| 344 | Ga0163162_10463539 | 3300013306 | Bacteria | 1399 |
| 345 | Ga0163162_11136547 | 3300013306 | Bacteria | 885 |
| 346 | Ga0157372_10000775 | 3300013307 | Bacteria | 34581 |
| 347 | Ga0157372_10018279 | 3300013307 | Bacteria | 7534 |
| 348 | Ga0157375_10015511 | 3300013308 | Bacteria | 6822 |
| 349 | Ga0157375_10029760 | 3300013308 | Bacteria | 5140 |
| 350 | Ga0157375_10043762 | 3300013308 | Bacteria | 4345 |
| 351 | Ga0157375_10137913 | 3300013308 | Bacteria | 2564 |
| 352 | Ga0157375_10236646 | 3300013308 | Bacteria | 1985 |
| 353 | Ga0163163_10009312 | 3300014325 | Bacteria | 8761 |
| 354 | Ga0163163_10089270 | 3300014325 | Bacteria | 3094 |
| 355 | Ga0163163_10136840 | 3300014325 | Bacteria | 2491 |
| 356 | Ga0157380_10007613 | 3300014326 | Bacteria | 7697 |
| 357 | Ga0157380_10150001 | 3300014326 | Bacteria | 2014 |
| 358 | Ga0157380_10964593 | 3300014326 | Bacteria | 883 |
| 359 | Ga0182008_10205890 | 3300014497 | Bacteria | 1002 |
| 360 | Ga0182008_10300639 | 3300014497 | Bacteria | 840 |
| 361 | Ga0157377_10000021 | 3300014745 | Bacteria | 147105 |
| 362 | Ga0157377_10145633 | 3300014745 | Bacteria | 1460 |
| 363 | Ga0157379_10027561 | 3300014968 | Bacteria | 5058 |
| 364 | Ga0157379_10038301 | 3300014968 | Bacteria | 4278 |
| 365 | Ga0157379_10038696 | 3300014968 | Bacteria | 4255 |
| 366 | Ga0157379_10060072 | 3300014968 | Bacteria | 3398 |
| 367 | Ga0157379_10605442 | 3300014968 | Bacteria | 1023 |
| 368 | Ga0157376_10037875 | 3300014969 | Bacteria | 3920 |
| 369 | Ga0157376_10281271 | 3300014969 | Bacteria | 1567 |
| 370 | Ga0157376_10333675 | 3300014969 | Bacteria | 1446 |
| 371 | Ga0157376_10700712 | 3300014969 | Bacteria | 1018 |
| 372 | Ga0182006_1001545 | 3300015261 | Bacteria | 13768 |
| 373 | Ga0182007_10003234 | 3300015262 | Bacteria | 7760 |
| 374 | Ga0182005_1100063 | 3300015265 | Bacteria | 812 |
| 375 | Ga0163161_10013318 | 3300017792 | Bacteria | 5720 |
| 376 | Ga0163161_10112127 | 3300017792 | Bacteria | 2040 |
| 377 | Ga0206351_10502756 | 3300020077 | Bacteria | 20710 |
| 378 | Ga0206350_10374774 | 3300020080 | Bacteria | 4455 |
| 379 | Ga0154015_1372279 | 3300020610 | Bacteria | 19706 |
| 380 | Ga0213872_10000320 | 3300021361 | Bacteria | 40938 |
| 381 | Ga0213872_10029589 | 3300021361 | Bacteria | 2511 |
| 382 | Ga0213872_10045721 | 3300021361 | Bacteria | 1992 |
| 383 | Ga0213876_10119413 | 3300021384 | Bacteria | 1399 |
| 384 | Ga0209784_100150 | 3300025224 | Bacteria | 63516 |
| 385 | Ga0209784_100517 | 3300025224 | Bacteria | 14709 |
| 386 | Ga0209784_100673 | 3300025224 | Bacteria | 9690 |
| 387 | Ga0209784_102726 | 3300025224 | Bacteria | 1688 |
| 388 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 389 | Ga0209566_101174 | 3300025225 | Bacteria | 9521 |
| 390 | Ga0209566_102638 | 3300025225 | Bacteria | 3163 |
| 391 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 392 | Ga0209674_100050 | 3300025226 | Bacteria | 341738 |
| 393 | Ga0209674_100248 | 3300025226 | Bacteria | 45380 |
| 394 | Ga0209674_109945 | 3300025226 | Bacteria | 1036 |
| 395 | Ga0209672_100218 | 3300025228 | Bacteria | 44911 |
| 396 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 397 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 398 | Ga0209563_100026 | 3300025230 | Bacteria | 559453 |
| 399 | Ga0209563_114570 | 3300025230 | Bacteria | 1007 |
| 400 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 401 | Ga0209646_1000055 | 3300025246 | Bacteria | 271793 |
| 402 | Ga0209026_1004460 | 3300025250 | Bacteria | 4134 |
| 403 | Ga0209026_1007223 | 3300025250 | Bacteria | 2547 |
| 404 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 405 | Ga0209677_104511 | 3300025253 | Bacteria | 3983 |
| 406 | Ga0209148_1000109 | 3300025254 | Bacteria | 204266 |
| 407 | Ga0209148_1003918 | 3300025254 | Bacteria | 3853 |
| 408 | Ga0209759_1000342 | 3300025256 | Bacteria | 61422 |
| 409 | Ga0209759_1002759 | 3300025256 | Bacteria | 7445 |
| 410 | Ga0209759_1003327 | 3300025256 | Bacteria | 6461 |
| 411 | Ga0209759_1003505 | 3300025256 | Bacteria | 6223 |
| 412 | Ga0209759_1005314 | 3300025256 | Bacteria | 4547 |
| 413 | Ga0209759_1024975 | 3300025256 | Bacteria | 1281 |
| 414 | Ga0209759_1036187 | 3300025256 | Bacteria | 902 |
| 415 | Ga0209129_1004207 | 3300025258 | Bacteria | 5772 |
| 416 | Ga0209565_1000045 | 3300025263 | Bacteria | 226864 |
| 417 | Ga0209565_1006412 | 3300025263 | Bacteria | 3304 |
| 418 | Ga0209565_1008844 | 3300025263 | Bacteria | 2606 |
| 419 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 420 | Ga0209675_1000449 | 3300025291 | Bacteria | 31892 |
| 421 | Ga0209675_1000663 | 3300025291 | Bacteria | 24182 |
| 422 | Ga0209676_1000064 | 3300025292 | Bacteria | 321700 |
| 423 | Ga0209025_1000690 | 3300025294 | Bacteria | 57778 |
| 424 | Ga0209025_1000746 | 3300025294 | Bacteria | 54767 |
| 425 | Ga0209025_1000762 | 3300025294 | Bacteria | 53705 |
| 426 | Ga0209025_1001563 | 3300025294 | Bacteria | 29053 |
| 427 | Ga0209025_1002648 | 3300025294 | Bacteria | 18307 |
| 428 | Ga0209025_1069276 | 3300025294 | Bacteria | 1262 |
| 429 | Ga0209564_1000462 | 3300025295 | Bacteria | 68050 |
| 430 | Ga0209564_1000891 | 3300025295 | Bacteria | 39249 |
| 431 | Ga0209564_1001109 | 3300025295 | Bacteria | 31794 |
| 432 | Ga0209758_1027209 | 3300025297 | Bacteria | 2450 |
| 433 | Ga0209050_1004945 | 3300025298 | Bacteria | 8692 |
| 434 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 435 | Ga0209256_1000105 | 3300025299 | Bacteria | 188238 |
| 436 | Ga0209256_1000193 | 3300025299 | Bacteria | 117486 |
| 437 | Ga0207426_1002027 | 3300025302 | Bacteria | 14205 |
| 438 | Ga0209051_1000454 | 3300025303 | Bacteria | 54312 |
| 439 | Ga0209051_1012476 | 3300025303 | Bacteria | 4108 |
| 440 | Ga0209051_1032132 | 3300025303 | Bacteria | 2007 |
| 441 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 442 | Ga0209257_1009360 | 3300025304 | Bacteria | 5273 |
| 443 | Ga0209257_1035023 | 3300025304 | Bacteria | 1558 |
| 444 | Ga0207697_10069502 | 3300025315 | Bacteria | 1474 |
| 445 | Ga0207697_10163028 | 3300025315 | Bacteria | 973 |
| 446 | Ga0207656_10022427 | 3300025321 | Bacteria | 2533 |
| 447 | Ga0207656_10028373 | 3300025321 | Bacteria | 2297 |
| 448 | Ga0207713_1012200 | 3300025735 | Bacteria | 4616 |
| 449 | Ga0207653_10113143 | 3300025885 | Bacteria | 971 |
| 450 | Ga0207682_10007232 | 3300025893 | Bacteria | 4437 |
| 451 | Ga0207682_10008774 | 3300025893 | Bacteria | 3998 |
| 452 | Ga0207682_10010486 | 3300025893 | Bacteria | 3632 |
| 453 | Ga0207682_10025014 | 3300025893 | Bacteria | 2367 |
| 454 | Ga0207642_10023867 | 3300025899 | Bacteria | 2450 |
| 455 | Ga0207642_10052794 | 3300025899 | Bacteria | 1846 |
| 456 | Ga0207642_10158598 | 3300025899 | Bacteria | 1212 |
| 457 | Ga0207688_10098459 | 3300025901 | Bacteria | 1686 |
| 458 | Ga0207688_10137924 | 3300025901 | Bacteria | 1434 |
| 459 | Ga0207688_10289641 | 3300025901 | Bacteria | 999 |
| 460 | Ga0207680_10012229 | 3300025903 | Bacteria | 4368 |
| 461 | Ga0207680_10235920 | 3300025903 | Bacteria | 1259 |
| 462 | Ga0207680_10353091 | 3300025903 | Bacteria | 1033 |
| 463 | Ga0207680_10357090 | 3300025903 | Bacteria | 1027 |
| 464 | Ga0207680_10369241 | 3300025903 | Bacteria | 1010 |
| 465 | Ga0207647_10008975 | 3300025904 | Bacteria | 7122 |
| 466 | Ga0207647_10014971 | 3300025904 | Bacteria | 5331 |
| 467 | Ga0207645_10007870 | 3300025907 | Bacteria | 7495 |
| 468 | Ga0207645_10025599 | 3300025907 | Bacteria | 3817 |
| 469 | Ga0207645_10076194 | 3300025907 | Bacteria | 2148 |
| 470 | Ga0207643_10009100 | 3300025908 | Bacteria | 5333 |
| 471 | Ga0207643_10044714 | 3300025908 | Bacteria | 2500 |
| 472 | Ga0207643_10202288 | 3300025908 | Bacteria | 1210 |
| 473 | Ga0207643_10237532 | 3300025908 | Bacteria | 1119 |
| 474 | Ga0207643_10401375 | 3300025908 | Bacteria | 867 |
| 475 | Ga0207705_10119327 | 3300025909 | Bacteria | 1956 |
| 476 | Ga0207705_10127778 | 3300025909 | Bacteria | 1890 |
| 477 | Ga0207705_10235797 | 3300025909 | Bacteria | 1393 |
| 478 | Ga0207705_10577739 | 3300025909 | Bacteria | 874 |
| 479 | Ga0207654_10191961 | 3300025911 | Bacteria | 1339 |
| 480 | Ga0207695_10020879 | 3300025913 | Bacteria | 7484 |
| 481 | Ga0207695_10032508 | 3300025913 | Bacteria | 5709 |
| 482 | Ga0207695_10050820 | 3300025913 | Bacteria | 4358 |
| 483 | Ga0207695_10221785 | 3300025913 | Bacteria | 1798 |
| 484 | Ga0207695_10544245 | 3300025913 | Bacteria | 1042 |
| 485 | Ga0207671_10018908 | 3300025914 | Bacteria | 5278 |
| 486 | Ga0207671_10025357 | 3300025914 | Bacteria | 4454 |
| 487 | Ga0207671_10488171 | 3300025914 | Bacteria | 982 |
| 488 | Ga0207663_10340230 | 3300025916 | Bacteria | 1133 |
| 489 | Ga0207660_10038683 | 3300025917 | Bacteria | 3330 |
| 490 | Ga0207660_10074410 | 3300025917 | Bacteria | 2479 |
| 491 | Ga0207662_10024856 | 3300025918 | Bacteria | 3448 |
| 492 | Ga0207662_10028948 | 3300025918 | Bacteria | 3206 |
| 493 | Ga0207662_10084753 | 3300025918 | Bacteria | 1939 |
| 494 | Ga0207657_10012865 | 3300025919 | Bacteria | 8230 |
| 495 | Ga0207657_10349702 | 3300025919 | Bacteria | 1166 |
| 496 | Ga0207649_10000302 | 3300025920 | Bacteria | 37899 |
| 497 | Ga0207649_10150683 | 3300025920 | Bacteria | 1601 |
| 498 | Ga0207649_10438737 | 3300025920 | Bacteria | 983 |
| 499 | Ga0207649_10463720 | 3300025920 | Bacteria | 958 |
| 500 | Ga0207652_10374554 | 3300025921 | Bacteria | 1285 |
| 501 | Ga0207681_10001253 | 3300025923 | Bacteria | 16371 |
| 502 | Ga0207681_10007721 | 3300025923 | Bacteria | 6587 |
| 503 | Ga0207681_10008569 | 3300025923 | Bacteria | 6244 |
| 504 | Ga0207681_10168567 | 3300025923 | Bacteria | 1658 |
| 505 | Ga0207694_10027495 | 3300025924 | Bacteria | 4332 |
| 506 | Ga0207694_10129906 | 3300025924 | Bacteria | 2019 |
| 507 | Ga0207650_10001909 | 3300025925 | Bacteria | 14684 |
| 508 | Ga0207650_10002430 | 3300025925 | Bacteria | 12967 |
| 509 | Ga0207650_10015531 | 3300025925 | Bacteria | 5303 |
| 510 | Ga0207650_10100285 | 3300025925 | Bacteria | 2227 |
| 511 | Ga0207650_10105991 | 3300025925 | Bacteria | 2170 |
| 512 | Ga0207650_10236203 | 3300025925 | Bacteria | 1476 |
| 513 | Ga0207650_10435358 | 3300025925 | Bacteria | 1090 |
| 514 | Ga0207659_10001279 | 3300025926 | Bacteria | 15051 |
| 515 | Ga0207659_10003994 | 3300025926 | Bacteria | 8900 |
| 516 | Ga0207659_10012858 | 3300025926 | Bacteria | 5344 |
| 517 | Ga0207659_10038132 | 3300025926 | Bacteria | 3340 |
| 518 | Ga0207659_10099463 | 3300025926 | Bacteria | 2190 |
| 519 | Ga0207659_10203406 | 3300025926 | Bacteria | 1583 |
| 520 | Ga0207659_10225726 | 3300025926 | Bacteria | 1508 |
| 521 | Ga0207659_10436152 | 3300025926 | Bacteria | 1101 |
| 522 | Ga0207687_10513729 | 3300025927 | Bacteria | 1001 |
| 523 | Ga0207644_10001397 | 3300025931 | Bacteria | 15575 |
| 524 | Ga0207644_10001986 | 3300025931 | Bacteria | 13227 |
| 525 | Ga0207644_10061998 | 3300025931 | Bacteria | 2710 |
| 526 | Ga0207644_10266138 | 3300025931 | Bacteria | 1372 |
| 527 | Ga0207644_10489797 | 3300025931 | Bacteria | 1013 |
| 528 | Ga0207690_10027687 | 3300025932 | Bacteria | 3584 |
| 529 | Ga0207690_10350906 | 3300025932 | Bacteria | 1166 |
| 530 | Ga0207690_10808215 | 3300025932 | Bacteria | 775 |
| 531 | Ga0207706_10042544 | 3300025933 | Bacteria | 4026 |
| 532 | Ga0207706_10137043 | 3300025933 | Bacteria | 2153 |
| 533 | Ga0207706_10300428 | 3300025933 | Bacteria | 1399 |
| 534 | Ga0207706_10427890 | 3300025933 | Bacteria | 1147 |
| 535 | Ga0207706_10674342 | 3300025933 | Bacteria | 884 |
| 536 | Ga0207686_10204223 | 3300025934 | Bacteria | 1417 |
| 537 | Ga0207709_10027408 | 3300025935 | Bacteria | 3282 |
| 538 | Ga0207709_10045854 | 3300025935 | Bacteria | 2650 |
| 539 | Ga0207670_10015813 | 3300025936 | Bacteria | 4518 |
| 540 | Ga0207670_11017448 | 3300025936 | Bacteria | 697 |
| 541 | Ga0207669_10006020 | 3300025937 | Bacteria | 5501 |
| 542 | Ga0207669_10092933 | 3300025937 | Bacteria | 1969 |
| 543 | Ga0207669_10357561 | 3300025937 | Bacteria | 1130 |
| 544 | Ga0207669_10448079 | 3300025937 | Bacteria | 1022 |
| 545 | Ga0207669_10499939 | 3300025937 | Bacteria | 972 |
| 546 | Ga0207704_10064764 | 3300025938 | Bacteria | 2285 |
| 547 | Ga0207704_10102281 | 3300025938 | Bacteria | 1913 |
| 548 | Ga0207665_10112107 | 3300025939 | Bacteria | 1917 |
| 549 | Ga0207691_10008987 | 3300025940 | Bacteria | 9584 |
| 550 | Ga0207691_10038531 | 3300025940 | Bacteria | 4424 |
| 551 | Ga0207691_10062504 | 3300025940 | Bacteria | 3378 |
| 552 | Ga0207691_10073282 | 3300025940 | Bacteria | 3088 |
| 553 | Ga0207691_10090505 | 3300025940 | Bacteria | 2742 |
| 554 | Ga0207691_10096822 | 3300025940 | Bacteria | 2638 |
| 555 | Ga0207691_10116063 | 3300025940 | Bacteria | 2376 |
| 556 | Ga0207691_10205809 | 3300025940 | Bacteria | 1711 |
| 557 | Ga0207691_10335866 | 3300025940 | Bacteria | 1294 |
| 558 | Ga0207691_10766811 | 3300025940 | Bacteria | 812 |
| 559 | Ga0207711_10006637 | 3300025941 | Bacteria | 9750 |
| 560 | Ga0207711_10008377 | 3300025941 | Bacteria | 8651 |
| 561 | Ga0207711_10019079 | 3300025941 | Bacteria | 5705 |
| 562 | Ga0207711_10229560 | 3300025941 | Bacteria | 1700 |
| 563 | Ga0207711_10259114 | 3300025941 | Bacteria | 1598 |
| 564 | Ga0207711_10560896 | 3300025941 | Bacteria | 1065 |
| 565 | Ga0207689_10011343 | 3300025942 | Bacteria | 7644 |
| 566 | Ga0207689_10021769 | 3300025942 | Bacteria | 5390 |
| 567 | Ga0207689_10023522 | 3300025942 | Bacteria | 5170 |
| 568 | Ga0207689_10396049 | 3300025942 | Bacteria | 1151 |
| 569 | Ga0207689_10551970 | 3300025942 | Bacteria | 968 |
| 570 | Ga0207679_10000007 | 3300025945 | Bacteria | 460140 |
| 571 | Ga0207679_10088897 | 3300025945 | Bacteria | 2383 |
| 572 | Ga0207679_10174875 | 3300025945 | Bacteria | 1771 |
| 573 | Ga0207679_10421559 | 3300025945 | Bacteria | 1178 |
| 574 | Ga0207679_11025148 | 3300025945 | Bacteria | 757 |
| 575 | Ga0207667_10054586 | 3300025949 | Bacteria | 4202 |
| 576 | Ga0207667_10097810 | 3300025949 | Bacteria | 3029 |
| 577 | Ga0207651_10001690 | 3300025960 | Bacteria | 10166 |
| 578 | Ga0207651_10009296 | 3300025960 | Bacteria | 5369 |
| 579 | Ga0207651_10030385 | 3300025960 | Bacteria | 3439 |
| 580 | Ga0207651_10036213 | 3300025960 | Bacteria | 3219 |
| 581 | Ga0207651_10614659 | 3300025960 | Bacteria | 951 |
| 582 | Ga0207712_10040848 | 3300025961 | Bacteria | 3186 |
| 583 | Ga0207668_10004921 | 3300025972 | Bacteria | 7855 |
| 584 | Ga0207668_10120698 | 3300025972 | Bacteria | 1984 |
| 585 | Ga0207640_10000255 | 3300025981 | Bacteria | 36145 |
| 586 | Ga0207640_10045816 | 3300025981 | Bacteria | 2811 |
| 587 | Ga0207640_10211630 | 3300025981 | Bacteria | 1477 |
| 588 | Ga0207640_10274683 | 3300025981 | Bacteria | 1320 |
| 589 | Ga0207658_10000904 | 3300025986 | Bacteria | 24667 |
| 590 | Ga0207658_10006823 | 3300025986 | Bacteria | 7781 |
| 591 | Ga0207658_10006899 | 3300025986 | Bacteria | 7733 |
| 592 | Ga0207658_10025617 | 3300025986 | Bacteria | 4131 |
| 593 | Ga0207658_10158931 | 3300025986 | Bacteria | 1850 |
| 594 | Ga0207658_10289582 | 3300025986 | Bacteria | 1407 |
| 595 | Ga0207658_10548540 | 3300025986 | Bacteria | 1034 |
| 596 | Ga0207658_10737848 | 3300025986 | Bacteria | 891 |
| 597 | Ga0207677_10003021 | 3300026023 | Bacteria | 8884 |
| 598 | Ga0207677_10054828 | 3300026023 | Bacteria | 2723 |
| 599 | Ga0207677_10075708 | 3300026023 | Bacteria | 2393 |
| 600 | Ga0207677_10089343 | 3300026023 | Bacteria | 2236 |
| 601 | Ga0207677_10572061 | 3300026023 | Bacteria | 988 |
| 602 | Ga0207677_10625621 | 3300026023 | Bacteria | 947 |
| 603 | Ga0207703_10004044 | 3300026035 | Bacteria | 12114 |
| 604 | Ga0207703_10004545 | 3300026035 | Bacteria | 11376 |
| 605 | Ga0207703_10009909 | 3300026035 | Bacteria | 7476 |
| 606 | Ga0207639_10403733 | 3300026041 | Bacteria | 1231 |
| 607 | Ga0207639_10572685 | 3300026041 | Bacteria | 1039 |
| 608 | Ga0207678_10000030 | 3300026067 | Bacteria | 112455 |
| 609 | Ga0207678_10000458 | 3300026067 | Bacteria | 36993 |
| 610 | Ga0207678_10022611 | 3300026067 | Bacteria | 5506 |
| 611 | Ga0207678_10120749 | 3300026067 | Bacteria | 2236 |
| 612 | Ga0207678_10569978 | 3300026067 | Bacteria | 991 |
| 613 | Ga0207678_10588794 | 3300026067 | Bacteria | 975 |
| 614 | Ga0207678_10947134 | 3300026067 | Bacteria | 762 |
| 615 | Ga0207708_10010099 | 3300026075 | Bacteria | 7009 |
| 616 | Ga0207708_10023828 | 3300026075 | Bacteria | 4628 |
| 617 | Ga0207702_10000054 | 3300026078 | Bacteria | 137192 |
| 618 | Ga0207641_10001982 | 3300026088 | Bacteria | 19548 |
| 619 | Ga0207641_10020017 | 3300026088 | Bacteria | 5494 |
| 620 | Ga0207641_10032341 | 3300026088 | Bacteria | 4343 |
| 621 | Ga0207641_10035638 | 3300026088 | Bacteria | 4147 |
| 622 | Ga0207641_10073011 | 3300026088 | Bacteria | 2956 |
| 623 | Ga0207648_10002350 | 3300026089 | Bacteria | 20408 |
| 624 | Ga0207648_10003015 | 3300026089 | Bacteria | 17790 |
| 625 | Ga0207648_10011629 | 3300026089 | Bacteria | 8284 |
| 626 | Ga0207648_10017770 | 3300026089 | Bacteria | 6457 |
| 627 | Ga0207648_10027125 | 3300026089 | Bacteria | 5087 |
| 628 | Ga0207648_10035911 | 3300026089 | Bacteria | 4367 |
| 629 | Ga0207648_10168093 | 3300026089 | Bacteria | 1938 |
| 630 | Ga0207648_10256291 | 3300026089 | Bacteria | 1560 |
| 631 | Ga0207648_10588299 | 3300026089 | Bacteria | 1025 |
| 632 | Ga0207676_10007912 | 3300026095 | Bacteria | 7562 |
| 633 | Ga0207676_10012227 | 3300026095 | Bacteria | 6145 |
| 634 | Ga0207676_10031295 | 3300026095 | Bacteria | 4001 |
| 635 | Ga0207676_10042520 | 3300026095 | Bacteria | 3496 |
| 636 | Ga0207676_10059839 | 3300026095 | Bacteria | 3010 |
| 637 | Ga0207676_10196763 | 3300026095 | Bacteria | 1778 |
| 638 | Ga0207676_10278028 | 3300026095 | Bacteria | 1519 |
| 639 | Ga0207676_10379405 | 3300026095 | Bacteria | 1315 |
| 640 | Ga0207674_10027431 | 3300026116 | Bacteria | 6024 |
| 641 | Ga0207674_10420622 | 3300026116 | Bacteria | 1291 |
| 642 | Ga0207675_100016390 | 3300026118 | Bacteria | 6918 |
| 643 | Ga0207675_100144609 | 3300026118 | Bacteria | 2260 |
| 644 | Ga0207675_100286865 | 3300026118 | Bacteria | 1600 |
| 645 | Ga0207675_100389890 | 3300026118 | Bacteria | 1371 |
| 646 | Ga0207675_100637240 | 3300026118 | Bacteria | 1071 |
| 647 | Ga0207683_10035749 | 3300026121 | Bacteria | 4321 |
| 648 | Ga0207683_10038597 | 3300026121 | Bacteria | 4164 |
| 649 | Ga0207683_10053784 | 3300026121 | Bacteria | 3531 |
| 650 | Ga0207683_10067351 | 3300026121 | Bacteria | 3158 |
| 651 | Ga0207683_10122705 | 3300026121 | Bacteria | 2333 |
| 652 | Ga0207683_10150801 | 3300026121 | Bacteria | 2098 |
| 653 | Ga0207683_10192887 | 3300026121 | Bacteria | 1850 |
| 654 | Ga0207683_10207643 | 3300026121 | Bacteria | 1782 |
| 655 | Ga0207683_10911640 | 3300026121 | Bacteria | 816 |
| 656 | Ga0207683_11158583 | 3300026121 | Bacteria | 717 |
| 657 | Ga0207698_10059494 | 3300026142 | Bacteria | 2967 |
| 658 | Ga0207698_10059566 | 3300026142 | Bacteria | 2965 |
| 659 | Ga0207698_10249519 | 3300026142 | Bacteria | 1623 |
| 660 | Ga0207698_10329869 | 3300026142 | Bacteria | 1433 |
| 661 | Ga0209282_1000046 | 3300027666 | Bacteria | 115032 |
| 662 | Ga0207428_10065766 | 3300027907 | Bacteria | 2859 |
| 663 | Ga0207428_10081399 | 3300027907 | Bacteria | 2528 |
| 664 | Ga0207428_10231966 | 3300027907 | Bacteria | 1381 |
| 665 | Ga0207428_10817902 | 3300027907 | Bacteria | 661 |
| 666 | Ga0268266_10035490 | 3300028379 | Bacteria | 4242 |
| 667 | Ga0268266_10061938 | 3300028379 | Bacteria | 3227 |
| 668 | Ga0268266_10294726 | 3300028379 | Bacteria | 1512 |
| 669 | Ga0268266_10571810 | 3300028379 | Bacteria | 1084 |
| 670 | Ga0268266_10814288 | 3300028379 | Bacteria | 902 |
| 671 | Ga0268265_10001934 | 3300028380 | Bacteria | 16433 |
| 672 | Ga0268265_10202426 | 3300028380 | Bacteria | 1723 |
| 673 | Ga0268265_10428155 | 3300028380 | Bacteria | 1230 |
| 674 | Ga0268264_10003117 | 3300028381 | Bacteria | 14365 |
| 675 | Ga0268264_10003895 | 3300028381 | Bacteria | 12787 |
| 676 | Ga0268264_10197332 | 3300028381 | Bacteria | 1838 |
| 677 | Ga0268264_10235769 | 3300028381 | Bacteria | 1692 |
| 678 | Ga0268264_10317339 | 3300028381 | Bacteria | 1472 |
| 679 | Ga0307517_10004249 | 3300028786 | Bacteria | 22093 |
| 680 | Ga0307517_10060587 | 3300028786 | Bacteria | 3598 |
| 681 | Ga0307517_10188580 | 3300028786 | Bacteria | 1314 |
| 682 | Ga0307517_10214928 | 3300028786 | Bacteria | 1178 |
| 683 | Ga0307517_10287749 | 3300028786 | Bacteria | 931 |
| 684 | Ga0307515_10000347 | 3300028794 | Bacteria | 114603 |
| 685 | Ga0307515_10000378 | 3300028794 | Bacteria | 108916 |
| 686 | Ga0307515_10001105 | 3300028794 | Bacteria | 61711 |
| 687 | Ga0307515_10002080 | 3300028794 | Bacteria | 44046 |
| 688 | Ga0307515_10016105 | 3300028794 | Bacteria | 13712 |
| 689 | Ga0307515_10055358 | 3300028794 | Bacteria | 5798 |
| 690 | Ga0307515_10069956 | 3300028794 | Bacteria | 4786 |
| 691 | Ga0307515_10123151 | 3300028794 | Bacteria | 2919 |
| 692 | Ga0307515_10648512 | 3300028794 | Bacteria | 668 |
| 693 | Ga0307511_10233776 | 3300030521 | Bacteria | 906 |
| 694 | Ga0307512_10065289 | 3300030522 | Bacteria | 2761 |
| 695 | Ga0307512_10148644 | 3300030522 | Bacteria | 1409 |
| 696 | Ga0316181_1138066 | 3300030744 | Bacteria | 855 |
| 697 | Ga0265331_10020075 | 3300031250 | Bacteria | 3437 |
| 698 | Ga0265316_10666167 | 3300031344 | Bacteria | 735 |
| 699 | Ga0307513_10008368 | 3300031456 | Bacteria | 13246 |
| 700 | Ga0307513_10074096 | 3300031456 | Bacteria | 3542 |
| 701 | Ga0307513_10074725 | 3300031456 | Bacteria | 3523 |
| 702 | Ga0307513_10089596 | 3300031456 | Bacteria | 3140 |
| 703 | Ga0307513_10111525 | 3300031456 | Bacteria | 2728 |
| 704 | Ga0307513_10169671 | 3300031456 | Bacteria | 2061 |
| 705 | Ga0307513_10362486 | 3300031456 | Bacteria | 1194 |
| 706 | Ga0307509_10001361 | 3300031507 | Bacteria | 41386 |
| 707 | Ga0307509_10010234 | 3300031507 | Bacteria | 11535 |
| 708 | Ga0307509_10083130 | 3300031507 | Bacteria | 3301 |
| 709 | Ga0307509_10135071 | 3300031507 | Bacteria | 2414 |
| 710 | Ga0307509_10178311 | 3300031507 | Bacteria | 1994 |
| 711 | Ga0307509_10257982 | 3300031507 | Bacteria | 1521 |
| 712 | Ga0307509_10311736 | 3300031507 | Bacteria | 1315 |
| 713 | Ga0307408_100033032 | 3300031548 | Bacteria | 3612 |
| 714 | Ga0307408_100134772 | 3300031548 | Bacteria | 1931 |
| 715 | Ga0307408_100137546 | 3300031548 | Bacteria | 1913 |
| 716 | Ga0307408_100239367 | 3300031548 | Bacteria | 1491 |
| 717 | Ga0307508_10000023 | 3300031616 | Bacteria | 177362 |
| 718 | Ga0307508_10035009 | 3300031616 | Bacteria | 4525 |
| 719 | Ga0307508_10080654 | 3300031616 | Bacteria | 2835 |
| 720 | Ga0307514_10001743 | 3300031649 | Bacteria | 24892 |
| 721 | Ga0307514_10002980 | 3300031649 | Bacteria | 16765 |
| 722 | Ga0307514_10028455 | 3300031649 | Bacteria | 4507 |
| 723 | Ga0307514_10124924 | 3300031649 | Bacteria | 1785 |
| 724 | Ga0307514_10340688 | 3300031649 | Bacteria | 807 |
| 725 | Ga0316575_10003201 | 3300031665 | Bacteria | 5609 |
| 726 | Ga0307516_10000045 | 3300031730 | Bacteria | 132787 |
| 727 | Ga0307516_10013210 | 3300031730 | Bacteria | 8818 |
| 728 | Ga0307516_10019134 | 3300031730 | Bacteria | 7098 |
| 729 | Ga0307516_10099929 | 3300031730 | Bacteria | 2717 |
| 730 | Ga0307516_10165426 | 3300031730 | Bacteria | 1957 |
| 731 | Ga0307516_10180438 | 3300031730 | Bacteria | 1845 |
| 732 | Ga0307405_10032709 | 3300031731 | Bacteria | 3076 |
| 733 | Ga0316577_10431718 | 3300031733 | Bacteria | 748 |
| 734 | Ga0307518_10026365 | 3300031838 | Bacteria | 4192 |
| 735 | Ga0307410_10000671 | 3300031852 | Bacteria | 14181 |
| 736 | Ga0307410_10265588 | 3300031852 | Bacteria | 1340 |
| 737 | Ga0307406_10013246 | 3300031901 | Bacteria | 4721 |
| 738 | Ga0307406_10296208 | 3300031901 | Bacteria | 1241 |
| 739 | Ga0307406_10846385 | 3300031901 | Bacteria | 775 |
| 740 | Ga0307407_10183932 | 3300031903 | Bacteria | 1387 |
| 741 | Ga0307412_10150111 | 3300031911 | Bacteria | 1718 |
| 742 | Ga0307416_100002710 | 3300032002 | Bacteria | 10263 |
| 743 | Ga0307416_100023052 | 3300032002 | Bacteria | 4509 |
| 744 | Ga0307414_10057246 | 3300032004 | Bacteria | 2739 |
| 745 | Ga0307414_10616294 | 3300032004 | Bacteria | 975 |
| 746 | Ga0307414_10720220 | 3300032004 | Bacteria | 905 |
| 747 | Ga0307411_10074281 | 3300032005 | Bacteria | 2316 |
| 748 | Ga0307411_10131550 | 3300032005 | Bacteria | 1829 |
| 749 | Ga0307411_10234259 | 3300032005 | Bacteria | 1433 |
| 750 | Ga0307411_10760585 | 3300032005 | Bacteria | 850 |
| 751 | Ga0307415_100224895 | 3300032126 | Bacteria | 1507 |
| 752 | Ga0316583_10000054 | 3300032133 | Bacteria | 22435 |
| 753 | Ga0316593_10000414 | 3300032168 | Bacteria | 7720 |
| 754 | Ga0307507_10169912 | 3300033179 | Bacteria | 1586 |
| 755 | Ga0307510_10001484 | 3300033180 | Bacteria | 25882 |
| 756 | Ga0307510_10022280 | 3300033180 | Bacteria | 7362 |
| 757 | Ga0307510_10104851 | 3300033180 | Bacteria | 2598 |
| 758 | Ga0307510_10288733 | 3300033180 | Bacteria | 1107 |
| 759 | Ga0307510_10378469 | 3300033180 | Unclassified | 861 |
| 760 | Ga0316592_1083445 | 3300033524 | Bacteria | 728 |
| 761 | Ga0316596_1000067 | 3300033541 | Bacteria | 12032 |
| 762 | Ga0373951_0123659 | 3300035091 | Bacteria | 706 |
| 763 | Ga0373943_0138369 | 3300035170 | Bacteria | 1310 |
| 764 | Ga0373961_0172924 | 3300035241 | Bacteria | 748 |
| 765 | Ga0316574_0074095 | 3300035398 | Bacteria | 2154 |
| 766 | Ga0373924_0342733 | 3300035410 | Bacteria | 666 |
| 767 | Ga0373935_0630148 | 3300035692 | Bacteria | 786 |
| 768 | Ga0373927_0215378 | 3300035695 | Bacteria | 1262 |
| 769 | Ga0373937_0068171 | 3300036401 | Bacteria | 3280 |
| 770 | Ga0373937_0964849 | 3300036401 | Bacteria | 801 |
| 771 | Ga0316584_0532424 | 3300036712 | Bacteria | 822 |
| 772 | Ga0373925_0208539 | 3300037068 | Bacteria | 1556 |
| 773 | Ga0373925_0404881 | 3300037068 | Bacteria | 1113 |
| 774 | Ga0395899_0001458 | 3300037312 | Bacteria | 20151 |
| 775 | Ga0395899_0014962 | 3300037312 | Bacteria | 5918 |
| 776 | Ga0395899_0017956 | 3300037312 | Bacteria | 5383 |
| 777 | Ga0395899_0097580 | 3300037312 | Bacteria | 2124 |
| 778 | Ga0395900_0000179 | 3300037418 | Bacteria | 102024 |
| 779 | Ga0395900_0010138 | 3300037418 | Bacteria | 9636 |
| 780 | Ga0395900_0044036 | 3300037418 | Bacteria | 4600 |
| 781 | Ga0395900_0056934 | 3300037418 | Bacteria | 4024 |
| 782 | Ga0395900_0111797 | 3300037418 | Bacteria | 2805 |
| 783 | Ga0395900_0172925 | 3300037418 | Bacteria | 2198 |
| 784 | Ga0395900_0443378 | 3300037418 | Bacteria | 1255 |
| 785 | Ga0395900_0511723 | 3300037418 | Bacteria | 1149 |
| 786 | Ga0395898_0022101 | 3300037466 | Bacteria | 6444 |
| 787 | Ga0395898_0110973 | 3300037466 | Bacteria | 2629 |
| 788 | Ga0395898_0460454 | 3300037466 | Bacteria | 1211 |
| 789 | Ga0395905_0000589 | 3300037471 | Bacteria | 48792 |
| 790 | Ga0395905_0006561 | 3300037471 | Bacteria | 11689 |
| 791 | Ga0395905_0011379 | 3300037471 | Bacteria | 8596 |
| 792 | Ga0395905_0011469 | 3300037471 | Bacteria | 8565 |
| 793 | Ga0395905_0093908 | 3300037471 | Bacteria | 2813 |
| 794 | Ga0395905_0151227 | 3300037471 | Bacteria | 2184 |
| 795 | Ga0395905_0294014 | 3300037471 | Bacteria | 1511 |
| 796 | Ga0395905_0546484 | 3300037471 | Bacteria | 1059 |
| 797 | Ga0316581_0011584 | 3300037588 | Bacteria | 2469 |
| 798 | Ga0395901_0098131 | 3300038443 | Bacteria | 3071 |
| 799 | Ga0395901_0352205 | 3300038443 | Bacteria | 1519 |
| 800 | Ga0242420_044146 | 3300038996 | Bacteria | 858 |
| 801 | Ga0400483_079285 | 3300039062 | Bacteria | 2335 |
| 802 | Ga0436365_1158146 | 3300039437 | Bacteria | 4249 |
| 803 | Ga0436360_0973346 | 3300039438 | Bacteria | 1384 |
| 804 | Ga0436361_0133265 | 3300039447 | Bacteria | 1009 |
| 805 | Ga0436361_0347622 | 3300039447 | Bacteria | 1085 |
| 806 | Ga0436361_0425380 | 3300039447 | Bacteria | 1159 |
| 807 | Ga0436361_0429567 | 3300039447 | Bacteria | 1004 |
| 808 | Ga0436361_0549519 | 3300039447 | Bacteria | 3416 |
| 809 | Ga0436361_0622987 | 3300039447 | Bacteria | 42920 |
| 810 | Ga0436361_1141426 | 3300039447 | Bacteria | 2126 |
| 811 | Ga0451845_0394058 | 3300041501 | Bacteria | 860 |
| 812 | Ga0451853_1213795 | 3300041512 | Bacteria | 2378 |
| 813 | Ga0439441_024922 | 3300042001 | Bacteria | 1126 |
| 814 | Ga0439448_0000328 | 3300042005 | Bacteria | 10546 |
| 815 | Ga0439448_0152937 | 3300042005 | Bacteria | 801 |
| 816 | Ga0439455_0032156 | 3300042012 | Bacteria | 1310 |
| 817 | Ga0450899_025886 | 3300042135 | Bacteria | 701 |
| 818 | Ga0439434_0222098 | 3300042435 | Bacteria | 641 |
| 819 | Ga0439464_0001296 | 3300042439 | Bacteria | 5820 |
| 820 | Ga0451577_0154121 | 3300042876 | Bacteria | 2067 |
| 821 | Ga0451577_0682584 | 3300042876 | Bacteria | 931 |
| 822 | Ga0451577_0716177 | 3300042876 | Bacteria | 906 |
| 823 | Ga0466969_0010333 | 3300044656 | Bacteria | 4950 |
| 824 | Ga0466969_0034399 | 3300044656 | Bacteria | 2567 |
| 825 | Ga0466972_0003323 | 3300044658 | Bacteria | 7976 |
| 826 | Ga0466972_0029231 | 3300044658 | Bacteria | 2713 |
| 827 | Ga0466982_0059055 | 3300044672 | Bacteria | 2358 |
| 828 | Ga0466965_0000489 | 3300044683 | Bacteria | 14080 |
| 829 | Ga0466965_0019428 | 3300044683 | Bacteria | 3261 |
| 830 | Ga0466966_0002592 | 3300044684 | Bacteria | 11843 |
| 831 | Ga0466966_0017490 | 3300044684 | Bacteria | 4736 |
| 832 | Ga0466966_0150758 | 3300044684 | Bacteria | 1418 |
| 833 | Ga0466961_0000499 | 3300044693 | Bacteria | 25055 |
| 834 | Ga0466961_0015851 | 3300044693 | Bacteria | 4835 |
| 835 | Ga0466961_0283452 | 3300044693 | Bacteria | 1013 |
| 836 | Ga0466961_0287662 | 3300044693 | Bacteria | 1005 |
| 837 | Ga0466964_0001971 | 3300044706 | Bacteria | 7202 |
| 838 | Ga0466964_0002101 | 3300044706 | Bacteria | 7014 |
| 839 | Ga0466964_0013348 | 3300044706 | Bacteria | 3116 |
| 840 | Ga0466964_0040453 | 3300044706 | Bacteria | 1882 |
| 841 | Ga0453684_0000824 | 3300044712 | Bacteria | 104740 |
| 842 | Ga0453684_0064148 | 3300044712 | Bacteria | 4694 |
| 843 | Ga0453684_0184932 | 3300044712 | Bacteria | 2443 |
| 844 | Ga0453684_0660891 | 3300044712 | Bacteria | 1139 |
| 845 | Ga0466968_0019229 | 3300044735 | Bacteria | 2748 |
| 846 | Ga0466968_0098760 | 3300044735 | Bacteria | 1301 |
| 847 | Ga0466968_0162729 | 3300044735 | Bacteria | 1030 |
| 848 | Ga0466968_0295889 | 3300044735 | Bacteria | 777 |
| 849 | Ga0466968_0311059 | 3300044735 | Bacteria | 759 |
| 850 | Ga0466968_0340374 | 3300044735 | Bacteria | 727 |
| 851 | Ga0466970_0013753 | 3300044765 | Bacteria | 4151 |
| 852 | Ga0466970_0018403 | 3300044765 | Bacteria | 3615 |
| 853 | Ga0466970_0018910 | 3300044765 | Bacteria | 3568 |
| 854 | Ga0466970_0023541 | 3300044765 | Bacteria | 3217 |
| 855 | Ga0466970_0057278 | 3300044765 | Bacteria | 2083 |
| 856 | Ga0466957_0007220 | 3300044842 | Bacteria | 6280 |
| 857 | Ga0466957_0011423 | 3300044842 | Bacteria | 5124 |
| 858 | Ga0466957_0020219 | 3300044842 | Bacteria | 3917 |
| 859 | Ga0466957_0124393 | 3300044842 | Bacteria | 1647 |
| 860 | Ga0466957_0262716 | 3300044842 | Bacteria | 1151 |
| 861 | Ga0466957_0526317 | 3300044842 | Bacteria | 822 |
| 862 | Ga0466957_0746495 | 3300044842 | Bacteria | 693 |
| 863 | Ga0466960_0075132 | 3300044901 | Bacteria | 1690 |
| 864 | Ga0466960_0096184 | 3300044901 | Bacteria | 1518 |
| 865 | Ga0466959_0031818 | 3300045049 | Bacteria | 3904 |
| 866 | Ga0466959_0047561 | 3300045049 | Bacteria | 3155 |
| 867 | Ga0466959_0061189 | 3300045049 | Bacteria | 2738 |
| 868 | Ga0466959_0087374 | 3300045049 | Bacteria | 2242 |
| 869 | Ga0466959_0103594 | 3300045049 | Bacteria | 2036 |
| 870 | Ga0466959_0344930 | 3300045049 | Bacteria | 1016 |
| 871 | Ga0466959_0751783 | 3300045049 | Bacteria | 652 |
| 872 | Ga0451576_0000591 | 3300045051 | Bacteria | 76735 |
| 873 | Ga0451576_0001118 | 3300045051 | Bacteria | 48728 |
| 874 | Ga0451576_0070290 | 3300045051 | Bacteria | 3644 |
| 875 | Ga0451576_0087763 | 3300045051 | Bacteria | 3235 |
| 876 | Ga0451576_0159444 | 3300045051 | Bacteria | 2354 |
| 877 | Ga0451576_0430090 | 3300045051 | Bacteria | 1385 |
| 878 | Ga0451576_1013033 | 3300045051 | Bacteria | 870 |
| 879 | Ga0466958_0008210 | 3300045836 | Bacteria | 5782 |
| 880 | Ga0466958_0219743 | 3300045836 | Bacteria | 1212 |
| 881 | Ga0466967_0059649 | 3300045976 | Bacteria | 3378 |
| 882 | Ga0466967_0926499 | 3300045976 | Bacteria | 867 |
| 883 | Ga0495592_0000495 | 3300046454 | Bacteria | 28713 |
| 884 | Ga0495592_0400949 | 3300046454 | Bacteria | 869 |
| 885 | Ga0495603_0389379 | 3300046455 | Bacteria | 799 |
| 886 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 887 | Ga0495590_0001173 | 3300046457 | Bacteria | 11470 |
| 888 | Ga0495590_0015488 | 3300046457 | Bacteria | 2767 |
| 889 | Ga0495590_0151463 | 3300046457 | Bacteria | 841 |
| 890 | Ga0495591_010008 | 3300046458 | Bacteria | 3715 |
| 891 | Ga0495591_016927 | 3300046458 | Bacteria | 2519 |
| 892 | Ga0495629_0000105 | 3300046459 | Bacteria | 74421 |
| 893 | Ga0495629_0556838 | 3300046459 | Bacteria | 769 |
| 894 | Ga0495638_0001843 | 3300046460 | Bacteria | 18350 |
| 895 | Ga0495638_0021407 | 3300046460 | Bacteria | 4262 |
| 896 | Ga0495638_0040024 | 3300046460 | Bacteria | 2972 |
| 897 | Ga0495651_0203148 | 3300046462 | Bacteria | 1385 |
| 898 | Ga0495651_0673394 | 3300046462 | Bacteria | 647 |
| 899 | Ga0495653_0035291 | 3300046463 | Bacteria | 3947 |
| 900 | Ga0495650_0001361 | 3300046471 | Bacteria | 24240 |
| 901 | Ga0495650_0098010 | 3300046471 | Bacteria | 1104 |
| 902 | Ga0495580_0020609 | 3300046472 | Bacteria | 4876 |
| 903 | Ga0495580_0056837 | 3300046472 | Bacteria | 2755 |
| 904 | Ga0495580_0614608 | 3300046472 | Bacteria | 717 |
| 905 | Ga0495582_0200343 | 3300046473 | Bacteria | 1140 |
| 906 | Ga0495582_0413651 | 3300046473 | Bacteria | 778 |
| 907 | Ga0495605_0004593 | 3300046474 | Bacteria | 8080 |
| 908 | Ga0495605_0005426 | 3300046474 | Bacteria | 7425 |
| 909 | Ga0495605_0007136 | 3300046474 | Bacteria | 6359 |
| 910 | Ga0495605_0060484 | 3300046474 | Bacteria | 1815 |
| 911 | Ga0495605_0159944 | 3300046474 | Bacteria | 1000 |
| 912 | Ga0495639_0063891 | 3300046475 | Bacteria | 1691 |
| 913 | Ga0495664_0387319 | 3300046477 | Bacteria | 840 |
| 914 | Ga0495584_0002713 | 3300046491 | Bacteria | 9935 |
| 915 | Ga0495584_0012621 | 3300046491 | Bacteria | 4314 |
| 916 | Ga0495584_0076567 | 3300046491 | Bacteria | 1682 |
| 917 | Ga0495584_0127815 | 3300046491 | Bacteria | 1288 |
| 918 | Ga0495585_0012863 | 3300046492 | Bacteria | 4918 |
| 919 | Ga0495585_0045420 | 3300046492 | Bacteria | 2451 |
| 920 | Ga0495585_0136206 | 3300046492 | Bacteria | 1289 |
| 921 | Ga0495596_0002830 | 3300046500 | Bacteria | 9064 |
| 922 | Ga0495596_0007897 | 3300046500 | Bacteria | 4766 |
| 923 | Ga0495596_0013027 | 3300046500 | Bacteria | 3542 |
| 924 | Ga0495607_0002447 | 3300046501 | Bacteria | 15114 |
| 925 | Ga0495607_0003605 | 3300046501 | Bacteria | 11763 |
| 926 | Ga0495607_0018017 | 3300046501 | Bacteria | 4514 |
| 927 | Ga0495607_0019153 | 3300046501 | Bacteria | 4352 |
| 928 | Ga0495607_0057059 | 3300046501 | Bacteria | 2239 |
| 929 | Ga0495583_0002744 | 3300046506 | Bacteria | 14573 |
| 930 | Ga0495583_0013367 | 3300046506 | Bacteria | 4582 |
| 931 | Ga0495583_0016125 | 3300046506 | Bacteria | 4029 |
| 932 | Ga0495583_0027562 | 3300046506 | Bacteria | 2803 |
| 933 | Ga0495583_0038999 | 3300046506 | Bacteria | 2240 |
| 934 | Ga0495583_0088521 | 3300046506 | Bacteria | 1336 |
| 935 | Ga0495606_0002227 | 3300046507 | Bacteria | 23133 |
| 936 | Ga0495606_0008385 | 3300046507 | Bacteria | 8994 |
| 937 | Ga0495606_0035152 | 3300046507 | Bacteria | 3429 |
| 938 | Ga0495606_0035892 | 3300046507 | Bacteria | 3384 |
| 939 | Ga0495606_0109936 | 3300046507 | Bacteria | 1664 |
| 940 | Ga0495606_0209924 | 3300046507 | Bacteria | 1103 |
| 941 | Ga0495610_0000583 | 3300046512 | Bacteria | 36114 |
| 942 | Ga0495610_0013836 | 3300046512 | Bacteria | 4770 |
| 943 | Ga0495610_0065228 | 3300046512 | Bacteria | 1719 |
| 944 | Ga0495616_0012802 | 3300046513 | Bacteria | 4746 |
| 945 | Ga0495616_0015635 | 3300046513 | Bacteria | 4216 |
| 946 | Ga0495616_0016448 | 3300046513 | Bacteria | 4094 |
| 947 | Ga0495616_0027829 | 3300046513 | Bacteria | 2997 |
| 948 | Ga0495616_0063245 | 3300046513 | Bacteria | 1809 |
| 949 | Ga0495628_0157730 | 3300046516 | Bacteria | 1726 |
| 950 | Ga0495628_0386946 | 3300046516 | Bacteria | 1023 |
| 951 | Ga0495628_0555003 | 3300046516 | Bacteria | 824 |
| 952 | Ga0495630_0090035 | 3300046517 | Bacteria | 2318 |
| 953 | Ga0495630_0389449 | 3300046517 | Bacteria | 1067 |
| 954 | Ga0495630_0597093 | 3300046517 | Bacteria | 846 |
| 955 | Ga0495631_0001383 | 3300046518 | Bacteria | 14748 |
| 956 | Ga0495631_0014780 | 3300046518 | Bacteria | 3758 |
| 957 | Ga0495631_0044586 | 3300046518 | Bacteria | 1953 |
| 958 | Ga0495631_0070766 | 3300046518 | Bacteria | 1508 |
| 959 | Ga0495632_0006665 | 3300046519 | Bacteria | 7384 |
| 960 | Ga0495632_0043451 | 3300046519 | Bacteria | 2246 |
| 961 | Ga0495632_0047781 | 3300046519 | Bacteria | 2121 |
| 962 | Ga0495637_0000006 | 3300046520 | Bacteria | 435763 |
| 963 | Ga0495643_0015349 | 3300046522 | Bacteria | 4528 |
| 964 | Ga0495643_0038910 | 3300046522 | Bacteria | 2602 |
| 965 | Ga0495643_0166771 | 3300046522 | Bacteria | 1079 |
| 966 | Ga0495644_0021625 | 3300046523 | Bacteria | 2453 |
| 967 | Ga0495644_0060633 | 3300046523 | Bacteria | 1422 |
| 968 | Ga0495648_0012825 | 3300046524 | Bacteria | 6223 |
| 969 | Ga0495648_0030902 | 3300046524 | Bacteria | 3534 |
| 970 | Ga0495648_0079312 | 3300046524 | Bacteria | 1874 |
| 971 | Ga0495648_0116953 | 3300046524 | Bacteria | 1440 |
| 972 | Ga0495648_0143650 | 3300046524 | Bacteria | 1253 |
| 973 | Ga0495648_0177411 | 3300046524 | Bacteria | 1086 |
| 974 | Ga0495663_0005054 | 3300046525 | Bacteria | 3685 |
| 975 | Ga0495642_0010302 | 3300046528 | Bacteria | 3580 |
| 976 | Ga0495642_0035367 | 3300046528 | Bacteria | 2015 |
| 977 | Ga0495642_0050457 | 3300046528 | Bacteria | 1711 |
| 978 | Ga0495642_0050668 | 3300046528 | Bacteria | 1707 |
| 979 | Ga0495642_0126721 | 3300046528 | Bacteria | 1098 |
| 980 | Ga0495652_0074591 | 3300046529 | Bacteria | 2821 |
| 981 | Ga0495654_0042687 | 3300046530 | Bacteria | 2250 |
| 982 | Ga0495654_0135295 | 3300046530 | Bacteria | 1103 |
| 983 | Ga0495654_0157225 | 3300046530 | Bacteria | 1001 |
| 984 | Ga0495665_0036302 | 3300046531 | Bacteria | 2631 |
| 985 | Ga0495586_0028974 | 3300046535 | Bacteria | 2964 |
| 986 | Ga0495598_0042200 | 3300046537 | Bacteria | 1338 |
| 987 | Ga0495598_0117729 | 3300046537 | Bacteria | 897 |
| 988 | Ga0495609_0001477 | 3300046538 | Bacteria | 15592 |
| 989 | Ga0495609_0010243 | 3300046538 | Bacteria | 4504 |
| 990 | Ga0495609_0017111 | 3300046538 | Bacteria | 3370 |
| 991 | Ga0495609_0024355 | 3300046538 | Bacteria | 2777 |
| 992 | Ga0495621_0045728 | 3300046539 | Bacteria | 1551 |
| 993 | Ga0495621_0104122 | 3300046539 | Bacteria | 1083 |
| 994 | Ga0495621_0188009 | 3300046539 | Bacteria | 827 |
| 995 | Ga0495597_0002647 | 3300046542 | Bacteria | 11104 |
| 996 | Ga0495597_0043387 | 3300046542 | Bacteria | 2003 |
| 997 | Ga0495645_0002681 | 3300046543 | Bacteria | 12086 |
| 998 | Ga0495645_0025935 | 3300046543 | Bacteria | 4255 |
| 999 | Ga0495645_0111443 | 3300046543 | Bacteria | 1935 |
| 1000 | Ga0495645_0394373 | 3300046543 | Bacteria | 883 |
| 1001 | Ga0495622_0057561 | 3300046557 | Bacteria | 1802 |
| 1002 | Ga0495633_0007426 | 3300046558 | Bacteria | 6307 |
| 1003 | Ga0495633_0042129 | 3300046558 | Bacteria | 2170 |
| 1004 | Ga0495656_0074089 | 3300046615 | Bacteria | 1520 |
| 1005 | Ga0495668_0004131 | 3300046616 | Bacteria | 10498 |
| 1006 | Ga0495668_0021458 | 3300046616 | Bacteria | 3703 |
| 1007 | Ga0495668_0025097 | 3300046616 | Bacteria | 3388 |
| 1008 | Ga0495668_0098764 | 3300046616 | Bacteria | 1597 |
| 1009 | Ga0495668_0212538 | 3300046616 | Bacteria | 1059 |
| 1010 | Ga0495668_0250847 | 3300046616 | Bacteria | 969 |
| 1011 | Ga0495611_0001407 | 3300046648 | Bacteria | 11995 |
| 1012 | Ga0495611_0011257 | 3300046648 | Bacteria | 3792 |
| 1013 | Ga0495611_0214317 | 3300046648 | Bacteria | 896 |
| 1014 | Ga0495625_0001105 | 3300046660 | Bacteria | 35003 |
| 1015 | Ga0495625_0124205 | 3300046660 | Bacteria | 1753 |
| 1016 | Ga0495625_0438235 | 3300046660 | Bacteria | 809 |
| 1017 | Ga0495635_0160976 | 3300046663 | Bacteria | 1527 |
| 1018 | Ga0495659_0008842 | 3300046664 | Bacteria | 3207 |
| 1019 | Ga0495661_0018647 | 3300046665 | Bacteria | 4557 |
| 1020 | Ga0495661_0030072 | 3300046665 | Bacteria | 3461 |
| 1021 | Ga0495661_0040383 | 3300046665 | Bacteria | 2893 |
| 1022 | Ga0495661_0072068 | 3300046665 | Bacteria | 2016 |
| 1023 | Ga0495661_0162470 | 3300046665 | Bacteria | 1197 |
| 1024 | Ga0495588_0053875 | 3300046674 | Bacteria | 2074 |
| 1025 | Ga0495599_0022101 | 3300046678 | Bacteria | 3969 |
| 1026 | Ga0495599_0248455 | 3300046678 | Bacteria | 1083 |
| 1027 | Ga0495623_0002817 | 3300046679 | Bacteria | 11470 |
| 1028 | Ga0495623_0006621 | 3300046679 | Bacteria | 7542 |
| 1029 | Ga0495646_0023757 | 3300046680 | Bacteria | 3859 |
| 1030 | Ga0495647_0010284 | 3300046681 | Bacteria | 3184 |
| 1031 | Ga0495647_0133543 | 3300046681 | Bacteria | 1053 |
| 1032 | Ga0495658_0019071 | 3300046683 | Bacteria | 3576 |
| 1033 | Ga0495658_0086939 | 3300046683 | Bacteria | 1845 |
| 1034 | Ga0495658_0192379 | 3300046683 | Bacteria | 1269 |
| 1035 | Ga0495658_0425661 | 3300046683 | Bacteria | 847 |
| 1036 | Ga0495669_0000597 | 3300046684 | Bacteria | 15822 |
| 1037 | Ga0495669_0023054 | 3300046684 | Bacteria | 2707 |
| 1038 | Ga0495669_0030746 | 3300046684 | Bacteria | 2357 |
| 1039 | Ga0495669_0055160 | 3300046684 | Bacteria | 1789 |
| 1040 | Ga0495669_0156332 | 3300046684 | Bacteria | 1081 |
| 1041 | Ga0495669_0158032 | 3300046684 | Bacteria | 1075 |
| 1042 | Ga0495624_0056754 | 3300046690 | Bacteria | 2463 |
| 1043 | Ga0495624_0104781 | 3300046690 | Bacteria | 1740 |
| 1044 | Ga0495670_0006236 | 3300046691 | Bacteria | 5852 |
| 1045 | Ga0495670_0019881 | 3300046691 | Bacteria | 3309 |
| 1046 | Ga0495670_0065859 | 3300046691 | Bacteria | 1827 |
| 1047 | Ga0495671_0004937 | 3300046692 | Bacteria | 7866 |
| 1048 | Ga0495671_0020689 | 3300046692 | Bacteria | 3466 |
| 1049 | Ga0495671_0025197 | 3300046692 | Bacteria | 3093 |
| 1050 | Ga0495671_0060409 | 3300046692 | Bacteria | 1871 |
| 1051 | Ga0495671_0061381 | 3300046692 | Bacteria | 1854 |
| 1052 | Ga0495671_0118782 | 3300046692 | Bacteria | 1290 |
| 1053 | Ga0495671_0193180 | 3300046692 | Bacteria | 988 |
| 1054 | Ga0495649_0001583 | 3300046694 | Bacteria | 17033 |
| 1055 | Ga0495649_0004743 | 3300046694 | Bacteria | 8817 |
| 1056 | Ga0495649_0025057 | 3300046694 | Bacteria | 3323 |
| 1057 | Ga0495649_0101728 | 3300046694 | Bacteria | 1527 |
| 1058 | Ga0495649_0121427 | 3300046694 | Bacteria | 1381 |
| 1059 | Ga0495589_0010898 | 3300046794 | Bacteria | 4723 |
| 1060 | Ga0495589_0023119 | 3300046794 | Bacteria | 3168 |
| 1061 | Ga0495589_0035270 | 3300046794 | Bacteria | 2508 |
| 1062 | Ga0495589_0039507 | 3300046794 | Bacteria | 2357 |
| 1063 | Ga0495589_0240213 | 3300046794 | Bacteria | 848 |
| 1064 | Ga0495660_0032918 | 3300046810 | Bacteria | 2909 |
| 1065 | Ga0495660_0111133 | 3300046810 | Bacteria | 1398 |
| 1066 | Ga0495581_0010374 | 3300047315 | Bacteria | 5390 |
| 1067 | Ga0495604_0039338 | 3300047317 | Bacteria | 3717 |
| 1068 | Ga0495604_0052611 | 3300047317 | Bacteria | 3152 |
| 1069 | Ga0495636_0011053 | 3300047318 | Bacteria | 3572 |
| 1070 | Ga0495636_0048126 | 3300047318 | Bacteria | 1781 |
| 1071 | Ga0495636_0048737 | 3300047318 | Bacteria | 1770 |
| 1072 | Ga0495636_0317301 | 3300047318 | Bacteria | 731 |
| 1073 | Ga0495674_0015753 | 3300047319 | Bacteria | 7057 |
| 1074 | Ga0495674_0545441 | 3300047319 | Bacteria | 923 |
| 1075 | Ga0495672_0000118 | 3300047320 | Bacteria | 124396 |
| 1076 | Ga0495672_0013610 | 3300047320 | Bacteria | 5603 |
| 1077 | Ga0495672_0020289 | 3300047320 | Bacteria | 4361 |
| 1078 | Ga0495672_0035117 | 3300047320 | Bacteria | 3089 |
| 1079 | Ga0495672_0048827 | 3300047320 | Bacteria | 2508 |
| 1080 | Ga0495676_0015875 | 3300047321 | Bacteria | 6693 |
| 1081 | Ga0495680_0014284 | 3300047322 | Bacteria | 6885 |
| 1082 | Ga0495683_0003322 | 3300047323 | Bacteria | 9404 |
| 1083 | Ga0495683_0015146 | 3300047323 | Bacteria | 4017 |
| 1084 | Ga0495683_0050400 | 3300047323 | Bacteria | 2083 |
| 1085 | Ga0495683_0140221 | 3300047323 | Bacteria | 1133 |
| 1086 | Ga0495687_000166 | 3300047443 | Bacteria | 98891 |
| 1087 | Ga0495687_011756 | 3300047443 | Bacteria | 4680 |
| 1088 | Ga0495687_015528 | 3300047443 | Bacteria | 3868 |
| 1089 | Ga0495687_093389 | 3300047443 | Bacteria | 1146 |
| 1090 | Ga0495675_0062194 | 3300047444 | Bacteria | 2364 |
| 1091 | Ga0495675_0064432 | 3300047444 | Bacteria | 2318 |
| 1092 | Ga0495675_0152634 | 3300047444 | Bacteria | 1426 |
| 1093 | Ga0495677_0001700 | 3300047445 | Bacteria | 8840 |
| 1094 | Ga0495677_0018416 | 3300047445 | Bacteria | 2532 |
| 1095 | Ga0495677_0139537 | 3300047445 | Bacteria | 930 |
| 1096 | Ga0495679_001920 | 3300047446 | Bacteria | 11114 |
| 1097 | Ga0495679_014054 | 3300047446 | Bacteria | 2982 |
| 1098 | Ga0495679_034720 | 3300047446 | Bacteria | 1603 |
| 1099 | Ga0495685_036318 | 3300047447 | Bacteria | 1692 |
| 1100 | Ga0495673_0036689 | 3300047469 | Bacteria | 2245 |
| 1101 | Ga0495681_0012047 | 3300047470 | Bacteria | 5103 |
| 1102 | Ga0495681_0015148 | 3300047470 | Bacteria | 4374 |
| 1103 | Ga0495681_0188366 | 3300047470 | Bacteria | 844 |
| 1104 | Ga0495686_0001863 | 3300047472 | Bacteria | 21173 |
| 1105 | Ga0495686_0003218 | 3300047472 | Bacteria | 14378 |
| 1106 | Ga0495686_0025029 | 3300047472 | Bacteria | 3914 |
| 1107 | Ga0495686_0180752 | 3300047472 | Bacteria | 1222 |
| 1108 | Ga0495686_0182009 | 3300047472 | Bacteria | 1217 |
| 1109 | Ga0495593_0021851 | 3300047673 | Bacteria | 3570 |
| 1110 | Ga0495593_0024457 | 3300047673 | Bacteria | 3347 |
| 1111 | Ga0495593_0035923 | 3300047673 | Bacteria | 2688 |
| 1112 | Ga0495593_0112648 | 3300047673 | Bacteria | 1388 |
| 1113 | Ga0495602_0046136 | 3300048088 | Bacteria | 3938 |
| 1114 | Ga0495602_0057269 | 3300048088 | Bacteria | 3420 |
| 1115 | Ga0495614_0014934 | 3300048089 | Bacteria | 3393 |
| 1116 | Ga0495615_0137751 | 3300048090 | Bacteria | 718 |
| 1117 | Ga0495626_0004474 | 3300048091 | Bacteria | 8568 |
| 1118 | Ga0495626_0007307 | 3300048091 | Bacteria | 6161 |
| 1119 | Ga0496100_0025801 | 3300048903 | Bacteria | 3596 |
| 1120 | Ga0496100_0044964 | 3300048903 | Bacteria | 2831 |
| 1121 | Ga0496100_0088238 | 3300048903 | Bacteria | 2110 |
| 1122 | Ga0496101_0004607 | 3300048904 | Bacteria | 8707 |
| 1123 | Ga0496101_0013292 | 3300048904 | Bacteria | 5513 |
| 1124 | Ga0496101_0034361 | 3300048904 | Bacteria | 3580 |
| 1125 | Ga0496101_0339944 | 3300048904 | Bacteria | 1179 |
| 1126 | Ga0496101_0356684 | 3300048904 | Bacteria | 1149 |
| 1127 | Ga0496101_0493517 | 3300048904 | Bacteria | 967 |
| 1128 | Ga0496102_0000425 | 3300048905 | Bacteria | 48803 |
| 1129 | Ga0496102_0010249 | 3300048905 | Bacteria | 8058 |
| 1130 | Ga0496102_0047891 | 3300048905 | Bacteria | 3886 |
| 1131 | Ga0496102_0080150 | 3300048905 | Bacteria | 3007 |
| 1132 | Ga0496102_0172244 | 3300048905 | Bacteria | 2038 |
| 1133 | Ga0496102_0266147 | 3300048905 | Bacteria | 1616 |
| 1134 | Ga0496103_0002171 | 3300048906 | Bacteria | 12467 |
| 1135 | Ga0496103_0057095 | 3300048906 | Bacteria | 2423 |
| 1136 | Ga0496103_0065089 | 3300048906 | Bacteria | 2273 |
| 1137 | Ga0496104_0064512 | 3300048907 | Bacteria | 3474 |
| 1138 | Ga0496104_0076004 | 3300048907 | Bacteria | 3198 |
| 1139 | Ga0496104_0155748 | 3300048907 | Bacteria | 2192 |
| 1140 | Ga0496104_0624866 | 3300048907 | Bacteria | 987 |
| 1141 | Ga0496105_0021434 | 3300048908 | Bacteria | 5228 |
| 1142 | Ga0496105_0092443 | 3300048908 | Bacteria | 2498 |
| 1143 | Ga0496105_0188458 | 3300048908 | Bacteria | 1687 |
| 1144 | Ga0496105_0604556 | 3300048908 | Bacteria | 850 |
| 1145 | Ga0496106_0062545 | 3300048909 | Bacteria | 2826 |
| 1146 | Ga0496106_0065232 | 3300048909 | Bacteria | 2772 |
| 1147 | Ga0496106_0123642 | 3300048909 | Bacteria | 2024 |
| 1148 | Ga0496106_0397089 | 3300048909 | Bacteria | 1108 |
| 1149 | Ga0496107_0003373 | 3300048910 | Bacteria | 10676 |
| 1150 | Ga0496107_0041522 | 3300048910 | Bacteria | 3303 |
| 1151 | Ga0496107_0123426 | 3300048910 | Bacteria | 1908 |
| 1152 | Ga0496108_0040578 | 3300048911 | Bacteria | 3881 |
| 1153 | Ga0496108_0051243 | 3300048911 | Bacteria | 3458 |
| 1154 | Ga0496108_0431906 | 3300048911 | Bacteria | 1150 |
| 1155 | Ga0496108_0487568 | 3300048911 | Bacteria | 1077 |
| 1156 | Ga0496109_0109656 | 3300048912 | Bacteria | 2566 |
| 1157 | Ga0496109_0139454 | 3300048912 | Bacteria | 2267 |
| 1158 | Ga0496109_0155391 | 3300048912 | Bacteria | 2143 |
| 1159 | Ga0496109_0197290 | 3300048912 | Bacteria | 1892 |
| 1160 | Ga0496109_0405269 | 3300048912 | Bacteria | 1288 |
| 1161 | Ga0496109_0596551 | 3300048912 | Bacteria | 1041 |
| 1162 | Ga0496111_0001327 | 3300048914 | Bacteria | 13919 |
| 1163 | Ga0496112_0107911 | 3300048915 | Bacteria | 2754 |
| 1164 | Ga0496112_0405792 | 3300048915 | Bacteria | 1302 |
| 1165 | Ga0496112_0466841 | 3300048915 | Bacteria | 1199 |
| 1166 | Ga0496113_0024520 | 3300048916 | Bacteria | 4288 |
| 1167 | Ga0496114_0003193 | 3300048917 | Bacteria | 12569 |
| 1168 | Ga0496114_0007150 | 3300048917 | Bacteria | 8805 |
| 1169 | Ga0496114_0243045 | 3300048917 | Bacteria | 1583 |
| 1170 | Ga0496114_0507828 | 3300048917 | Bacteria | 1066 |
| 1171 | Ga0496115_0173428 | 3300048918 | Bacteria | 1783 |
| 1172 | Ga0496116_0013099 | 3300048919 | Bacteria | 6718 |
| 1173 | Ga0496116_0014929 | 3300048919 | Bacteria | 6166 |
| 1174 | Ga0496116_0019076 | 3300048919 | Bacteria | 5264 |
| 1175 | Ga0496117_0033439 | 3300048920 | Bacteria | 3887 |
| 1176 | Ga0496119_0102948 | 3300048922 | Bacteria | 1600 |
| 1177 | Ga0496119_0111082 | 3300048922 | Bacteria | 1521 |
| 1178 | Ga0496120_0123717 | 3300048923 | Bacteria | 1334 |
| 1179 | Ga0496121_0013422 | 3300048924 | Bacteria | 8803 |
| 1180 | Ga0496121_0032350 | 3300048924 | Bacteria | 4756 |
| 1181 | Ga0496121_0037317 | 3300048924 | Bacteria | 4317 |
| 1182 | Ga0496121_0142265 | 3300048924 | Bacteria | 1777 |
| 1183 | Ga0496121_0217818 | 3300048924 | Bacteria | 1347 |
| 1184 | Ga0496122_0013875 | 3300048925 | Bacteria | 7844 |
| 1185 | Ga0496122_0028426 | 3300048925 | Bacteria | 4744 |
| 1186 | Ga0496123_0021967 | 3300048926 | Bacteria | 4936 |
| 1187 | Ga0496123_0060843 | 3300048926 | Bacteria | 2431 |
| 1188 | Ga0496124_0010111 | 3300048927 | Bacteria | 9613 |
| 1189 | Ga0496125_0002625 | 3300048928 | Bacteria | 23036 |
| 1190 | Ga0496125_0126401 | 3300048928 | Bacteria | 1811 |
| 1191 | Ga0496125_0260056 | 3300048928 | Bacteria | 1088 |
| 1192 | Ga0496126_0020071 | 3300048929 | Bacteria | 6561 |
| 1193 | Ga0496126_0067260 | 3300048929 | Bacteria | 3202 |
| 1194 | Ga0496126_0352856 | 3300048929 | Bacteria | 1203 |
| 1195 | Ga0496126_0918858 | 3300048929 | Bacteria | 662 |
| 1196 | Ga0495678_000113 | 3300049459 | Bacteria | 96866 |
| 1197 | Ga0495678_052756 | 3300049459 | Bacteria | 1564 |
| 1198 | Ga0495678_064357 | 3300049459 | Bacteria | 1366 |
| 1199 | Ga0495678_075366 | 3300049459 | Bacteria | 1225 |
| 1200 | Ga0495682_0007048 | 3300049460 | Bacteria | 4498 |
| 1201 | Ga0495682_0024037 | 3300049460 | Bacteria | 2274 |
| 1202 | Ga0495682_0061653 | 3300049460 | Bacteria | 1353 |
| 1203 | Ga0501031_0410964 | 3300049568 | Bacteria | 875 |
| 1204 | Ga0501034_0000385 | 3300049571 | Bacteria | 75496 |
| 1205 | Ga0501036_0180728 | 3300049572 | Bacteria | 1776 |
| 1206 | Ga0501037_0182804 | 3300049573 | Bacteria | 1487 |
| 1207 | Ga0501038_0204622 | 3300049574 | Bacteria | 1582 |
| 1208 | Ga0501039_0007165 | 3300049575 | Bacteria | 8494 |
| 1209 | Ga0501039_0126796 | 3300049575 | Bacteria | 2002 |
| 1210 | Ga0501040_0008414 | 3300049576 | Bacteria | 6703 |
| 1211 | Ga0501040_0445764 | 3300049576 | Bacteria | 932 |
| 1212 | Ga0501041_0016872 | 3300049577 | Bacteria | 4345 |
| 1213 | Ga0501041_0583425 | 3300049577 | Bacteria | 713 |
| 1214 | Ga0501042_0268652 | 3300049578 | Bacteria | 1231 |
| 1215 | Ga0501042_0654332 | 3300049578 | Bacteria | 764 |
| 1216 | Ga0501043_0287238 | 3300049579 | Bacteria | 1260 |
| 1217 | Ga0501043_0482170 | 3300049579 | Bacteria | 928 |
| 1218 | Ga0501046_0016835 | 3300049580 | Bacteria | 6113 |
| 1219 | Ga0501048_0118623 | 3300049582 | Bacteria | 1869 |
| 1220 | Ga0501048_0249390 | 3300049582 | Bacteria | 1260 |
| 1221 | Ga0501068_0302928 | 3300049584 | Bacteria | 1023 |
| 1222 | Ga0501071_0010141 | 3300049587 | Bacteria | 6304 |
| 1223 | Ga0501072_0017384 | 3300049588 | Bacteria | 5525 |
| 1224 | Ga0501072_0794178 | 3300049588 | Bacteria | 742 |
| 1225 | Ga0501074_0213744 | 3300049590 | Bacteria | 1373 |
| 1226 | Ga0501075_0006027 | 3300049591 | Bacteria | 8310 |
| 1227 | Ga0501076_0001751 | 3300049592 | Bacteria | 14664 |
| 1228 | Ga0501076_0604863 | 3300049592 | Bacteria | 904 |
| 1229 | Ga0501077_0013917 | 3300049593 | Bacteria | 5044 |
| 1230 | Ga0501077_0181298 | 3300049593 | Bacteria | 1338 |
| 1231 | Ga0501249_055740 | 3300049679 | Bacteria | 912 |
| 1232 | Ga0501079_0086483 | 3300049741 | Bacteria | 2427 |
| 1233 | Ga0501079_0205993 | 3300049741 | Bacteria | 1536 |
| 1234 | Ga0501079_0457122 | 3300049741 | Bacteria | 1003 |
| 1235 | Ga0501080_0217334 | 3300049742 | Bacteria | 1750 |
| 1236 | Ga0501080_1332921 | 3300049742 | Bacteria | 614 |
| 1237 | Ga0501081_0002036 | 3300049743 | Bacteria | 12604 |
| 1238 | Ga0501081_0082368 | 3300049743 | Bacteria | 2254 |
| 1239 | nmdc:mga0yw44_396601_c1 | 3300050492 | Bacteria | 933 |
| 1240 | nmdc:mga0k408_103712_c1 | 3300050493 | Bacteria | 1678 |
| 1241 | nmdc:mga0k408_150447_c1 | 3300050493 | Bacteria | 1386 |
| 1242 | nmdc:mga0k408_1564_c1 | 3300050493 | Bacteria | 12138 |
| 1243 | nmdc:mga0k408_246477_c1 | 3300050493 | Bacteria | 1067 |
| 1244 | nmdc:mga0k408_42082_c1 | 3300050493 | Bacteria | 2631 |
| 1245 | nmdc:mga06z11_126989_c1 | 3300050494 | Bacteria | 1428 |
| 1246 | nmdc:mga07m45_186925_c1 | 3300050496 | Bacteria | 1205 |
| 1247 | nmdc:mga07m45_240_c1 | 3300050496 | Bacteria | 22136 |
| 1248 | nmdc:mga07m45_29676_c1 | 3300050496 | Bacteria | 3026 |
| 1249 | nmdc:mga07m45_390605_c1 | 3300050496 | Bacteria | 808 |
| 1250 | nmdc:mga07m45_47080_c1 | 3300050496 | Bacteria | 2424 |
| 1251 | nmdc:mga0qj67_4213_c1 | 3300050509 | Bacteria | 10417 |
| 1252 | nmdc:mga0qj67_673677_c1 | 3300050509 | Bacteria | 824 |
| 1253 | nmdc:mga06r32_155764_c1 | 3300050510 | Bacteria | 2266 |
| 1254 | nmdc:mga08y16_106694_c1 | 3300050511 | Bacteria | 2916 |
| 1255 | nmdc:mga08y16_229138_c1 | 3300050511 | Bacteria | 1922 |
| 1256 | nmdc:mga08y16_459834_c1 | 3300050511 | Bacteria | 1297 |
| 1257 | nmdc:mga08y16_482695_c1 | 3300050511 | Bacteria | 1261 |
| 1258 | nmdc:mga08y16_57458_c1 | 3300050511 | Bacteria | 4066 |
| 1259 | Ga0500650_0120701 | 3300053098 | Bacteria | 1222 |
| 1260 | Ga0500593_000371 | 3300053117 | Bacteria | 18072 |
| 1261 | Ga0500594_0007947 | 3300053118 | Bacteria | 2408 |
| 1262 | Ga0500658_0019243 | 3300053134 | Bacteria | 2568 |
| 1263 | Ga0500559_0001133 | 3300053136 | Bacteria | 16045 |
| 1264 | Ga0500561_0027948 | 3300053137 | Bacteria | 1395 |
| 1265 | Ga0500590_015257 | 3300053148 | Bacteria | 3965 |
| 1266 | Ga0500590_144662 | 3300053148 | Bacteria | 1081 |
| 1267 | Ga0500619_000054 | 3300053154 | Bacteria | 34866 |
| 1268 | Ga0500619_004840 | 3300053154 | Bacteria | 2937 |
| 1269 | Ga0500620_046921 | 3300053155 | Bacteria | 1437 |
| 1270 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 1271 | Ga0500625_118289 | 3300053729 | Bacteria | 1071 |
| 1272 | Ga0500587_006581 | 3300053739 | Bacteria | 1536 |
| 1273 | Ga0501084_0054546 | 3300054114 | Bacteria | 3344 |
| 1274 | Ga0501084_0308865 | 3300054114 | Bacteria | 1336 |
| 1275 | Ga0501082_0067871 | 3300060353 | Bacteria | 3071 |
| 1276 | Ga0501082_0114811 | 3300060353 | Bacteria | 2332 |
| 1277 | Ga0466962_0085992 | 3300061719 | Bacteria | 1505 |
| 1278 | Ga0530510_0000042 | 3300061734 | Bacteria | 58436 |
| 1279 | Ga0530510_1001857 | 3300061734 | Bacteria | 639 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003316 | rootH1_10012984 | rootH1_100129843 | 170 |
| 2 | 3300003323 | rootH1_10137895 | rootH1_101378952 | 171 |
| 3 | 3300005339 | Ga0070660_100085744 | Ga0070660_1000857442 | 171 |
| 4 | 3300005366 | Ga0070659_100186400 | Ga0070659_1001864002 | 171 |
| 5 | 3300005563 | Ga0068855_100444873 | Ga0068855_1004448732 | 171 |
| 6 | 3300009093 | Ga0105240_10680036 | Ga0105240_106800362 | 171 |
| 7 | 3300009093 | Ga0105240_11243043 | Ga0105240_112430431 | 171 |
| 8 | 3300009176 | Ga0105242_10032793 | Ga0105242_100327935 | 171 |
| 9 | 3300025256 | Ga0209759_1005314 | Ga0209759_10053141 | 171 |
| 10 | 3300025913 | Ga0207695_10544245 | Ga0207695_105442451 | 171 |
| 11 | 3300025932 | Ga0207690_10808215 | Ga0207690_108082152 | 171 |
| 12 | 3300025960 | Ga0207651_10001690 | Ga0207651_100016908 | 171 |
| 13 | 3300026041 | Ga0207639_10572685 | Ga0207639_105726851 | 171 |
| 14 | 3300026067 | Ga0207678_10569978 | Ga0207678_105699782 | 171 |
| 15 | 3300032133 | Ga0316583_10000054 | Ga0316583_100000545 | 171 |
| 16 | 3300039062 | Ga0400483_079285 | Ga0400483_079285_95_643 | 171 |
| 17 | 3300039447 | Ga0436361_1141426 | Ga0436361_1141426_758_1324 | 171 |
| 18 | 3300044901 | Ga0466960_0075132 | Ga0466960_0075132_862_1425 | 171 |
| 19 | 3300048911 | Ga0496108_0051243 | Ga0496108_0051243_921_1493 | 171 |
| 20 | 3300048912 | Ga0496109_0139454 | Ga0496109_0139454_871_1443 | 171 |
| 21 | 3300050496 | nmdc:mga07m45_240_c1 | nmdc:mga07m45_240_c1_13083_13643 | 171 |
| 22 | 3300005439 | Ga0070711_100540174 | Ga0070711_1005401742 | 172 |
| 23 | 3300006353 | Ga0075370_10008599 | Ga0075370_100085992 | 172 |
| 24 | 3300006844 | Ga0075428_100109618 | Ga0075428_1001096183 | 172 |
| 25 | 3300009147 | Ga0114129_10591848 | Ga0114129_105918482 | 172 |
| 26 | 3300025916 | Ga0207663_10340230 | Ga0207663_103402302 | 172 |
| 27 | 3300031344 | Ga0265316_10666167 | Ga0265316_106661671 | 172 |
| 28 | 3300050496 | nmdc:mga07m45_29676_c1 | nmdc:mga07m45_29676_c1_1197_1781 | 172 |
| 29 | 3300050509 | nmdc:mga0qj67_673677_c1 | nmdc:mga0qj67_673677_c1_12_587 | 172 |
| 30 | iso_pu_bacteria | 2881101125 | 2881103240 | 172 |
| 31 | 3300005353 | Ga0070669_100484343 | Ga0070669_1004843431 | 173 |
| 32 | 3300005618 | Ga0068864_100088530 | Ga0068864_1000885303 | 173 |
| 33 | 3300009177 | Ga0105248_10106940 | Ga0105248_101069402 | 173 |
| 34 | 3300025941 | Ga0207711_10229560 | Ga0207711_102295602 | 173 |
| 35 | 3300026095 | Ga0207676_10059839 | Ga0207676_100598393 | 173 |
| 36 | 3300037471 | Ga0395905_0546484 | Ga0395905_0546484_264_851 | 173 |
| 37 | 3300006195 | Ga0075366_10115026 | Ga0075366_101150262 | 174 |
| 38 | 3300028794 | Ga0307515_10123151 | Ga0307515_101231513 | 174 |
| 39 | 3300042876 | Ga0451577_0682584 | Ga0451577_0682584_29_625 | 174 |
| 40 | 3300044712 | Ga0453684_0184932 | Ga0453684_0184932_574_1170 | 174 |
| 41 | 3300050493 | nmdc:mga0k408_103712_c1 | nmdc:mga0k408_103712_c1_380_976 | 174 |
| 42 | iso_pu_bacteria | 2515154123 | 2515689471 | 174 |
| 43 | iso_pu_bacteria | 2585428062 | 2587758820 | 174 |
| 44 | iso_pu_bacteria | 2901300506 | 2901308156 | 174 |
| 45 | 3300002067 | JGI24735J21928_10002393 | JGI24735J21928_100023935 | 175 |
| 46 | 3300003187 | JGI25151J46595_10029267 | JGI25151J46595_100292673 | 175 |
| 47 | 3300003791 | Ga0055530_10046509 | Ga0055530_100465092 | 175 |
| 48 | 3300005336 | Ga0070680_100106872 | Ga0070680_1001068722 | 175 |
| 49 | 3300005336 | Ga0070680_100694378 | Ga0070680_1006943782 | 175 |
| 50 | 3300005338 | Ga0068868_100871305 | Ga0068868_1008713052 | 175 |
| 51 | 3300005339 | Ga0070660_100010897 | Ga0070660_1000108974 | 175 |
| 52 | 3300005340 | Ga0070689_101314010 | Ga0070689_1013140101 | 175 |
| 53 | 3300005343 | Ga0070687_100003995 | Ga0070687_1000039954 | 175 |
| 54 | 3300005345 | Ga0070692_10072358 | Ga0070692_100723582 | 175 |
| 55 | 3300005347 | Ga0070668_100105862 | Ga0070668_1001058622 | 175 |
| 56 | 3300005353 | Ga0070669_100008805 | Ga0070669_1000088054 | 175 |
| 57 | 3300005353 | Ga0070669_100877275 | Ga0070669_1008772751 | 175 |
| 58 | 3300005354 | Ga0070675_100422924 | Ga0070675_1004229241 | 175 |
| 59 | 3300005354 | Ga0070675_100978778 | Ga0070675_1009787782 | 175 |
| 60 | 3300005356 | Ga0070674_100180955 | Ga0070674_1001809552 | 175 |
| 61 | 3300005364 | Ga0070673_100172901 | Ga0070673_1001729013 | 175 |
| 62 | 3300005365 | Ga0070688_100225616 | Ga0070688_1002256162 | 175 |
| 63 | 3300005438 | Ga0070701_10055247 | Ga0070701_100552472 | 175 |
| 64 | 3300005441 | Ga0070700_100003564 | Ga0070700_1000035647 | 175 |
| 65 | 3300005441 | Ga0070700_100448086 | Ga0070700_1004480862 | 175 |
| 66 | 3300005444 | Ga0070694_100005915 | Ga0070694_1000059154 | 175 |
| 67 | 3300005444 | Ga0070694_100624671 | Ga0070694_1006246712 | 175 |
| 68 | 3300005455 | Ga0070663_100106408 | Ga0070663_1001064082 | 175 |
| 69 | 3300005457 | Ga0070662_100463643 | Ga0070662_1004636432 | 175 |
| 70 | 3300005459 | Ga0068867_100003201 | Ga0068867_1000032014 | 175 |
| 71 | 3300005539 | Ga0068853_100410523 | Ga0068853_1004105232 | 175 |
| 72 | 3300005543 | Ga0070672_100259693 | Ga0070672_1002596932 | 175 |
| 73 | 3300005544 | Ga0070686_100161391 | Ga0070686_1001613912 | 175 |
| 74 | 3300005545 | Ga0070695_100047148 | Ga0070695_1000471482 | 175 |
| 75 | 3300005546 | Ga0070696_100023627 | Ga0070696_1000236273 | 175 |
| 76 | 3300005546 | Ga0070696_100410035 | Ga0070696_1004100352 | 175 |
| 77 | 3300005548 | Ga0070665_100929479 | Ga0070665_1009294792 | 175 |
| 78 | 3300005563 | Ga0068855_100011895 | Ga0068855_1000118959 | 175 |
| 79 | 3300005614 | Ga0068856_100131758 | Ga0068856_1001317582 | 175 |
| 80 | 3300005615 | Ga0070702_100051490 | Ga0070702_1000514902 | 175 |
| 81 | 3300005718 | Ga0068866_10071239 | Ga0068866_100712392 | 175 |
| 82 | 3300005719 | Ga0068861_100003457 | Ga0068861_1000034573 | 175 |
| 83 | 3300005840 | Ga0068870_10183174 | Ga0068870_101831742 | 175 |
| 84 | 3300005844 | Ga0068862_100011607 | Ga0068862_1000116077 | 175 |
| 85 | 3300005844 | Ga0068862_100094400 | Ga0068862_1000944003 | 175 |
| 86 | 3300006038 | Ga0075365_10156624 | Ga0075365_101566242 | 175 |
| 87 | 3300006058 | Ga0075432_10036610 | Ga0075432_100366102 | 175 |
| 88 | 3300006846 | Ga0075430_100000168 | Ga0075430_10000016841 | 175 |
| 89 | 3300006847 | Ga0075431_100044508 | Ga0075431_1000445082 | 175 |
| 90 | 3300006880 | Ga0075429_100784447 | Ga0075429_1007844472 | 175 |
| 91 | 3300006881 | Ga0068865_100212659 | Ga0068865_1002126592 | 175 |
| 92 | 3300006946 | Ga0079104_1015257 | Ga0079104_10152572 | 175 |
| 93 | 3300009093 | Ga0105240_10001844 | Ga0105240_1000184431 | 175 |
| 94 | 3300009094 | Ga0111539_10133059 | Ga0111539_101330592 | 175 |
| 95 | 3300009094 | Ga0111539_10272981 | Ga0111539_102729812 | 175 |
| 96 | 3300009094 | Ga0111539_10397608 | Ga0111539_103976082 | 175 |
| 97 | 3300009094 | Ga0111539_12489100 | Ga0111539_124891001 | 175 |
| 98 | 3300009147 | Ga0114129_10926740 | Ga0114129_109267402 | 175 |
| 99 | 3300009148 | Ga0105243_10066339 | Ga0105243_100663393 | 175 |
| 100 | 3300009174 | Ga0105241_10105240 | Ga0105241_101052402 | 175 |
| 101 | 3300009176 | Ga0105242_10571467 | Ga0105242_105714672 | 175 |
| 102 | 3300009177 | Ga0105248_10007354 | Ga0105248_100073544 | 175 |
| 103 | 3300009551 | Ga0105238_10290002 | Ga0105238_102900022 | 175 |
| 104 | 3300009553 | Ga0105249_10159790 | Ga0105249_101597904 | 175 |
| 105 | 3300010375 | Ga0105239_10101934 | Ga0105239_101019343 | 175 |
| 106 | 3300013104 | Ga0157370_10000310 | Ga0157370_1000031034 | 175 |
| 107 | 3300013105 | Ga0157369_10000525 | Ga0157369_1000052528 | 175 |
| 108 | 3300013296 | Ga0157374_10000138 | Ga0157374_1000013826 | 175 |
| 109 | 3300013306 | Ga0163162_10001494 | Ga0163162_1000149418 | 175 |
| 110 | 3300013307 | Ga0157372_10018279 | Ga0157372_100182792 | 175 |
| 111 | 3300014326 | Ga0157380_10150001 | Ga0157380_101500011 | 175 |
| 112 | 3300014326 | Ga0157380_10964593 | Ga0157380_109645932 | 175 |
| 113 | 3300014497 | Ga0182008_10300639 | Ga0182008_103006392 | 175 |
| 114 | 3300021361 | Ga0213872_10000320 | Ga0213872_1000032030 | 175 |
| 115 | 3300021361 | Ga0213872_10029589 | Ga0213872_100295893 | 175 |
| 116 | 3300021361 | Ga0213872_10045721 | Ga0213872_100457212 | 175 |
| 117 | 3300025256 | Ga0209759_1003505 | Ga0209759_10035053 | 175 |
| 118 | 3300025258 | Ga0209129_1004207 | Ga0209129_10042074 | 175 |
| 119 | 3300025294 | Ga0209025_1002648 | Ga0209025_10026485 | 175 |
| 120 | 3300025298 | Ga0209050_1004945 | Ga0209050_10049455 | 175 |
| 121 | 3300025304 | Ga0209257_1009360 | Ga0209257_10093602 | 175 |
| 122 | 3300025885 | Ga0207653_10113143 | Ga0207653_101131432 | 175 |
| 123 | 3300025899 | Ga0207642_10052794 | Ga0207642_100527942 | 175 |
| 124 | 3300025899 | Ga0207642_10158598 | Ga0207642_101585982 | 175 |
| 125 | 3300025901 | Ga0207688_10289641 | Ga0207688_102896412 | 175 |
| 126 | 3300025904 | Ga0207647_10008975 | Ga0207647_100089754 | 175 |
| 127 | 3300025908 | Ga0207643_10044714 | Ga0207643_100447142 | 175 |
| 128 | 3300025911 | Ga0207654_10191961 | Ga0207654_101919612 | 175 |
| 129 | 3300025913 | Ga0207695_10050820 | Ga0207695_100508203 | 175 |
| 130 | 3300025914 | Ga0207671_10025357 | Ga0207671_100253576 | 175 |
| 131 | 3300025917 | Ga0207660_10038683 | Ga0207660_100386833 | 175 |
| 132 | 3300025917 | Ga0207660_10074410 | Ga0207660_100744104 | 175 |
| 133 | 3300025918 | Ga0207662_10024856 | Ga0207662_100248562 | 175 |
| 134 | 3300025919 | Ga0207657_10012865 | Ga0207657_100128655 | 175 |
| 135 | 3300025921 | Ga0207652_10374554 | Ga0207652_103745542 | 175 |
| 136 | 3300025923 | Ga0207681_10008569 | Ga0207681_100085694 | 175 |
| 137 | 3300025924 | Ga0207694_10129906 | Ga0207694_101299062 | 175 |
| 138 | 3300025926 | Ga0207659_10225726 | Ga0207659_102257262 | 175 |
| 139 | 3300025933 | Ga0207706_10427890 | Ga0207706_104278902 | 175 |
| 140 | 3300025934 | Ga0207686_10204223 | Ga0207686_102042231 | 175 |
| 141 | 3300025935 | Ga0207709_10045854 | Ga0207709_100458542 | 175 |
| 142 | 3300025936 | Ga0207670_11017448 | Ga0207670_110174482 | 175 |
| 143 | 3300025937 | Ga0207669_10448079 | Ga0207669_104480792 | 175 |
| 144 | 3300025938 | Ga0207704_10102281 | Ga0207704_101022813 | 175 |
| 145 | 3300025940 | Ga0207691_10062504 | Ga0207691_100625042 | 175 |
| 146 | 3300025941 | Ga0207711_10006637 | Ga0207711_100066377 | 175 |
| 147 | 3300025942 | Ga0207689_10021769 | Ga0207689_100217695 | 175 |
| 148 | 3300025942 | Ga0207689_10551970 | Ga0207689_105519701 | 175 |
| 149 | 3300025949 | Ga0207667_10054586 | Ga0207667_100545862 | 175 |
| 150 | 3300025961 | Ga0207712_10040848 | Ga0207712_100408483 | 175 |
| 151 | 3300025972 | Ga0207668_10120698 | Ga0207668_101206983 | 175 |
| 152 | 3300025986 | Ga0207658_10006899 | Ga0207658_100068997 | 175 |
| 153 | 3300026075 | Ga0207708_10010099 | Ga0207708_100100995 | 175 |
| 154 | 3300026089 | Ga0207648_10003015 | Ga0207648_1000301518 | 175 |
| 155 | 3300026118 | Ga0207675_100016390 | Ga0207675_1000163904 | 175 |
| 156 | 3300026121 | Ga0207683_11158583 | Ga0207683_111585832 | 175 |
| 157 | 3300027907 | Ga0207428_10065766 | Ga0207428_100657662 | 175 |
| 158 | 3300027907 | Ga0207428_10081399 | Ga0207428_100813992 | 175 |
| 159 | 3300027907 | Ga0207428_10231966 | Ga0207428_102319662 | 175 |
| 160 | 3300027907 | Ga0207428_10817902 | Ga0207428_108179021 | 175 |
| 161 | 3300028379 | Ga0268266_10571810 | Ga0268266_105718102 | 175 |
| 162 | 3300028380 | Ga0268265_10001934 | Ga0268265_1000193420 | 175 |
| 163 | 3300028380 | Ga0268265_10428155 | Ga0268265_104281552 | 175 |
| 164 | 3300028381 | Ga0268264_10235769 | Ga0268264_102357692 | 175 |
| 165 | 3300031250 | Ga0265331_10020075 | Ga0265331_100200754 | 175 |
| 166 | 3300031548 | Ga0307408_100134772 | Ga0307408_1001347723 | 175 |
| 167 | 3300031548 | Ga0307408_100137546 | Ga0307408_1001375463 | 175 |
| 168 | 3300031665 | Ga0316575_10003201 | Ga0316575_100032012 | 175 |
| 169 | 3300031901 | Ga0307406_10846385 | Ga0307406_108463851 | 175 |
| 170 | 3300032002 | Ga0307416_100023052 | Ga0307416_1000230527 | 175 |
| 171 | 3300032005 | Ga0307411_10074281 | Ga0307411_100742812 | 175 |
| 172 | 3300032005 | Ga0307411_10234259 | Ga0307411_102342592 | 175 |
| 173 | 3300032005 | Ga0307411_10760585 | Ga0307411_107605851 | 175 |
| 174 | 3300033180 | Ga0307510_10378469 | Ga0307510_103784691 | 175 |
| 175 | 3300035091 | Ga0373951_0123659 | Ga0373951_0123659_80_613 | 175 |
| 176 | 3300035241 | Ga0373961_0172924 | Ga0373961_0172924_30_566 | 175 |
| 177 | 3300035398 | Ga0316574_0074095 | Ga0316574_0074095_257_799 | 175 |
| 178 | 3300037418 | Ga0395900_0000179 | Ga0395900_0000179_79514_80071 | 175 |
| 179 | 3300037418 | Ga0395900_0044036 | Ga0395900_0044036_2173_2730 | 175 |
| 180 | 3300037418 | Ga0395900_0172925 | Ga0395900_0172925_248_805 | 175 |
| 181 | 3300037466 | Ga0395898_0022101 | Ga0395898_0022101_3262_3819 | 175 |
| 182 | 3300037466 | Ga0395898_0110973 | Ga0395898_0110973_507_1064 | 175 |
| 183 | 3300038996 | Ga0242420_044146 | Ga0242420_044146_216_749 | 175 |
| 184 | 3300039447 | Ga0436361_0133265 | Ga0436361_0133265_335_880 | 175 |
| 185 | 3300039447 | Ga0436361_0347622 | Ga0436361_0347622_273_830 | 175 |
| 186 | 3300039447 | Ga0436361_0425380 | Ga0436361_0425380_123_668 | 175 |
| 187 | 3300039447 | Ga0436361_0429567 | Ga0436361_0429567_123_668 | 175 |
| 188 | 3300039447 | Ga0436361_0549519 | Ga0436361_0549519_819_1364 | 175 |
| 189 | 3300039447 | Ga0436361_0622987 | Ga0436361_0622987_1943_2488 | 175 |
| 190 | 3300042005 | Ga0439448_0000328 | Ga0439448_0000328_5258_5815 | 175 |
| 191 | 3300042012 | Ga0439455_0032156 | Ga0439455_0032156_287_844 | 175 |
| 192 | 3300042876 | Ga0451577_0716177 | Ga0451577_0716177_171_704 | 175 |
| 193 | 3300044656 | Ga0466969_0010333 | Ga0466969_0010333_3081_3632 | 175 |
| 194 | 3300044683 | Ga0466965_0019428 | Ga0466965_0019428_1282_1839 | 175 |
| 195 | 3300044684 | Ga0466966_0002592 | Ga0466966_0002592_4576_5133 | 175 |
| 196 | 3300044684 | Ga0466966_0017490 | Ga0466966_0017490_2788_3339 | 175 |
| 197 | 3300044684 | Ga0466966_0150758 | Ga0466966_0150758_314_865 | 175 |
| 198 | 3300044693 | Ga0466961_0015851 | Ga0466961_0015851_3339_3890 | 175 |
| 199 | 3300044693 | Ga0466961_0283452 | Ga0466961_0283452_212_769 | 175 |
| 200 | 3300044693 | Ga0466961_0287662 | Ga0466961_0287662_77_628 | 175 |
| 201 | 3300044706 | Ga0466964_0013348 | Ga0466964_0013348_503_1060 | 175 |
| 202 | 3300044712 | Ga0453684_0000824 | Ga0453684_0000824_91889_92440 | 175 |
| 203 | 3300044712 | Ga0453684_0660891 | Ga0453684_0660891_276_827 | 175 |
| 204 | 3300044735 | Ga0466968_0340374 | Ga0466968_0340374_82_633 | 175 |
| 205 | 3300044765 | Ga0466970_0013753 | Ga0466970_0013753_950_1501 | 175 |
| 206 | 3300044765 | Ga0466970_0018910 | Ga0466970_0018910_714_1265 | 175 |
| 207 | 3300044765 | Ga0466970_0057278 | Ga0466970_0057278_504_1061 | 175 |
| 208 | 3300044842 | Ga0466957_0007220 | Ga0466957_0007220_2500_3057 | 175 |
| 209 | 3300044842 | Ga0466957_0262716 | Ga0466957_0262716_149_706 | 175 |
| 210 | 3300044842 | Ga0466957_0746495 | Ga0466957_0746495_61_612 | 175 |
| 211 | 3300044901 | Ga0466960_0096184 | Ga0466960_0096184_562_1113 | 175 |
| 212 | 3300045049 | Ga0466959_0031818 | Ga0466959_0031818_1046_1597 | 175 |
| 213 | 3300045049 | Ga0466959_0087374 | Ga0466959_0087374_1441_1998 | 175 |
| 214 | 3300045049 | Ga0466959_0751783 | Ga0466959_0751783_17_568 | 175 |
| 215 | 3300045051 | Ga0451576_0000591 | Ga0451576_0000591_25982_26515 | 175 |
| 216 | 3300045051 | Ga0451576_0001118 | Ga0451576_0001118_8362_8895 | 175 |
| 217 | 3300045051 | Ga0451576_0070290 | Ga0451576_0070290_2291_2836 | 175 |
| 218 | 3300045051 | Ga0451576_0087763 | Ga0451576_0087763_1786_2337 | 175 |
| 219 | 3300045051 | Ga0451576_0430090 | Ga0451576_0430090_740_1339 | 175 |
| 220 | 3300045836 | Ga0466958_0008210 | Ga0466958_0008210_3212_3769 | 175 |
| 221 | 3300045836 | Ga0466958_0219743 | Ga0466958_0219743_460_1011 | 175 |
| 222 | 3300045976 | Ga0466967_0926499 | Ga0466967_0926499_220_771 | 175 |
| 223 | 3300046457 | Ga0495590_0015488 | Ga0495590_0015488_867_1424 | 175 |
| 224 | 3300046457 | Ga0495590_0151463 | Ga0495590_0151463_90_647 | 175 |
| 225 | 3300046458 | Ga0495591_010008 | Ga0495591_010008_2028_2585 | 175 |
| 226 | 3300046459 | Ga0495629_0000105 | Ga0495629_0000105_32755_33312 | 175 |
| 227 | 3300046460 | Ga0495638_0001843 | Ga0495638_0001843_9277_9834 | 175 |
| 228 | 3300046462 | Ga0495651_0203148 | Ga0495651_0203148_174_728 | 175 |
| 229 | 3300046471 | Ga0495650_0001361 | Ga0495650_0001361_14289_14846 | 175 |
| 230 | 3300046471 | Ga0495650_0098010 | Ga0495650_0098010_63_620 | 175 |
| 231 | 3300046472 | Ga0495580_0020609 | Ga0495580_0020609_2228_2785 | 175 |
| 232 | 3300046474 | Ga0495605_0005426 | Ga0495605_0005426_506_1063 | 175 |
| 233 | 3300046491 | Ga0495584_0127815 | Ga0495584_0127815_545_1102 | 175 |
| 234 | 3300046492 | Ga0495585_0136206 | Ga0495585_0136206_527_1084 | 175 |
| 235 | 3300046501 | Ga0495607_0019153 | Ga0495607_0019153_1249_1806 | 175 |
| 236 | 3300046506 | Ga0495583_0013367 | Ga0495583_0013367_562_1119 | 175 |
| 237 | 3300046506 | Ga0495583_0088521 | Ga0495583_0088521_577_1134 | 175 |
| 238 | 3300046507 | Ga0495606_0008385 | Ga0495606_0008385_4012_4569 | 175 |
| 239 | 3300046507 | Ga0495606_0035892 | Ga0495606_0035892_2232_2789 | 175 |
| 240 | 3300046507 | Ga0495606_0109936 | Ga0495606_0109936_853_1410 | 175 |
| 241 | 3300046513 | Ga0495616_0027829 | Ga0495616_0027829_1304_1861 | 175 |
| 242 | 3300046516 | Ga0495628_0157730 | Ga0495628_0157730_100_657 | 175 |
| 243 | 3300046517 | Ga0495630_0090035 | Ga0495630_0090035_232_789 | 175 |
| 244 | 3300046518 | Ga0495631_0070766 | Ga0495631_0070766_177_734 | 175 |
| 245 | 3300046523 | Ga0495644_0021625 | Ga0495644_0021625_1373_1930 | 175 |
| 246 | 3300046523 | Ga0495644_0060633 | Ga0495644_0060633_99_656 | 175 |
| 247 | 3300046524 | Ga0495648_0079312 | Ga0495648_0079312_317_874 | 175 |
| 248 | 3300046530 | Ga0495654_0042687 | Ga0495654_0042687_612_1169 | 175 |
| 249 | 3300046537 | Ga0495598_0042200 | Ga0495598_0042200_33_566 | 175 |
| 250 | 3300046542 | Ga0495597_0043387 | Ga0495597_0043387_143_700 | 175 |
| 251 | 3300046543 | Ga0495645_0002681 | Ga0495645_0002681_2762_3319 | 175 |
| 252 | 3300046557 | Ga0495622_0057561 | Ga0495622_0057561_677_1234 | 175 |
| 253 | 3300046648 | Ga0495611_0214317 | Ga0495611_0214317_24_581 | 175 |
| 254 | 3300046678 | Ga0495599_0022101 | Ga0495599_0022101_1635_2189 | 175 |
| 255 | 3300046679 | Ga0495623_0006621 | Ga0495623_0006621_6307_6861 | 175 |
| 256 | 3300046680 | Ga0495646_0023757 | Ga0495646_0023757_387_944 | 175 |
| 257 | 3300046684 | Ga0495669_0030746 | Ga0495669_0030746_973_1530 | 175 |
| 258 | 3300046684 | Ga0495669_0158032 | Ga0495669_0158032_248_805 | 175 |
| 259 | 3300046691 | Ga0495670_0006236 | Ga0495670_0006236_1248_1805 | 175 |
| 260 | 3300046692 | Ga0495671_0025197 | Ga0495671_0025197_1690_2247 | 175 |
| 261 | 3300046692 | Ga0495671_0060409 | Ga0495671_0060409_674_1231 | 175 |
| 262 | 3300046692 | Ga0495671_0118782 | Ga0495671_0118782_653_1210 | 175 |
| 263 | 3300046692 | Ga0495671_0193180 | Ga0495671_0193180_168_725 | 175 |
| 264 | 3300046694 | Ga0495649_0025057 | Ga0495649_0025057_492_1049 | 175 |
| 265 | 3300046794 | Ga0495589_0010898 | Ga0495589_0010898_1056_1613 | 175 |
| 266 | 3300046794 | Ga0495589_0023119 | Ga0495589_0023119_1449_2006 | 175 |
| 267 | 3300046794 | Ga0495589_0240213 | Ga0495589_0240213_142_699 | 175 |
| 268 | 3300047315 | Ga0495581_0010374 | Ga0495581_0010374_2755_3312 | 175 |
| 269 | 3300047317 | Ga0495604_0039338 | Ga0495604_0039338_474_1028 | 175 |
| 270 | 3300047320 | Ga0495672_0035117 | Ga0495672_0035117_1255_1812 | 175 |
| 271 | 3300047323 | Ga0495683_0015146 | Ga0495683_0015146_2794_3351 | 175 |
| 272 | 3300047323 | Ga0495683_0050400 | Ga0495683_0050400_13_570 | 175 |
| 273 | 3300047443 | Ga0495687_011756 | Ga0495687_011756_1290_1847 | 175 |
| 274 | 3300047443 | Ga0495687_015528 | Ga0495687_015528_1557_2114 | 175 |
| 275 | 3300047444 | Ga0495675_0064432 | Ga0495675_0064432_522_1079 | 175 |
| 276 | 3300047445 | Ga0495677_0018416 | Ga0495677_0018416_868_1425 | 175 |
| 277 | 3300047446 | Ga0495679_034720 | Ga0495679_034720_402_959 | 175 |
| 278 | 3300047447 | Ga0495685_036318 | Ga0495685_036318_606_1163 | 175 |
| 279 | 3300047469 | Ga0495673_0036689 | Ga0495673_0036689_1676_2233 | 175 |
| 280 | 3300047470 | Ga0495681_0188366 | Ga0495681_0188366_213_770 | 175 |
| 281 | 3300047472 | Ga0495686_0180752 | Ga0495686_0180752_15_572 | 175 |
| 282 | 3300047673 | Ga0495593_0021851 | Ga0495593_0021851_665_1222 | 175 |
| 283 | 3300048088 | Ga0495602_0046136 | Ga0495602_0046136_669_1223 | 175 |
| 284 | 3300048089 | Ga0495614_0014934 | Ga0495614_0014934_2631_3188 | 175 |
| 285 | 3300048090 | Ga0495615_0137751 | Ga0495615_0137751_83_616 | 175 |
| 286 | 3300048091 | Ga0495626_0007307 | Ga0495626_0007307_2499_3056 | 175 |
| 287 | 3300048903 | Ga0496100_0088238 | Ga0496100_0088238_317_874 | 175 |
| 288 | 3300048904 | Ga0496101_0013292 | Ga0496101_0013292_4361_4918 | 175 |
| 289 | 3300048904 | Ga0496101_0034361 | Ga0496101_0034361_123_680 | 175 |
| 290 | 3300048905 | Ga0496102_0047891 | Ga0496102_0047891_2823_3380 | 175 |
| 291 | 3300048907 | Ga0496104_0064512 | Ga0496104_0064512_2133_2690 | 175 |
| 292 | 3300048907 | Ga0496104_0076004 | Ga0496104_0076004_1129_1686 | 175 |
| 293 | 3300048908 | Ga0496105_0021434 | Ga0496105_0021434_3491_4048 | 175 |
| 294 | 3300048908 | Ga0496105_0092443 | Ga0496105_0092443_1332_1889 | 175 |
| 295 | 3300048909 | Ga0496106_0397089 | Ga0496106_0397089_481_1038 | 175 |
| 296 | 3300048910 | Ga0496107_0041522 | Ga0496107_0041522_2298_2855 | 175 |
| 297 | 3300048910 | Ga0496107_0123426 | Ga0496107_0123426_280_837 | 175 |
| 298 | 3300048911 | Ga0496108_0487568 | Ga0496108_0487568_419_976 | 175 |
| 299 | 3300048915 | Ga0496112_0107911 | Ga0496112_0107911_2182_2739 | 175 |
| 300 | 3300048915 | Ga0496112_0405792 | Ga0496112_0405792_378_923 | 175 |
| 301 | 3300048917 | Ga0496114_0003193 | Ga0496114_0003193_9307_9864 | 175 |
| 302 | 3300048918 | Ga0496115_0173428 | Ga0496115_0173428_1029_1586 | 175 |
| 303 | 3300048922 | Ga0496119_0111082 | Ga0496119_0111082_184_741 | 175 |
| 304 | 3300048924 | Ga0496121_0037317 | Ga0496121_0037317_3141_3698 | 175 |
| 305 | 3300048924 | Ga0496121_0142265 | Ga0496121_0142265_153_710 | 175 |
| 306 | 3300048929 | Ga0496126_0020071 | Ga0496126_0020071_123_683 | 175 |
| 307 | 3300048929 | Ga0496126_0067260 | Ga0496126_0067260_1328_1888 | 175 |
| 308 | 3300048929 | Ga0496126_0352856 | Ga0496126_0352856_95_652 | 175 |
| 309 | 3300049459 | Ga0495678_075366 | Ga0495678_075366_288_845 | 175 |
| 310 | 3300049460 | Ga0495682_0007048 | Ga0495682_0007048_1058_1615 | 175 |
| 311 | 3300049568 | Ga0501031_0410964 | Ga0501031_0410964_286_819 | 175 |
| 312 | 3300049572 | Ga0501036_0180728 | Ga0501036_0180728_895_1428 | 175 |
| 313 | 3300049573 | Ga0501037_0182804 | Ga0501037_0182804_520_1053 | 175 |
| 314 | 3300049574 | Ga0501038_0204622 | Ga0501038_0204622_687_1220 | 175 |
| 315 | 3300049575 | Ga0501039_0007165 | Ga0501039_0007165_7846_8379 | 175 |
| 316 | 3300049575 | Ga0501039_0126796 | Ga0501039_0126796_333_866 | 175 |
| 317 | 3300049576 | Ga0501040_0008414 | Ga0501040_0008414_5400_5933 | 175 |
| 318 | 3300049576 | Ga0501040_0445764 | Ga0501040_0445764_148_681 | 175 |
| 319 | 3300049577 | Ga0501041_0016872 | Ga0501041_0016872_2065_2598 | 175 |
| 320 | 3300049577 | Ga0501041_0583425 | Ga0501041_0583425_24_557 | 175 |
| 321 | 3300049578 | Ga0501042_0268652 | Ga0501042_0268652_530_1063 | 175 |
| 322 | 3300049578 | Ga0501042_0654332 | Ga0501042_0654332_19_552 | 175 |
| 323 | 3300049579 | Ga0501043_0287238 | Ga0501043_0287238_64_597 | 175 |
| 324 | 3300049579 | Ga0501043_0482170 | Ga0501043_0482170_327_860 | 175 |
| 325 | 3300049580 | Ga0501046_0016835 | Ga0501046_0016835_5517_6050 | 175 |
| 326 | 3300049582 | Ga0501048_0118623 | Ga0501048_0118623_987_1520 | 175 |
| 327 | 3300049582 | Ga0501048_0249390 | Ga0501048_0249390_622_1155 | 175 |
| 328 | 3300049584 | Ga0501068_0302928 | Ga0501068_0302928_252_785 | 175 |
| 329 | 3300049587 | Ga0501071_0010141 | Ga0501071_0010141_4661_5194 | 175 |
| 330 | 3300049588 | Ga0501072_0017384 | Ga0501072_0017384_4702_5235 | 175 |
| 331 | 3300049588 | Ga0501072_0794178 | Ga0501072_0794178_29_562 | 175 |
| 332 | 3300049590 | Ga0501074_0213744 | Ga0501074_0213744_825_1358 | 175 |
| 333 | 3300049591 | Ga0501075_0006027 | Ga0501075_0006027_64_597 | 175 |
| 334 | 3300049592 | Ga0501076_0001751 | Ga0501076_0001751_2846_3379 | 175 |
| 335 | 3300049592 | Ga0501076_0604863 | Ga0501076_0604863_26_559 | 175 |
| 336 | 3300049593 | Ga0501077_0013917 | Ga0501077_0013917_2509_3042 | 175 |
| 337 | 3300049593 | Ga0501077_0181298 | Ga0501077_0181298_511_1044 | 175 |
| 338 | 3300049679 | Ga0501249_055740 | Ga0501249_055740_270_803 | 175 |
| 339 | 3300049741 | Ga0501079_0086483 | Ga0501079_0086483_1271_1804 | 175 |
| 340 | 3300049741 | Ga0501079_0205993 | Ga0501079_0205993_738_1271 | 175 |
| 341 | 3300049741 | Ga0501079_0457122 | Ga0501079_0457122_118_651 | 175 |
| 342 | 3300049742 | Ga0501080_0217334 | Ga0501080_0217334_706_1239 | 175 |
| 343 | 3300049742 | Ga0501080_1332921 | Ga0501080_1332921_13_546 | 175 |
| 344 | 3300049743 | Ga0501081_0002036 | Ga0501081_0002036_11586_12119 | 175 |
| 345 | 3300049743 | Ga0501081_0082368 | Ga0501081_0082368_819_1352 | 175 |
| 346 | 3300050509 | nmdc:mga0qj67_4213_c1 | nmdc:mga0qj67_4213_c1_3091_3624 | 175 |
| 347 | 3300050510 | nmdc:mga06r32_155764_c1 | nmdc:mga06r32_155764_c1_1154_1687 | 175 |
| 348 | 3300050511 | nmdc:mga08y16_106694_c1 | nmdc:mga08y16_106694_c1_1747_2280 | 175 |
| 349 | 3300050511 | nmdc:mga08y16_229138_c1 | nmdc:mga08y16_229138_c1_700_1233 | 175 |
| 350 | 3300050511 | nmdc:mga08y16_482695_c1 | nmdc:mga08y16_482695_c1_626_1159 | 175 |
| 351 | 3300050511 | nmdc:mga08y16_57458_c1 | nmdc:mga08y16_57458_c1_575_1108 | 175 |
| 352 | 3300053117 | Ga0500593_000371 | Ga0500593_000371_9536_10129 | 175 |
| 353 | 3300053148 | Ga0500590_144662 | Ga0500590_144662_349_900 | 175 |
| 354 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_397520_398062 | 175 |
| 355 | 3300053729 | Ga0500625_118289 | Ga0500625_118289_417_950 | 175 |
| 356 | 3300054114 | Ga0501084_0054546 | Ga0501084_0054546_309_842 | 175 |
| 357 | 3300054114 | Ga0501084_0308865 | Ga0501084_0308865_221_754 | 175 |
| 358 | 3300060353 | Ga0501082_0067871 | Ga0501082_0067871_1398_1931 | 175 |
| 359 | 3300060353 | Ga0501082_0114811 | Ga0501082_0114811_862_1395 | 175 |
| 360 | 3300061734 | Ga0530510_0000042 | Ga0530510_0000042_2121_2654 | 175 |
| 361 | 3300061734 | Ga0530510_1001857 | Ga0530510_1001857_85_618 | 175 |
| 362 | iso_pu_bacteria | 2501025504 | 2501407974 | 175 |
| 363 | iso_pu_bacteria | 2510917014 | 2511095719 | 175 |
| 364 | iso_pu_bacteria | 2510917015 | 2511103528 | 175 |
| 365 | iso_pu_bacteria | 2513237082 | 2513554303 | 175 |
| 366 | iso_pu_bacteria | 2513237083 | 2513562581 | 175 |
| 367 | iso_pu_bacteria | 2600255067 | 2600810415 | 175 |
| 368 | iso_pu_bacteria | 2900634093 | 2900636294 | 175 |
| 369 | iso_pu_bacteria | 2921643360 | 2921655040 | 175 |
| 370 | iso_pu_bacteria | 642555113 | 642620249 | 175 |
| 371 | iso_pu_bacteria | 8003955200 | 8003959790 | 175 |
| 372 | 3300003316 | rootH1_10097847 | rootH1_100978472 | 176 |
| 373 | 3300005328 | Ga0070676_10072709 | Ga0070676_100727092 | 176 |
| 374 | 3300005330 | Ga0070690_100296141 | Ga0070690_1002961412 | 176 |
| 375 | 3300005331 | Ga0070670_100003283 | Ga0070670_1000032836 | 176 |
| 376 | 3300005331 | Ga0070670_100074887 | Ga0070670_1000748872 | 176 |
| 377 | 3300005331 | Ga0070670_100116237 | Ga0070670_1001162372 | 176 |
| 378 | 3300005334 | Ga0068869_100021949 | Ga0068869_1000219494 | 176 |
| 379 | 3300005335 | Ga0070666_10011342 | Ga0070666_100113424 | 176 |
| 380 | 3300005335 | Ga0070666_10376314 | Ga0070666_103763142 | 176 |
| 381 | 3300005337 | Ga0070682_100780926 | Ga0070682_1007809261 | 176 |
| 382 | 3300005338 | Ga0068868_100009310 | Ga0068868_1000093106 | 176 |
| 383 | 3300005338 | Ga0068868_100259058 | Ga0068868_1002590581 | 176 |
| 384 | 3300005343 | Ga0070687_100181456 | Ga0070687_1001814562 | 176 |
| 385 | 3300005344 | Ga0070661_100561211 | Ga0070661_1005612112 | 176 |
| 386 | 3300005354 | Ga0070675_100002407 | Ga0070675_1000024078 | 176 |
| 387 | 3300005354 | Ga0070675_100013720 | Ga0070675_1000137206 | 176 |
| 388 | 3300005354 | Ga0070675_100022424 | Ga0070675_1000224246 | 176 |
| 389 | 3300005354 | Ga0070675_100044472 | Ga0070675_1000444723 | 176 |
| 390 | 3300005355 | Ga0070671_100041344 | Ga0070671_1000413442 | 176 |
| 391 | 3300005355 | Ga0070671_100113636 | Ga0070671_1001136361 | 176 |
| 392 | 3300005355 | Ga0070671_100564749 | Ga0070671_1005647492 | 176 |
| 393 | 3300005356 | Ga0070674_100635680 | Ga0070674_1006356802 | 176 |
| 394 | 3300005364 | Ga0070673_100010706 | Ga0070673_1000107062 | 176 |
| 395 | 3300005364 | Ga0070673_100024640 | Ga0070673_1000246402 | 176 |
| 396 | 3300005365 | Ga0070688_100425627 | Ga0070688_1004256272 | 176 |
| 397 | 3300005367 | Ga0070667_100016316 | Ga0070667_1000163163 | 176 |
| 398 | 3300005456 | Ga0070678_100007678 | Ga0070678_1000076783 | 176 |
| 399 | 3300005456 | Ga0070678_100190872 | Ga0070678_1001908722 | 176 |
| 400 | 3300005457 | Ga0070662_100171358 | Ga0070662_1001713582 | 176 |
| 401 | 3300005457 | Ga0070662_100282080 | Ga0070662_1002820802 | 176 |
| 402 | 3300005459 | Ga0068867_100124684 | Ga0068867_1001246842 | 176 |
| 403 | 3300005466 | Ga0070685_10027554 | Ga0070685_100275542 | 176 |
| 404 | 3300005543 | Ga0070672_100006265 | Ga0070672_1000062656 | 176 |
| 405 | 3300005543 | Ga0070672_100259237 | Ga0070672_1002592372 | 176 |
| 406 | 3300005544 | Ga0070686_100106892 | Ga0070686_1001068922 | 176 |
| 407 | 3300005564 | Ga0070664_100084721 | Ga0070664_1000847212 | 176 |
| 408 | 3300005564 | Ga0070664_100137572 | Ga0070664_1001375722 | 176 |
| 409 | 3300005578 | Ga0068854_100215157 | Ga0068854_1002151572 | 176 |
| 410 | 3300005578 | Ga0068854_100266048 | Ga0068854_1002660482 | 176 |
| 411 | 3300005617 | Ga0068859_100018681 | Ga0068859_1000186814 | 176 |
| 412 | 3300005618 | Ga0068864_100008520 | Ga0068864_1000085204 | 176 |
| 413 | 3300005618 | Ga0068864_100014167 | Ga0068864_1000141675 | 176 |
| 414 | 3300005834 | Ga0068851_10095103 | Ga0068851_100951032 | 176 |
| 415 | 3300005840 | Ga0068870_10340611 | Ga0068870_103406112 | 176 |
| 416 | 3300005841 | Ga0068863_100017003 | Ga0068863_1000170036 | 176 |
| 417 | 3300005841 | Ga0068863_100275905 | Ga0068863_1002759052 | 176 |
| 418 | 3300005841 | Ga0068863_100294660 | Ga0068863_1002946602 | 176 |
| 419 | 3300005842 | Ga0068858_100001814 | Ga0068858_10000181420 | 176 |
| 420 | 3300005843 | Ga0068860_100270691 | Ga0068860_1002706911 | 176 |
| 421 | 3300006237 | Ga0097621_100163862 | Ga0097621_1001638622 | 176 |
| 422 | 3300006358 | Ga0068871_100168381 | Ga0068871_1001683812 | 176 |
| 423 | 3300006358 | Ga0068871_100571390 | Ga0068871_1005713902 | 176 |
| 424 | 3300006881 | Ga0068865_100250844 | Ga0068865_1002508442 | 176 |
| 425 | 3300006931 | Ga0097620_100018680 | Ga0097620_1000186804 | 176 |
| 426 | 3300009177 | Ga0105248_10071910 | Ga0105248_100719103 | 176 |
| 427 | 3300013306 | Ga0163162_10463539 | Ga0163162_104635392 | 176 |
| 428 | 3300014325 | Ga0163163_10009312 | Ga0163163_100093122 | 176 |
| 429 | 3300014745 | Ga0157377_10145633 | Ga0157377_101456332 | 176 |
| 430 | 3300014968 | Ga0157379_10038301 | Ga0157379_100383013 | 176 |
| 431 | 3300014969 | Ga0157376_10037875 | Ga0157376_100378753 | 176 |
| 432 | 3300014969 | Ga0157376_10281271 | Ga0157376_102812713 | 176 |
| 433 | 3300017792 | Ga0163161_10112127 | Ga0163161_101121272 | 176 |
| 434 | 3300025256 | Ga0209759_1000342 | Ga0209759_100034212 | 176 |
| 435 | 3300025321 | Ga0207656_10022427 | Ga0207656_100224272 | 176 |
| 436 | 3300025893 | Ga0207682_10010486 | Ga0207682_100104862 | 176 |
| 437 | 3300025903 | Ga0207680_10012229 | Ga0207680_100122295 | 176 |
| 438 | 3300025903 | Ga0207680_10357090 | Ga0207680_103570902 | 176 |
| 439 | 3300025907 | Ga0207645_10076194 | Ga0207645_100761943 | 176 |
| 440 | 3300025908 | Ga0207643_10237532 | Ga0207643_102375322 | 176 |
| 441 | 3300025909 | Ga0207705_10119327 | Ga0207705_101193272 | 176 |
| 442 | 3300025909 | Ga0207705_10127778 | Ga0207705_101277783 | 176 |
| 443 | 3300025909 | Ga0207705_10577739 | Ga0207705_105777392 | 176 |
| 444 | 3300025920 | Ga0207649_10438737 | Ga0207649_104387372 | 176 |
| 445 | 3300025925 | Ga0207650_10001909 | Ga0207650_1000190910 | 176 |
| 446 | 3300025925 | Ga0207650_10105991 | Ga0207650_101059912 | 176 |
| 447 | 3300025925 | Ga0207650_10236203 | Ga0207650_102362032 | 176 |
| 448 | 3300025926 | Ga0207659_10003994 | Ga0207659_100039946 | 176 |
| 449 | 3300025926 | Ga0207659_10012858 | Ga0207659_100128586 | 176 |
| 450 | 3300025926 | Ga0207659_10436152 | Ga0207659_104361522 | 176 |
| 451 | 3300025931 | Ga0207644_10001986 | Ga0207644_100019862 | 176 |
| 452 | 3300025933 | Ga0207706_10137043 | Ga0207706_101370432 | 176 |
| 453 | 3300025933 | Ga0207706_10300428 | Ga0207706_103004282 | 176 |
| 454 | 3300025936 | Ga0207670_10015813 | Ga0207670_100158132 | 176 |
| 455 | 3300025940 | Ga0207691_10008987 | Ga0207691_100089876 | 176 |
| 456 | 3300025940 | Ga0207691_10205809 | Ga0207691_102058092 | 176 |
| 457 | 3300025940 | Ga0207691_10335866 | Ga0207691_103358661 | 176 |
| 458 | 3300025940 | Ga0207691_10766811 | Ga0207691_107668111 | 176 |
| 459 | 3300025941 | Ga0207711_10019079 | Ga0207711_100190794 | 176 |
| 460 | 3300025941 | Ga0207711_10560896 | Ga0207711_105608962 | 176 |
| 461 | 3300025942 | Ga0207689_10023522 | Ga0207689_100235224 | 176 |
| 462 | 3300025945 | Ga0207679_10174875 | Ga0207679_101748752 | 176 |
| 463 | 3300025960 | Ga0207651_10009296 | Ga0207651_100092966 | 176 |
| 464 | 3300025986 | Ga0207658_10006823 | Ga0207658_100068233 | 176 |
| 465 | 3300026023 | Ga0207677_10003021 | Ga0207677_100030217 | 176 |
| 466 | 3300026023 | Ga0207677_10572061 | Ga0207677_105720612 | 176 |
| 467 | 3300026035 | Ga0207703_10004044 | Ga0207703_100040448 | 176 |
| 468 | 3300026067 | Ga0207678_10120749 | Ga0207678_101207492 | 176 |
| 469 | 3300026067 | Ga0207678_10947134 | Ga0207678_109471341 | 176 |
| 470 | 3300026088 | Ga0207641_10032341 | Ga0207641_100323412 | 176 |
| 471 | 3300026088 | Ga0207641_10035638 | Ga0207641_100356382 | 176 |
| 472 | 3300026088 | Ga0207641_10073011 | Ga0207641_100730112 | 176 |
| 473 | 3300026095 | Ga0207676_10007912 | Ga0207676_100079127 | 176 |
| 474 | 3300026095 | Ga0207676_10012227 | Ga0207676_100122276 | 176 |
| 475 | 3300026118 | Ga0207675_100389890 | Ga0207675_1003898902 | 176 |
| 476 | 3300026121 | Ga0207683_10038597 | Ga0207683_100385973 | 176 |
| 477 | 3300026121 | Ga0207683_10192887 | Ga0207683_101928872 | 176 |
| 478 | 3300026121 | Ga0207683_10911640 | Ga0207683_109116401 | 176 |
| 479 | 3300028381 | Ga0268264_10317339 | Ga0268264_103173392 | 176 |
| 480 | 3300028794 | Ga0307515_10000378 | Ga0307515_100003783 | 176 |
| 481 | 3300031456 | Ga0307513_10008368 | Ga0307513_1000836811 | 176 |
| 482 | 3300031649 | Ga0307514_10001743 | Ga0307514_1000174318 | 176 |
| 483 | 3300031733 | Ga0316577_10431718 | Ga0316577_104317181 | 176 |
| 484 | 3300032004 | Ga0307414_10616294 | Ga0307414_106162942 | 176 |
| 485 | 3300037588 | Ga0316581_0011584 | Ga0316581_0011584_183_743 | 176 |
| 486 | 3300039438 | Ga0436360_0973346 | Ga0436360_0973346_604_1167 | 176 |
| 487 | 3300042001 | Ga0439441_024922 | Ga0439441_024922_316_918 | 176 |
| 488 | 3300042005 | Ga0439448_0152937 | Ga0439448_0152937_181_783 | 176 |
| 489 | 3300042435 | Ga0439434_0222098 | Ga0439434_0222098_23_604 | 176 |
| 490 | 3300042439 | Ga0439464_0001296 | Ga0439464_0001296_2593_3195 | 176 |
| 491 | 3300046477 | Ga0495664_0387319 | Ga0495664_0387319_136_699 | 176 |
| 492 | 3300046543 | Ga0495645_0025935 | Ga0495645_0025935_2463_3071 | 176 |
| 493 | 3300046681 | Ga0495647_0133543 | Ga0495647_0133543_55_660 | 176 |
| 494 | 3300046694 | Ga0495649_0101728 | Ga0495649_0101728_875_1444 | 176 |
| 495 | 3300047319 | Ga0495674_0015753 | Ga0495674_0015753_3976_4539 | 176 |
| 496 | 3300047320 | Ga0495672_0013610 | Ga0495672_0013610_12_575 | 176 |
| 497 | 3300048909 | Ga0496106_0123642 | Ga0496106_0123642_1260_1865 | 176 |
| 498 | 3300048911 | Ga0496108_0040578 | Ga0496108_0040578_416_1021 | 176 |
| 499 | 3300048912 | Ga0496109_0109656 | Ga0496109_0109656_455_1063 | 176 |
| 500 | 3300048912 | Ga0496109_0405269 | Ga0496109_0405269_323_928 | 176 |
| 501 | 3300048912 | Ga0496109_0596551 | Ga0496109_0596551_229_837 | 176 |
| 502 | 3300048917 | Ga0496114_0507828 | Ga0496114_0507828_158_763 | 176 |
| 503 | 3300003316 | rootH1_10059048 | rootH1_100590483 | 177 |
| 504 | 3300003792 | Ga0055540_1001614 | Ga0055540_10016145 | 177 |
| 505 | 3300003794 | Ga0055531_10002809 | Ga0055531_100028096 | 177 |
| 506 | 3300005327 | Ga0070658_10369786 | Ga0070658_103697862 | 177 |
| 507 | 3300005328 | Ga0070676_10032673 | Ga0070676_100326733 | 177 |
| 508 | 3300005328 | Ga0070676_10120555 | Ga0070676_101205551 | 177 |
| 509 | 3300005331 | Ga0070670_100035755 | Ga0070670_1000357554 | 177 |
| 510 | 3300005331 | Ga0070670_100280161 | Ga0070670_1002801612 | 177 |
| 511 | 3300005331 | Ga0070670_100472311 | Ga0070670_1004723112 | 177 |
| 512 | 3300005331 | Ga0070670_100501395 | Ga0070670_1005013951 | 177 |
| 513 | 3300005331 | Ga0070670_101023725 | Ga0070670_1010237251 | 177 |
| 514 | 3300005333 | Ga0070677_10003148 | Ga0070677_100031483 | 177 |
| 515 | 3300005333 | Ga0070677_10013848 | Ga0070677_100138483 | 177 |
| 516 | 3300005333 | Ga0070677_10077985 | Ga0070677_100779852 | 177 |
| 517 | 3300005333 | Ga0070677_10121295 | Ga0070677_101212951 | 177 |
| 518 | 3300005334 | Ga0068869_100004113 | Ga0068869_1000041136 | 177 |
| 519 | 3300005335 | Ga0070666_10326700 | Ga0070666_103267001 | 177 |
| 520 | 3300005335 | Ga0070666_10334021 | Ga0070666_103340212 | 177 |
| 521 | 3300005338 | Ga0068868_100068111 | Ga0068868_1000681112 | 177 |
| 522 | 3300005338 | Ga0068868_100153350 | Ga0068868_1001533502 | 177 |
| 523 | 3300005338 | Ga0068868_100414072 | Ga0068868_1004140722 | 177 |
| 524 | 3300005338 | Ga0068868_100414319 | Ga0068868_1004143192 | 177 |
| 525 | 3300005343 | Ga0070687_100018067 | Ga0070687_1000180673 | 177 |
| 526 | 3300005347 | Ga0070668_100019399 | Ga0070668_1000193993 | 177 |
| 527 | 3300005353 | Ga0070669_100013746 | Ga0070669_1000137463 | 177 |
| 528 | 3300005353 | Ga0070669_100050201 | Ga0070669_1000502013 | 177 |
| 529 | 3300005353 | Ga0070669_100520801 | Ga0070669_1005208012 | 177 |
| 530 | 3300005354 | Ga0070675_100019141 | Ga0070675_1000191414 | 177 |
| 531 | 3300005354 | Ga0070675_100024765 | Ga0070675_1000247652 | 177 |
| 532 | 3300005354 | Ga0070675_100170640 | Ga0070675_1001706402 | 177 |
| 533 | 3300005354 | Ga0070675_100250813 | Ga0070675_1002508132 | 177 |
| 534 | 3300005355 | Ga0070671_100003297 | Ga0070671_1000032974 | 177 |
| 535 | 3300005355 | Ga0070671_100092436 | Ga0070671_1000924363 | 177 |
| 536 | 3300005355 | Ga0070671_100200288 | Ga0070671_1002002882 | 177 |
| 537 | 3300005356 | Ga0070674_100017825 | Ga0070674_1000178254 | 177 |
| 538 | 3300005356 | Ga0070674_100031937 | Ga0070674_1000319372 | 177 |
| 539 | 3300005356 | Ga0070674_100178103 | Ga0070674_1001781032 | 177 |
| 540 | 3300005356 | Ga0070674_100209566 | Ga0070674_1002095662 | 177 |
| 541 | 3300005364 | Ga0070673_100050212 | Ga0070673_1000502122 | 177 |
| 542 | 3300005364 | Ga0070673_100853708 | Ga0070673_1008537082 | 177 |
| 543 | 3300005366 | Ga0070659_100053565 | Ga0070659_1000535654 | 177 |
| 544 | 3300005367 | Ga0070667_100004664 | Ga0070667_1000046643 | 177 |
| 545 | 3300005367 | Ga0070667_100169310 | Ga0070667_1001693102 | 177 |
| 546 | 3300005441 | Ga0070700_100231214 | Ga0070700_1002312142 | 177 |
| 547 | 3300005445 | Ga0070708_100438762 | Ga0070708_1004387622 | 177 |
| 548 | 3300005455 | Ga0070663_100000383 | Ga0070663_10000038314 | 177 |
| 549 | 3300005455 | Ga0070663_100018798 | Ga0070663_1000187986 | 177 |
| 550 | 3300005455 | Ga0070663_100340516 | Ga0070663_1003405162 | 177 |
| 551 | 3300005455 | Ga0070663_100557360 | Ga0070663_1005573602 | 177 |
| 552 | 3300005456 | Ga0070678_100007693 | Ga0070678_1000076937 | 177 |
| 553 | 3300005456 | Ga0070678_100027275 | Ga0070678_1000272753 | 177 |
| 554 | 3300005456 | Ga0070678_100064007 | Ga0070678_1000640072 | 177 |
| 555 | 3300005456 | Ga0070678_100107343 | Ga0070678_1001073432 | 177 |
| 556 | 3300005456 | Ga0070678_100800847 | Ga0070678_1008008471 | 177 |
| 557 | 3300005457 | Ga0070662_100018320 | Ga0070662_1000183203 | 177 |
| 558 | 3300005459 | Ga0068867_100000021 | Ga0068867_10000002126 | 177 |
| 559 | 3300005459 | Ga0068867_100015559 | Ga0068867_1000155592 | 177 |
| 560 | 3300005459 | Ga0068867_100022723 | Ga0068867_1000227232 | 177 |
| 561 | 3300005459 | Ga0068867_100023593 | Ga0068867_1000235933 | 177 |
| 562 | 3300005459 | Ga0068867_100256997 | Ga0068867_1002569972 | 177 |
| 563 | 3300005459 | Ga0068867_100797100 | Ga0068867_1007971002 | 177 |
| 564 | 3300005539 | Ga0068853_100324998 | Ga0068853_1003249982 | 177 |
| 565 | 3300005543 | Ga0070672_100017297 | Ga0070672_1000172974 | 177 |
| 566 | 3300005543 | Ga0070672_100112244 | Ga0070672_1001122442 | 177 |
| 567 | 3300005543 | Ga0070672_100297053 | Ga0070672_1002970532 | 177 |
| 568 | 3300005544 | Ga0070686_100685905 | Ga0070686_1006859052 | 177 |
| 569 | 3300005548 | Ga0070665_100030125 | Ga0070665_1000301256 | 177 |
| 570 | 3300005548 | Ga0070665_100203381 | Ga0070665_1002033811 | 177 |
| 571 | 3300005548 | Ga0070665_100247846 | Ga0070665_1002478464 | 177 |
| 572 | 3300005548 | Ga0070665_100992631 | Ga0070665_1009926312 | 177 |
| 573 | 3300005564 | Ga0070664_100048588 | Ga0070664_1000485882 | 177 |
| 574 | 3300005564 | Ga0070664_100074018 | Ga0070664_1000740182 | 177 |
| 575 | 3300005564 | Ga0070664_100084786 | Ga0070664_1000847862 | 177 |
| 576 | 3300005564 | Ga0070664_100277793 | Ga0070664_1002777932 | 177 |
| 577 | 3300005578 | Ga0068854_100123104 | Ga0068854_1001231042 | 177 |
| 578 | 3300005578 | Ga0068854_100158888 | Ga0068854_1001588882 | 177 |
| 579 | 3300005615 | Ga0070702_100158970 | Ga0070702_1001589702 | 177 |
| 580 | 3300005616 | Ga0068852_100012412 | Ga0068852_1000124123 | 177 |
| 581 | 3300005616 | Ga0068852_100812430 | Ga0068852_1008124302 | 177 |
| 582 | 3300005616 | Ga0068852_100859154 | Ga0068852_1008591542 | 177 |
| 583 | 3300005616 | Ga0068852_100925034 | Ga0068852_1009250342 | 177 |
| 584 | 3300005617 | Ga0068859_100319072 | Ga0068859_1003190722 | 177 |
| 585 | 3300005617 | Ga0068859_100692883 | Ga0068859_1006928832 | 177 |
| 586 | 3300005618 | Ga0068864_100008889 | Ga0068864_1000088894 | 177 |
| 587 | 3300005618 | Ga0068864_100034866 | Ga0068864_1000348665 | 177 |
| 588 | 3300005618 | Ga0068864_100090299 | Ga0068864_1000902992 | 177 |
| 589 | 3300005618 | Ga0068864_100207308 | Ga0068864_1002073082 | 177 |
| 590 | 3300005618 | Ga0068864_100227472 | Ga0068864_1002274722 | 177 |
| 591 | 3300005718 | Ga0068866_10004238 | Ga0068866_100042384 | 177 |
| 592 | 3300005719 | Ga0068861_100029120 | Ga0068861_1000291204 | 177 |
| 593 | 3300005719 | Ga0068861_100203848 | Ga0068861_1002038482 | 177 |
| 594 | 3300005834 | Ga0068851_10037603 | Ga0068851_100376032 | 177 |
| 595 | 3300005834 | Ga0068851_10239381 | Ga0068851_102393812 | 177 |
| 596 | 3300005840 | Ga0068870_10129556 | Ga0068870_101295562 | 177 |
| 597 | 3300005840 | Ga0068870_10467270 | Ga0068870_104672702 | 177 |
| 598 | 3300005841 | Ga0068863_100006252 | Ga0068863_1000062522 | 177 |
| 599 | 3300005841 | Ga0068863_100045259 | Ga0068863_1000452592 | 177 |
| 600 | 3300005841 | Ga0068863_100062851 | Ga0068863_1000628512 | 177 |
| 601 | 3300005841 | Ga0068863_100802494 | Ga0068863_1008024942 | 177 |
| 602 | 3300005842 | Ga0068858_100060157 | Ga0068858_1000601572 | 177 |
| 603 | 3300005842 | Ga0068858_100125379 | Ga0068858_1001253793 | 177 |
| 604 | 3300005843 | Ga0068860_100015915 | Ga0068860_1000159157 | 177 |
| 605 | 3300005844 | Ga0068862_100041368 | Ga0068862_1000413684 | 177 |
| 606 | 3300006042 | Ga0075368_10047088 | Ga0075368_100470881 | 177 |
| 607 | 3300006048 | Ga0075363_100272563 | Ga0075363_1002725632 | 177 |
| 608 | 3300006178 | Ga0075367_10037421 | Ga0075367_100374213 | 177 |
| 609 | 3300006195 | Ga0075366_10006987 | Ga0075366_100069874 | 177 |
| 610 | 3300006195 | Ga0075366_10008243 | Ga0075366_100082434 | 177 |
| 611 | 3300006195 | Ga0075366_10064258 | Ga0075366_100642582 | 177 |
| 612 | 3300006237 | Ga0097621_100054084 | Ga0097621_1000540842 | 177 |
| 613 | 3300006237 | Ga0097621_100209158 | Ga0097621_1002091582 | 177 |
| 614 | 3300006237 | Ga0097621_100289894 | Ga0097621_1002898942 | 177 |
| 615 | 3300006237 | Ga0097621_100411394 | Ga0097621_1004113942 | 177 |
| 616 | 3300006353 | Ga0075370_10001022 | Ga0075370_100010228 | 177 |
| 617 | 3300006353 | Ga0075370_10022938 | Ga0075370_100229382 | 177 |
| 618 | 3300006358 | Ga0068871_100055678 | Ga0068871_1000556783 | 177 |
| 619 | 3300006358 | Ga0068871_100104270 | Ga0068871_1001042702 | 177 |
| 620 | 3300006881 | Ga0068865_100017387 | Ga0068865_1000173874 | 177 |
| 621 | 3300006931 | Ga0097620_100319058 | Ga0097620_1003190582 | 177 |
| 622 | 3300006931 | Ga0097620_100692914 | Ga0097620_1006929142 | 177 |
| 623 | 3300009093 | Ga0105240_10003122 | Ga0105240_1000312217 | 177 |
| 624 | 3300009093 | Ga0105240_10574098 | Ga0105240_105740982 | 177 |
| 625 | 3300009098 | Ga0105245_10054536 | Ga0105245_100545365 | 177 |
| 626 | 3300009148 | Ga0105243_10000295 | Ga0105243_100002952 | 177 |
| 627 | 3300009148 | Ga0105243_10067185 | Ga0105243_100671854 | 177 |
| 628 | 3300009148 | Ga0105243_10187960 | Ga0105243_101879603 | 177 |
| 629 | 3300009148 | Ga0105243_11559356 | Ga0105243_115593562 | 177 |
| 630 | 3300009174 | Ga0105241_10148197 | Ga0105241_101481973 | 177 |
| 631 | 3300009176 | Ga0105242_10674403 | Ga0105242_106744032 | 177 |
| 632 | 3300009177 | Ga0105248_10542651 | Ga0105248_105426512 | 177 |
| 633 | 3300009545 | Ga0105237_10000678 | Ga0105237_1000067846 | 177 |
| 634 | 3300009545 | Ga0105237_10237395 | Ga0105237_102373952 | 177 |
| 635 | 3300009551 | Ga0105238_10003973 | Ga0105238_100039735 | 177 |
| 636 | 3300010375 | Ga0105239_10000292 | Ga0105239_1000029257 | 177 |
| 637 | 3300011119 | Ga0105246_10387269 | Ga0105246_103872692 | 177 |
| 638 | 3300013105 | Ga0157369_10210924 | Ga0157369_102109242 | 177 |
| 639 | 3300013296 | Ga0157374_11232871 | Ga0157374_112328711 | 177 |
| 640 | 3300013297 | Ga0157378_10226603 | Ga0157378_102266032 | 177 |
| 641 | 3300013306 | Ga0163162_10047420 | Ga0163162_100474202 | 177 |
| 642 | 3300013306 | Ga0163162_10077078 | Ga0163162_100770783 | 177 |
| 643 | 3300013306 | Ga0163162_10354497 | Ga0163162_103544972 | 177 |
| 644 | 3300013306 | Ga0163162_11136547 | Ga0163162_111365472 | 177 |
| 645 | 3300013308 | Ga0157375_10015511 | Ga0157375_100155112 | 177 |
| 646 | 3300013308 | Ga0157375_10029760 | Ga0157375_100297602 | 177 |
| 647 | 3300013308 | Ga0157375_10137913 | Ga0157375_101379133 | 177 |
| 648 | 3300013308 | Ga0157375_10236646 | Ga0157375_102366463 | 177 |
| 649 | 3300014325 | Ga0163163_10089270 | Ga0163163_100892702 | 177 |
| 650 | 3300014325 | Ga0163163_10136840 | Ga0163163_101368402 | 177 |
| 651 | 3300014326 | Ga0157380_10007613 | Ga0157380_100076132 | 177 |
| 652 | 3300014745 | Ga0157377_10000021 | Ga0157377_1000002189 | 177 |
| 653 | 3300014968 | Ga0157379_10027561 | Ga0157379_100275612 | 177 |
| 654 | 3300014968 | Ga0157379_10060072 | Ga0157379_100600722 | 177 |
| 655 | 3300014968 | Ga0157379_10605442 | Ga0157379_106054422 | 177 |
| 656 | 3300014969 | Ga0157376_10333675 | Ga0157376_103336752 | 177 |
| 657 | 3300014969 | Ga0157376_10700712 | Ga0157376_107007122 | 177 |
| 658 | 3300017792 | Ga0163161_10013318 | Ga0163161_100133184 | 177 |
| 659 | 3300025256 | Ga0209759_1024975 | Ga0209759_10249752 | 177 |
| 660 | 3300025302 | Ga0207426_1002027 | Ga0207426_10020276 | 177 |
| 661 | 3300025303 | Ga0209051_1000454 | Ga0209051_100045414 | 177 |
| 662 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022753 | 177 |
| 663 | 3300025304 | Ga0209257_1035023 | Ga0209257_10350233 | 177 |
| 664 | 3300025315 | Ga0207697_10069502 | Ga0207697_100695022 | 177 |
| 665 | 3300025315 | Ga0207697_10163028 | Ga0207697_101630282 | 177 |
| 666 | 3300025321 | Ga0207656_10028373 | Ga0207656_100283732 | 177 |
| 667 | 3300025735 | Ga0207713_1012200 | Ga0207713_10122002 | 177 |
| 668 | 3300025893 | Ga0207682_10007232 | Ga0207682_100072323 | 177 |
| 669 | 3300025893 | Ga0207682_10008774 | Ga0207682_100087744 | 177 |
| 670 | 3300025893 | Ga0207682_10025014 | Ga0207682_100250142 | 177 |
| 671 | 3300025899 | Ga0207642_10023867 | Ga0207642_100238672 | 177 |
| 672 | 3300025901 | Ga0207688_10098459 | Ga0207688_100984592 | 177 |
| 673 | 3300025901 | Ga0207688_10137924 | Ga0207688_101379242 | 177 |
| 674 | 3300025903 | Ga0207680_10353091 | Ga0207680_103530912 | 177 |
| 675 | 3300025903 | Ga0207680_10369241 | Ga0207680_103692412 | 177 |
| 676 | 3300025904 | Ga0207647_10014971 | Ga0207647_100149716 | 177 |
| 677 | 3300025907 | Ga0207645_10007870 | Ga0207645_100078702 | 177 |
| 678 | 3300025907 | Ga0207645_10025599 | Ga0207645_100255992 | 177 |
| 679 | 3300025908 | Ga0207643_10009100 | Ga0207643_100091006 | 177 |
| 680 | 3300025908 | Ga0207643_10202288 | Ga0207643_102022882 | 177 |
| 681 | 3300025908 | Ga0207643_10401375 | Ga0207643_104013752 | 177 |
| 682 | 3300025909 | Ga0207705_10235797 | Ga0207705_102357972 | 177 |
| 683 | 3300025913 | Ga0207695_10020879 | Ga0207695_100208796 | 177 |
| 684 | 3300025913 | Ga0207695_10221785 | Ga0207695_102217852 | 177 |
| 685 | 3300025914 | Ga0207671_10018908 | Ga0207671_100189086 | 177 |
| 686 | 3300025914 | Ga0207671_10488171 | Ga0207671_104881712 | 177 |
| 687 | 3300025918 | Ga0207662_10028948 | Ga0207662_100289482 | 177 |
| 688 | 3300025919 | Ga0207657_10349702 | Ga0207657_103497021 | 177 |
| 689 | 3300025920 | Ga0207649_10150683 | Ga0207649_101506831 | 177 |
| 690 | 3300025920 | Ga0207649_10463720 | Ga0207649_104637202 | 177 |
| 691 | 3300025923 | Ga0207681_10001253 | Ga0207681_1000125312 | 177 |
| 692 | 3300025923 | Ga0207681_10007721 | Ga0207681_100077216 | 177 |
| 693 | 3300025924 | Ga0207694_10027495 | Ga0207694_100274954 | 177 |
| 694 | 3300025925 | Ga0207650_10002430 | Ga0207650_100024306 | 177 |
| 695 | 3300025925 | Ga0207650_10015531 | Ga0207650_100155313 | 177 |
| 696 | 3300025925 | Ga0207650_10100285 | Ga0207650_101002852 | 177 |
| 697 | 3300025925 | Ga0207650_10435358 | Ga0207650_104353582 | 177 |
| 698 | 3300025926 | Ga0207659_10001279 | Ga0207659_1000127912 | 177 |
| 699 | 3300025926 | Ga0207659_10038132 | Ga0207659_100381324 | 177 |
| 700 | 3300025926 | Ga0207659_10099463 | Ga0207659_100994633 | 177 |
| 701 | 3300025926 | Ga0207659_10203406 | Ga0207659_102034062 | 177 |
| 702 | 3300025927 | Ga0207687_10513729 | Ga0207687_105137291 | 177 |
| 703 | 3300025931 | Ga0207644_10001397 | Ga0207644_100013979 | 177 |
| 704 | 3300025931 | Ga0207644_10061998 | Ga0207644_100619982 | 177 |
| 705 | 3300025931 | Ga0207644_10266138 | Ga0207644_102661382 | 177 |
| 706 | 3300025931 | Ga0207644_10489797 | Ga0207644_104897972 | 177 |
| 707 | 3300025933 | Ga0207706_10042544 | Ga0207706_100425442 | 177 |
| 708 | 3300025933 | Ga0207706_10674342 | Ga0207706_106743422 | 177 |
| 709 | 3300025935 | Ga0207709_10027408 | Ga0207709_100274082 | 177 |
| 710 | 3300025937 | Ga0207669_10006020 | Ga0207669_100060202 | 177 |
| 711 | 3300025937 | Ga0207669_10092933 | Ga0207669_100929332 | 177 |
| 712 | 3300025937 | Ga0207669_10357561 | Ga0207669_103575612 | 177 |
| 713 | 3300025937 | Ga0207669_10499939 | Ga0207669_104999392 | 177 |
| 714 | 3300025938 | Ga0207704_10064764 | Ga0207704_100647643 | 177 |
| 715 | 3300025939 | Ga0207665_10112107 | Ga0207665_101121072 | 177 |
| 716 | 3300025940 | Ga0207691_10038531 | Ga0207691_100385313 | 177 |
| 717 | 3300025940 | Ga0207691_10073282 | Ga0207691_100732822 | 177 |
| 718 | 3300025940 | Ga0207691_10090505 | Ga0207691_100905052 | 177 |
| 719 | 3300025940 | Ga0207691_10096822 | Ga0207691_100968222 | 177 |
| 720 | 3300025940 | Ga0207691_10116063 | Ga0207691_101160632 | 177 |
| 721 | 3300025941 | Ga0207711_10008377 | Ga0207711_100083779 | 177 |
| 722 | 3300025942 | Ga0207689_10011343 | Ga0207689_100113433 | 177 |
| 723 | 3300025942 | Ga0207689_10396049 | Ga0207689_103960492 | 177 |
| 724 | 3300025945 | Ga0207679_10088897 | Ga0207679_100888973 | 177 |
| 725 | 3300025945 | Ga0207679_10421559 | Ga0207679_104215592 | 177 |
| 726 | 3300025945 | Ga0207679_11025148 | Ga0207679_110251481 | 177 |
| 727 | 3300025949 | Ga0207667_10097810 | Ga0207667_100978104 | 177 |
| 728 | 3300025960 | Ga0207651_10030385 | Ga0207651_100303853 | 177 |
| 729 | 3300025960 | Ga0207651_10036213 | Ga0207651_100362132 | 177 |
| 730 | 3300025960 | Ga0207651_10614659 | Ga0207651_106146592 | 177 |
| 731 | 3300025972 | Ga0207668_10004921 | Ga0207668_100049217 | 177 |
| 732 | 3300025981 | Ga0207640_10045816 | Ga0207640_100458163 | 177 |
| 733 | 3300025981 | Ga0207640_10211630 | Ga0207640_102116302 | 177 |
| 734 | 3300025981 | Ga0207640_10274683 | Ga0207640_102746832 | 177 |
| 735 | 3300025986 | Ga0207658_10000904 | Ga0207658_1000090415 | 177 |
| 736 | 3300025986 | Ga0207658_10025617 | Ga0207658_100256175 | 177 |
| 737 | 3300025986 | Ga0207658_10158931 | Ga0207658_101589312 | 177 |
| 738 | 3300025986 | Ga0207658_10289582 | Ga0207658_102895822 | 177 |
| 739 | 3300025986 | Ga0207658_10548540 | Ga0207658_105485402 | 177 |
| 740 | 3300026023 | Ga0207677_10054828 | Ga0207677_100548282 | 177 |
| 741 | 3300026023 | Ga0207677_10075708 | Ga0207677_100757082 | 177 |
| 742 | 3300026023 | Ga0207677_10089343 | Ga0207677_100893432 | 177 |
| 743 | 3300026023 | Ga0207677_10625621 | Ga0207677_106256212 | 177 |
| 744 | 3300026035 | Ga0207703_10009909 | Ga0207703_100099097 | 177 |
| 745 | 3300026041 | Ga0207639_10403733 | Ga0207639_104037332 | 177 |
| 746 | 3300026067 | Ga0207678_10000458 | Ga0207678_1000045826 | 177 |
| 747 | 3300026067 | Ga0207678_10022611 | Ga0207678_100226114 | 177 |
| 748 | 3300026067 | Ga0207678_10588794 | Ga0207678_105887942 | 177 |
| 749 | 3300026075 | Ga0207708_10023828 | Ga0207708_100238283 | 177 |
| 750 | 3300026088 | Ga0207641_10001982 | Ga0207641_1000198211 | 177 |
| 751 | 3300026088 | Ga0207641_10020017 | Ga0207641_100200174 | 177 |
| 752 | 3300026089 | Ga0207648_10002350 | Ga0207648_100023505 | 177 |
| 753 | 3300026089 | Ga0207648_10011629 | Ga0207648_100116297 | 177 |
| 754 | 3300026089 | Ga0207648_10017770 | Ga0207648_100177702 | 177 |
| 755 | 3300026089 | Ga0207648_10027125 | Ga0207648_100271253 | 177 |
| 756 | 3300026089 | Ga0207648_10035911 | Ga0207648_100359112 | 177 |
| 757 | 3300026089 | Ga0207648_10168093 | Ga0207648_101680932 | 177 |
| 758 | 3300026089 | Ga0207648_10588299 | Ga0207648_105882992 | 177 |
| 759 | 3300026095 | Ga0207676_10031295 | Ga0207676_100312952 | 177 |
| 760 | 3300026095 | Ga0207676_10042520 | Ga0207676_100425202 | 177 |
| 761 | 3300026095 | Ga0207676_10196763 | Ga0207676_101967632 | 177 |
| 762 | 3300026095 | Ga0207676_10278028 | Ga0207676_102780282 | 177 |
| 763 | 3300026095 | Ga0207676_10379405 | Ga0207676_103794052 | 177 |
| 764 | 3300026116 | Ga0207674_10420622 | Ga0207674_104206222 | 177 |
| 765 | 3300026118 | Ga0207675_100144609 | Ga0207675_1001446093 | 177 |
| 766 | 3300026118 | Ga0207675_100286865 | Ga0207675_1002868652 | 177 |
| 767 | 3300026118 | Ga0207675_100637240 | Ga0207675_1006372402 | 177 |
| 768 | 3300026121 | Ga0207683_10035749 | Ga0207683_100357493 | 177 |
| 769 | 3300026121 | Ga0207683_10053784 | Ga0207683_100537844 | 177 |
| 770 | 3300026121 | Ga0207683_10067351 | Ga0207683_100673513 | 177 |
| 771 | 3300026121 | Ga0207683_10122705 | Ga0207683_101227052 | 177 |
| 772 | 3300026121 | Ga0207683_10150801 | Ga0207683_101508012 | 177 |
| 773 | 3300026121 | Ga0207683_10207643 | Ga0207683_102076433 | 177 |
| 774 | 3300026142 | Ga0207698_10059494 | Ga0207698_100594942 | 177 |
| 775 | 3300026142 | Ga0207698_10059566 | Ga0207698_100595662 | 177 |
| 776 | 3300026142 | Ga0207698_10329869 | Ga0207698_103298692 | 177 |
| 777 | 3300028379 | Ga0268266_10035490 | Ga0268266_100354902 | 177 |
| 778 | 3300028379 | Ga0268266_10061938 | Ga0268266_100619383 | 177 |
| 779 | 3300028379 | Ga0268266_10294726 | Ga0268266_102947261 | 177 |
| 780 | 3300028379 | Ga0268266_10814288 | Ga0268266_108142882 | 177 |
| 781 | 3300028380 | Ga0268265_10202426 | Ga0268265_102024262 | 177 |
| 782 | 3300028381 | Ga0268264_10003895 | Ga0268264_1000389510 | 177 |
| 783 | 3300028381 | Ga0268264_10197332 | Ga0268264_101973322 | 177 |
| 784 | 3300028786 | Ga0307517_10004249 | Ga0307517_100042495 | 177 |
| 785 | 3300028786 | Ga0307517_10060587 | Ga0307517_100605872 | 177 |
| 786 | 3300028786 | Ga0307517_10214928 | Ga0307517_102149282 | 177 |
| 787 | 3300028786 | Ga0307517_10287749 | Ga0307517_102877492 | 177 |
| 788 | 3300028794 | Ga0307515_10000347 | Ga0307515_1000034727 | 177 |
| 789 | 3300028794 | Ga0307515_10001105 | Ga0307515_1000110547 | 177 |
| 790 | 3300028794 | Ga0307515_10002080 | Ga0307515_100020802 | 177 |
| 791 | 3300028794 | Ga0307515_10016105 | Ga0307515_1001610511 | 177 |
| 792 | 3300028794 | Ga0307515_10055358 | Ga0307515_100553583 | 177 |
| 793 | 3300028794 | Ga0307515_10069956 | Ga0307515_100699562 | 177 |
| 794 | 3300028794 | Ga0307515_10648512 | Ga0307515_106485121 | 177 |
| 795 | 3300030521 | Ga0307511_10233776 | Ga0307511_102337762 | 177 |
| 796 | 3300030522 | Ga0307512_10065289 | Ga0307512_100652892 | 177 |
| 797 | 3300030522 | Ga0307512_10148644 | Ga0307512_101486442 | 177 |
| 798 | 3300031456 | Ga0307513_10074096 | Ga0307513_100740961 | 177 |
| 799 | 3300031456 | Ga0307513_10074725 | Ga0307513_100747252 | 177 |
| 800 | 3300031456 | Ga0307513_10089596 | Ga0307513_100895963 | 177 |
| 801 | 3300031456 | Ga0307513_10111525 | Ga0307513_101115253 | 177 |
| 802 | 3300031456 | Ga0307513_10169671 | Ga0307513_101696712 | 177 |
| 803 | 3300031456 | Ga0307513_10362486 | Ga0307513_103624862 | 177 |
| 804 | 3300031507 | Ga0307509_10001361 | Ga0307509_100013618 | 177 |
| 805 | 3300031507 | Ga0307509_10010234 | Ga0307509_100102348 | 177 |
| 806 | 3300031507 | Ga0307509_10083130 | Ga0307509_100831303 | 177 |
| 807 | 3300031507 | Ga0307509_10135071 | Ga0307509_101350712 | 177 |
| 808 | 3300031507 | Ga0307509_10178311 | Ga0307509_101783112 | 177 |
| 809 | 3300031507 | Ga0307509_10257982 | Ga0307509_102579822 | 177 |
| 810 | 3300031507 | Ga0307509_10311736 | Ga0307509_103117362 | 177 |
| 811 | 3300031548 | Ga0307408_100033032 | Ga0307408_1000330323 | 177 |
| 812 | 3300031548 | Ga0307408_100239367 | Ga0307408_1002393672 | 177 |
| 813 | 3300031616 | Ga0307508_10000023 | Ga0307508_1000002340 | 177 |
| 814 | 3300031616 | Ga0307508_10035009 | Ga0307508_100350095 | 177 |
| 815 | 3300031616 | Ga0307508_10080654 | Ga0307508_100806543 | 177 |
| 816 | 3300031649 | Ga0307514_10002980 | Ga0307514_1000298013 | 177 |
| 817 | 3300031649 | Ga0307514_10028455 | Ga0307514_100284556 | 177 |
| 818 | 3300031649 | Ga0307514_10124924 | Ga0307514_101249242 | 177 |
| 819 | 3300031649 | Ga0307514_10340688 | Ga0307514_103406881 | 177 |
| 820 | 3300031730 | Ga0307516_10013210 | Ga0307516_100132102 | 177 |
| 821 | 3300031730 | Ga0307516_10019134 | Ga0307516_100191345 | 177 |
| 822 | 3300031730 | Ga0307516_10099929 | Ga0307516_100999293 | 177 |
| 823 | 3300031730 | Ga0307516_10165426 | Ga0307516_101654262 | 177 |
| 824 | 3300031730 | Ga0307516_10180438 | Ga0307516_101804382 | 177 |
| 825 | 3300031731 | Ga0307405_10032709 | Ga0307405_100327092 | 177 |
| 826 | 3300031852 | Ga0307410_10000671 | Ga0307410_1000067112 | 177 |
| 827 | 3300031852 | Ga0307410_10265588 | Ga0307410_102655882 | 177 |
| 828 | 3300031901 | Ga0307406_10013246 | Ga0307406_100132462 | 177 |
| 829 | 3300031903 | Ga0307407_10183932 | Ga0307407_101839322 | 177 |
| 830 | 3300031911 | Ga0307412_10150111 | Ga0307412_101501113 | 177 |
| 831 | 3300032002 | Ga0307416_100002710 | Ga0307416_1000027107 | 177 |
| 832 | 3300032004 | Ga0307414_10057246 | Ga0307414_100572463 | 177 |
| 833 | 3300032004 | Ga0307414_10720220 | Ga0307414_107202202 | 177 |
| 834 | 3300032005 | Ga0307411_10131550 | Ga0307411_101315503 | 177 |
| 835 | 3300032126 | Ga0307415_100224895 | Ga0307415_1002248952 | 177 |
| 836 | 3300033179 | Ga0307507_10169912 | Ga0307507_101699122 | 177 |
| 837 | 3300033180 | Ga0307510_10001484 | Ga0307510_1000148414 | 177 |
| 838 | 3300033180 | Ga0307510_10022280 | Ga0307510_100222806 | 177 |
| 839 | 3300033180 | Ga0307510_10104851 | Ga0307510_101048512 | 177 |
| 840 | 3300033180 | Ga0307510_10288733 | Ga0307510_102887331 | 177 |
| 841 | 3300035170 | Ga0373943_0138369 | Ga0373943_0138369_505_1113 | 177 |
| 842 | 3300035410 | Ga0373924_0342733 | Ga0373924_0342733_28_636 | 177 |
| 843 | 3300035692 | Ga0373935_0630148 | Ga0373935_0630148_64_672 | 177 |
| 844 | 3300035695 | Ga0373927_0215378 | Ga0373927_0215378_643_1251 | 177 |
| 845 | 3300036401 | Ga0373937_0068171 | Ga0373937_0068171_2629_3237 | 177 |
| 846 | 3300036401 | Ga0373937_0964849 | Ga0373937_0964849_11_628 | 177 |
| 847 | 3300037068 | Ga0373925_0208539 | Ga0373925_0208539_714_1331 | 177 |
| 848 | 3300037068 | Ga0373925_0404881 | Ga0373925_0404881_144_752 | 177 |
| 849 | 3300037312 | Ga0395899_0017956 | Ga0395899_0017956_3902_4471 | 177 |
| 850 | 3300037418 | Ga0395900_0056934 | Ga0395900_0056934_3054_3623 | 177 |
| 851 | 3300037418 | Ga0395900_0443378 | Ga0395900_0443378_528_1097 | 177 |
| 852 | 3300037418 | Ga0395900_0511723 | Ga0395900_0511723_528_1097 | 177 |
| 853 | 3300037471 | Ga0395905_0093908 | Ga0395905_0093908_170_748 | 177 |
| 854 | 3300037471 | Ga0395905_0294014 | Ga0395905_0294014_130_699 | 177 |
| 855 | 3300038443 | Ga0395901_0098131 | Ga0395901_0098131_2479_3048 | 177 |
| 856 | 3300041501 | Ga0451845_0394058 | Ga0451845_0394058_130_738 | 177 |
| 857 | 3300041512 | Ga0451853_1213795 | Ga0451853_1213795_305_913 | 177 |
| 858 | 3300042135 | Ga0450899_025886 | Ga0450899_025886_50_619 | 177 |
| 859 | 3300042876 | Ga0451577_0154121 | Ga0451577_0154121_285_854 | 177 |
| 860 | 3300044735 | Ga0466968_0098760 | Ga0466968_0098760_613_1227 | 177 |
| 861 | 3300044842 | Ga0466957_0124393 | Ga0466957_0124393_764_1333 | 177 |
| 862 | 3300044842 | Ga0466957_0526317 | Ga0466957_0526317_29_595 | 177 |
| 863 | 3300045049 | Ga0466959_0103594 | Ga0466959_0103594_247_813 | 177 |
| 864 | 3300045049 | Ga0466959_0344930 | Ga0466959_0344930_31_651 | 177 |
| 865 | 3300045051 | Ga0451576_0159444 | Ga0451576_0159444_651_1220 | 177 |
| 866 | 3300046454 | Ga0495592_0000495 | Ga0495592_0000495_20335_20952 | 177 |
| 867 | 3300046454 | Ga0495592_0400949 | Ga0495592_0400949_214_822 | 177 |
| 868 | 3300046455 | Ga0495603_0389379 | Ga0495603_0389379_117_725 | 177 |
| 869 | 3300046457 | Ga0495590_0001173 | Ga0495590_0001173_1238_1810 | 177 |
| 870 | 3300046459 | Ga0495629_0556838 | Ga0495629_0556838_115_723 | 177 |
| 871 | 3300046460 | Ga0495638_0040024 | Ga0495638_0040024_1004_1621 | 177 |
| 872 | 3300046462 | Ga0495651_0673394 | Ga0495651_0673394_27_599 | 177 |
| 873 | 3300046463 | Ga0495653_0035291 | Ga0495653_0035291_2710_3282 | 177 |
| 874 | 3300046472 | Ga0495580_0614608 | Ga0495580_0614608_68_676 | 177 |
| 875 | 3300046473 | Ga0495582_0200343 | Ga0495582_0200343_351_968 | 177 |
| 876 | 3300046473 | Ga0495582_0413651 | Ga0495582_0413651_89_661 | 177 |
| 877 | 3300046475 | Ga0495639_0063891 | Ga0495639_0063891_833_1441 | 177 |
| 878 | 3300046491 | Ga0495584_0012621 | Ga0495584_0012621_2902_3474 | 177 |
| 879 | 3300046507 | Ga0495606_0035152 | Ga0495606_0035152_1035_1607 | 177 |
| 880 | 3300046512 | Ga0495610_0065228 | Ga0495610_0065228_669_1286 | 177 |
| 881 | 3300046516 | Ga0495628_0386946 | Ga0495628_0386946_368_940 | 177 |
| 882 | 3300046516 | Ga0495628_0555003 | Ga0495628_0555003_110_727 | 177 |
| 883 | 3300046517 | Ga0495630_0389449 | Ga0495630_0389449_174_746 | 177 |
| 884 | 3300046517 | Ga0495630_0597093 | Ga0495630_0597093_71_688 | 177 |
| 885 | 3300046519 | Ga0495632_0043451 | Ga0495632_0043451_453_1070 | 177 |
| 886 | 3300046522 | Ga0495643_0038910 | Ga0495643_0038910_1961_2569 | 177 |
| 887 | 3300046524 | Ga0495648_0116953 | Ga0495648_0116953_511_1122 | 177 |
| 888 | 3300046524 | Ga0495648_0143650 | Ga0495648_0143650_324_941 | 177 |
| 889 | 3300046528 | Ga0495642_0126721 | Ga0495642_0126721_312_929 | 177 |
| 890 | 3300046529 | Ga0495652_0074591 | Ga0495652_0074591_705_1277 | 177 |
| 891 | 3300046530 | Ga0495654_0157225 | Ga0495654_0157225_20_628 | 177 |
| 892 | 3300046531 | Ga0495665_0036302 | Ga0495665_0036302_138_710 | 177 |
| 893 | 3300046535 | Ga0495586_0028974 | Ga0495586_0028974_1806_2378 | 177 |
| 894 | 3300046539 | Ga0495621_0045728 | Ga0495621_0045728_257_865 | 177 |
| 895 | 3300046539 | Ga0495621_0104122 | Ga0495621_0104122_284_850 | 177 |
| 896 | 3300046539 | Ga0495621_0188009 | Ga0495621_0188009_49_657 | 177 |
| 897 | 3300046542 | Ga0495597_0002647 | Ga0495597_0002647_6866_7438 | 177 |
| 898 | 3300046543 | Ga0495645_0111443 | Ga0495645_0111443_1302_1874 | 177 |
| 899 | 3300046543 | Ga0495645_0394373 | Ga0495645_0394373_144_752 | 177 |
| 900 | 3300046616 | Ga0495668_0021458 | Ga0495668_0021458_852_1463 | 177 |
| 901 | 3300046616 | Ga0495668_0212538 | Ga0495668_0212538_10_627 | 177 |
| 902 | 3300046616 | Ga0495668_0250847 | Ga0495668_0250847_228_800 | 177 |
| 903 | 3300046660 | Ga0495625_0001105 | Ga0495625_0001105_2604_3212 | 177 |
| 904 | 3300046660 | Ga0495625_0438235 | Ga0495625_0438235_22_639 | 177 |
| 905 | 3300046663 | Ga0495635_0160976 | Ga0495635_0160976_842_1414 | 177 |
| 906 | 3300046678 | Ga0495599_0248455 | Ga0495599_0248455_418_990 | 177 |
| 907 | 3300046679 | Ga0495623_0002817 | Ga0495623_0002817_4386_4958 | 177 |
| 908 | 3300046681 | Ga0495647_0010284 | Ga0495647_0010284_2174_2782 | 177 |
| 909 | 3300046683 | Ga0495658_0019071 | Ga0495658_0019071_2361_2984 | 177 |
| 910 | 3300046683 | Ga0495658_0086939 | Ga0495658_0086939_1080_1688 | 177 |
| 911 | 3300046683 | Ga0495658_0192379 | Ga0495658_0192379_350_967 | 177 |
| 912 | 3300046683 | Ga0495658_0425661 | Ga0495658_0425661_57_665 | 177 |
| 913 | 3300046684 | Ga0495669_0023054 | Ga0495669_0023054_807_1379 | 177 |
| 914 | 3300046684 | Ga0495669_0156332 | Ga0495669_0156332_382_954 | 177 |
| 915 | 3300046690 | Ga0495624_0056754 | Ga0495624_0056754_593_1210 | 177 |
| 916 | 3300046690 | Ga0495624_0104781 | Ga0495624_0104781_482_1054 | 177 |
| 917 | 3300046691 | Ga0495670_0065859 | Ga0495670_0065859_809_1417 | 177 |
| 918 | 3300046692 | Ga0495671_0020689 | Ga0495671_0020689_876_1487 | 177 |
| 919 | 3300047317 | Ga0495604_0052611 | Ga0495604_0052611_2278_2850 | 177 |
| 920 | 3300047319 | Ga0495674_0545441 | Ga0495674_0545441_84_656 | 177 |
| 921 | 3300047321 | Ga0495676_0015875 | Ga0495676_0015875_2568_3185 | 177 |
| 922 | 3300047322 | Ga0495680_0014284 | Ga0495680_0014284_2244_2816 | 177 |
| 923 | 3300047323 | Ga0495683_0003322 | Ga0495683_0003322_6037_6609 | 177 |
| 924 | 3300047444 | Ga0495675_0062194 | Ga0495675_0062194_1443_2015 | 177 |
| 925 | 3300047444 | Ga0495675_0152634 | Ga0495675_0152634_163_735 | 177 |
| 926 | 3300047472 | Ga0495686_0001863 | Ga0495686_0001863_5103_5702 | 177 |
| 927 | 3300047472 | Ga0495686_0182009 | Ga0495686_0182009_29_637 | 177 |
| 928 | 3300047673 | Ga0495593_0024457 | Ga0495593_0024457_1938_2510 | 177 |
| 929 | 3300047673 | Ga0495593_0035923 | Ga0495593_0035923_1262_1834 | 177 |
| 930 | 3300047673 | Ga0495593_0112648 | Ga0495593_0112648_492_1109 | 177 |
| 931 | 3300048088 | Ga0495602_0057269 | Ga0495602_0057269_1590_2162 | 177 |
| 932 | 3300048903 | Ga0496100_0044964 | Ga0496100_0044964_1931_2503 | 177 |
| 933 | 3300048904 | Ga0496101_0004607 | Ga0496101_0004607_5982_6554 | 177 |
| 934 | 3300048904 | Ga0496101_0339944 | Ga0496101_0339944_332_949 | 177 |
| 935 | 3300048904 | Ga0496101_0356684 | Ga0496101_0356684_93_665 | 177 |
| 936 | 3300048905 | Ga0496102_0010249 | Ga0496102_0010249_4137_4736 | 177 |
| 937 | 3300048905 | Ga0496102_0080150 | Ga0496102_0080150_1555_2127 | 177 |
| 938 | 3300048905 | Ga0496102_0172244 | Ga0496102_0172244_151_759 | 177 |
| 939 | 3300048906 | Ga0496103_0002171 | Ga0496103_0002171_9869_10441 | 177 |
| 940 | 3300048907 | Ga0496104_0155748 | Ga0496104_0155748_1153_1725 | 177 |
| 941 | 3300048908 | Ga0496105_0188458 | Ga0496105_0188458_203_775 | 177 |
| 942 | 3300048908 | Ga0496105_0604556 | Ga0496105_0604556_40_612 | 177 |
| 943 | 3300048909 | Ga0496106_0062545 | Ga0496106_0062545_1487_2059 | 177 |
| 944 | 3300048909 | Ga0496106_0065232 | Ga0496106_0065232_1298_1906 | 177 |
| 945 | 3300048910 | Ga0496107_0003373 | Ga0496107_0003373_1285_1857 | 177 |
| 946 | 3300048911 | Ga0496108_0431906 | Ga0496108_0431906_70_642 | 177 |
| 947 | 3300048912 | Ga0496109_0155391 | Ga0496109_0155391_260_868 | 177 |
| 948 | 3300048912 | Ga0496109_0197290 | Ga0496109_0197290_1178_1750 | 177 |
| 949 | 3300048914 | Ga0496111_0001327 | Ga0496111_0001327_7269_7841 | 177 |
| 950 | 3300048915 | Ga0496112_0466841 | Ga0496112_0466841_464_1036 | 177 |
| 951 | 3300048916 | Ga0496113_0024520 | Ga0496113_0024520_2981_3553 | 177 |
| 952 | 3300048917 | Ga0496114_0243045 | Ga0496114_0243045_415_1023 | 177 |
| 953 | 3300048919 | Ga0496116_0013099 | Ga0496116_0013099_5262_5834 | 177 |
| 954 | 3300048920 | Ga0496117_0033439 | Ga0496117_0033439_833_1405 | 177 |
| 955 | 3300048922 | Ga0496119_0102948 | Ga0496119_0102948_443_1015 | 177 |
| 956 | 3300048923 | Ga0496120_0123717 | Ga0496120_0123717_574_1146 | 177 |
| 957 | 3300048924 | Ga0496121_0013422 | Ga0496121_0013422_4099_4671 | 177 |
| 958 | 3300048924 | Ga0496121_0217818 | Ga0496121_0217818_279_887 | 177 |
| 959 | 3300048925 | Ga0496122_0013875 | Ga0496122_0013875_6067_6639 | 177 |
| 960 | 3300048926 | Ga0496123_0021967 | Ga0496123_0021967_1853_2425 | 177 |
| 961 | 3300048927 | Ga0496124_0010111 | Ga0496124_0010111_613_1185 | 177 |
| 962 | 3300049459 | Ga0495678_064357 | Ga0495678_064357_762_1334 | 177 |
| 963 | 3300050492 | nmdc:mga0yw44_396601_c1 | nmdc:mga0yw44_396601_c1_13_585 | 177 |
| 964 | 3300050493 | nmdc:mga0k408_1564_c1 | nmdc:mga0k408_1564_c1_798_1418 | 177 |
| 965 | 3300050493 | nmdc:mga0k408_42082_c1 | nmdc:mga0k408_42082_c1_1068_1685 | 177 |
| 966 | 3300050494 | nmdc:mga06z11_126989_c1 | nmdc:mga06z11_126989_c1_589_1197 | 177 |
| 967 | 3300050496 | nmdc:mga07m45_186925_c1 | nmdc:mga07m45_186925_c1_134_742 | 177 |
| 968 | 3300050496 | nmdc:mga07m45_390605_c1 | nmdc:mga07m45_390605_c1_160_768 | 177 |
| 969 | 3300050496 | nmdc:mga07m45_47080_c1 | nmdc:mga07m45_47080_c1_17_634 | 177 |
| 970 | 3300053098 | Ga0500650_0120701 | Ga0500650_0120701_536_1153 | 177 |
| 971 | 3300053118 | Ga0500594_0007947 | Ga0500594_0007947_1126_1743 | 177 |
| 972 | 3300053134 | Ga0500658_0019243 | Ga0500658_0019243_858_1466 | 177 |
| 973 | 3300053136 | Ga0500559_0001133 | Ga0500559_0001133_2692_3309 | 177 |
| 974 | 3300053148 | Ga0500590_015257 | Ga0500590_015257_354_962 | 177 |
| 975 | 3300053154 | Ga0500619_000054 | Ga0500619_000054_11736_12335 | 177 |
| 976 | 3300053154 | Ga0500619_004840 | Ga0500619_004840_254_862 | 177 |
| 977 | 3300053155 | Ga0500620_046921 | Ga0500620_046921_467_1075 | 177 |
| 978 | 3300053739 | Ga0500587_006581 | Ga0500587_006581_104_712 | 177 |
| 979 | iso_pu_bacteria | 2643221654 | 2644303420 | 177 |
| 980 | 3300003322 | rootL2_10285392 | rootL2_102853922 | 178 |
| 981 | 3300005335 | Ga0070666_10268319 | Ga0070666_102683192 | 178 |
| 982 | 3300005343 | Ga0070687_100177157 | Ga0070687_1001771572 | 178 |
| 983 | 3300005353 | Ga0070669_100096035 | Ga0070669_1000960352 | 178 |
| 984 | 3300005366 | Ga0070659_100332166 | Ga0070659_1003321662 | 178 |
| 985 | 3300005367 | Ga0070667_100006816 | Ga0070667_1000068168 | 178 |
| 986 | 3300005539 | Ga0068853_100391329 | Ga0068853_1003913292 | 178 |
| 987 | 3300005543 | Ga0070672_100048444 | Ga0070672_1000484441 | 178 |
| 988 | 3300005617 | Ga0068859_100053864 | Ga0068859_1000538645 | 178 |
| 989 | 3300005842 | Ga0068858_100006288 | Ga0068858_1000062888 | 178 |
| 990 | 3300005843 | Ga0068860_100049997 | Ga0068860_1000499972 | 178 |
| 991 | 3300006195 | Ga0075366_10203642 | Ga0075366_102036422 | 178 |
| 992 | 3300006931 | Ga0097620_100053863 | Ga0097620_1000538635 | 178 |
| 993 | 3300009177 | Ga0105248_10237055 | Ga0105248_102370552 | 178 |
| 994 | 3300013308 | Ga0157375_10043762 | Ga0157375_100437624 | 178 |
| 995 | 3300014968 | Ga0157379_10038696 | Ga0157379_100386963 | 178 |
| 996 | 3300021384 | Ga0213876_10119413 | Ga0213876_101194132 | 178 |
| 997 | 3300025903 | Ga0207680_10235920 | Ga0207680_102359202 | 178 |
| 998 | 3300025918 | Ga0207662_10084753 | Ga0207662_100847532 | 178 |
| 999 | 3300025923 | Ga0207681_10168567 | Ga0207681_101685672 | 178 |
| 1000 | 3300025932 | Ga0207690_10350906 | Ga0207690_103509062 | 178 |
| 1001 | 3300025941 | Ga0207711_10259114 | Ga0207711_102591142 | 178 |
| 1002 | 3300026035 | Ga0207703_10004545 | Ga0207703_100045454 | 178 |
| 1003 | 3300026089 | Ga0207648_10256291 | Ga0207648_102562912 | 178 |
| 1004 | 3300028381 | Ga0268264_10003117 | Ga0268264_1000311714 | 178 |
| 1005 | 3300032168 | Ga0316593_10000414 | Ga0316593_100004144 | 178 |
| 1006 | 3300033524 | Ga0316592_1083445 | Ga0316592_10834451 | 178 |
| 1007 | 3300033541 | Ga0316596_1000067 | Ga0316596_100006710 | 178 |
| 1008 | 3300036712 | Ga0316584_0532424 | Ga0316584_0532424_189_746 | 178 |
| 1009 | 3300039437 | Ga0436365_1158146 | Ga0436365_1158146_2906_3517 | 178 |
| 1010 | 3300044658 | Ga0466972_0003323 | Ga0466972_0003323_2950_3507 | 178 |
| 1011 | 3300044683 | Ga0466965_0000489 | Ga0466965_0000489_13133_13690 | 178 |
| 1012 | 3300044706 | Ga0466964_0002101 | Ga0466964_0002101_1299_1856 | 178 |
| 1013 | 3300044706 | Ga0466964_0040453 | Ga0466964_0040453_1161_1718 | 178 |
| 1014 | 3300044712 | Ga0453684_0064148 | Ga0453684_0064148_3954_4580 | 178 |
| 1015 | 3300044735 | Ga0466968_0019229 | Ga0466968_0019229_904_1461 | 178 |
| 1016 | 3300044735 | Ga0466968_0295889 | Ga0466968_0295889_125_682 | 178 |
| 1017 | 3300044735 | Ga0466968_0311059 | Ga0466968_0311059_121_678 | 178 |
| 1018 | 3300045051 | Ga0451576_1013033 | Ga0451576_1013033_235_846 | 178 |
| 1019 | 3300046472 | Ga0495580_0056837 | Ga0495580_0056837_1680_2291 | 178 |
| 1020 | 3300050493 | nmdc:mga0k408_246477_c1 | nmdc:mga0k408_246477_c1_253_873 | 178 |
| 1021 | 3300028786 | Ga0307517_10188580 | Ga0307517_101885802 | 179 |
| 1022 | 3300030744 | Ga0316181_1138066 | Ga0316181_11380662 | 179 |
| 1023 | 3300031730 | Ga0307516_10000045 | Ga0307516_1000004571 | 179 |
| 1024 | 3300044842 | Ga0466957_0020219 | Ga0466957_0020219_295_855 | 179 |
| 1025 | 3300046525 | Ga0495663_0005054 | Ga0495663_0005054_1799_2353 | 179 |
| 1026 | 3300053137 | Ga0500561_0027948 | Ga0500561_0027948_202_825 | 179 |
| 1027 | iso_pu_bacteria | 2721755763 | 2723876415 | 179 |
| 1028 | 3300005293 | Ga0065715_10166303 | Ga0065715_101663031 | 180 |
| 1029 | 3300005458 | Ga0070681_10763020 | Ga0070681_107630202 | 180 |
| 1030 | 3300005471 | Ga0070698_100079870 | Ga0070698_1000798702 | 180 |
| 1031 | 3300009094 | Ga0111539_10591810 | Ga0111539_105918101 | 180 |
| 1032 | 3300013104 | Ga0157370_10004672 | Ga0157370_1000467210 | 180 |
| 1033 | 3300013104 | Ga0157370_10049678 | Ga0157370_100496782 | 180 |
| 1034 | 3300025250 | Ga0209026_1004460 | Ga0209026_10044604 | 180 |
| 1035 | 3300037312 | Ga0395899_0001458 | Ga0395899_0001458_731_1291 | 180 |
| 1036 | 3300037312 | Ga0395899_0014962 | Ga0395899_0014962_5271_5831 | 180 |
| 1037 | 3300037418 | Ga0395900_0010138 | Ga0395900_0010138_6480_7040 | 180 |
| 1038 | 3300037418 | Ga0395900_0111797 | Ga0395900_0111797_1548_2108 | 180 |
| 1039 | 3300037471 | Ga0395905_0000589 | Ga0395905_0000589_12133_12696 | 180 |
| 1040 | 3300037471 | Ga0395905_0011379 | Ga0395905_0011379_3444_4004 | 180 |
| 1041 | 3300038443 | Ga0395901_0352205 | Ga0395901_0352205_179_739 | 180 |
| 1042 | 3300044765 | Ga0466970_0018403 | Ga0466970_0018403_1852_2412 | 180 |
| 1043 | 3300045049 | Ga0466959_0047561 | Ga0466959_0047561_583_1143 | 180 |
| 1044 | 3300046457 | Ga0495590_0000007 | Ga0495590_0000007_41286_41846 | 180 |
| 1045 | 3300046458 | Ga0495591_016927 | Ga0495591_016927_804_1364 | 180 |
| 1046 | 3300046474 | Ga0495605_0007136 | Ga0495605_0007136_195_755 | 180 |
| 1047 | 3300046491 | Ga0495584_0002713 | Ga0495584_0002713_2727_3287 | 180 |
| 1048 | 3300046492 | Ga0495585_0012863 | Ga0495585_0012863_3731_4291 | 180 |
| 1049 | 3300046492 | Ga0495585_0045420 | Ga0495585_0045420_516_1076 | 180 |
| 1050 | 3300046500 | Ga0495596_0002830 | Ga0495596_0002830_4960_5520 | 180 |
| 1051 | 3300046501 | Ga0495607_0003605 | Ga0495607_0003605_6670_7230 | 180 |
| 1052 | 3300046501 | Ga0495607_0057059 | Ga0495607_0057059_1450_2010 | 180 |
| 1053 | 3300046506 | Ga0495583_0002744 | Ga0495583_0002744_11258_11818 | 180 |
| 1054 | 3300046506 | Ga0495583_0016125 | Ga0495583_0016125_2788_3348 | 180 |
| 1055 | 3300046506 | Ga0495583_0027562 | Ga0495583_0027562_726_1286 | 180 |
| 1056 | 3300046507 | Ga0495606_0209924 | Ga0495606_0209924_204_764 | 180 |
| 1057 | 3300046512 | Ga0495610_0000583 | Ga0495610_0000583_25971_26531 | 180 |
| 1058 | 3300046513 | Ga0495616_0016448 | Ga0495616_0016448_890_1450 | 180 |
| 1059 | 3300046513 | Ga0495616_0063245 | Ga0495616_0063245_800_1360 | 180 |
| 1060 | 3300046518 | Ga0495631_0001383 | Ga0495631_0001383_2934_3494 | 180 |
| 1061 | 3300046518 | Ga0495631_0014780 | Ga0495631_0014780_3116_3676 | 180 |
| 1062 | 3300046519 | Ga0495632_0006665 | Ga0495632_0006665_3720_4280 | 180 |
| 1063 | 3300046519 | Ga0495632_0047781 | Ga0495632_0047781_510_1070 | 180 |
| 1064 | 3300046520 | Ga0495637_0000006 | Ga0495637_0000006_293049_293609 | 180 |
| 1065 | 3300046522 | Ga0495643_0015349 | Ga0495643_0015349_1385_1945 | 180 |
| 1066 | 3300046522 | Ga0495643_0166771 | Ga0495643_0166771_201_761 | 180 |
| 1067 | 3300046524 | Ga0495648_0012825 | Ga0495648_0012825_101_661 | 180 |
| 1068 | 3300046524 | Ga0495648_0030902 | Ga0495648_0030902_1465_2025 | 180 |
| 1069 | 3300046528 | Ga0495642_0010302 | Ga0495642_0010302_800_1360 | 180 |
| 1070 | 3300046528 | Ga0495642_0035367 | Ga0495642_0035367_203_763 | 180 |
| 1071 | 3300046528 | Ga0495642_0050668 | Ga0495642_0050668_207_767 | 180 |
| 1072 | 3300046537 | Ga0495598_0117729 | Ga0495598_0117729_296_856 | 180 |
| 1073 | 3300046538 | Ga0495609_0017111 | Ga0495609_0017111_450_1010 | 180 |
| 1074 | 3300046538 | Ga0495609_0024355 | Ga0495609_0024355_1619_2179 | 180 |
| 1075 | 3300046558 | Ga0495633_0007426 | Ga0495633_0007426_1271_1831 | 180 |
| 1076 | 3300046615 | Ga0495656_0074089 | Ga0495656_0074089_109_669 | 180 |
| 1077 | 3300046616 | Ga0495668_0098764 | Ga0495668_0098764_351_911 | 180 |
| 1078 | 3300046648 | Ga0495611_0001407 | Ga0495611_0001407_8741_9301 | 180 |
| 1079 | 3300046648 | Ga0495611_0011257 | Ga0495611_0011257_1003_1563 | 180 |
| 1080 | 3300046660 | Ga0495625_0124205 | Ga0495625_0124205_959_1519 | 180 |
| 1081 | 3300046665 | Ga0495661_0018647 | Ga0495661_0018647_653_1213 | 180 |
| 1082 | 3300046665 | Ga0495661_0040383 | Ga0495661_0040383_591_1151 | 180 |
| 1083 | 3300046665 | Ga0495661_0072068 | Ga0495661_0072068_500_1060 | 180 |
| 1084 | 3300046691 | Ga0495670_0019881 | Ga0495670_0019881_767_1327 | 180 |
| 1085 | 3300046694 | Ga0495649_0001583 | Ga0495649_0001583_11322_11882 | 180 |
| 1086 | 3300046794 | Ga0495589_0039507 | Ga0495589_0039507_1049_1609 | 180 |
| 1087 | 3300046810 | Ga0495660_0032918 | Ga0495660_0032918_535_1095 | 180 |
| 1088 | 3300047318 | Ga0495636_0048737 | Ga0495636_0048737_1180_1740 | 180 |
| 1089 | 3300047318 | Ga0495636_0317301 | Ga0495636_0317301_146_706 | 180 |
| 1090 | 3300047320 | Ga0495672_0000118 | Ga0495672_0000118_46954_47514 | 180 |
| 1091 | 3300047320 | Ga0495672_0048827 | Ga0495672_0048827_1061_1621 | 180 |
| 1092 | 3300047443 | Ga0495687_000166 | Ga0495687_000166_55782_56342 | 180 |
| 1093 | 3300047445 | Ga0495677_0001700 | Ga0495677_0001700_5565_6125 | 180 |
| 1094 | 3300047445 | Ga0495677_0139537 | Ga0495677_0139537_151_711 | 180 |
| 1095 | 3300047446 | Ga0495679_001920 | Ga0495679_001920_859_1419 | 180 |
| 1096 | 3300047470 | Ga0495681_0015148 | Ga0495681_0015148_500_1060 | 180 |
| 1097 | 3300047472 | Ga0495686_0003218 | Ga0495686_0003218_2343_2903 | 180 |
| 1098 | 3300048091 | Ga0495626_0004474 | Ga0495626_0004474_4732_5292 | 180 |
| 1099 | 3300048906 | Ga0496103_0065089 | Ga0496103_0065089_571_1125 | 180 |
| 1100 | 3300048929 | Ga0496126_0918858 | Ga0496126_0918858_82_639 | 180 |
| 1101 | 3300049459 | Ga0495678_000113 | Ga0495678_000113_41161_41721 | 180 |
| 1102 | 3300049459 | Ga0495678_052756 | Ga0495678_052756_605_1165 | 180 |
| 1103 | 3300049460 | Ga0495682_0024037 | Ga0495682_0024037_810_1370 | 180 |
| 1104 | 3300049460 | Ga0495682_0061653 | Ga0495682_0061653_459_1019 | 180 |
| 1105 | 3300050511 | nmdc:mga08y16_459834_c1 | nmdc:mga08y16_459834_c1_588_1169 | 180 |
| 1106 | iso_pu_bacteria | 2858688981 | 2858692679 | 180 |
| 1107 | 3300006048 | Ga0075363_100230892 | Ga0075363_1002308922 | 181 |
| 1108 | 3300006195 | Ga0075366_10083194 | Ga0075366_100831942 | 181 |
| 1109 | 3300046474 | Ga0495605_0060484 | Ga0495605_0060484_804_1367 | 181 |
| 1110 | 3300046491 | Ga0495584_0076567 | Ga0495584_0076567_783_1346 | 181 |
| 1111 | 3300046500 | Ga0495596_0013027 | Ga0495596_0013027_2032_2595 | 181 |
| 1112 | 3300046507 | Ga0495606_0002227 | Ga0495606_0002227_7572_8135 | 181 |
| 1113 | 3300046518 | Ga0495631_0044586 | Ga0495631_0044586_1022_1585 | 181 |
| 1114 | 3300046616 | Ga0495668_0025097 | Ga0495668_0025097_925_1488 | 181 |
| 1115 | 3300046694 | Ga0495649_0121427 | Ga0495649_0121427_175_738 | 181 |
| 1116 | 3300046794 | Ga0495589_0035270 | Ga0495589_0035270_1577_2140 | 181 |
| 1117 | 3300047323 | Ga0495683_0140221 | Ga0495683_0140221_202_765 | 181 |
| 1118 | 3300048903 | Ga0496100_0025801 | Ga0496100_0025801_2815_3372 | 181 |
| 1119 | 3300050493 | nmdc:mga0k408_150447_c1 | nmdc:mga0k408_150447_c1_362_997 | 181 |
| 1120 | 3300025986 | Ga0207658_10737848 | Ga0207658_107378481 | 182 |
| 1121 | 3300046674 | Ga0495588_0053875 | Ga0495588_0053875_1234_1797 | 182 |
| 1122 | 3300003775 | Ga0055524_1000029 | Ga0055524_100002963 | 183 |
| 1123 | 3300005337 | Ga0070682_100119355 | Ga0070682_1001193552 | 183 |
| 1124 | 3300025263 | Ga0209565_1008844 | Ga0209565_10088442 | 183 |
| 1125 | 3300025299 | Ga0209256_1000013 | Ga0209256_1000013140 | 183 |
| 1126 | 3300037471 | Ga0395905_0006561 | Ga0395905_0006561_6261_6830 | 183 |
| 1127 | iso_pu_bacteria | 2513237150 | 2513954015 | 183 |
| 1128 | iso_pu_bacteria | 644736347 | 644746806 | 183 |
| 1129 | 3300003771 | Ga0055526_1000526 | Ga0055526_10005269 | 184 |
| 1130 | 3300046460 | Ga0495638_0021407 | Ga0495638_0021407_2993_3562 | 184 |
| 1131 | 3300046474 | Ga0495605_0159944 | Ga0495605_0159944_135_704 | 184 |
| 1132 | 3300046501 | Ga0495607_0002447 | Ga0495607_0002447_5002_5571 | 184 |
| 1133 | 3300046506 | Ga0495583_0038999 | Ga0495583_0038999_331_900 | 184 |
| 1134 | 3300046513 | Ga0495616_0015635 | Ga0495616_0015635_1012_1581 | 184 |
| 1135 | 3300046538 | Ga0495609_0001477 | Ga0495609_0001477_1048_1617 | 184 |
| 1136 | 3300046616 | Ga0495668_0004131 | Ga0495668_0004131_7983_8552 | 184 |
| 1137 | 3300046664 | Ga0495659_0008842 | Ga0495659_0008842_1837_2406 | 184 |
| 1138 | 3300046665 | Ga0495661_0030072 | Ga0495661_0030072_1136_1705 | 184 |
| 1139 | 3300046684 | Ga0495669_0000597 | Ga0495669_0000597_9874_10443 | 184 |
| 1140 | 3300046692 | Ga0495671_0061381 | Ga0495671_0061381_1071_1640 | 184 |
| 1141 | 3300046694 | Ga0495649_0004743 | Ga0495649_0004743_6143_6712 | 184 |
| 1142 | 3300046810 | Ga0495660_0111133 | Ga0495660_0111133_112_681 | 184 |
| 1143 | 3300047318 | Ga0495636_0011053 | Ga0495636_0011053_1907_2476 | 184 |
| 1144 | 3300047446 | Ga0495679_014054 | Ga0495679_014054_1509_2078 | 184 |
| 1145 | 3300047470 | Ga0495681_0012047 | Ga0495681_0012047_1707_2276 | 184 |
| 1146 | 3300048904 | Ga0496101_0493517 | Ga0496101_0493517_123_701 | 184 |
| 1147 | 3300048905 | Ga0496102_0000425 | Ga0496102_0000425_44612_45190 | 184 |
| 1148 | 3300048905 | Ga0496102_0266147 | Ga0496102_0266147_935_1513 | 184 |
| 1149 | 3300048906 | Ga0496103_0057095 | Ga0496103_0057095_1098_1676 | 184 |
| 1150 | 3300048907 | Ga0496104_0624866 | Ga0496104_0624866_349_927 | 184 |
| 1151 | 3300048919 | Ga0496116_0014929 | Ga0496116_0014929_927_1505 | 184 |
| 1152 | 3300031838 | Ga0307518_10026365 | Ga0307518_100263653 | 185 |
| 1153 | 3300046558 | Ga0495633_0042129 | Ga0495633_0042129_506_1090 | 185 |
| 1154 | 3300048917 | Ga0496114_0007150 | Ga0496114_0007150_5499_6083 | 185 |
| 1155 | 3300048928 | Ga0496125_0002625 | Ga0496125_0002625_14139_14723 | 185 |
| 1156 | iso_pu_bacteria | 2834641062 | 2834645434 | 185 |
| 1157 | iso_pu_bacteria | 2928115317 | 2928121194 | 185 |
| 1158 | 3300006946 | Ga0079104_1004880 | Ga0079104_10048802 | 186 |
| 1159 | 3300031901 | Ga0307406_10296208 | Ga0307406_102962081 | 186 |
| 1160 | 3300037471 | Ga0395905_0011469 | Ga0395905_0011469_5080_5673 | 186 |
| 1161 | 3300037471 | Ga0395905_0151227 | Ga0395905_0151227_1209_1802 | 186 |
| 1162 | 3300046528 | Ga0495642_0050457 | Ga0495642_0050457_265_861 | 186 |
| 1163 | 3300047443 | Ga0495687_093389 | Ga0495687_093389_23_619 | 186 |
| 1164 | 3300047472 | Ga0495686_0025029 | Ga0495686_0025029_3110_3724 | 186 |
| 1165 | 3300006948 | Ga0099826_10000014 | Ga0099826_10000014125 | 187 |
| 1166 | 3300009011 | Ga0105251_10037988 | Ga0105251_100379882 | 187 |
| 1167 | 3300025303 | Ga0209051_1032132 | Ga0209051_10321322 | 187 |
| 1168 | 3300027666 | Ga0209282_1000046 | Ga0209282_100004699 | 187 |
| 1169 | 3300046474 | Ga0495605_0004593 | Ga0495605_0004593_680_1276 | 187 |
| 1170 | 3300046500 | Ga0495596_0007897 | Ga0495596_0007897_3826_4422 | 187 |
| 1171 | 3300046501 | Ga0495607_0018017 | Ga0495607_0018017_410_1006 | 187 |
| 1172 | 3300046512 | Ga0495610_0013836 | Ga0495610_0013836_3683_4279 | 187 |
| 1173 | 3300046513 | Ga0495616_0012802 | Ga0495616_0012802_3693_4289 | 187 |
| 1174 | 3300046524 | Ga0495648_0177411 | Ga0495648_0177411_273_869 | 187 |
| 1175 | 3300046530 | Ga0495654_0135295 | Ga0495654_0135295_239_835 | 187 |
| 1176 | 3300046538 | Ga0495609_0010243 | Ga0495609_0010243_3586_4182 | 187 |
| 1177 | 3300046665 | Ga0495661_0162470 | Ga0495661_0162470_323_919 | 187 |
| 1178 | 3300046684 | Ga0495669_0055160 | Ga0495669_0055160_302_898 | 187 |
| 1179 | 3300046692 | Ga0495671_0004937 | Ga0495671_0004937_3526_4122 | 187 |
| 1180 | 3300047318 | Ga0495636_0048126 | Ga0495636_0048126_956_1543 | 187 |
| 1181 | 3300047320 | Ga0495672_0020289 | Ga0495672_0020289_3648_4244 | 187 |
| 1182 | 3300048919 | Ga0496116_0019076 | Ga0496116_0019076_117_713 | 187 |
| 1183 | 3300048924 | Ga0496121_0032350 | Ga0496121_0032350_3645_4241 | 187 |
| 1184 | 3300048925 | Ga0496122_0028426 | Ga0496122_0028426_3689_4285 | 187 |
| 1185 | 3300048926 | Ga0496123_0060843 | Ga0496123_0060843_452_1048 | 187 |
| 1186 | 3300048928 | Ga0496125_0126401 | Ga0496125_0126401_755_1351 | 187 |
| 1187 | 3300003187 | JGI25151J46595_10015671 | JGI25151J46595_100156712 | 188 |
| 1188 | 3300003322 | rootL2_10258849 | rootL2_102588492 | 188 |
| 1189 | 3300003771 | Ga0055526_1015796 | Ga0055526_10157961 | 188 |
| 1190 | 3300003771 | Ga0055526_1025067 | Ga0055526_10250672 | 188 |
| 1191 | 3300003781 | Ga0055536_1000150 | Ga0055536_100015044 | 188 |
| 1192 | 3300003784 | Ga0055534_1007945 | Ga0055534_10079452 | 188 |
| 1193 | 3300025263 | Ga0209565_1006412 | Ga0209565_10064123 | 188 |
| 1194 | 3300025291 | Ga0209675_1000449 | Ga0209675_100044910 | 188 |
| 1195 | 3300025292 | Ga0209676_1000064 | Ga0209676_1000064168 | 188 |
| 1196 | 3300025294 | Ga0209025_1000690 | Ga0209025_100069049 | 188 |
| 1197 | 3300025294 | Ga0209025_1000746 | Ga0209025_100074646 | 188 |
| 1198 | 3300025295 | Ga0209564_1000891 | Ga0209564_100089127 | 188 |
| 1199 | 3300025295 | Ga0209564_1001109 | Ga0209564_100110920 | 188 |
| 1200 | 3300025299 | Ga0209256_1000193 | Ga0209256_100019350 | 188 |
| 1201 | 3300025303 | Ga0209051_1012476 | Ga0209051_10124765 | 188 |
| 1202 | iso_pu_bacteria | 2513237165 | 2514040135 | 188 |
| 1203 | iso_pu_bacteria | 2596583598 | 2597030768 | 188 |
| 1204 | iso_pu_bacteria | 2599185178 | 2599446998 | 188 |
| 1205 | iso_pu_bacteria | 2885266251 | 2885268936 | 188 |
| 1206 | iso_pu_bacteria | 2900577576 | 2900579543 | 188 |
| 1207 | iso_pu_bacteria | 2900577576 | 2900582302 | 188 |
| 1208 | iso_pu_bacteria | 2928058823 | 2928061300 | 188 |
| 1209 | 3300003187 | JGI25151J46595_10003399 | JGI25151J46595_100033992 | 189 |
| 1210 | 3300003775 | Ga0055524_1000300 | Ga0055524_100030046 | 189 |
| 1211 | 3300003784 | Ga0055534_1002058 | Ga0055534_10020585 | 189 |
| 1212 | 3300025263 | Ga0209565_1000045 | Ga0209565_1000045102 | 189 |
| 1213 | 3300025291 | Ga0209675_1000663 | Ga0209675_10006637 | 189 |
| 1214 | 3300025294 | Ga0209025_1000762 | Ga0209025_100076220 | 189 |
| 1215 | 3300025294 | Ga0209025_1001563 | Ga0209025_100156319 | 189 |
| 1216 | 3300025294 | Ga0209025_1069276 | Ga0209025_10692762 | 189 |
| 1217 | 3300025295 | Ga0209564_1000462 | Ga0209564_100046265 | 189 |
| 1218 | 3300025297 | Ga0209758_1027209 | Ga0209758_10272092 | 189 |
| 1219 | 3300025299 | Ga0209256_1000105 | Ga0209256_100010571 | 189 |
| 1220 | 3300049571 | Ga0501034_0000385 | Ga0501034_0000385_66904_67506 | 189 |
| 1221 | 3300001979 | JGI24740J21852_10000170 | JGI24740J21852_1000017023 | 192 |
| 1222 | 3300001979 | JGI24740J21852_10000394 | JGI24740J21852_1000039418 | 192 |
| 1223 | 3300002705 | JGI25156J39149_1009826 | JGI25156J39149_10098262 | 192 |
| 1224 | 3300003751 | Ga0055538_1007050 | Ga0055538_10070502 | 192 |
| 1225 | 3300003751 | Ga0055538_1007053 | Ga0055538_10070532 | 192 |
| 1226 | 3300003752 | Ga0055539_1000230 | Ga0055539_10002307 | 192 |
| 1227 | 3300003752 | Ga0055539_1000294 | Ga0055539_10002947 | 192 |
| 1228 | 3300003756 | Ga0055533_1007351 | Ga0055533_10073512 | 192 |
| 1229 | 3300003756 | Ga0055533_1007464 | Ga0055533_10074641 | 192 |
| 1230 | 3300003758 | Ga0055532_1000006 | Ga0055532_1000006109 | 192 |
| 1231 | 3300003759 | Ga0055525_1000414 | Ga0055525_100041417 | 192 |
| 1232 | 3300003760 | Ga0055527_1002364 | Ga0055527_10023642 | 192 |
| 1233 | 3300003761 | Ga0055535_1000004 | Ga0055535_1000004109 | 192 |
| 1234 | 3300003762 | Ga0055542_1001324 | Ga0055542_100132410 | 192 |
| 1235 | 3300003763 | Ga0055529_1000022 | Ga0055529_1000022212 | 192 |
| 1236 | 3300003841 | Ga0055541_1002414 | Ga0055541_10024143 | 192 |
| 1237 | 3300003841 | Ga0055541_1007377 | Ga0055541_10073772 | 192 |
| 1238 | 3300003841 | Ga0055541_1014989 | Ga0055541_10149892 | 192 |
| 1239 | 3300005344 | Ga0070661_100000012 | Ga0070661_100000012160 | 192 |
| 1240 | 3300005366 | Ga0070659_100042824 | Ga0070659_1000428242 | 192 |
| 1241 | 3300005455 | Ga0070663_100000020 | Ga0070663_10000002018 | 192 |
| 1242 | 3300005564 | Ga0070664_100000003 | Ga0070664_100000003212 | 192 |
| 1243 | 3300005577 | Ga0068857_100164971 | Ga0068857_1001649712 | 192 |
| 1244 | 3300005578 | Ga0068854_100000352 | Ga0068854_10000035222 | 192 |
| 1245 | 3300005614 | Ga0068856_100000011 | Ga0068856_100000011111 | 192 |
| 1246 | 3300009093 | Ga0105240_10063637 | Ga0105240_100636375 | 192 |
| 1247 | 3300013102 | Ga0157371_10000083 | Ga0157371_10000083110 | 192 |
| 1248 | 3300013104 | Ga0157370_10000141 | Ga0157370_1000014150 | 192 |
| 1249 | 3300013105 | Ga0157369_10003851 | Ga0157369_100038512 | 192 |
| 1250 | 3300013307 | Ga0157372_10000775 | Ga0157372_100007757 | 192 |
| 1251 | 3300014497 | Ga0182008_10205890 | Ga0182008_102058902 | 192 |
| 1252 | 3300015261 | Ga0182006_1001545 | Ga0182006_10015456 | 192 |
| 1253 | 3300015262 | Ga0182007_10003234 | Ga0182007_100032345 | 192 |
| 1254 | 3300015265 | Ga0182005_1100063 | Ga0182005_11000632 | 192 |
| 1255 | 3300020077 | Ga0206351_10502756 | Ga0206351_1050275614 | 192 |
| 1256 | 3300020080 | Ga0206350_10374774 | Ga0206350_103747744 | 192 |
| 1257 | 3300020610 | Ga0154015_1372279 | Ga0154015_13722795 | 192 |
| 1258 | 3300025224 | Ga0209784_100150 | Ga0209784_10015023 | 192 |
| 1259 | 3300025224 | Ga0209784_100517 | Ga0209784_1005177 | 192 |
| 1260 | 3300025224 | Ga0209784_100673 | Ga0209784_1006736 | 192 |
| 1261 | 3300025224 | Ga0209784_102726 | Ga0209784_1027262 | 192 |
| 1262 | 3300025225 | Ga0209566_100002 | Ga0209566_100002961 | 192 |
| 1263 | 3300025225 | Ga0209566_101174 | Ga0209566_1011747 | 192 |
| 1264 | 3300025225 | Ga0209566_102638 | Ga0209566_1026382 | 192 |
| 1265 | 3300025226 | Ga0209674_100010 | Ga0209674_100010177 | 192 |
| 1266 | 3300025226 | Ga0209674_100050 | Ga0209674_100050112 | 192 |
| 1267 | 3300025226 | Ga0209674_100248 | Ga0209674_10024834 | 192 |
| 1268 | 3300025226 | Ga0209674_109945 | Ga0209674_1099451 | 192 |
| 1269 | 3300025228 | Ga0209672_100218 | Ga0209672_10021830 | 192 |
| 1270 | 3300025229 | Ga0209147_100015 | Ga0209147_100015434 | 192 |
| 1271 | 3300025230 | Ga0209563_100004 | Ga0209563_100004372 | 192 |
| 1272 | 3300025230 | Ga0209563_100026 | Ga0209563_100026377 | 192 |
| 1273 | 3300025230 | Ga0209563_114570 | Ga0209563_1145701 | 192 |
| 1274 | 3300025242 | Ga0209258_100021 | Ga0209258_100021434 | 192 |
| 1275 | 3300025246 | Ga0209646_1000055 | Ga0209646_1000055271 | 192 |
| 1276 | 3300025250 | Ga0209026_1007223 | Ga0209026_10072233 | 192 |
| 1277 | 3300025253 | Ga0209677_100007 | Ga0209677_100007960 | 192 |
| 1278 | 3300025253 | Ga0209677_104511 | Ga0209677_1045112 | 192 |
| 1279 | 3300025254 | Ga0209148_1000109 | Ga0209148_100010933 | 192 |
| 1280 | 3300025254 | Ga0209148_1003918 | Ga0209148_10039183 | 192 |
| 1281 | 3300025256 | Ga0209759_1002759 | Ga0209759_10027593 | 192 |
| 1282 | 3300025256 | Ga0209759_1003327 | Ga0209759_10033275 | 192 |
| 1283 | 3300025256 | Ga0209759_1036187 | Ga0209759_10361872 | 192 |
| 1284 | 3300025272 | Ga0209455_1000028 | Ga0209455_1000028434 | 192 |
| 1285 | 3300025913 | Ga0207695_10032508 | Ga0207695_100325086 | 192 |
| 1286 | 3300025920 | Ga0207649_10000302 | Ga0207649_1000030234 | 192 |
| 1287 | 3300025932 | Ga0207690_10027687 | Ga0207690_100276872 | 192 |
| 1288 | 3300025945 | Ga0207679_10000007 | Ga0207679_100000077 | 192 |
| 1289 | 3300025981 | Ga0207640_10000255 | Ga0207640_100002556 | 192 |
| 1290 | 3300026067 | Ga0207678_10000030 | Ga0207678_1000003018 | 192 |
| 1291 | 3300026078 | Ga0207702_10000054 | Ga0207702_1000005452 | 192 |
| 1292 | 3300026116 | Ga0207674_10027431 | Ga0207674_100274315 | 192 |
| 1293 | 3300026142 | Ga0207698_10249519 | Ga0207698_102495191 | 192 |
| 1294 | 3300037312 | Ga0395899_0097580 | Ga0395899_0097580_266_844 | 192 |
| 1295 | 3300037466 | Ga0395898_0460454 | Ga0395898_0460454_544_1122 | 192 |
| 1296 | 3300044656 | Ga0466969_0034399 | Ga0466969_0034399_832_1410 | 192 |
| 1297 | 3300044658 | Ga0466972_0029231 | Ga0466972_0029231_1106_1684 | 192 |
| 1298 | 3300044672 | Ga0466982_0059055 | Ga0466982_0059055_1169_1747 | 192 |
| 1299 | 3300044693 | Ga0466961_0000499 | Ga0466961_0000499_6075_6653 | 192 |
| 1300 | 3300044706 | Ga0466964_0001971 | Ga0466964_0001971_709_1287 | 192 |
| 1301 | 3300044735 | Ga0466968_0162729 | Ga0466968_0162729_108_686 | 192 |
| 1302 | 3300044765 | Ga0466970_0023541 | Ga0466970_0023541_692_1270 | 192 |
| 1303 | 3300044842 | Ga0466957_0011423 | Ga0466957_0011423_2799_3377 | 192 |
| 1304 | 3300045049 | Ga0466959_0061189 | Ga0466959_0061189_506_1084 | 192 |
| 1305 | 3300045976 | Ga0466967_0059649 | Ga0466967_0059649_1957_2535 | 192 |
| 1306 | 3300048928 | Ga0496125_0260056 | Ga0496125_0260056_292_870 | 192 |
| 1307 | 3300061719 | Ga0466962_0085992 | Ga0466962_0085992_47_625 | 192 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l8h-assembly4.cif.gz_D | crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate | 0.9958 | 6 | 181 |
| 3l8h-assembly4.cif.gz_D | crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate | 0.9737 | 6 | 181 |
| 4pnh-assembly1.cif.gz_A | crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis | 0.9309 | 6 | 181 |
| 4pnh-assembly1.cif.gz_A | crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis | 0.9137 | 6 | 181 |
| 2fpx-assembly1.cif.gz_A | crystal structure of the n-terminal domain of e.coli hisb- sulfate complex. | 0.8825 | 5 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l8hD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9918 | 6 | 181 | 3.40.50.1000 |
| 3l8hD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9749 | 6 | 181 | 3.40.50.1000 |
| 4jyrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9307 | 6 | 181 | 3.40.50.1000 |
| 4jyrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9136 | 6 | 181 | 3.40.50.1000 |
| af_P9WMV3_2_164_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8698 | 2 | 170 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2R1F9-F1-model_v4 | D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase | 1.006 | 6 | 94 |
GO:0005975
GO:0016791 |
| AF-A0A1G5TH41-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) | 1.001 | 6 | 179 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
| AF-A0A3D1J0Y8-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase | 1.001 | 6 | 166 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
| AF-A0A1J4YMS1-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) | 1 | 6 | 179 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
| AF-A0A2M7J2C6-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) | 1 | 6 | 179 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar