F492831

General Info

Members Datasets Scaffolds Average Seq Length
1307 487 1279 193

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10737848|Ga0207658_107378481
Length 223
Sequence MLPRGGAQCPSGGRAGTGMTPMKLIILDRDGTINEDRDDFVKTPDEWVPIPGALEAIARLNHAGWHTVIATNQSGLGRGTFDMATLNAMHTKMNQMLAKQGGRIDAVFFCPHAPEDACQCRKPLPGLFEQIGERFGVPLSEVPVVGDSLRDLQAGVAVGCAPHLVRTGKGAAMSQAQLDALCAQVPGTIVHADLTAFADHMIRTERRDRAATGESDSGFGRLD

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
5 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
6 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
7 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
8 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
11 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
12 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
15 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
16 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
17 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
18 2885266251 Ralstonia sp. SET104 Isolate Nodule
19 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
20 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
21 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
22 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
23 2928058823 Ralstonia sp. 1138 Isolate Unclassified
24 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
49 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
171 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
172 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
175 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
254 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
255 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
256 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
257 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
263 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
267 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
268 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
269 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
273 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
276 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
277 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
279 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
280 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
285 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
286 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
291 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
292 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
299 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
308 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
309 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
310 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
321 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
330 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
331 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
345 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
346 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
347 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
348 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
349 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
355 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
356 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
359 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
362 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
365 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
366 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
367 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
368 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
369 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
370 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
380 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
381 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
382 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
386 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
387 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
388 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
389 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
390 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
391 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
392 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
393 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
396 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
397 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
398 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
402 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
403 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
404 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
405 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
411 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
412 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
413 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
414 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
415 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
416 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
417 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
418 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
419 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
420 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
421 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
422 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
423 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
424 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
425 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
426 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
429 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
430 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
431 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
432 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
433 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
434 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
435 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
436 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
437 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
452 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
455 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
456 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
457 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
458 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
459 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
460 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
461 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
462 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
463 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
464 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
467 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
468 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
469 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
470 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
471 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
472 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
473 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
474 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
475 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
476 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
477 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
478 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
479 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
480 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
481 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
485 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
486 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
487 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0.46
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.1
Nodule 0.99
Rhizoplane 4.13
Rhizosphere 77.28
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000170 3300001979 Bacteria 26025
2 JGI24740J21852_10000394 3300001979 Bacteria 18727
3 JGI24735J21928_10002393 3300002067 Bacteria 6520
4 JGI25156J39149_1009826 3300002705 Bacteria 2294
5 JGI25151J46595_10003399 3300003187 Bacteria 8810
6 JGI25151J46595_10015671 3300003187 Bacteria 3333
7 JGI25151J46595_10029267 3300003187 Bacteria 2183
8 rootH1_10012984 3300003316 Bacteria 1918
9 rootH1_10059048 3300003316 Bacteria 1713
10 rootH1_10097847 3300003316 Bacteria 1979
11 rootL2_10258849 3300003322 Bacteria 2309
12 rootL2_10285392 3300003322 Bacteria 1801
13 rootH1_10137895 3300003323 Bacteria 1061
14 Ga0055538_1007050 3300003751 Bacteria 1042
15 Ga0055538_1007053 3300003751 Bacteria 1042
16 Ga0055539_1000230 3300003752 Bacteria 39333
17 Ga0055539_1000294 3300003752 Bacteria 27517
18 Ga0055533_1007351 3300003756 Bacteria 1510
19 Ga0055533_1007464 3300003756 Bacteria 1487
20 Ga0055532_1000006 3300003758 Bacteria 451244
21 Ga0055525_1000414 3300003759 Bacteria 26035
22 Ga0055527_1002364 3300003760 Bacteria 3231
23 Ga0055535_1000004 3300003761 Bacteria 451244
24 Ga0055542_1001324 3300003762 Bacteria 12975
25 Ga0055529_1000022 3300003763 Bacteria 320108
26 Ga0055526_1000526 3300003771 Bacteria 30389
27 Ga0055526_1015796 3300003771 Bacteria 3005
28 Ga0055526_1025067 3300003771 Bacteria 1926
29 Ga0055524_1000029 3300003775 Bacteria 201332
30 Ga0055524_1000300 3300003775 Bacteria 47498
31 Ga0055536_1000150 3300003781 Bacteria 59586
32 Ga0055534_1002058 3300003784 Bacteria 7264
33 Ga0055534_1007945 3300003784 Bacteria 2460
34 Ga0055530_10046509 3300003791 Bacteria 1030
35 Ga0055540_1001614 3300003792 Bacteria 13126
36 Ga0055531_10002809 3300003794 Bacteria 11426
37 Ga0055541_1002414 3300003841 Bacteria 3743
38 Ga0055541_1007377 3300003841 Bacteria 1810
39 Ga0055541_1014989 3300003841 Bacteria 1042
40 Ga0065715_10166303 3300005293 Bacteria 1584
41 Ga0070658_10369786 3300005327 Bacteria 1229
42 Ga0070676_10032673 3300005328 Bacteria 2982
43 Ga0070676_10072709 3300005328 Bacteria 2068
44 Ga0070676_10120555 3300005328 Bacteria 1646
45 Ga0070690_100296141 3300005330 Bacteria 1159
46 Ga0070670_100003283 3300005331 Bacteria 13377
47 Ga0070670_100035755 3300005331 Bacteria 4276
48 Ga0070670_100074887 3300005331 Bacteria 2909
49 Ga0070670_100116237 3300005331 Bacteria 2306
50 Ga0070670_100280161 3300005331 Bacteria 1456
51 Ga0070670_100472311 3300005331 Bacteria 1113
52 Ga0070670_100501395 3300005331 Bacteria 1079
53 Ga0070670_101023725 3300005331 Bacteria 751
54 Ga0070677_10003148 3300005333 Bacteria 5305
55 Ga0070677_10013848 3300005333 Bacteria 2831
56 Ga0070677_10077985 3300005333 Bacteria 1410
57 Ga0070677_10121295 3300005333 Bacteria 1181
58 Ga0068869_100004113 3300005334 Bacteria 9017
59 Ga0068869_100021949 3300005334 Bacteria 4394
60 Ga0070666_10011342 3300005335 Bacteria 5592
61 Ga0070666_10268319 3300005335 Bacteria 1211
62 Ga0070666_10326700 3300005335 Bacteria 1095
63 Ga0070666_10334021 3300005335 Bacteria 1083
64 Ga0070666_10376314 3300005335 Bacteria 1019
65 Ga0070680_100106872 3300005336 Bacteria 2327
66 Ga0070680_100694378 3300005336 Bacteria 875
67 Ga0070682_100119355 3300005337 Bacteria 1768
68 Ga0070682_100780926 3300005337 Bacteria 774
69 Ga0068868_100009310 3300005338 Bacteria 7062
70 Ga0068868_100068111 3300005338 Bacteria 2834
71 Ga0068868_100153350 3300005338 Bacteria 1899
72 Ga0068868_100259058 3300005338 Bacteria 1466
73 Ga0068868_100414072 3300005338 Bacteria 1166
74 Ga0068868_100414319 3300005338 Bacteria 1165
75 Ga0068868_100871305 3300005338 Bacteria 817
76 Ga0070660_100010897 3300005339 Bacteria 6435
77 Ga0070660_100085744 3300005339 Bacteria 2477
78 Ga0070689_101314010 3300005340 Bacteria 651
79 Ga0070687_100003995 3300005343 Bacteria 5816
80 Ga0070687_100018067 3300005343 Bacteria 3254
81 Ga0070687_100177157 3300005343 Bacteria 1274
82 Ga0070687_100181456 3300005343 Bacteria 1261
83 Ga0070661_100000012 3300005344 Bacteria 167998
84 Ga0070661_100561211 3300005344 Bacteria 920
85 Ga0070692_10072358 3300005345 Bacteria 1839
86 Ga0070668_100019399 3300005347 Bacteria 5118
87 Ga0070668_100105862 3300005347 Bacteria 2234
88 Ga0070669_100008805 3300005353 Bacteria 7199
89 Ga0070669_100013746 3300005353 Bacteria 5754
90 Ga0070669_100050201 3300005353 Bacteria 3047
91 Ga0070669_100096035 3300005353 Bacteria 2230
92 Ga0070669_100484343 3300005353 Bacteria 1024
93 Ga0070669_100520801 3300005353 Bacteria 988
94 Ga0070669_100877275 3300005353 Bacteria 765
95 Ga0070675_100002407 3300005354 Bacteria 13964
96 Ga0070675_100013720 3300005354 Bacteria 6376
97 Ga0070675_100019141 3300005354 Bacteria 5454
98 Ga0070675_100022424 3300005354 Bacteria 5046
99 Ga0070675_100024765 3300005354 Bacteria 4807
100 Ga0070675_100044472 3300005354 Bacteria 3632
101 Ga0070675_100170640 3300005354 Bacteria 1875
102 Ga0070675_100250813 3300005354 Bacteria 1549
103 Ga0070675_100422924 3300005354 Bacteria 1191
104 Ga0070675_100978778 3300005354 Bacteria 776
105 Ga0070671_100003297 3300005355 Bacteria 12596
106 Ga0070671_100041344 3300005355 Bacteria 3831
107 Ga0070671_100092436 3300005355 Bacteria 2535
108 Ga0070671_100113636 3300005355 Bacteria 2275
109 Ga0070671_100200288 3300005355 Bacteria 1693
110 Ga0070671_100564749 3300005355 Bacteria 982
111 Ga0070674_100017825 3300005356 Bacteria 4475
112 Ga0070674_100031937 3300005356 Bacteria 3493
113 Ga0070674_100178103 3300005356 Bacteria 1626
114 Ga0070674_100180955 3300005356 Bacteria 1615
115 Ga0070674_100209566 3300005356 Bacteria 1510
116 Ga0070674_100635680 3300005356 Bacteria 906
117 Ga0070673_100010706 3300005364 Bacteria 6220
118 Ga0070673_100024640 3300005364 Bacteria 4415
119 Ga0070673_100050212 3300005364 Bacteria 3261
120 Ga0070673_100172901 3300005364 Bacteria 1845
121 Ga0070673_100853708 3300005364 Bacteria 842
122 Ga0070688_100225616 3300005365 Bacteria 1323
123 Ga0070688_100425627 3300005365 Bacteria 988
124 Ga0070659_100042824 3300005366 Bacteria 3540
125 Ga0070659_100053565 3300005366 Bacteria 3176
126 Ga0070659_100186400 3300005366 Bacteria 1704
127 Ga0070659_100332166 3300005366 Bacteria 1272
128 Ga0070667_100004664 3300005367 Bacteria 11504
129 Ga0070667_100006816 3300005367 Bacteria 9488
130 Ga0070667_100016316 3300005367 Bacteria 6144
131 Ga0070667_100169310 3300005367 Bacteria 1928
132 Ga0070701_10055247 3300005438 Bacteria 2073
133 Ga0070711_100540174 3300005439 Bacteria 966
134 Ga0070700_100003564 3300005441 Bacteria 8042
135 Ga0070700_100231214 3300005441 Bacteria 1316
136 Ga0070700_100448086 3300005441 Bacteria 982
137 Ga0070694_100005915 3300005444 Bacteria 7415
138 Ga0070694_100624671 3300005444 Bacteria 870
139 Ga0070708_100438762 3300005445 Bacteria 1232
140 Ga0070663_100000020 3300005455 Bacteria 112469
141 Ga0070663_100000383 3300005455 Bacteria 23293
142 Ga0070663_100018798 3300005455 Bacteria 4539
143 Ga0070663_100106408 3300005455 Bacteria 2101
144 Ga0070663_100340516 3300005455 Bacteria 1212
145 Ga0070663_100557360 3300005455 Bacteria 959
146 Ga0070678_100007678 3300005456 Bacteria 6412
147 Ga0070678_100007693 3300005456 Bacteria 6407
148 Ga0070678_100027275 3300005456 Bacteria 3877
149 Ga0070678_100064007 3300005456 Bacteria 2724
150 Ga0070678_100107343 3300005456 Bacteria 2177
151 Ga0070678_100190872 3300005456 Bacteria 1684
152 Ga0070678_100800847 3300005456 Bacteria 856
153 Ga0070662_100018320 3300005457 Bacteria 4735
154 Ga0070662_100171358 3300005457 Bacteria 1705
155 Ga0070662_100282080 3300005457 Bacteria 1345
156 Ga0070662_100463643 3300005457 Bacteria 1053
157 Ga0070681_10763020 3300005458 Bacteria 884
158 Ga0068867_100000021 3300005459 Bacteria 92798
159 Ga0068867_100003201 3300005459 Bacteria 11543
160 Ga0068867_100015559 3300005459 Bacteria 5397
161 Ga0068867_100022723 3300005459 Bacteria 4486
162 Ga0068867_100023593 3300005459 Bacteria 4404
163 Ga0068867_100124684 3300005459 Bacteria 1994
164 Ga0068867_100256997 3300005459 Bacteria 1423
165 Ga0068867_100797100 3300005459 Bacteria 842
166 Ga0070685_10027554 3300005466 Bacteria 3142
167 Ga0070698_100079870 3300005471 Bacteria 3267
168 Ga0068853_100324998 3300005539 Bacteria 1427
169 Ga0068853_100391329 3300005539 Bacteria 1300
170 Ga0068853_100410523 3300005539 Bacteria 1269
171 Ga0070672_100006265 3300005543 Bacteria 7972
172 Ga0070672_100017297 3300005543 Bacteria 5185
173 Ga0070672_100048444 3300005543 Bacteria 3302
174 Ga0070672_100112244 3300005543 Bacteria 2223
175 Ga0070672_100259237 3300005543 Bacteria 1466
176 Ga0070672_100259693 3300005543 Bacteria 1465
177 Ga0070672_100297053 3300005543 Bacteria 1368
178 Ga0070686_100106892 3300005544 Bacteria 1900
179 Ga0070686_100161391 3300005544 Bacteria 1579
180 Ga0070686_100685905 3300005544 Bacteria 816
181 Ga0070695_100047148 3300005545 Bacteria 2751
182 Ga0070696_100023627 3300005546 Bacteria 4178
183 Ga0070696_100410035 3300005546 Bacteria 1062
184 Ga0070665_100030125 3300005548 Bacteria 5460
185 Ga0070665_100203381 3300005548 Bacteria 1981
186 Ga0070665_100247846 3300005548 Bacteria 1782
187 Ga0070665_100929479 3300005548 Bacteria 882
188 Ga0070665_100992631 3300005548 Bacteria 852
189 Ga0068855_100011895 3300005563 Bacteria 10522
190 Ga0068855_100444873 3300005563 Bacteria 1415
191 Ga0070664_100000003 3300005564 Bacteria 325604
192 Ga0070664_100048588 3300005564 Bacteria 3585
193 Ga0070664_100074018 3300005564 Bacteria 2923
194 Ga0070664_100084721 3300005564 Bacteria 2736
195 Ga0070664_100084786 3300005564 Bacteria 2735
196 Ga0070664_100137572 3300005564 Bacteria 2149
197 Ga0070664_100277793 3300005564 Bacteria 1510
198 Ga0068857_100164971 3300005577 Bacteria 2011
199 Ga0068854_100000352 3300005578 Bacteria 29570
200 Ga0068854_100123104 3300005578 Bacteria 1972
201 Ga0068854_100158888 3300005578 Bacteria 1749
202 Ga0068854_100215157 3300005578 Bacteria 1518
203 Ga0068854_100266048 3300005578 Bacteria 1374
204 Ga0068856_100000011 3300005614 Bacteria 170419
205 Ga0068856_100131758 3300005614 Bacteria 2505
206 Ga0070702_100051490 3300005615 Bacteria 2357
207 Ga0070702_100158970 3300005615 Bacteria 1459
208 Ga0068852_100012412 3300005616 Bacteria 6468
209 Ga0068852_100812430 3300005616 Bacteria 949
210 Ga0068852_100859154 3300005616 Bacteria 923
211 Ga0068852_100925034 3300005616 Bacteria 890
212 Ga0068859_100018681 3300005617 Bacteria 6966
213 Ga0068859_100053864 3300005617 Bacteria 4046
214 Ga0068859_100319072 3300005617 Bacteria 1648
215 Ga0068859_100692883 3300005617 Bacteria 1110
216 Ga0068864_100008520 3300005618 Bacteria 8460
217 Ga0068864_100008889 3300005618 Bacteria 8281
218 Ga0068864_100014167 3300005618 Bacteria 6617
219 Ga0068864_100034866 3300005618 Bacteria 4282
220 Ga0068864_100088530 3300005618 Bacteria 2727
221 Ga0068864_100090299 3300005618 Bacteria 2701
222 Ga0068864_100207308 3300005618 Bacteria 1803
223 Ga0068864_100227472 3300005618 Bacteria 1724
224 Ga0068866_10004238 3300005718 Bacteria 5888
225 Ga0068866_10071239 3300005718 Bacteria 1838
226 Ga0068861_100003457 3300005719 Bacteria 10487
227 Ga0068861_100029120 3300005719 Bacteria 4036
228 Ga0068861_100203848 3300005719 Bacteria 1662
229 Ga0068851_10037603 3300005834 Bacteria 2427
230 Ga0068851_10095103 3300005834 Bacteria 1574
231 Ga0068851_10239381 3300005834 Bacteria 1026
232 Ga0068870_10129556 3300005840 Bacteria 1464
233 Ga0068870_10183174 3300005840 Bacteria 1259
234 Ga0068870_10340611 3300005840 Bacteria 959
235 Ga0068870_10467270 3300005840 Bacteria 835
236 Ga0068863_100006252 3300005841 Bacteria 11696
237 Ga0068863_100017003 3300005841 Bacteria 6975
238 Ga0068863_100045259 3300005841 Bacteria 4177
239 Ga0068863_100062851 3300005841 Bacteria 3511
240 Ga0068863_100275905 3300005841 Bacteria 1628
241 Ga0068863_100294660 3300005841 Bacteria 1573
242 Ga0068863_100802494 3300005841 Bacteria 939
243 Ga0068858_100001814 3300005842 Bacteria 21735
244 Ga0068858_100006288 3300005842 Bacteria 11568
245 Ga0068858_100060157 3300005842 Bacteria 3511
246 Ga0068858_100125379 3300005842 Bacteria 2404
247 Ga0068860_100015915 3300005843 Bacteria 7340
248 Ga0068860_100049997 3300005843 Bacteria 3981
249 Ga0068860_100270691 3300005843 Bacteria 1658
250 Ga0068862_100011607 3300005844 Bacteria 7268
251 Ga0068862_100041368 3300005844 Bacteria 3920
252 Ga0068862_100094400 3300005844 Bacteria 2609
253 Ga0075365_10156624 3300006038 Bacteria 1586
254 Ga0075368_10047088 3300006042 Bacteria 1706
255 Ga0075363_100230892 3300006048 Bacteria 1062
256 Ga0075363_100272563 3300006048 Bacteria 978
257 Ga0075432_10036610 3300006058 Bacteria 1706
258 Ga0075367_10037421 3300006178 Bacteria 2820
259 Ga0075366_10006987 3300006195 Bacteria 6215
260 Ga0075366_10008243 3300006195 Bacteria 5784
261 Ga0075366_10064258 3300006195 Bacteria 2182
262 Ga0075366_10083194 3300006195 Bacteria 1913
263 Ga0075366_10115026 3300006195 Bacteria 1620
264 Ga0075366_10203642 3300006195 Bacteria 1204
265 Ga0097621_100054084 3300006237 Bacteria 3273
266 Ga0097621_100163862 3300006237 Bacteria 1912
267 Ga0097621_100209158 3300006237 Bacteria 1697
268 Ga0097621_100289894 3300006237 Bacteria 1443
269 Ga0097621_100411394 3300006237 Bacteria 1212
270 Ga0075370_10001022 3300006353 Bacteria 11620
271 Ga0075370_10008599 3300006353 Bacteria 5263
272 Ga0075370_10022938 3300006353 Bacteria 3433
273 Ga0068871_100055678 3300006358 Bacteria 3211
274 Ga0068871_100104270 3300006358 Bacteria 2379
275 Ga0068871_100168381 3300006358 Bacteria 1877
276 Ga0068871_100571390 3300006358 Bacteria 1026
277 Ga0075428_100109618 3300006844 Bacteria 3007
278 Ga0075430_100000168 3300006846 Bacteria 43228
279 Ga0075431_100044508 3300006847 Bacteria 4579
280 Ga0075429_100784447 3300006880 Bacteria 835
281 Ga0068865_100017387 3300006881 Bacteria 4625
282 Ga0068865_100212659 3300006881 Bacteria 1508
283 Ga0068865_100250844 3300006881 Bacteria 1397
284 Ga0097620_100018680 3300006931 Bacteria 6966
285 Ga0097620_100053863 3300006931 Bacteria 4046
286 Ga0097620_100319058 3300006931 Bacteria 1648
287 Ga0097620_100692914 3300006931 Bacteria 1110
288 Ga0079104_1004880 3300006946 Bacteria 5545
289 Ga0079104_1015257 3300006946 Bacteria 2283
290 Ga0099826_10000014 3300006948 Bacteria 258520
291 Ga0105251_10037988 3300009011 Bacteria 2360
292 Ga0105240_10001844 3300009093 Bacteria 35489
293 Ga0105240_10003122 3300009093 Bacteria 26091
294 Ga0105240_10063637 3300009093 Bacteria 4587
295 Ga0105240_10574098 3300009093 Bacteria 1245
296 Ga0105240_10680036 3300009093 Bacteria 1125
297 Ga0105240_11243043 3300009093 Bacteria 787
298 Ga0111539_10133059 3300009094 Bacteria 2912
299 Ga0111539_10272981 3300009094 Bacteria 1968
300 Ga0111539_10397608 3300009094 Bacteria 1605
301 Ga0111539_10591810 3300009094 Bacteria 1292
302 Ga0111539_12489100 3300009094 Bacteria 600
303 Ga0105245_10054536 3300009098 Bacteria 3590
304 Ga0114129_10591848 3300009147 Bacteria 1438
305 Ga0114129_10926740 3300009147 Bacteria 1102
306 Ga0105243_10000295 3300009148 Bacteria 55066
307 Ga0105243_10066339 3300009148 Bacteria 2902
308 Ga0105243_10067185 3300009148 Bacteria 2885
309 Ga0105243_10187960 3300009148 Bacteria 1802
310 Ga0105243_11559356 3300009148 Bacteria 686
311 Ga0105241_10105240 3300009174 Bacteria 2250
312 Ga0105241_10148197 3300009174 Bacteria 1917
313 Ga0105242_10032793 3300009176 Bacteria 4155
314 Ga0105242_10571467 3300009176 Bacteria 1087
315 Ga0105242_10674403 3300009176 Bacteria 1008
316 Ga0105248_10007354 3300009177 Bacteria 12084
317 Ga0105248_10071910 3300009177 Bacteria 3887
318 Ga0105248_10106940 3300009177 Bacteria 3154
319 Ga0105248_10237055 3300009177 Bacteria 2054
320 Ga0105248_10542651 3300009177 Bacteria 1312
321 Ga0105237_10000678 3300009545 Bacteria 47128
322 Ga0105237_10237395 3300009545 Bacteria 1824
323 Ga0105238_10003973 3300009551 Bacteria 14670
324 Ga0105238_10290002 3300009551 Bacteria 1618
325 Ga0105249_10159790 3300009553 Bacteria 2176
326 Ga0105239_10000292 3300010375 Bacteria 73809
327 Ga0105239_10101934 3300010375 Bacteria 3176
328 Ga0105246_10387269 3300011119 Bacteria 1157
329 Ga0157371_10000083 3300013102 Bacteria 149633
330 Ga0157370_10000141 3300013104 Bacteria 87406
331 Ga0157370_10000310 3300013104 Bacteria 60996
332 Ga0157370_10004672 3300013104 Bacteria 15630
333 Ga0157370_10049678 3300013104 Bacteria 4014
334 Ga0157369_10000525 3300013105 Bacteria 50581
335 Ga0157369_10003851 3300013105 Bacteria 17830
336 Ga0157369_10210924 3300013105 Bacteria 2036
337 Ga0157374_10000138 3300013296 Bacteria 65783
338 Ga0157374_11232871 3300013296 Bacteria 769
339 Ga0157378_10226603 3300013297 Bacteria 1779
340 Ga0163162_10001494 3300013306 Bacteria 21792
341 Ga0163162_10047420 3300013306 Bacteria 4306
342 Ga0163162_10077078 3300013306 Bacteria 3397
343 Ga0163162_10354497 3300013306 Bacteria 1600
344 Ga0163162_10463539 3300013306 Bacteria 1399
345 Ga0163162_11136547 3300013306 Bacteria 885
346 Ga0157372_10000775 3300013307 Bacteria 34581
347 Ga0157372_10018279 3300013307 Bacteria 7534
348 Ga0157375_10015511 3300013308 Bacteria 6822
349 Ga0157375_10029760 3300013308 Bacteria 5140
350 Ga0157375_10043762 3300013308 Bacteria 4345
351 Ga0157375_10137913 3300013308 Bacteria 2564
352 Ga0157375_10236646 3300013308 Bacteria 1985
353 Ga0163163_10009312 3300014325 Bacteria 8761
354 Ga0163163_10089270 3300014325 Bacteria 3094
355 Ga0163163_10136840 3300014325 Bacteria 2491
356 Ga0157380_10007613 3300014326 Bacteria 7697
357 Ga0157380_10150001 3300014326 Bacteria 2014
358 Ga0157380_10964593 3300014326 Bacteria 883
359 Ga0182008_10205890 3300014497 Bacteria 1002
360 Ga0182008_10300639 3300014497 Bacteria 840
361 Ga0157377_10000021 3300014745 Bacteria 147105
362 Ga0157377_10145633 3300014745 Bacteria 1460
363 Ga0157379_10027561 3300014968 Bacteria 5058
364 Ga0157379_10038301 3300014968 Bacteria 4278
365 Ga0157379_10038696 3300014968 Bacteria 4255
366 Ga0157379_10060072 3300014968 Bacteria 3398
367 Ga0157379_10605442 3300014968 Bacteria 1023
368 Ga0157376_10037875 3300014969 Bacteria 3920
369 Ga0157376_10281271 3300014969 Bacteria 1567
370 Ga0157376_10333675 3300014969 Bacteria 1446
371 Ga0157376_10700712 3300014969 Bacteria 1018
372 Ga0182006_1001545 3300015261 Bacteria 13768
373 Ga0182007_10003234 3300015262 Bacteria 7760
374 Ga0182005_1100063 3300015265 Bacteria 812
375 Ga0163161_10013318 3300017792 Bacteria 5720
376 Ga0163161_10112127 3300017792 Bacteria 2040
377 Ga0206351_10502756 3300020077 Bacteria 20710
378 Ga0206350_10374774 3300020080 Bacteria 4455
379 Ga0154015_1372279 3300020610 Bacteria 19706
380 Ga0213872_10000320 3300021361 Bacteria 40938
381 Ga0213872_10029589 3300021361 Bacteria 2511
382 Ga0213872_10045721 3300021361 Bacteria 1992
383 Ga0213876_10119413 3300021384 Bacteria 1399
384 Ga0209784_100150 3300025224 Bacteria 63516
385 Ga0209784_100517 3300025224 Bacteria 14709
386 Ga0209784_100673 3300025224 Bacteria 9690
387 Ga0209784_102726 3300025224 Bacteria 1688
388 Ga0209566_100002 3300025225 Bacteria 2614868
389 Ga0209566_101174 3300025225 Bacteria 9521
390 Ga0209566_102638 3300025225 Bacteria 3163
391 Ga0209674_100010 3300025226 Bacteria 1038638
392 Ga0209674_100050 3300025226 Bacteria 341738
393 Ga0209674_100248 3300025226 Bacteria 45380
394 Ga0209674_109945 3300025226 Bacteria 1036
395 Ga0209672_100218 3300025228 Bacteria 44911
396 Ga0209147_100015 3300025229 Bacteria 565073
397 Ga0209563_100004 3300025230 Bacteria 1814108
398 Ga0209563_100026 3300025230 Bacteria 559453
399 Ga0209563_114570 3300025230 Bacteria 1007
400 Ga0209258_100021 3300025242 Bacteria 565073
401 Ga0209646_1000055 3300025246 Bacteria 271793
402 Ga0209026_1004460 3300025250 Bacteria 4134
403 Ga0209026_1007223 3300025250 Bacteria 2547
404 Ga0209677_100007 3300025253 Bacteria 1021332
405 Ga0209677_104511 3300025253 Bacteria 3983
406 Ga0209148_1000109 3300025254 Bacteria 204266
407 Ga0209148_1003918 3300025254 Bacteria 3853
408 Ga0209759_1000342 3300025256 Bacteria 61422
409 Ga0209759_1002759 3300025256 Bacteria 7445
410 Ga0209759_1003327 3300025256 Bacteria 6461
411 Ga0209759_1003505 3300025256 Bacteria 6223
412 Ga0209759_1005314 3300025256 Bacteria 4547
413 Ga0209759_1024975 3300025256 Bacteria 1281
414 Ga0209759_1036187 3300025256 Bacteria 902
415 Ga0209129_1004207 3300025258 Bacteria 5772
416 Ga0209565_1000045 3300025263 Bacteria 226864
417 Ga0209565_1006412 3300025263 Bacteria 3304
418 Ga0209565_1008844 3300025263 Bacteria 2606
419 Ga0209455_1000028 3300025272 Bacteria 565073
420 Ga0209675_1000449 3300025291 Bacteria 31892
421 Ga0209675_1000663 3300025291 Bacteria 24182
422 Ga0209676_1000064 3300025292 Bacteria 321700
423 Ga0209025_1000690 3300025294 Bacteria 57778
424 Ga0209025_1000746 3300025294 Bacteria 54767
425 Ga0209025_1000762 3300025294 Bacteria 53705
426 Ga0209025_1001563 3300025294 Bacteria 29053
427 Ga0209025_1002648 3300025294 Bacteria 18307
428 Ga0209025_1069276 3300025294 Bacteria 1262
429 Ga0209564_1000462 3300025295 Bacteria 68050
430 Ga0209564_1000891 3300025295 Bacteria 39249
431 Ga0209564_1001109 3300025295 Bacteria 31794
432 Ga0209758_1027209 3300025297 Bacteria 2450
433 Ga0209050_1004945 3300025298 Bacteria 8692
434 Ga0209256_1000013 3300025299 Bacteria 689442
435 Ga0209256_1000105 3300025299 Bacteria 188238
436 Ga0209256_1000193 3300025299 Bacteria 117486
437 Ga0207426_1002027 3300025302 Bacteria 14205
438 Ga0209051_1000454 3300025303 Bacteria 54312
439 Ga0209051_1012476 3300025303 Bacteria 4108
440 Ga0209051_1032132 3300025303 Bacteria 2007
441 Ga0209257_1000022 3300025304 Bacteria 765258
442 Ga0209257_1009360 3300025304 Bacteria 5273
443 Ga0209257_1035023 3300025304 Bacteria 1558
444 Ga0207697_10069502 3300025315 Bacteria 1474
445 Ga0207697_10163028 3300025315 Bacteria 973
446 Ga0207656_10022427 3300025321 Bacteria 2533
447 Ga0207656_10028373 3300025321 Bacteria 2297
448 Ga0207713_1012200 3300025735 Bacteria 4616
449 Ga0207653_10113143 3300025885 Bacteria 971
450 Ga0207682_10007232 3300025893 Bacteria 4437
451 Ga0207682_10008774 3300025893 Bacteria 3998
452 Ga0207682_10010486 3300025893 Bacteria 3632
453 Ga0207682_10025014 3300025893 Bacteria 2367
454 Ga0207642_10023867 3300025899 Bacteria 2450
455 Ga0207642_10052794 3300025899 Bacteria 1846
456 Ga0207642_10158598 3300025899 Bacteria 1212
457 Ga0207688_10098459 3300025901 Bacteria 1686
458 Ga0207688_10137924 3300025901 Bacteria 1434
459 Ga0207688_10289641 3300025901 Bacteria 999
460 Ga0207680_10012229 3300025903 Bacteria 4368
461 Ga0207680_10235920 3300025903 Bacteria 1259
462 Ga0207680_10353091 3300025903 Bacteria 1033
463 Ga0207680_10357090 3300025903 Bacteria 1027
464 Ga0207680_10369241 3300025903 Bacteria 1010
465 Ga0207647_10008975 3300025904 Bacteria 7122
466 Ga0207647_10014971 3300025904 Bacteria 5331
467 Ga0207645_10007870 3300025907 Bacteria 7495
468 Ga0207645_10025599 3300025907 Bacteria 3817
469 Ga0207645_10076194 3300025907 Bacteria 2148
470 Ga0207643_10009100 3300025908 Bacteria 5333
471 Ga0207643_10044714 3300025908 Bacteria 2500
472 Ga0207643_10202288 3300025908 Bacteria 1210
473 Ga0207643_10237532 3300025908 Bacteria 1119
474 Ga0207643_10401375 3300025908 Bacteria 867
475 Ga0207705_10119327 3300025909 Bacteria 1956
476 Ga0207705_10127778 3300025909 Bacteria 1890
477 Ga0207705_10235797 3300025909 Bacteria 1393
478 Ga0207705_10577739 3300025909 Bacteria 874
479 Ga0207654_10191961 3300025911 Bacteria 1339
480 Ga0207695_10020879 3300025913 Bacteria 7484
481 Ga0207695_10032508 3300025913 Bacteria 5709
482 Ga0207695_10050820 3300025913 Bacteria 4358
483 Ga0207695_10221785 3300025913 Bacteria 1798
484 Ga0207695_10544245 3300025913 Bacteria 1042
485 Ga0207671_10018908 3300025914 Bacteria 5278
486 Ga0207671_10025357 3300025914 Bacteria 4454
487 Ga0207671_10488171 3300025914 Bacteria 982
488 Ga0207663_10340230 3300025916 Bacteria 1133
489 Ga0207660_10038683 3300025917 Bacteria 3330
490 Ga0207660_10074410 3300025917 Bacteria 2479
491 Ga0207662_10024856 3300025918 Bacteria 3448
492 Ga0207662_10028948 3300025918 Bacteria 3206
493 Ga0207662_10084753 3300025918 Bacteria 1939
494 Ga0207657_10012865 3300025919 Bacteria 8230
495 Ga0207657_10349702 3300025919 Bacteria 1166
496 Ga0207649_10000302 3300025920 Bacteria 37899
497 Ga0207649_10150683 3300025920 Bacteria 1601
498 Ga0207649_10438737 3300025920 Bacteria 983
499 Ga0207649_10463720 3300025920 Bacteria 958
500 Ga0207652_10374554 3300025921 Bacteria 1285
501 Ga0207681_10001253 3300025923 Bacteria 16371
502 Ga0207681_10007721 3300025923 Bacteria 6587
503 Ga0207681_10008569 3300025923 Bacteria 6244
504 Ga0207681_10168567 3300025923 Bacteria 1658
505 Ga0207694_10027495 3300025924 Bacteria 4332
506 Ga0207694_10129906 3300025924 Bacteria 2019
507 Ga0207650_10001909 3300025925 Bacteria 14684
508 Ga0207650_10002430 3300025925 Bacteria 12967
509 Ga0207650_10015531 3300025925 Bacteria 5303
510 Ga0207650_10100285 3300025925 Bacteria 2227
511 Ga0207650_10105991 3300025925 Bacteria 2170
512 Ga0207650_10236203 3300025925 Bacteria 1476
513 Ga0207650_10435358 3300025925 Bacteria 1090
514 Ga0207659_10001279 3300025926 Bacteria 15051
515 Ga0207659_10003994 3300025926 Bacteria 8900
516 Ga0207659_10012858 3300025926 Bacteria 5344
517 Ga0207659_10038132 3300025926 Bacteria 3340
518 Ga0207659_10099463 3300025926 Bacteria 2190
519 Ga0207659_10203406 3300025926 Bacteria 1583
520 Ga0207659_10225726 3300025926 Bacteria 1508
521 Ga0207659_10436152 3300025926 Bacteria 1101
522 Ga0207687_10513729 3300025927 Bacteria 1001
523 Ga0207644_10001397 3300025931 Bacteria 15575
524 Ga0207644_10001986 3300025931 Bacteria 13227
525 Ga0207644_10061998 3300025931 Bacteria 2710
526 Ga0207644_10266138 3300025931 Bacteria 1372
527 Ga0207644_10489797 3300025931 Bacteria 1013
528 Ga0207690_10027687 3300025932 Bacteria 3584
529 Ga0207690_10350906 3300025932 Bacteria 1166
530 Ga0207690_10808215 3300025932 Bacteria 775
531 Ga0207706_10042544 3300025933 Bacteria 4026
532 Ga0207706_10137043 3300025933 Bacteria 2153
533 Ga0207706_10300428 3300025933 Bacteria 1399
534 Ga0207706_10427890 3300025933 Bacteria 1147
535 Ga0207706_10674342 3300025933 Bacteria 884
536 Ga0207686_10204223 3300025934 Bacteria 1417
537 Ga0207709_10027408 3300025935 Bacteria 3282
538 Ga0207709_10045854 3300025935 Bacteria 2650
539 Ga0207670_10015813 3300025936 Bacteria 4518
540 Ga0207670_11017448 3300025936 Bacteria 697
541 Ga0207669_10006020 3300025937 Bacteria 5501
542 Ga0207669_10092933 3300025937 Bacteria 1969
543 Ga0207669_10357561 3300025937 Bacteria 1130
544 Ga0207669_10448079 3300025937 Bacteria 1022
545 Ga0207669_10499939 3300025937 Bacteria 972
546 Ga0207704_10064764 3300025938 Bacteria 2285
547 Ga0207704_10102281 3300025938 Bacteria 1913
548 Ga0207665_10112107 3300025939 Bacteria 1917
549 Ga0207691_10008987 3300025940 Bacteria 9584
550 Ga0207691_10038531 3300025940 Bacteria 4424
551 Ga0207691_10062504 3300025940 Bacteria 3378
552 Ga0207691_10073282 3300025940 Bacteria 3088
553 Ga0207691_10090505 3300025940 Bacteria 2742
554 Ga0207691_10096822 3300025940 Bacteria 2638
555 Ga0207691_10116063 3300025940 Bacteria 2376
556 Ga0207691_10205809 3300025940 Bacteria 1711
557 Ga0207691_10335866 3300025940 Bacteria 1294
558 Ga0207691_10766811 3300025940 Bacteria 812
559 Ga0207711_10006637 3300025941 Bacteria 9750
560 Ga0207711_10008377 3300025941 Bacteria 8651
561 Ga0207711_10019079 3300025941 Bacteria 5705
562 Ga0207711_10229560 3300025941 Bacteria 1700
563 Ga0207711_10259114 3300025941 Bacteria 1598
564 Ga0207711_10560896 3300025941 Bacteria 1065
565 Ga0207689_10011343 3300025942 Bacteria 7644
566 Ga0207689_10021769 3300025942 Bacteria 5390
567 Ga0207689_10023522 3300025942 Bacteria 5170
568 Ga0207689_10396049 3300025942 Bacteria 1151
569 Ga0207689_10551970 3300025942 Bacteria 968
570 Ga0207679_10000007 3300025945 Bacteria 460140
571 Ga0207679_10088897 3300025945 Bacteria 2383
572 Ga0207679_10174875 3300025945 Bacteria 1771
573 Ga0207679_10421559 3300025945 Bacteria 1178
574 Ga0207679_11025148 3300025945 Bacteria 757
575 Ga0207667_10054586 3300025949 Bacteria 4202
576 Ga0207667_10097810 3300025949 Bacteria 3029
577 Ga0207651_10001690 3300025960 Bacteria 10166
578 Ga0207651_10009296 3300025960 Bacteria 5369
579 Ga0207651_10030385 3300025960 Bacteria 3439
580 Ga0207651_10036213 3300025960 Bacteria 3219
581 Ga0207651_10614659 3300025960 Bacteria 951
582 Ga0207712_10040848 3300025961 Bacteria 3186
583 Ga0207668_10004921 3300025972 Bacteria 7855
584 Ga0207668_10120698 3300025972 Bacteria 1984
585 Ga0207640_10000255 3300025981 Bacteria 36145
586 Ga0207640_10045816 3300025981 Bacteria 2811
587 Ga0207640_10211630 3300025981 Bacteria 1477
588 Ga0207640_10274683 3300025981 Bacteria 1320
589 Ga0207658_10000904 3300025986 Bacteria 24667
590 Ga0207658_10006823 3300025986 Bacteria 7781
591 Ga0207658_10006899 3300025986 Bacteria 7733
592 Ga0207658_10025617 3300025986 Bacteria 4131
593 Ga0207658_10158931 3300025986 Bacteria 1850
594 Ga0207658_10289582 3300025986 Bacteria 1407
595 Ga0207658_10548540 3300025986 Bacteria 1034
596 Ga0207658_10737848 3300025986 Bacteria 891
597 Ga0207677_10003021 3300026023 Bacteria 8884
598 Ga0207677_10054828 3300026023 Bacteria 2723
599 Ga0207677_10075708 3300026023 Bacteria 2393
600 Ga0207677_10089343 3300026023 Bacteria 2236
601 Ga0207677_10572061 3300026023 Bacteria 988
602 Ga0207677_10625621 3300026023 Bacteria 947
603 Ga0207703_10004044 3300026035 Bacteria 12114
604 Ga0207703_10004545 3300026035 Bacteria 11376
605 Ga0207703_10009909 3300026035 Bacteria 7476
606 Ga0207639_10403733 3300026041 Bacteria 1231
607 Ga0207639_10572685 3300026041 Bacteria 1039
608 Ga0207678_10000030 3300026067 Bacteria 112455
609 Ga0207678_10000458 3300026067 Bacteria 36993
610 Ga0207678_10022611 3300026067 Bacteria 5506
611 Ga0207678_10120749 3300026067 Bacteria 2236
612 Ga0207678_10569978 3300026067 Bacteria 991
613 Ga0207678_10588794 3300026067 Bacteria 975
614 Ga0207678_10947134 3300026067 Bacteria 762
615 Ga0207708_10010099 3300026075 Bacteria 7009
616 Ga0207708_10023828 3300026075 Bacteria 4628
617 Ga0207702_10000054 3300026078 Bacteria 137192
618 Ga0207641_10001982 3300026088 Bacteria 19548
619 Ga0207641_10020017 3300026088 Bacteria 5494
620 Ga0207641_10032341 3300026088 Bacteria 4343
621 Ga0207641_10035638 3300026088 Bacteria 4147
622 Ga0207641_10073011 3300026088 Bacteria 2956
623 Ga0207648_10002350 3300026089 Bacteria 20408
624 Ga0207648_10003015 3300026089 Bacteria 17790
625 Ga0207648_10011629 3300026089 Bacteria 8284
626 Ga0207648_10017770 3300026089 Bacteria 6457
627 Ga0207648_10027125 3300026089 Bacteria 5087
628 Ga0207648_10035911 3300026089 Bacteria 4367
629 Ga0207648_10168093 3300026089 Bacteria 1938
630 Ga0207648_10256291 3300026089 Bacteria 1560
631 Ga0207648_10588299 3300026089 Bacteria 1025
632 Ga0207676_10007912 3300026095 Bacteria 7562
633 Ga0207676_10012227 3300026095 Bacteria 6145
634 Ga0207676_10031295 3300026095 Bacteria 4001
635 Ga0207676_10042520 3300026095 Bacteria 3496
636 Ga0207676_10059839 3300026095 Bacteria 3010
637 Ga0207676_10196763 3300026095 Bacteria 1778
638 Ga0207676_10278028 3300026095 Bacteria 1519
639 Ga0207676_10379405 3300026095 Bacteria 1315
640 Ga0207674_10027431 3300026116 Bacteria 6024
641 Ga0207674_10420622 3300026116 Bacteria 1291
642 Ga0207675_100016390 3300026118 Bacteria 6918
643 Ga0207675_100144609 3300026118 Bacteria 2260
644 Ga0207675_100286865 3300026118 Bacteria 1600
645 Ga0207675_100389890 3300026118 Bacteria 1371
646 Ga0207675_100637240 3300026118 Bacteria 1071
647 Ga0207683_10035749 3300026121 Bacteria 4321
648 Ga0207683_10038597 3300026121 Bacteria 4164
649 Ga0207683_10053784 3300026121 Bacteria 3531
650 Ga0207683_10067351 3300026121 Bacteria 3158
651 Ga0207683_10122705 3300026121 Bacteria 2333
652 Ga0207683_10150801 3300026121 Bacteria 2098
653 Ga0207683_10192887 3300026121 Bacteria 1850
654 Ga0207683_10207643 3300026121 Bacteria 1782
655 Ga0207683_10911640 3300026121 Bacteria 816
656 Ga0207683_11158583 3300026121 Bacteria 717
657 Ga0207698_10059494 3300026142 Bacteria 2967
658 Ga0207698_10059566 3300026142 Bacteria 2965
659 Ga0207698_10249519 3300026142 Bacteria 1623
660 Ga0207698_10329869 3300026142 Bacteria 1433
661 Ga0209282_1000046 3300027666 Bacteria 115032
662 Ga0207428_10065766 3300027907 Bacteria 2859
663 Ga0207428_10081399 3300027907 Bacteria 2528
664 Ga0207428_10231966 3300027907 Bacteria 1381
665 Ga0207428_10817902 3300027907 Bacteria 661
666 Ga0268266_10035490 3300028379 Bacteria 4242
667 Ga0268266_10061938 3300028379 Bacteria 3227
668 Ga0268266_10294726 3300028379 Bacteria 1512
669 Ga0268266_10571810 3300028379 Bacteria 1084
670 Ga0268266_10814288 3300028379 Bacteria 902
671 Ga0268265_10001934 3300028380 Bacteria 16433
672 Ga0268265_10202426 3300028380 Bacteria 1723
673 Ga0268265_10428155 3300028380 Bacteria 1230
674 Ga0268264_10003117 3300028381 Bacteria 14365
675 Ga0268264_10003895 3300028381 Bacteria 12787
676 Ga0268264_10197332 3300028381 Bacteria 1838
677 Ga0268264_10235769 3300028381 Bacteria 1692
678 Ga0268264_10317339 3300028381 Bacteria 1472
679 Ga0307517_10004249 3300028786 Bacteria 22093
680 Ga0307517_10060587 3300028786 Bacteria 3598
681 Ga0307517_10188580 3300028786 Bacteria 1314
682 Ga0307517_10214928 3300028786 Bacteria 1178
683 Ga0307517_10287749 3300028786 Bacteria 931
684 Ga0307515_10000347 3300028794 Bacteria 114603
685 Ga0307515_10000378 3300028794 Bacteria 108916
686 Ga0307515_10001105 3300028794 Bacteria 61711
687 Ga0307515_10002080 3300028794 Bacteria 44046
688 Ga0307515_10016105 3300028794 Bacteria 13712
689 Ga0307515_10055358 3300028794 Bacteria 5798
690 Ga0307515_10069956 3300028794 Bacteria 4786
691 Ga0307515_10123151 3300028794 Bacteria 2919
692 Ga0307515_10648512 3300028794 Bacteria 668
693 Ga0307511_10233776 3300030521 Bacteria 906
694 Ga0307512_10065289 3300030522 Bacteria 2761
695 Ga0307512_10148644 3300030522 Bacteria 1409
696 Ga0316181_1138066 3300030744 Bacteria 855
697 Ga0265331_10020075 3300031250 Bacteria 3437
698 Ga0265316_10666167 3300031344 Bacteria 735
699 Ga0307513_10008368 3300031456 Bacteria 13246
700 Ga0307513_10074096 3300031456 Bacteria 3542
701 Ga0307513_10074725 3300031456 Bacteria 3523
702 Ga0307513_10089596 3300031456 Bacteria 3140
703 Ga0307513_10111525 3300031456 Bacteria 2728
704 Ga0307513_10169671 3300031456 Bacteria 2061
705 Ga0307513_10362486 3300031456 Bacteria 1194
706 Ga0307509_10001361 3300031507 Bacteria 41386
707 Ga0307509_10010234 3300031507 Bacteria 11535
708 Ga0307509_10083130 3300031507 Bacteria 3301
709 Ga0307509_10135071 3300031507 Bacteria 2414
710 Ga0307509_10178311 3300031507 Bacteria 1994
711 Ga0307509_10257982 3300031507 Bacteria 1521
712 Ga0307509_10311736 3300031507 Bacteria 1315
713 Ga0307408_100033032 3300031548 Bacteria 3612
714 Ga0307408_100134772 3300031548 Bacteria 1931
715 Ga0307408_100137546 3300031548 Bacteria 1913
716 Ga0307408_100239367 3300031548 Bacteria 1491
717 Ga0307508_10000023 3300031616 Bacteria 177362
718 Ga0307508_10035009 3300031616 Bacteria 4525
719 Ga0307508_10080654 3300031616 Bacteria 2835
720 Ga0307514_10001743 3300031649 Bacteria 24892
721 Ga0307514_10002980 3300031649 Bacteria 16765
722 Ga0307514_10028455 3300031649 Bacteria 4507
723 Ga0307514_10124924 3300031649 Bacteria 1785
724 Ga0307514_10340688 3300031649 Bacteria 807
725 Ga0316575_10003201 3300031665 Bacteria 5609
726 Ga0307516_10000045 3300031730 Bacteria 132787
727 Ga0307516_10013210 3300031730 Bacteria 8818
728 Ga0307516_10019134 3300031730 Bacteria 7098
729 Ga0307516_10099929 3300031730 Bacteria 2717
730 Ga0307516_10165426 3300031730 Bacteria 1957
731 Ga0307516_10180438 3300031730 Bacteria 1845
732 Ga0307405_10032709 3300031731 Bacteria 3076
733 Ga0316577_10431718 3300031733 Bacteria 748
734 Ga0307518_10026365 3300031838 Bacteria 4192
735 Ga0307410_10000671 3300031852 Bacteria 14181
736 Ga0307410_10265588 3300031852 Bacteria 1340
737 Ga0307406_10013246 3300031901 Bacteria 4721
738 Ga0307406_10296208 3300031901 Bacteria 1241
739 Ga0307406_10846385 3300031901 Bacteria 775
740 Ga0307407_10183932 3300031903 Bacteria 1387
741 Ga0307412_10150111 3300031911 Bacteria 1718
742 Ga0307416_100002710 3300032002 Bacteria 10263
743 Ga0307416_100023052 3300032002 Bacteria 4509
744 Ga0307414_10057246 3300032004 Bacteria 2739
745 Ga0307414_10616294 3300032004 Bacteria 975
746 Ga0307414_10720220 3300032004 Bacteria 905
747 Ga0307411_10074281 3300032005 Bacteria 2316
748 Ga0307411_10131550 3300032005 Bacteria 1829
749 Ga0307411_10234259 3300032005 Bacteria 1433
750 Ga0307411_10760585 3300032005 Bacteria 850
751 Ga0307415_100224895 3300032126 Bacteria 1507
752 Ga0316583_10000054 3300032133 Bacteria 22435
753 Ga0316593_10000414 3300032168 Bacteria 7720
754 Ga0307507_10169912 3300033179 Bacteria 1586
755 Ga0307510_10001484 3300033180 Bacteria 25882
756 Ga0307510_10022280 3300033180 Bacteria 7362
757 Ga0307510_10104851 3300033180 Bacteria 2598
758 Ga0307510_10288733 3300033180 Bacteria 1107
759 Ga0307510_10378469 3300033180 Unclassified 861
760 Ga0316592_1083445 3300033524 Bacteria 728
761 Ga0316596_1000067 3300033541 Bacteria 12032
762 Ga0373951_0123659 3300035091 Bacteria 706
763 Ga0373943_0138369 3300035170 Bacteria 1310
764 Ga0373961_0172924 3300035241 Bacteria 748
765 Ga0316574_0074095 3300035398 Bacteria 2154
766 Ga0373924_0342733 3300035410 Bacteria 666
767 Ga0373935_0630148 3300035692 Bacteria 786
768 Ga0373927_0215378 3300035695 Bacteria 1262
769 Ga0373937_0068171 3300036401 Bacteria 3280
770 Ga0373937_0964849 3300036401 Bacteria 801
771 Ga0316584_0532424 3300036712 Bacteria 822
772 Ga0373925_0208539 3300037068 Bacteria 1556
773 Ga0373925_0404881 3300037068 Bacteria 1113
774 Ga0395899_0001458 3300037312 Bacteria 20151
775 Ga0395899_0014962 3300037312 Bacteria 5918
776 Ga0395899_0017956 3300037312 Bacteria 5383
777 Ga0395899_0097580 3300037312 Bacteria 2124
778 Ga0395900_0000179 3300037418 Bacteria 102024
779 Ga0395900_0010138 3300037418 Bacteria 9636
780 Ga0395900_0044036 3300037418 Bacteria 4600
781 Ga0395900_0056934 3300037418 Bacteria 4024
782 Ga0395900_0111797 3300037418 Bacteria 2805
783 Ga0395900_0172925 3300037418 Bacteria 2198
784 Ga0395900_0443378 3300037418 Bacteria 1255
785 Ga0395900_0511723 3300037418 Bacteria 1149
786 Ga0395898_0022101 3300037466 Bacteria 6444
787 Ga0395898_0110973 3300037466 Bacteria 2629
788 Ga0395898_0460454 3300037466 Bacteria 1211
789 Ga0395905_0000589 3300037471 Bacteria 48792
790 Ga0395905_0006561 3300037471 Bacteria 11689
791 Ga0395905_0011379 3300037471 Bacteria 8596
792 Ga0395905_0011469 3300037471 Bacteria 8565
793 Ga0395905_0093908 3300037471 Bacteria 2813
794 Ga0395905_0151227 3300037471 Bacteria 2184
795 Ga0395905_0294014 3300037471 Bacteria 1511
796 Ga0395905_0546484 3300037471 Bacteria 1059
797 Ga0316581_0011584 3300037588 Bacteria 2469
798 Ga0395901_0098131 3300038443 Bacteria 3071
799 Ga0395901_0352205 3300038443 Bacteria 1519
800 Ga0242420_044146 3300038996 Bacteria 858
801 Ga0400483_079285 3300039062 Bacteria 2335
802 Ga0436365_1158146 3300039437 Bacteria 4249
803 Ga0436360_0973346 3300039438 Bacteria 1384
804 Ga0436361_0133265 3300039447 Bacteria 1009
805 Ga0436361_0347622 3300039447 Bacteria 1085
806 Ga0436361_0425380 3300039447 Bacteria 1159
807 Ga0436361_0429567 3300039447 Bacteria 1004
808 Ga0436361_0549519 3300039447 Bacteria 3416
809 Ga0436361_0622987 3300039447 Bacteria 42920
810 Ga0436361_1141426 3300039447 Bacteria 2126
811 Ga0451845_0394058 3300041501 Bacteria 860
812 Ga0451853_1213795 3300041512 Bacteria 2378
813 Ga0439441_024922 3300042001 Bacteria 1126
814 Ga0439448_0000328 3300042005 Bacteria 10546
815 Ga0439448_0152937 3300042005 Bacteria 801
816 Ga0439455_0032156 3300042012 Bacteria 1310
817 Ga0450899_025886 3300042135 Bacteria 701
818 Ga0439434_0222098 3300042435 Bacteria 641
819 Ga0439464_0001296 3300042439 Bacteria 5820
820 Ga0451577_0154121 3300042876 Bacteria 2067
821 Ga0451577_0682584 3300042876 Bacteria 931
822 Ga0451577_0716177 3300042876 Bacteria 906
823 Ga0466969_0010333 3300044656 Bacteria 4950
824 Ga0466969_0034399 3300044656 Bacteria 2567
825 Ga0466972_0003323 3300044658 Bacteria 7976
826 Ga0466972_0029231 3300044658 Bacteria 2713
827 Ga0466982_0059055 3300044672 Bacteria 2358
828 Ga0466965_0000489 3300044683 Bacteria 14080
829 Ga0466965_0019428 3300044683 Bacteria 3261
830 Ga0466966_0002592 3300044684 Bacteria 11843
831 Ga0466966_0017490 3300044684 Bacteria 4736
832 Ga0466966_0150758 3300044684 Bacteria 1418
833 Ga0466961_0000499 3300044693 Bacteria 25055
834 Ga0466961_0015851 3300044693 Bacteria 4835
835 Ga0466961_0283452 3300044693 Bacteria 1013
836 Ga0466961_0287662 3300044693 Bacteria 1005
837 Ga0466964_0001971 3300044706 Bacteria 7202
838 Ga0466964_0002101 3300044706 Bacteria 7014
839 Ga0466964_0013348 3300044706 Bacteria 3116
840 Ga0466964_0040453 3300044706 Bacteria 1882
841 Ga0453684_0000824 3300044712 Bacteria 104740
842 Ga0453684_0064148 3300044712 Bacteria 4694
843 Ga0453684_0184932 3300044712 Bacteria 2443
844 Ga0453684_0660891 3300044712 Bacteria 1139
845 Ga0466968_0019229 3300044735 Bacteria 2748
846 Ga0466968_0098760 3300044735 Bacteria 1301
847 Ga0466968_0162729 3300044735 Bacteria 1030
848 Ga0466968_0295889 3300044735 Bacteria 777
849 Ga0466968_0311059 3300044735 Bacteria 759
850 Ga0466968_0340374 3300044735 Bacteria 727
851 Ga0466970_0013753 3300044765 Bacteria 4151
852 Ga0466970_0018403 3300044765 Bacteria 3615
853 Ga0466970_0018910 3300044765 Bacteria 3568
854 Ga0466970_0023541 3300044765 Bacteria 3217
855 Ga0466970_0057278 3300044765 Bacteria 2083
856 Ga0466957_0007220 3300044842 Bacteria 6280
857 Ga0466957_0011423 3300044842 Bacteria 5124
858 Ga0466957_0020219 3300044842 Bacteria 3917
859 Ga0466957_0124393 3300044842 Bacteria 1647
860 Ga0466957_0262716 3300044842 Bacteria 1151
861 Ga0466957_0526317 3300044842 Bacteria 822
862 Ga0466957_0746495 3300044842 Bacteria 693
863 Ga0466960_0075132 3300044901 Bacteria 1690
864 Ga0466960_0096184 3300044901 Bacteria 1518
865 Ga0466959_0031818 3300045049 Bacteria 3904
866 Ga0466959_0047561 3300045049 Bacteria 3155
867 Ga0466959_0061189 3300045049 Bacteria 2738
868 Ga0466959_0087374 3300045049 Bacteria 2242
869 Ga0466959_0103594 3300045049 Bacteria 2036
870 Ga0466959_0344930 3300045049 Bacteria 1016
871 Ga0466959_0751783 3300045049 Bacteria 652
872 Ga0451576_0000591 3300045051 Bacteria 76735
873 Ga0451576_0001118 3300045051 Bacteria 48728
874 Ga0451576_0070290 3300045051 Bacteria 3644
875 Ga0451576_0087763 3300045051 Bacteria 3235
876 Ga0451576_0159444 3300045051 Bacteria 2354
877 Ga0451576_0430090 3300045051 Bacteria 1385
878 Ga0451576_1013033 3300045051 Bacteria 870
879 Ga0466958_0008210 3300045836 Bacteria 5782
880 Ga0466958_0219743 3300045836 Bacteria 1212
881 Ga0466967_0059649 3300045976 Bacteria 3378
882 Ga0466967_0926499 3300045976 Bacteria 867
883 Ga0495592_0000495 3300046454 Bacteria 28713
884 Ga0495592_0400949 3300046454 Bacteria 869
885 Ga0495603_0389379 3300046455 Bacteria 799
886 Ga0495590_0000007 3300046457 Bacteria 331108
887 Ga0495590_0001173 3300046457 Bacteria 11470
888 Ga0495590_0015488 3300046457 Bacteria 2767
889 Ga0495590_0151463 3300046457 Bacteria 841
890 Ga0495591_010008 3300046458 Bacteria 3715
891 Ga0495591_016927 3300046458 Bacteria 2519
892 Ga0495629_0000105 3300046459 Bacteria 74421
893 Ga0495629_0556838 3300046459 Bacteria 769
894 Ga0495638_0001843 3300046460 Bacteria 18350
895 Ga0495638_0021407 3300046460 Bacteria 4262
896 Ga0495638_0040024 3300046460 Bacteria 2972
897 Ga0495651_0203148 3300046462 Bacteria 1385
898 Ga0495651_0673394 3300046462 Bacteria 647
899 Ga0495653_0035291 3300046463 Bacteria 3947
900 Ga0495650_0001361 3300046471 Bacteria 24240
901 Ga0495650_0098010 3300046471 Bacteria 1104
902 Ga0495580_0020609 3300046472 Bacteria 4876
903 Ga0495580_0056837 3300046472 Bacteria 2755
904 Ga0495580_0614608 3300046472 Bacteria 717
905 Ga0495582_0200343 3300046473 Bacteria 1140
906 Ga0495582_0413651 3300046473 Bacteria 778
907 Ga0495605_0004593 3300046474 Bacteria 8080
908 Ga0495605_0005426 3300046474 Bacteria 7425
909 Ga0495605_0007136 3300046474 Bacteria 6359
910 Ga0495605_0060484 3300046474 Bacteria 1815
911 Ga0495605_0159944 3300046474 Bacteria 1000
912 Ga0495639_0063891 3300046475 Bacteria 1691
913 Ga0495664_0387319 3300046477 Bacteria 840
914 Ga0495584_0002713 3300046491 Bacteria 9935
915 Ga0495584_0012621 3300046491 Bacteria 4314
916 Ga0495584_0076567 3300046491 Bacteria 1682
917 Ga0495584_0127815 3300046491 Bacteria 1288
918 Ga0495585_0012863 3300046492 Bacteria 4918
919 Ga0495585_0045420 3300046492 Bacteria 2451
920 Ga0495585_0136206 3300046492 Bacteria 1289
921 Ga0495596_0002830 3300046500 Bacteria 9064
922 Ga0495596_0007897 3300046500 Bacteria 4766
923 Ga0495596_0013027 3300046500 Bacteria 3542
924 Ga0495607_0002447 3300046501 Bacteria 15114
925 Ga0495607_0003605 3300046501 Bacteria 11763
926 Ga0495607_0018017 3300046501 Bacteria 4514
927 Ga0495607_0019153 3300046501 Bacteria 4352
928 Ga0495607_0057059 3300046501 Bacteria 2239
929 Ga0495583_0002744 3300046506 Bacteria 14573
930 Ga0495583_0013367 3300046506 Bacteria 4582
931 Ga0495583_0016125 3300046506 Bacteria 4029
932 Ga0495583_0027562 3300046506 Bacteria 2803
933 Ga0495583_0038999 3300046506 Bacteria 2240
934 Ga0495583_0088521 3300046506 Bacteria 1336
935 Ga0495606_0002227 3300046507 Bacteria 23133
936 Ga0495606_0008385 3300046507 Bacteria 8994
937 Ga0495606_0035152 3300046507 Bacteria 3429
938 Ga0495606_0035892 3300046507 Bacteria 3384
939 Ga0495606_0109936 3300046507 Bacteria 1664
940 Ga0495606_0209924 3300046507 Bacteria 1103
941 Ga0495610_0000583 3300046512 Bacteria 36114
942 Ga0495610_0013836 3300046512 Bacteria 4770
943 Ga0495610_0065228 3300046512 Bacteria 1719
944 Ga0495616_0012802 3300046513 Bacteria 4746
945 Ga0495616_0015635 3300046513 Bacteria 4216
946 Ga0495616_0016448 3300046513 Bacteria 4094
947 Ga0495616_0027829 3300046513 Bacteria 2997
948 Ga0495616_0063245 3300046513 Bacteria 1809
949 Ga0495628_0157730 3300046516 Bacteria 1726
950 Ga0495628_0386946 3300046516 Bacteria 1023
951 Ga0495628_0555003 3300046516 Bacteria 824
952 Ga0495630_0090035 3300046517 Bacteria 2318
953 Ga0495630_0389449 3300046517 Bacteria 1067
954 Ga0495630_0597093 3300046517 Bacteria 846
955 Ga0495631_0001383 3300046518 Bacteria 14748
956 Ga0495631_0014780 3300046518 Bacteria 3758
957 Ga0495631_0044586 3300046518 Bacteria 1953
958 Ga0495631_0070766 3300046518 Bacteria 1508
959 Ga0495632_0006665 3300046519 Bacteria 7384
960 Ga0495632_0043451 3300046519 Bacteria 2246
961 Ga0495632_0047781 3300046519 Bacteria 2121
962 Ga0495637_0000006 3300046520 Bacteria 435763
963 Ga0495643_0015349 3300046522 Bacteria 4528
964 Ga0495643_0038910 3300046522 Bacteria 2602
965 Ga0495643_0166771 3300046522 Bacteria 1079
966 Ga0495644_0021625 3300046523 Bacteria 2453
967 Ga0495644_0060633 3300046523 Bacteria 1422
968 Ga0495648_0012825 3300046524 Bacteria 6223
969 Ga0495648_0030902 3300046524 Bacteria 3534
970 Ga0495648_0079312 3300046524 Bacteria 1874
971 Ga0495648_0116953 3300046524 Bacteria 1440
972 Ga0495648_0143650 3300046524 Bacteria 1253
973 Ga0495648_0177411 3300046524 Bacteria 1086
974 Ga0495663_0005054 3300046525 Bacteria 3685
975 Ga0495642_0010302 3300046528 Bacteria 3580
976 Ga0495642_0035367 3300046528 Bacteria 2015
977 Ga0495642_0050457 3300046528 Bacteria 1711
978 Ga0495642_0050668 3300046528 Bacteria 1707
979 Ga0495642_0126721 3300046528 Bacteria 1098
980 Ga0495652_0074591 3300046529 Bacteria 2821
981 Ga0495654_0042687 3300046530 Bacteria 2250
982 Ga0495654_0135295 3300046530 Bacteria 1103
983 Ga0495654_0157225 3300046530 Bacteria 1001
984 Ga0495665_0036302 3300046531 Bacteria 2631
985 Ga0495586_0028974 3300046535 Bacteria 2964
986 Ga0495598_0042200 3300046537 Bacteria 1338
987 Ga0495598_0117729 3300046537 Bacteria 897
988 Ga0495609_0001477 3300046538 Bacteria 15592
989 Ga0495609_0010243 3300046538 Bacteria 4504
990 Ga0495609_0017111 3300046538 Bacteria 3370
991 Ga0495609_0024355 3300046538 Bacteria 2777
992 Ga0495621_0045728 3300046539 Bacteria 1551
993 Ga0495621_0104122 3300046539 Bacteria 1083
994 Ga0495621_0188009 3300046539 Bacteria 827
995 Ga0495597_0002647 3300046542 Bacteria 11104
996 Ga0495597_0043387 3300046542 Bacteria 2003
997 Ga0495645_0002681 3300046543 Bacteria 12086
998 Ga0495645_0025935 3300046543 Bacteria 4255
999 Ga0495645_0111443 3300046543 Bacteria 1935
1000 Ga0495645_0394373 3300046543 Bacteria 883
1001 Ga0495622_0057561 3300046557 Bacteria 1802
1002 Ga0495633_0007426 3300046558 Bacteria 6307
1003 Ga0495633_0042129 3300046558 Bacteria 2170
1004 Ga0495656_0074089 3300046615 Bacteria 1520
1005 Ga0495668_0004131 3300046616 Bacteria 10498
1006 Ga0495668_0021458 3300046616 Bacteria 3703
1007 Ga0495668_0025097 3300046616 Bacteria 3388
1008 Ga0495668_0098764 3300046616 Bacteria 1597
1009 Ga0495668_0212538 3300046616 Bacteria 1059
1010 Ga0495668_0250847 3300046616 Bacteria 969
1011 Ga0495611_0001407 3300046648 Bacteria 11995
1012 Ga0495611_0011257 3300046648 Bacteria 3792
1013 Ga0495611_0214317 3300046648 Bacteria 896
1014 Ga0495625_0001105 3300046660 Bacteria 35003
1015 Ga0495625_0124205 3300046660 Bacteria 1753
1016 Ga0495625_0438235 3300046660 Bacteria 809
1017 Ga0495635_0160976 3300046663 Bacteria 1527
1018 Ga0495659_0008842 3300046664 Bacteria 3207
1019 Ga0495661_0018647 3300046665 Bacteria 4557
1020 Ga0495661_0030072 3300046665 Bacteria 3461
1021 Ga0495661_0040383 3300046665 Bacteria 2893
1022 Ga0495661_0072068 3300046665 Bacteria 2016
1023 Ga0495661_0162470 3300046665 Bacteria 1197
1024 Ga0495588_0053875 3300046674 Bacteria 2074
1025 Ga0495599_0022101 3300046678 Bacteria 3969
1026 Ga0495599_0248455 3300046678 Bacteria 1083
1027 Ga0495623_0002817 3300046679 Bacteria 11470
1028 Ga0495623_0006621 3300046679 Bacteria 7542
1029 Ga0495646_0023757 3300046680 Bacteria 3859
1030 Ga0495647_0010284 3300046681 Bacteria 3184
1031 Ga0495647_0133543 3300046681 Bacteria 1053
1032 Ga0495658_0019071 3300046683 Bacteria 3576
1033 Ga0495658_0086939 3300046683 Bacteria 1845
1034 Ga0495658_0192379 3300046683 Bacteria 1269
1035 Ga0495658_0425661 3300046683 Bacteria 847
1036 Ga0495669_0000597 3300046684 Bacteria 15822
1037 Ga0495669_0023054 3300046684 Bacteria 2707
1038 Ga0495669_0030746 3300046684 Bacteria 2357
1039 Ga0495669_0055160 3300046684 Bacteria 1789
1040 Ga0495669_0156332 3300046684 Bacteria 1081
1041 Ga0495669_0158032 3300046684 Bacteria 1075
1042 Ga0495624_0056754 3300046690 Bacteria 2463
1043 Ga0495624_0104781 3300046690 Bacteria 1740
1044 Ga0495670_0006236 3300046691 Bacteria 5852
1045 Ga0495670_0019881 3300046691 Bacteria 3309
1046 Ga0495670_0065859 3300046691 Bacteria 1827
1047 Ga0495671_0004937 3300046692 Bacteria 7866
1048 Ga0495671_0020689 3300046692 Bacteria 3466
1049 Ga0495671_0025197 3300046692 Bacteria 3093
1050 Ga0495671_0060409 3300046692 Bacteria 1871
1051 Ga0495671_0061381 3300046692 Bacteria 1854
1052 Ga0495671_0118782 3300046692 Bacteria 1290
1053 Ga0495671_0193180 3300046692 Bacteria 988
1054 Ga0495649_0001583 3300046694 Bacteria 17033
1055 Ga0495649_0004743 3300046694 Bacteria 8817
1056 Ga0495649_0025057 3300046694 Bacteria 3323
1057 Ga0495649_0101728 3300046694 Bacteria 1527
1058 Ga0495649_0121427 3300046694 Bacteria 1381
1059 Ga0495589_0010898 3300046794 Bacteria 4723
1060 Ga0495589_0023119 3300046794 Bacteria 3168
1061 Ga0495589_0035270 3300046794 Bacteria 2508
1062 Ga0495589_0039507 3300046794 Bacteria 2357
1063 Ga0495589_0240213 3300046794 Bacteria 848
1064 Ga0495660_0032918 3300046810 Bacteria 2909
1065 Ga0495660_0111133 3300046810 Bacteria 1398
1066 Ga0495581_0010374 3300047315 Bacteria 5390
1067 Ga0495604_0039338 3300047317 Bacteria 3717
1068 Ga0495604_0052611 3300047317 Bacteria 3152
1069 Ga0495636_0011053 3300047318 Bacteria 3572
1070 Ga0495636_0048126 3300047318 Bacteria 1781
1071 Ga0495636_0048737 3300047318 Bacteria 1770
1072 Ga0495636_0317301 3300047318 Bacteria 731
1073 Ga0495674_0015753 3300047319 Bacteria 7057
1074 Ga0495674_0545441 3300047319 Bacteria 923
1075 Ga0495672_0000118 3300047320 Bacteria 124396
1076 Ga0495672_0013610 3300047320 Bacteria 5603
1077 Ga0495672_0020289 3300047320 Bacteria 4361
1078 Ga0495672_0035117 3300047320 Bacteria 3089
1079 Ga0495672_0048827 3300047320 Bacteria 2508
1080 Ga0495676_0015875 3300047321 Bacteria 6693
1081 Ga0495680_0014284 3300047322 Bacteria 6885
1082 Ga0495683_0003322 3300047323 Bacteria 9404
1083 Ga0495683_0015146 3300047323 Bacteria 4017
1084 Ga0495683_0050400 3300047323 Bacteria 2083
1085 Ga0495683_0140221 3300047323 Bacteria 1133
1086 Ga0495687_000166 3300047443 Bacteria 98891
1087 Ga0495687_011756 3300047443 Bacteria 4680
1088 Ga0495687_015528 3300047443 Bacteria 3868
1089 Ga0495687_093389 3300047443 Bacteria 1146
1090 Ga0495675_0062194 3300047444 Bacteria 2364
1091 Ga0495675_0064432 3300047444 Bacteria 2318
1092 Ga0495675_0152634 3300047444 Bacteria 1426
1093 Ga0495677_0001700 3300047445 Bacteria 8840
1094 Ga0495677_0018416 3300047445 Bacteria 2532
1095 Ga0495677_0139537 3300047445 Bacteria 930
1096 Ga0495679_001920 3300047446 Bacteria 11114
1097 Ga0495679_014054 3300047446 Bacteria 2982
1098 Ga0495679_034720 3300047446 Bacteria 1603
1099 Ga0495685_036318 3300047447 Bacteria 1692
1100 Ga0495673_0036689 3300047469 Bacteria 2245
1101 Ga0495681_0012047 3300047470 Bacteria 5103
1102 Ga0495681_0015148 3300047470 Bacteria 4374
1103 Ga0495681_0188366 3300047470 Bacteria 844
1104 Ga0495686_0001863 3300047472 Bacteria 21173
1105 Ga0495686_0003218 3300047472 Bacteria 14378
1106 Ga0495686_0025029 3300047472 Bacteria 3914
1107 Ga0495686_0180752 3300047472 Bacteria 1222
1108 Ga0495686_0182009 3300047472 Bacteria 1217
1109 Ga0495593_0021851 3300047673 Bacteria 3570
1110 Ga0495593_0024457 3300047673 Bacteria 3347
1111 Ga0495593_0035923 3300047673 Bacteria 2688
1112 Ga0495593_0112648 3300047673 Bacteria 1388
1113 Ga0495602_0046136 3300048088 Bacteria 3938
1114 Ga0495602_0057269 3300048088 Bacteria 3420
1115 Ga0495614_0014934 3300048089 Bacteria 3393
1116 Ga0495615_0137751 3300048090 Bacteria 718
1117 Ga0495626_0004474 3300048091 Bacteria 8568
1118 Ga0495626_0007307 3300048091 Bacteria 6161
1119 Ga0496100_0025801 3300048903 Bacteria 3596
1120 Ga0496100_0044964 3300048903 Bacteria 2831
1121 Ga0496100_0088238 3300048903 Bacteria 2110
1122 Ga0496101_0004607 3300048904 Bacteria 8707
1123 Ga0496101_0013292 3300048904 Bacteria 5513
1124 Ga0496101_0034361 3300048904 Bacteria 3580
1125 Ga0496101_0339944 3300048904 Bacteria 1179
1126 Ga0496101_0356684 3300048904 Bacteria 1149
1127 Ga0496101_0493517 3300048904 Bacteria 967
1128 Ga0496102_0000425 3300048905 Bacteria 48803
1129 Ga0496102_0010249 3300048905 Bacteria 8058
1130 Ga0496102_0047891 3300048905 Bacteria 3886
1131 Ga0496102_0080150 3300048905 Bacteria 3007
1132 Ga0496102_0172244 3300048905 Bacteria 2038
1133 Ga0496102_0266147 3300048905 Bacteria 1616
1134 Ga0496103_0002171 3300048906 Bacteria 12467
1135 Ga0496103_0057095 3300048906 Bacteria 2423
1136 Ga0496103_0065089 3300048906 Bacteria 2273
1137 Ga0496104_0064512 3300048907 Bacteria 3474
1138 Ga0496104_0076004 3300048907 Bacteria 3198
1139 Ga0496104_0155748 3300048907 Bacteria 2192
1140 Ga0496104_0624866 3300048907 Bacteria 987
1141 Ga0496105_0021434 3300048908 Bacteria 5228
1142 Ga0496105_0092443 3300048908 Bacteria 2498
1143 Ga0496105_0188458 3300048908 Bacteria 1687
1144 Ga0496105_0604556 3300048908 Bacteria 850
1145 Ga0496106_0062545 3300048909 Bacteria 2826
1146 Ga0496106_0065232 3300048909 Bacteria 2772
1147 Ga0496106_0123642 3300048909 Bacteria 2024
1148 Ga0496106_0397089 3300048909 Bacteria 1108
1149 Ga0496107_0003373 3300048910 Bacteria 10676
1150 Ga0496107_0041522 3300048910 Bacteria 3303
1151 Ga0496107_0123426 3300048910 Bacteria 1908
1152 Ga0496108_0040578 3300048911 Bacteria 3881
1153 Ga0496108_0051243 3300048911 Bacteria 3458
1154 Ga0496108_0431906 3300048911 Bacteria 1150
1155 Ga0496108_0487568 3300048911 Bacteria 1077
1156 Ga0496109_0109656 3300048912 Bacteria 2566
1157 Ga0496109_0139454 3300048912 Bacteria 2267
1158 Ga0496109_0155391 3300048912 Bacteria 2143
1159 Ga0496109_0197290 3300048912 Bacteria 1892
1160 Ga0496109_0405269 3300048912 Bacteria 1288
1161 Ga0496109_0596551 3300048912 Bacteria 1041
1162 Ga0496111_0001327 3300048914 Bacteria 13919
1163 Ga0496112_0107911 3300048915 Bacteria 2754
1164 Ga0496112_0405792 3300048915 Bacteria 1302
1165 Ga0496112_0466841 3300048915 Bacteria 1199
1166 Ga0496113_0024520 3300048916 Bacteria 4288
1167 Ga0496114_0003193 3300048917 Bacteria 12569
1168 Ga0496114_0007150 3300048917 Bacteria 8805
1169 Ga0496114_0243045 3300048917 Bacteria 1583
1170 Ga0496114_0507828 3300048917 Bacteria 1066
1171 Ga0496115_0173428 3300048918 Bacteria 1783
1172 Ga0496116_0013099 3300048919 Bacteria 6718
1173 Ga0496116_0014929 3300048919 Bacteria 6166
1174 Ga0496116_0019076 3300048919 Bacteria 5264
1175 Ga0496117_0033439 3300048920 Bacteria 3887
1176 Ga0496119_0102948 3300048922 Bacteria 1600
1177 Ga0496119_0111082 3300048922 Bacteria 1521
1178 Ga0496120_0123717 3300048923 Bacteria 1334
1179 Ga0496121_0013422 3300048924 Bacteria 8803
1180 Ga0496121_0032350 3300048924 Bacteria 4756
1181 Ga0496121_0037317 3300048924 Bacteria 4317
1182 Ga0496121_0142265 3300048924 Bacteria 1777
1183 Ga0496121_0217818 3300048924 Bacteria 1347
1184 Ga0496122_0013875 3300048925 Bacteria 7844
1185 Ga0496122_0028426 3300048925 Bacteria 4744
1186 Ga0496123_0021967 3300048926 Bacteria 4936
1187 Ga0496123_0060843 3300048926 Bacteria 2431
1188 Ga0496124_0010111 3300048927 Bacteria 9613
1189 Ga0496125_0002625 3300048928 Bacteria 23036
1190 Ga0496125_0126401 3300048928 Bacteria 1811
1191 Ga0496125_0260056 3300048928 Bacteria 1088
1192 Ga0496126_0020071 3300048929 Bacteria 6561
1193 Ga0496126_0067260 3300048929 Bacteria 3202
1194 Ga0496126_0352856 3300048929 Bacteria 1203
1195 Ga0496126_0918858 3300048929 Bacteria 662
1196 Ga0495678_000113 3300049459 Bacteria 96866
1197 Ga0495678_052756 3300049459 Bacteria 1564
1198 Ga0495678_064357 3300049459 Bacteria 1366
1199 Ga0495678_075366 3300049459 Bacteria 1225
1200 Ga0495682_0007048 3300049460 Bacteria 4498
1201 Ga0495682_0024037 3300049460 Bacteria 2274
1202 Ga0495682_0061653 3300049460 Bacteria 1353
1203 Ga0501031_0410964 3300049568 Bacteria 875
1204 Ga0501034_0000385 3300049571 Bacteria 75496
1205 Ga0501036_0180728 3300049572 Bacteria 1776
1206 Ga0501037_0182804 3300049573 Bacteria 1487
1207 Ga0501038_0204622 3300049574 Bacteria 1582
1208 Ga0501039_0007165 3300049575 Bacteria 8494
1209 Ga0501039_0126796 3300049575 Bacteria 2002
1210 Ga0501040_0008414 3300049576 Bacteria 6703
1211 Ga0501040_0445764 3300049576 Bacteria 932
1212 Ga0501041_0016872 3300049577 Bacteria 4345
1213 Ga0501041_0583425 3300049577 Bacteria 713
1214 Ga0501042_0268652 3300049578 Bacteria 1231
1215 Ga0501042_0654332 3300049578 Bacteria 764
1216 Ga0501043_0287238 3300049579 Bacteria 1260
1217 Ga0501043_0482170 3300049579 Bacteria 928
1218 Ga0501046_0016835 3300049580 Bacteria 6113
1219 Ga0501048_0118623 3300049582 Bacteria 1869
1220 Ga0501048_0249390 3300049582 Bacteria 1260
1221 Ga0501068_0302928 3300049584 Bacteria 1023
1222 Ga0501071_0010141 3300049587 Bacteria 6304
1223 Ga0501072_0017384 3300049588 Bacteria 5525
1224 Ga0501072_0794178 3300049588 Bacteria 742
1225 Ga0501074_0213744 3300049590 Bacteria 1373
1226 Ga0501075_0006027 3300049591 Bacteria 8310
1227 Ga0501076_0001751 3300049592 Bacteria 14664
1228 Ga0501076_0604863 3300049592 Bacteria 904
1229 Ga0501077_0013917 3300049593 Bacteria 5044
1230 Ga0501077_0181298 3300049593 Bacteria 1338
1231 Ga0501249_055740 3300049679 Bacteria 912
1232 Ga0501079_0086483 3300049741 Bacteria 2427
1233 Ga0501079_0205993 3300049741 Bacteria 1536
1234 Ga0501079_0457122 3300049741 Bacteria 1003
1235 Ga0501080_0217334 3300049742 Bacteria 1750
1236 Ga0501080_1332921 3300049742 Bacteria 614
1237 Ga0501081_0002036 3300049743 Bacteria 12604
1238 Ga0501081_0082368 3300049743 Bacteria 2254
1239 nmdc:mga0yw44_396601_c1 3300050492 Bacteria 933
1240 nmdc:mga0k408_103712_c1 3300050493 Bacteria 1678
1241 nmdc:mga0k408_150447_c1 3300050493 Bacteria 1386
1242 nmdc:mga0k408_1564_c1 3300050493 Bacteria 12138
1243 nmdc:mga0k408_246477_c1 3300050493 Bacteria 1067
1244 nmdc:mga0k408_42082_c1 3300050493 Bacteria 2631
1245 nmdc:mga06z11_126989_c1 3300050494 Bacteria 1428
1246 nmdc:mga07m45_186925_c1 3300050496 Bacteria 1205
1247 nmdc:mga07m45_240_c1 3300050496 Bacteria 22136
1248 nmdc:mga07m45_29676_c1 3300050496 Bacteria 3026
1249 nmdc:mga07m45_390605_c1 3300050496 Bacteria 808
1250 nmdc:mga07m45_47080_c1 3300050496 Bacteria 2424
1251 nmdc:mga0qj67_4213_c1 3300050509 Bacteria 10417
1252 nmdc:mga0qj67_673677_c1 3300050509 Bacteria 824
1253 nmdc:mga06r32_155764_c1 3300050510 Bacteria 2266
1254 nmdc:mga08y16_106694_c1 3300050511 Bacteria 2916
1255 nmdc:mga08y16_229138_c1 3300050511 Bacteria 1922
1256 nmdc:mga08y16_459834_c1 3300050511 Bacteria 1297
1257 nmdc:mga08y16_482695_c1 3300050511 Bacteria 1261
1258 nmdc:mga08y16_57458_c1 3300050511 Bacteria 4066
1259 Ga0500650_0120701 3300053098 Bacteria 1222
1260 Ga0500593_000371 3300053117 Bacteria 18072
1261 Ga0500594_0007947 3300053118 Bacteria 2408
1262 Ga0500658_0019243 3300053134 Bacteria 2568
1263 Ga0500559_0001133 3300053136 Bacteria 16045
1264 Ga0500561_0027948 3300053137 Bacteria 1395
1265 Ga0500590_015257 3300053148 Bacteria 3965
1266 Ga0500590_144662 3300053148 Bacteria 1081
1267 Ga0500619_000054 3300053154 Bacteria 34866
1268 Ga0500619_004840 3300053154 Bacteria 2937
1269 Ga0500620_046921 3300053155 Bacteria 1437
1270 Ga0500622_0000002 3300053156 Bacteria 646442
1271 Ga0500625_118289 3300053729 Bacteria 1071
1272 Ga0500587_006581 3300053739 Bacteria 1536
1273 Ga0501084_0054546 3300054114 Bacteria 3344
1274 Ga0501084_0308865 3300054114 Bacteria 1336
1275 Ga0501082_0067871 3300060353 Bacteria 3071
1276 Ga0501082_0114811 3300060353 Bacteria 2332
1277 Ga0466962_0085992 3300061719 Bacteria 1505
1278 Ga0530510_0000042 3300061734 Bacteria 58436
1279 Ga0530510_1001857 3300061734 Bacteria 639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10012984 rootH1_100129843 170
2 3300003323 rootH1_10137895 rootH1_101378952 171
3 3300005339 Ga0070660_100085744 Ga0070660_1000857442 171
4 3300005366 Ga0070659_100186400 Ga0070659_1001864002 171
5 3300005563 Ga0068855_100444873 Ga0068855_1004448732 171
6 3300009093 Ga0105240_10680036 Ga0105240_106800362 171
7 3300009093 Ga0105240_11243043 Ga0105240_112430431 171
8 3300009176 Ga0105242_10032793 Ga0105242_100327935 171
9 3300025256 Ga0209759_1005314 Ga0209759_10053141 171
10 3300025913 Ga0207695_10544245 Ga0207695_105442451 171
11 3300025932 Ga0207690_10808215 Ga0207690_108082152 171
12 3300025960 Ga0207651_10001690 Ga0207651_100016908 171
13 3300026041 Ga0207639_10572685 Ga0207639_105726851 171
14 3300026067 Ga0207678_10569978 Ga0207678_105699782 171
15 3300032133 Ga0316583_10000054 Ga0316583_100000545 171
16 3300039062 Ga0400483_079285 Ga0400483_079285_95_643 171
17 3300039447 Ga0436361_1141426 Ga0436361_1141426_758_1324 171
18 3300044901 Ga0466960_0075132 Ga0466960_0075132_862_1425 171
19 3300048911 Ga0496108_0051243 Ga0496108_0051243_921_1493 171
20 3300048912 Ga0496109_0139454 Ga0496109_0139454_871_1443 171
21 3300050496 nmdc:mga07m45_240_c1 nmdc:mga07m45_240_c1_13083_13643 171
22 3300005439 Ga0070711_100540174 Ga0070711_1005401742 172
23 3300006353 Ga0075370_10008599 Ga0075370_100085992 172
24 3300006844 Ga0075428_100109618 Ga0075428_1001096183 172
25 3300009147 Ga0114129_10591848 Ga0114129_105918482 172
26 3300025916 Ga0207663_10340230 Ga0207663_103402302 172
27 3300031344 Ga0265316_10666167 Ga0265316_106661671 172
28 3300050496 nmdc:mga07m45_29676_c1 nmdc:mga07m45_29676_c1_1197_1781 172
29 3300050509 nmdc:mga0qj67_673677_c1 nmdc:mga0qj67_673677_c1_12_587 172
30 iso_pu_bacteria 2881101125 2881103240 172
31 3300005353 Ga0070669_100484343 Ga0070669_1004843431 173
32 3300005618 Ga0068864_100088530 Ga0068864_1000885303 173
33 3300009177 Ga0105248_10106940 Ga0105248_101069402 173
34 3300025941 Ga0207711_10229560 Ga0207711_102295602 173
35 3300026095 Ga0207676_10059839 Ga0207676_100598393 173
36 3300037471 Ga0395905_0546484 Ga0395905_0546484_264_851 173
37 3300006195 Ga0075366_10115026 Ga0075366_101150262 174
38 3300028794 Ga0307515_10123151 Ga0307515_101231513 174
39 3300042876 Ga0451577_0682584 Ga0451577_0682584_29_625 174
40 3300044712 Ga0453684_0184932 Ga0453684_0184932_574_1170 174
41 3300050493 nmdc:mga0k408_103712_c1 nmdc:mga0k408_103712_c1_380_976 174
42 iso_pu_bacteria 2515154123 2515689471 174
43 iso_pu_bacteria 2585428062 2587758820 174
44 iso_pu_bacteria 2901300506 2901308156 174
45 3300002067 JGI24735J21928_10002393 JGI24735J21928_100023935 175
46 3300003187 JGI25151J46595_10029267 JGI25151J46595_100292673 175
47 3300003791 Ga0055530_10046509 Ga0055530_100465092 175
48 3300005336 Ga0070680_100106872 Ga0070680_1001068722 175
49 3300005336 Ga0070680_100694378 Ga0070680_1006943782 175
50 3300005338 Ga0068868_100871305 Ga0068868_1008713052 175
51 3300005339 Ga0070660_100010897 Ga0070660_1000108974 175
52 3300005340 Ga0070689_101314010 Ga0070689_1013140101 175
53 3300005343 Ga0070687_100003995 Ga0070687_1000039954 175
54 3300005345 Ga0070692_10072358 Ga0070692_100723582 175
55 3300005347 Ga0070668_100105862 Ga0070668_1001058622 175
56 3300005353 Ga0070669_100008805 Ga0070669_1000088054 175
57 3300005353 Ga0070669_100877275 Ga0070669_1008772751 175
58 3300005354 Ga0070675_100422924 Ga0070675_1004229241 175
59 3300005354 Ga0070675_100978778 Ga0070675_1009787782 175
60 3300005356 Ga0070674_100180955 Ga0070674_1001809552 175
61 3300005364 Ga0070673_100172901 Ga0070673_1001729013 175
62 3300005365 Ga0070688_100225616 Ga0070688_1002256162 175
63 3300005438 Ga0070701_10055247 Ga0070701_100552472 175
64 3300005441 Ga0070700_100003564 Ga0070700_1000035647 175
65 3300005441 Ga0070700_100448086 Ga0070700_1004480862 175
66 3300005444 Ga0070694_100005915 Ga0070694_1000059154 175
67 3300005444 Ga0070694_100624671 Ga0070694_1006246712 175
68 3300005455 Ga0070663_100106408 Ga0070663_1001064082 175
69 3300005457 Ga0070662_100463643 Ga0070662_1004636432 175
70 3300005459 Ga0068867_100003201 Ga0068867_1000032014 175
71 3300005539 Ga0068853_100410523 Ga0068853_1004105232 175
72 3300005543 Ga0070672_100259693 Ga0070672_1002596932 175
73 3300005544 Ga0070686_100161391 Ga0070686_1001613912 175
74 3300005545 Ga0070695_100047148 Ga0070695_1000471482 175
75 3300005546 Ga0070696_100023627 Ga0070696_1000236273 175
76 3300005546 Ga0070696_100410035 Ga0070696_1004100352 175
77 3300005548 Ga0070665_100929479 Ga0070665_1009294792 175
78 3300005563 Ga0068855_100011895 Ga0068855_1000118959 175
79 3300005614 Ga0068856_100131758 Ga0068856_1001317582 175
80 3300005615 Ga0070702_100051490 Ga0070702_1000514902 175
81 3300005718 Ga0068866_10071239 Ga0068866_100712392 175
82 3300005719 Ga0068861_100003457 Ga0068861_1000034573 175
83 3300005840 Ga0068870_10183174 Ga0068870_101831742 175
84 3300005844 Ga0068862_100011607 Ga0068862_1000116077 175
85 3300005844 Ga0068862_100094400 Ga0068862_1000944003 175
86 3300006038 Ga0075365_10156624 Ga0075365_101566242 175
87 3300006058 Ga0075432_10036610 Ga0075432_100366102 175
88 3300006846 Ga0075430_100000168 Ga0075430_10000016841 175
89 3300006847 Ga0075431_100044508 Ga0075431_1000445082 175
90 3300006880 Ga0075429_100784447 Ga0075429_1007844472 175
91 3300006881 Ga0068865_100212659 Ga0068865_1002126592 175
92 3300006946 Ga0079104_1015257 Ga0079104_10152572 175
93 3300009093 Ga0105240_10001844 Ga0105240_1000184431 175
94 3300009094 Ga0111539_10133059 Ga0111539_101330592 175
95 3300009094 Ga0111539_10272981 Ga0111539_102729812 175
96 3300009094 Ga0111539_10397608 Ga0111539_103976082 175
97 3300009094 Ga0111539_12489100 Ga0111539_124891001 175
98 3300009147 Ga0114129_10926740 Ga0114129_109267402 175
99 3300009148 Ga0105243_10066339 Ga0105243_100663393 175
100 3300009174 Ga0105241_10105240 Ga0105241_101052402 175
101 3300009176 Ga0105242_10571467 Ga0105242_105714672 175
102 3300009177 Ga0105248_10007354 Ga0105248_100073544 175
103 3300009551 Ga0105238_10290002 Ga0105238_102900022 175
104 3300009553 Ga0105249_10159790 Ga0105249_101597904 175
105 3300010375 Ga0105239_10101934 Ga0105239_101019343 175
106 3300013104 Ga0157370_10000310 Ga0157370_1000031034 175
107 3300013105 Ga0157369_10000525 Ga0157369_1000052528 175
108 3300013296 Ga0157374_10000138 Ga0157374_1000013826 175
109 3300013306 Ga0163162_10001494 Ga0163162_1000149418 175
110 3300013307 Ga0157372_10018279 Ga0157372_100182792 175
111 3300014326 Ga0157380_10150001 Ga0157380_101500011 175
112 3300014326 Ga0157380_10964593 Ga0157380_109645932 175
113 3300014497 Ga0182008_10300639 Ga0182008_103006392 175
114 3300021361 Ga0213872_10000320 Ga0213872_1000032030 175
115 3300021361 Ga0213872_10029589 Ga0213872_100295893 175
116 3300021361 Ga0213872_10045721 Ga0213872_100457212 175
117 3300025256 Ga0209759_1003505 Ga0209759_10035053 175
118 3300025258 Ga0209129_1004207 Ga0209129_10042074 175
119 3300025294 Ga0209025_1002648 Ga0209025_10026485 175
120 3300025298 Ga0209050_1004945 Ga0209050_10049455 175
121 3300025304 Ga0209257_1009360 Ga0209257_10093602 175
122 3300025885 Ga0207653_10113143 Ga0207653_101131432 175
123 3300025899 Ga0207642_10052794 Ga0207642_100527942 175
124 3300025899 Ga0207642_10158598 Ga0207642_101585982 175
125 3300025901 Ga0207688_10289641 Ga0207688_102896412 175
126 3300025904 Ga0207647_10008975 Ga0207647_100089754 175
127 3300025908 Ga0207643_10044714 Ga0207643_100447142 175
128 3300025911 Ga0207654_10191961 Ga0207654_101919612 175
129 3300025913 Ga0207695_10050820 Ga0207695_100508203 175
130 3300025914 Ga0207671_10025357 Ga0207671_100253576 175
131 3300025917 Ga0207660_10038683 Ga0207660_100386833 175
132 3300025917 Ga0207660_10074410 Ga0207660_100744104 175
133 3300025918 Ga0207662_10024856 Ga0207662_100248562 175
134 3300025919 Ga0207657_10012865 Ga0207657_100128655 175
135 3300025921 Ga0207652_10374554 Ga0207652_103745542 175
136 3300025923 Ga0207681_10008569 Ga0207681_100085694 175
137 3300025924 Ga0207694_10129906 Ga0207694_101299062 175
138 3300025926 Ga0207659_10225726 Ga0207659_102257262 175
139 3300025933 Ga0207706_10427890 Ga0207706_104278902 175
140 3300025934 Ga0207686_10204223 Ga0207686_102042231 175
141 3300025935 Ga0207709_10045854 Ga0207709_100458542 175
142 3300025936 Ga0207670_11017448 Ga0207670_110174482 175
143 3300025937 Ga0207669_10448079 Ga0207669_104480792 175
144 3300025938 Ga0207704_10102281 Ga0207704_101022813 175
145 3300025940 Ga0207691_10062504 Ga0207691_100625042 175
146 3300025941 Ga0207711_10006637 Ga0207711_100066377 175
147 3300025942 Ga0207689_10021769 Ga0207689_100217695 175
148 3300025942 Ga0207689_10551970 Ga0207689_105519701 175
149 3300025949 Ga0207667_10054586 Ga0207667_100545862 175
150 3300025961 Ga0207712_10040848 Ga0207712_100408483 175
151 3300025972 Ga0207668_10120698 Ga0207668_101206983 175
152 3300025986 Ga0207658_10006899 Ga0207658_100068997 175
153 3300026075 Ga0207708_10010099 Ga0207708_100100995 175
154 3300026089 Ga0207648_10003015 Ga0207648_1000301518 175
155 3300026118 Ga0207675_100016390 Ga0207675_1000163904 175
156 3300026121 Ga0207683_11158583 Ga0207683_111585832 175
157 3300027907 Ga0207428_10065766 Ga0207428_100657662 175
158 3300027907 Ga0207428_10081399 Ga0207428_100813992 175
159 3300027907 Ga0207428_10231966 Ga0207428_102319662 175
160 3300027907 Ga0207428_10817902 Ga0207428_108179021 175
161 3300028379 Ga0268266_10571810 Ga0268266_105718102 175
162 3300028380 Ga0268265_10001934 Ga0268265_1000193420 175
163 3300028380 Ga0268265_10428155 Ga0268265_104281552 175
164 3300028381 Ga0268264_10235769 Ga0268264_102357692 175
165 3300031250 Ga0265331_10020075 Ga0265331_100200754 175
166 3300031548 Ga0307408_100134772 Ga0307408_1001347723 175
167 3300031548 Ga0307408_100137546 Ga0307408_1001375463 175
168 3300031665 Ga0316575_10003201 Ga0316575_100032012 175
169 3300031901 Ga0307406_10846385 Ga0307406_108463851 175
170 3300032002 Ga0307416_100023052 Ga0307416_1000230527 175
171 3300032005 Ga0307411_10074281 Ga0307411_100742812 175
172 3300032005 Ga0307411_10234259 Ga0307411_102342592 175
173 3300032005 Ga0307411_10760585 Ga0307411_107605851 175
174 3300033180 Ga0307510_10378469 Ga0307510_103784691 175
175 3300035091 Ga0373951_0123659 Ga0373951_0123659_80_613 175
176 3300035241 Ga0373961_0172924 Ga0373961_0172924_30_566 175
177 3300035398 Ga0316574_0074095 Ga0316574_0074095_257_799 175
178 3300037418 Ga0395900_0000179 Ga0395900_0000179_79514_80071 175
179 3300037418 Ga0395900_0044036 Ga0395900_0044036_2173_2730 175
180 3300037418 Ga0395900_0172925 Ga0395900_0172925_248_805 175
181 3300037466 Ga0395898_0022101 Ga0395898_0022101_3262_3819 175
182 3300037466 Ga0395898_0110973 Ga0395898_0110973_507_1064 175
183 3300038996 Ga0242420_044146 Ga0242420_044146_216_749 175
184 3300039447 Ga0436361_0133265 Ga0436361_0133265_335_880 175
185 3300039447 Ga0436361_0347622 Ga0436361_0347622_273_830 175
186 3300039447 Ga0436361_0425380 Ga0436361_0425380_123_668 175
187 3300039447 Ga0436361_0429567 Ga0436361_0429567_123_668 175
188 3300039447 Ga0436361_0549519 Ga0436361_0549519_819_1364 175
189 3300039447 Ga0436361_0622987 Ga0436361_0622987_1943_2488 175
190 3300042005 Ga0439448_0000328 Ga0439448_0000328_5258_5815 175
191 3300042012 Ga0439455_0032156 Ga0439455_0032156_287_844 175
192 3300042876 Ga0451577_0716177 Ga0451577_0716177_171_704 175
193 3300044656 Ga0466969_0010333 Ga0466969_0010333_3081_3632 175
194 3300044683 Ga0466965_0019428 Ga0466965_0019428_1282_1839 175
195 3300044684 Ga0466966_0002592 Ga0466966_0002592_4576_5133 175
196 3300044684 Ga0466966_0017490 Ga0466966_0017490_2788_3339 175
197 3300044684 Ga0466966_0150758 Ga0466966_0150758_314_865 175
198 3300044693 Ga0466961_0015851 Ga0466961_0015851_3339_3890 175
199 3300044693 Ga0466961_0283452 Ga0466961_0283452_212_769 175
200 3300044693 Ga0466961_0287662 Ga0466961_0287662_77_628 175
201 3300044706 Ga0466964_0013348 Ga0466964_0013348_503_1060 175
202 3300044712 Ga0453684_0000824 Ga0453684_0000824_91889_92440 175
203 3300044712 Ga0453684_0660891 Ga0453684_0660891_276_827 175
204 3300044735 Ga0466968_0340374 Ga0466968_0340374_82_633 175
205 3300044765 Ga0466970_0013753 Ga0466970_0013753_950_1501 175
206 3300044765 Ga0466970_0018910 Ga0466970_0018910_714_1265 175
207 3300044765 Ga0466970_0057278 Ga0466970_0057278_504_1061 175
208 3300044842 Ga0466957_0007220 Ga0466957_0007220_2500_3057 175
209 3300044842 Ga0466957_0262716 Ga0466957_0262716_149_706 175
210 3300044842 Ga0466957_0746495 Ga0466957_0746495_61_612 175
211 3300044901 Ga0466960_0096184 Ga0466960_0096184_562_1113 175
212 3300045049 Ga0466959_0031818 Ga0466959_0031818_1046_1597 175
213 3300045049 Ga0466959_0087374 Ga0466959_0087374_1441_1998 175
214 3300045049 Ga0466959_0751783 Ga0466959_0751783_17_568 175
215 3300045051 Ga0451576_0000591 Ga0451576_0000591_25982_26515 175
216 3300045051 Ga0451576_0001118 Ga0451576_0001118_8362_8895 175
217 3300045051 Ga0451576_0070290 Ga0451576_0070290_2291_2836 175
218 3300045051 Ga0451576_0087763 Ga0451576_0087763_1786_2337 175
219 3300045051 Ga0451576_0430090 Ga0451576_0430090_740_1339 175
220 3300045836 Ga0466958_0008210 Ga0466958_0008210_3212_3769 175
221 3300045836 Ga0466958_0219743 Ga0466958_0219743_460_1011 175
222 3300045976 Ga0466967_0926499 Ga0466967_0926499_220_771 175
223 3300046457 Ga0495590_0015488 Ga0495590_0015488_867_1424 175
224 3300046457 Ga0495590_0151463 Ga0495590_0151463_90_647 175
225 3300046458 Ga0495591_010008 Ga0495591_010008_2028_2585 175
226 3300046459 Ga0495629_0000105 Ga0495629_0000105_32755_33312 175
227 3300046460 Ga0495638_0001843 Ga0495638_0001843_9277_9834 175
228 3300046462 Ga0495651_0203148 Ga0495651_0203148_174_728 175
229 3300046471 Ga0495650_0001361 Ga0495650_0001361_14289_14846 175
230 3300046471 Ga0495650_0098010 Ga0495650_0098010_63_620 175
231 3300046472 Ga0495580_0020609 Ga0495580_0020609_2228_2785 175
232 3300046474 Ga0495605_0005426 Ga0495605_0005426_506_1063 175
233 3300046491 Ga0495584_0127815 Ga0495584_0127815_545_1102 175
234 3300046492 Ga0495585_0136206 Ga0495585_0136206_527_1084 175
235 3300046501 Ga0495607_0019153 Ga0495607_0019153_1249_1806 175
236 3300046506 Ga0495583_0013367 Ga0495583_0013367_562_1119 175
237 3300046506 Ga0495583_0088521 Ga0495583_0088521_577_1134 175
238 3300046507 Ga0495606_0008385 Ga0495606_0008385_4012_4569 175
239 3300046507 Ga0495606_0035892 Ga0495606_0035892_2232_2789 175
240 3300046507 Ga0495606_0109936 Ga0495606_0109936_853_1410 175
241 3300046513 Ga0495616_0027829 Ga0495616_0027829_1304_1861 175
242 3300046516 Ga0495628_0157730 Ga0495628_0157730_100_657 175
243 3300046517 Ga0495630_0090035 Ga0495630_0090035_232_789 175
244 3300046518 Ga0495631_0070766 Ga0495631_0070766_177_734 175
245 3300046523 Ga0495644_0021625 Ga0495644_0021625_1373_1930 175
246 3300046523 Ga0495644_0060633 Ga0495644_0060633_99_656 175
247 3300046524 Ga0495648_0079312 Ga0495648_0079312_317_874 175
248 3300046530 Ga0495654_0042687 Ga0495654_0042687_612_1169 175
249 3300046537 Ga0495598_0042200 Ga0495598_0042200_33_566 175
250 3300046542 Ga0495597_0043387 Ga0495597_0043387_143_700 175
251 3300046543 Ga0495645_0002681 Ga0495645_0002681_2762_3319 175
252 3300046557 Ga0495622_0057561 Ga0495622_0057561_677_1234 175
253 3300046648 Ga0495611_0214317 Ga0495611_0214317_24_581 175
254 3300046678 Ga0495599_0022101 Ga0495599_0022101_1635_2189 175
255 3300046679 Ga0495623_0006621 Ga0495623_0006621_6307_6861 175
256 3300046680 Ga0495646_0023757 Ga0495646_0023757_387_944 175
257 3300046684 Ga0495669_0030746 Ga0495669_0030746_973_1530 175
258 3300046684 Ga0495669_0158032 Ga0495669_0158032_248_805 175
259 3300046691 Ga0495670_0006236 Ga0495670_0006236_1248_1805 175
260 3300046692 Ga0495671_0025197 Ga0495671_0025197_1690_2247 175
261 3300046692 Ga0495671_0060409 Ga0495671_0060409_674_1231 175
262 3300046692 Ga0495671_0118782 Ga0495671_0118782_653_1210 175
263 3300046692 Ga0495671_0193180 Ga0495671_0193180_168_725 175
264 3300046694 Ga0495649_0025057 Ga0495649_0025057_492_1049 175
265 3300046794 Ga0495589_0010898 Ga0495589_0010898_1056_1613 175
266 3300046794 Ga0495589_0023119 Ga0495589_0023119_1449_2006 175
267 3300046794 Ga0495589_0240213 Ga0495589_0240213_142_699 175
268 3300047315 Ga0495581_0010374 Ga0495581_0010374_2755_3312 175
269 3300047317 Ga0495604_0039338 Ga0495604_0039338_474_1028 175
270 3300047320 Ga0495672_0035117 Ga0495672_0035117_1255_1812 175
271 3300047323 Ga0495683_0015146 Ga0495683_0015146_2794_3351 175
272 3300047323 Ga0495683_0050400 Ga0495683_0050400_13_570 175
273 3300047443 Ga0495687_011756 Ga0495687_011756_1290_1847 175
274 3300047443 Ga0495687_015528 Ga0495687_015528_1557_2114 175
275 3300047444 Ga0495675_0064432 Ga0495675_0064432_522_1079 175
276 3300047445 Ga0495677_0018416 Ga0495677_0018416_868_1425 175
277 3300047446 Ga0495679_034720 Ga0495679_034720_402_959 175
278 3300047447 Ga0495685_036318 Ga0495685_036318_606_1163 175
279 3300047469 Ga0495673_0036689 Ga0495673_0036689_1676_2233 175
280 3300047470 Ga0495681_0188366 Ga0495681_0188366_213_770 175
281 3300047472 Ga0495686_0180752 Ga0495686_0180752_15_572 175
282 3300047673 Ga0495593_0021851 Ga0495593_0021851_665_1222 175
283 3300048088 Ga0495602_0046136 Ga0495602_0046136_669_1223 175
284 3300048089 Ga0495614_0014934 Ga0495614_0014934_2631_3188 175
285 3300048090 Ga0495615_0137751 Ga0495615_0137751_83_616 175
286 3300048091 Ga0495626_0007307 Ga0495626_0007307_2499_3056 175
287 3300048903 Ga0496100_0088238 Ga0496100_0088238_317_874 175
288 3300048904 Ga0496101_0013292 Ga0496101_0013292_4361_4918 175
289 3300048904 Ga0496101_0034361 Ga0496101_0034361_123_680 175
290 3300048905 Ga0496102_0047891 Ga0496102_0047891_2823_3380 175
291 3300048907 Ga0496104_0064512 Ga0496104_0064512_2133_2690 175
292 3300048907 Ga0496104_0076004 Ga0496104_0076004_1129_1686 175
293 3300048908 Ga0496105_0021434 Ga0496105_0021434_3491_4048 175
294 3300048908 Ga0496105_0092443 Ga0496105_0092443_1332_1889 175
295 3300048909 Ga0496106_0397089 Ga0496106_0397089_481_1038 175
296 3300048910 Ga0496107_0041522 Ga0496107_0041522_2298_2855 175
297 3300048910 Ga0496107_0123426 Ga0496107_0123426_280_837 175
298 3300048911 Ga0496108_0487568 Ga0496108_0487568_419_976 175
299 3300048915 Ga0496112_0107911 Ga0496112_0107911_2182_2739 175
300 3300048915 Ga0496112_0405792 Ga0496112_0405792_378_923 175
301 3300048917 Ga0496114_0003193 Ga0496114_0003193_9307_9864 175
302 3300048918 Ga0496115_0173428 Ga0496115_0173428_1029_1586 175
303 3300048922 Ga0496119_0111082 Ga0496119_0111082_184_741 175
304 3300048924 Ga0496121_0037317 Ga0496121_0037317_3141_3698 175
305 3300048924 Ga0496121_0142265 Ga0496121_0142265_153_710 175
306 3300048929 Ga0496126_0020071 Ga0496126_0020071_123_683 175
307 3300048929 Ga0496126_0067260 Ga0496126_0067260_1328_1888 175
308 3300048929 Ga0496126_0352856 Ga0496126_0352856_95_652 175
309 3300049459 Ga0495678_075366 Ga0495678_075366_288_845 175
310 3300049460 Ga0495682_0007048 Ga0495682_0007048_1058_1615 175
311 3300049568 Ga0501031_0410964 Ga0501031_0410964_286_819 175
312 3300049572 Ga0501036_0180728 Ga0501036_0180728_895_1428 175
313 3300049573 Ga0501037_0182804 Ga0501037_0182804_520_1053 175
314 3300049574 Ga0501038_0204622 Ga0501038_0204622_687_1220 175
315 3300049575 Ga0501039_0007165 Ga0501039_0007165_7846_8379 175
316 3300049575 Ga0501039_0126796 Ga0501039_0126796_333_866 175
317 3300049576 Ga0501040_0008414 Ga0501040_0008414_5400_5933 175
318 3300049576 Ga0501040_0445764 Ga0501040_0445764_148_681 175
319 3300049577 Ga0501041_0016872 Ga0501041_0016872_2065_2598 175
320 3300049577 Ga0501041_0583425 Ga0501041_0583425_24_557 175
321 3300049578 Ga0501042_0268652 Ga0501042_0268652_530_1063 175
322 3300049578 Ga0501042_0654332 Ga0501042_0654332_19_552 175
323 3300049579 Ga0501043_0287238 Ga0501043_0287238_64_597 175
324 3300049579 Ga0501043_0482170 Ga0501043_0482170_327_860 175
325 3300049580 Ga0501046_0016835 Ga0501046_0016835_5517_6050 175
326 3300049582 Ga0501048_0118623 Ga0501048_0118623_987_1520 175
327 3300049582 Ga0501048_0249390 Ga0501048_0249390_622_1155 175
328 3300049584 Ga0501068_0302928 Ga0501068_0302928_252_785 175
329 3300049587 Ga0501071_0010141 Ga0501071_0010141_4661_5194 175
330 3300049588 Ga0501072_0017384 Ga0501072_0017384_4702_5235 175
331 3300049588 Ga0501072_0794178 Ga0501072_0794178_29_562 175
332 3300049590 Ga0501074_0213744 Ga0501074_0213744_825_1358 175
333 3300049591 Ga0501075_0006027 Ga0501075_0006027_64_597 175
334 3300049592 Ga0501076_0001751 Ga0501076_0001751_2846_3379 175
335 3300049592 Ga0501076_0604863 Ga0501076_0604863_26_559 175
336 3300049593 Ga0501077_0013917 Ga0501077_0013917_2509_3042 175
337 3300049593 Ga0501077_0181298 Ga0501077_0181298_511_1044 175
338 3300049679 Ga0501249_055740 Ga0501249_055740_270_803 175
339 3300049741 Ga0501079_0086483 Ga0501079_0086483_1271_1804 175
340 3300049741 Ga0501079_0205993 Ga0501079_0205993_738_1271 175
341 3300049741 Ga0501079_0457122 Ga0501079_0457122_118_651 175
342 3300049742 Ga0501080_0217334 Ga0501080_0217334_706_1239 175
343 3300049742 Ga0501080_1332921 Ga0501080_1332921_13_546 175
344 3300049743 Ga0501081_0002036 Ga0501081_0002036_11586_12119 175
345 3300049743 Ga0501081_0082368 Ga0501081_0082368_819_1352 175
346 3300050509 nmdc:mga0qj67_4213_c1 nmdc:mga0qj67_4213_c1_3091_3624 175
347 3300050510 nmdc:mga06r32_155764_c1 nmdc:mga06r32_155764_c1_1154_1687 175
348 3300050511 nmdc:mga08y16_106694_c1 nmdc:mga08y16_106694_c1_1747_2280 175
349 3300050511 nmdc:mga08y16_229138_c1 nmdc:mga08y16_229138_c1_700_1233 175
350 3300050511 nmdc:mga08y16_482695_c1 nmdc:mga08y16_482695_c1_626_1159 175
351 3300050511 nmdc:mga08y16_57458_c1 nmdc:mga08y16_57458_c1_575_1108 175
352 3300053117 Ga0500593_000371 Ga0500593_000371_9536_10129 175
353 3300053148 Ga0500590_144662 Ga0500590_144662_349_900 175
354 3300053156 Ga0500622_0000002 Ga0500622_0000002_397520_398062 175
355 3300053729 Ga0500625_118289 Ga0500625_118289_417_950 175
356 3300054114 Ga0501084_0054546 Ga0501084_0054546_309_842 175
357 3300054114 Ga0501084_0308865 Ga0501084_0308865_221_754 175
358 3300060353 Ga0501082_0067871 Ga0501082_0067871_1398_1931 175
359 3300060353 Ga0501082_0114811 Ga0501082_0114811_862_1395 175
360 3300061734 Ga0530510_0000042 Ga0530510_0000042_2121_2654 175
361 3300061734 Ga0530510_1001857 Ga0530510_1001857_85_618 175
362 iso_pu_bacteria 2501025504 2501407974 175
363 iso_pu_bacteria 2510917014 2511095719 175
364 iso_pu_bacteria 2510917015 2511103528 175
365 iso_pu_bacteria 2513237082 2513554303 175
366 iso_pu_bacteria 2513237083 2513562581 175
367 iso_pu_bacteria 2600255067 2600810415 175
368 iso_pu_bacteria 2900634093 2900636294 175
369 iso_pu_bacteria 2921643360 2921655040 175
370 iso_pu_bacteria 642555113 642620249 175
371 iso_pu_bacteria 8003955200 8003959790 175
372 3300003316 rootH1_10097847 rootH1_100978472 176
373 3300005328 Ga0070676_10072709 Ga0070676_100727092 176
374 3300005330 Ga0070690_100296141 Ga0070690_1002961412 176
375 3300005331 Ga0070670_100003283 Ga0070670_1000032836 176
376 3300005331 Ga0070670_100074887 Ga0070670_1000748872 176
377 3300005331 Ga0070670_100116237 Ga0070670_1001162372 176
378 3300005334 Ga0068869_100021949 Ga0068869_1000219494 176
379 3300005335 Ga0070666_10011342 Ga0070666_100113424 176
380 3300005335 Ga0070666_10376314 Ga0070666_103763142 176
381 3300005337 Ga0070682_100780926 Ga0070682_1007809261 176
382 3300005338 Ga0068868_100009310 Ga0068868_1000093106 176
383 3300005338 Ga0068868_100259058 Ga0068868_1002590581 176
384 3300005343 Ga0070687_100181456 Ga0070687_1001814562 176
385 3300005344 Ga0070661_100561211 Ga0070661_1005612112 176
386 3300005354 Ga0070675_100002407 Ga0070675_1000024078 176
387 3300005354 Ga0070675_100013720 Ga0070675_1000137206 176
388 3300005354 Ga0070675_100022424 Ga0070675_1000224246 176
389 3300005354 Ga0070675_100044472 Ga0070675_1000444723 176
390 3300005355 Ga0070671_100041344 Ga0070671_1000413442 176
391 3300005355 Ga0070671_100113636 Ga0070671_1001136361 176
392 3300005355 Ga0070671_100564749 Ga0070671_1005647492 176
393 3300005356 Ga0070674_100635680 Ga0070674_1006356802 176
394 3300005364 Ga0070673_100010706 Ga0070673_1000107062 176
395 3300005364 Ga0070673_100024640 Ga0070673_1000246402 176
396 3300005365 Ga0070688_100425627 Ga0070688_1004256272 176
397 3300005367 Ga0070667_100016316 Ga0070667_1000163163 176
398 3300005456 Ga0070678_100007678 Ga0070678_1000076783 176
399 3300005456 Ga0070678_100190872 Ga0070678_1001908722 176
400 3300005457 Ga0070662_100171358 Ga0070662_1001713582 176
401 3300005457 Ga0070662_100282080 Ga0070662_1002820802 176
402 3300005459 Ga0068867_100124684 Ga0068867_1001246842 176
403 3300005466 Ga0070685_10027554 Ga0070685_100275542 176
404 3300005543 Ga0070672_100006265 Ga0070672_1000062656 176
405 3300005543 Ga0070672_100259237 Ga0070672_1002592372 176
406 3300005544 Ga0070686_100106892 Ga0070686_1001068922 176
407 3300005564 Ga0070664_100084721 Ga0070664_1000847212 176
408 3300005564 Ga0070664_100137572 Ga0070664_1001375722 176
409 3300005578 Ga0068854_100215157 Ga0068854_1002151572 176
410 3300005578 Ga0068854_100266048 Ga0068854_1002660482 176
411 3300005617 Ga0068859_100018681 Ga0068859_1000186814 176
412 3300005618 Ga0068864_100008520 Ga0068864_1000085204 176
413 3300005618 Ga0068864_100014167 Ga0068864_1000141675 176
414 3300005834 Ga0068851_10095103 Ga0068851_100951032 176
415 3300005840 Ga0068870_10340611 Ga0068870_103406112 176
416 3300005841 Ga0068863_100017003 Ga0068863_1000170036 176
417 3300005841 Ga0068863_100275905 Ga0068863_1002759052 176
418 3300005841 Ga0068863_100294660 Ga0068863_1002946602 176
419 3300005842 Ga0068858_100001814 Ga0068858_10000181420 176
420 3300005843 Ga0068860_100270691 Ga0068860_1002706911 176
421 3300006237 Ga0097621_100163862 Ga0097621_1001638622 176
422 3300006358 Ga0068871_100168381 Ga0068871_1001683812 176
423 3300006358 Ga0068871_100571390 Ga0068871_1005713902 176
424 3300006881 Ga0068865_100250844 Ga0068865_1002508442 176
425 3300006931 Ga0097620_100018680 Ga0097620_1000186804 176
426 3300009177 Ga0105248_10071910 Ga0105248_100719103 176
427 3300013306 Ga0163162_10463539 Ga0163162_104635392 176
428 3300014325 Ga0163163_10009312 Ga0163163_100093122 176
429 3300014745 Ga0157377_10145633 Ga0157377_101456332 176
430 3300014968 Ga0157379_10038301 Ga0157379_100383013 176
431 3300014969 Ga0157376_10037875 Ga0157376_100378753 176
432 3300014969 Ga0157376_10281271 Ga0157376_102812713 176
433 3300017792 Ga0163161_10112127 Ga0163161_101121272 176
434 3300025256 Ga0209759_1000342 Ga0209759_100034212 176
435 3300025321 Ga0207656_10022427 Ga0207656_100224272 176
436 3300025893 Ga0207682_10010486 Ga0207682_100104862 176
437 3300025903 Ga0207680_10012229 Ga0207680_100122295 176
438 3300025903 Ga0207680_10357090 Ga0207680_103570902 176
439 3300025907 Ga0207645_10076194 Ga0207645_100761943 176
440 3300025908 Ga0207643_10237532 Ga0207643_102375322 176
441 3300025909 Ga0207705_10119327 Ga0207705_101193272 176
442 3300025909 Ga0207705_10127778 Ga0207705_101277783 176
443 3300025909 Ga0207705_10577739 Ga0207705_105777392 176
444 3300025920 Ga0207649_10438737 Ga0207649_104387372 176
445 3300025925 Ga0207650_10001909 Ga0207650_1000190910 176
446 3300025925 Ga0207650_10105991 Ga0207650_101059912 176
447 3300025925 Ga0207650_10236203 Ga0207650_102362032 176
448 3300025926 Ga0207659_10003994 Ga0207659_100039946 176
449 3300025926 Ga0207659_10012858 Ga0207659_100128586 176
450 3300025926 Ga0207659_10436152 Ga0207659_104361522 176
451 3300025931 Ga0207644_10001986 Ga0207644_100019862 176
452 3300025933 Ga0207706_10137043 Ga0207706_101370432 176
453 3300025933 Ga0207706_10300428 Ga0207706_103004282 176
454 3300025936 Ga0207670_10015813 Ga0207670_100158132 176
455 3300025940 Ga0207691_10008987 Ga0207691_100089876 176
456 3300025940 Ga0207691_10205809 Ga0207691_102058092 176
457 3300025940 Ga0207691_10335866 Ga0207691_103358661 176
458 3300025940 Ga0207691_10766811 Ga0207691_107668111 176
459 3300025941 Ga0207711_10019079 Ga0207711_100190794 176
460 3300025941 Ga0207711_10560896 Ga0207711_105608962 176
461 3300025942 Ga0207689_10023522 Ga0207689_100235224 176
462 3300025945 Ga0207679_10174875 Ga0207679_101748752 176
463 3300025960 Ga0207651_10009296 Ga0207651_100092966 176
464 3300025986 Ga0207658_10006823 Ga0207658_100068233 176
465 3300026023 Ga0207677_10003021 Ga0207677_100030217 176
466 3300026023 Ga0207677_10572061 Ga0207677_105720612 176
467 3300026035 Ga0207703_10004044 Ga0207703_100040448 176
468 3300026067 Ga0207678_10120749 Ga0207678_101207492 176
469 3300026067 Ga0207678_10947134 Ga0207678_109471341 176
470 3300026088 Ga0207641_10032341 Ga0207641_100323412 176
471 3300026088 Ga0207641_10035638 Ga0207641_100356382 176
472 3300026088 Ga0207641_10073011 Ga0207641_100730112 176
473 3300026095 Ga0207676_10007912 Ga0207676_100079127 176
474 3300026095 Ga0207676_10012227 Ga0207676_100122276 176
475 3300026118 Ga0207675_100389890 Ga0207675_1003898902 176
476 3300026121 Ga0207683_10038597 Ga0207683_100385973 176
477 3300026121 Ga0207683_10192887 Ga0207683_101928872 176
478 3300026121 Ga0207683_10911640 Ga0207683_109116401 176
479 3300028381 Ga0268264_10317339 Ga0268264_103173392 176
480 3300028794 Ga0307515_10000378 Ga0307515_100003783 176
481 3300031456 Ga0307513_10008368 Ga0307513_1000836811 176
482 3300031649 Ga0307514_10001743 Ga0307514_1000174318 176
483 3300031733 Ga0316577_10431718 Ga0316577_104317181 176
484 3300032004 Ga0307414_10616294 Ga0307414_106162942 176
485 3300037588 Ga0316581_0011584 Ga0316581_0011584_183_743 176
486 3300039438 Ga0436360_0973346 Ga0436360_0973346_604_1167 176
487 3300042001 Ga0439441_024922 Ga0439441_024922_316_918 176
488 3300042005 Ga0439448_0152937 Ga0439448_0152937_181_783 176
489 3300042435 Ga0439434_0222098 Ga0439434_0222098_23_604 176
490 3300042439 Ga0439464_0001296 Ga0439464_0001296_2593_3195 176
491 3300046477 Ga0495664_0387319 Ga0495664_0387319_136_699 176
492 3300046543 Ga0495645_0025935 Ga0495645_0025935_2463_3071 176
493 3300046681 Ga0495647_0133543 Ga0495647_0133543_55_660 176
494 3300046694 Ga0495649_0101728 Ga0495649_0101728_875_1444 176
495 3300047319 Ga0495674_0015753 Ga0495674_0015753_3976_4539 176
496 3300047320 Ga0495672_0013610 Ga0495672_0013610_12_575 176
497 3300048909 Ga0496106_0123642 Ga0496106_0123642_1260_1865 176
498 3300048911 Ga0496108_0040578 Ga0496108_0040578_416_1021 176
499 3300048912 Ga0496109_0109656 Ga0496109_0109656_455_1063 176
500 3300048912 Ga0496109_0405269 Ga0496109_0405269_323_928 176
501 3300048912 Ga0496109_0596551 Ga0496109_0596551_229_837 176
502 3300048917 Ga0496114_0507828 Ga0496114_0507828_158_763 176
503 3300003316 rootH1_10059048 rootH1_100590483 177
504 3300003792 Ga0055540_1001614 Ga0055540_10016145 177
505 3300003794 Ga0055531_10002809 Ga0055531_100028096 177
506 3300005327 Ga0070658_10369786 Ga0070658_103697862 177
507 3300005328 Ga0070676_10032673 Ga0070676_100326733 177
508 3300005328 Ga0070676_10120555 Ga0070676_101205551 177
509 3300005331 Ga0070670_100035755 Ga0070670_1000357554 177
510 3300005331 Ga0070670_100280161 Ga0070670_1002801612 177
511 3300005331 Ga0070670_100472311 Ga0070670_1004723112 177
512 3300005331 Ga0070670_100501395 Ga0070670_1005013951 177
513 3300005331 Ga0070670_101023725 Ga0070670_1010237251 177
514 3300005333 Ga0070677_10003148 Ga0070677_100031483 177
515 3300005333 Ga0070677_10013848 Ga0070677_100138483 177
516 3300005333 Ga0070677_10077985 Ga0070677_100779852 177
517 3300005333 Ga0070677_10121295 Ga0070677_101212951 177
518 3300005334 Ga0068869_100004113 Ga0068869_1000041136 177
519 3300005335 Ga0070666_10326700 Ga0070666_103267001 177
520 3300005335 Ga0070666_10334021 Ga0070666_103340212 177
521 3300005338 Ga0068868_100068111 Ga0068868_1000681112 177
522 3300005338 Ga0068868_100153350 Ga0068868_1001533502 177
523 3300005338 Ga0068868_100414072 Ga0068868_1004140722 177
524 3300005338 Ga0068868_100414319 Ga0068868_1004143192 177
525 3300005343 Ga0070687_100018067 Ga0070687_1000180673 177
526 3300005347 Ga0070668_100019399 Ga0070668_1000193993 177
527 3300005353 Ga0070669_100013746 Ga0070669_1000137463 177
528 3300005353 Ga0070669_100050201 Ga0070669_1000502013 177
529 3300005353 Ga0070669_100520801 Ga0070669_1005208012 177
530 3300005354 Ga0070675_100019141 Ga0070675_1000191414 177
531 3300005354 Ga0070675_100024765 Ga0070675_1000247652 177
532 3300005354 Ga0070675_100170640 Ga0070675_1001706402 177
533 3300005354 Ga0070675_100250813 Ga0070675_1002508132 177
534 3300005355 Ga0070671_100003297 Ga0070671_1000032974 177
535 3300005355 Ga0070671_100092436 Ga0070671_1000924363 177
536 3300005355 Ga0070671_100200288 Ga0070671_1002002882 177
537 3300005356 Ga0070674_100017825 Ga0070674_1000178254 177
538 3300005356 Ga0070674_100031937 Ga0070674_1000319372 177
539 3300005356 Ga0070674_100178103 Ga0070674_1001781032 177
540 3300005356 Ga0070674_100209566 Ga0070674_1002095662 177
541 3300005364 Ga0070673_100050212 Ga0070673_1000502122 177
542 3300005364 Ga0070673_100853708 Ga0070673_1008537082 177
543 3300005366 Ga0070659_100053565 Ga0070659_1000535654 177
544 3300005367 Ga0070667_100004664 Ga0070667_1000046643 177
545 3300005367 Ga0070667_100169310 Ga0070667_1001693102 177
546 3300005441 Ga0070700_100231214 Ga0070700_1002312142 177
547 3300005445 Ga0070708_100438762 Ga0070708_1004387622 177
548 3300005455 Ga0070663_100000383 Ga0070663_10000038314 177
549 3300005455 Ga0070663_100018798 Ga0070663_1000187986 177
550 3300005455 Ga0070663_100340516 Ga0070663_1003405162 177
551 3300005455 Ga0070663_100557360 Ga0070663_1005573602 177
552 3300005456 Ga0070678_100007693 Ga0070678_1000076937 177
553 3300005456 Ga0070678_100027275 Ga0070678_1000272753 177
554 3300005456 Ga0070678_100064007 Ga0070678_1000640072 177
555 3300005456 Ga0070678_100107343 Ga0070678_1001073432 177
556 3300005456 Ga0070678_100800847 Ga0070678_1008008471 177
557 3300005457 Ga0070662_100018320 Ga0070662_1000183203 177
558 3300005459 Ga0068867_100000021 Ga0068867_10000002126 177
559 3300005459 Ga0068867_100015559 Ga0068867_1000155592 177
560 3300005459 Ga0068867_100022723 Ga0068867_1000227232 177
561 3300005459 Ga0068867_100023593 Ga0068867_1000235933 177
562 3300005459 Ga0068867_100256997 Ga0068867_1002569972 177
563 3300005459 Ga0068867_100797100 Ga0068867_1007971002 177
564 3300005539 Ga0068853_100324998 Ga0068853_1003249982 177
565 3300005543 Ga0070672_100017297 Ga0070672_1000172974 177
566 3300005543 Ga0070672_100112244 Ga0070672_1001122442 177
567 3300005543 Ga0070672_100297053 Ga0070672_1002970532 177
568 3300005544 Ga0070686_100685905 Ga0070686_1006859052 177
569 3300005548 Ga0070665_100030125 Ga0070665_1000301256 177
570 3300005548 Ga0070665_100203381 Ga0070665_1002033811 177
571 3300005548 Ga0070665_100247846 Ga0070665_1002478464 177
572 3300005548 Ga0070665_100992631 Ga0070665_1009926312 177
573 3300005564 Ga0070664_100048588 Ga0070664_1000485882 177
574 3300005564 Ga0070664_100074018 Ga0070664_1000740182 177
575 3300005564 Ga0070664_100084786 Ga0070664_1000847862 177
576 3300005564 Ga0070664_100277793 Ga0070664_1002777932 177
577 3300005578 Ga0068854_100123104 Ga0068854_1001231042 177
578 3300005578 Ga0068854_100158888 Ga0068854_1001588882 177
579 3300005615 Ga0070702_100158970 Ga0070702_1001589702 177
580 3300005616 Ga0068852_100012412 Ga0068852_1000124123 177
581 3300005616 Ga0068852_100812430 Ga0068852_1008124302 177
582 3300005616 Ga0068852_100859154 Ga0068852_1008591542 177
583 3300005616 Ga0068852_100925034 Ga0068852_1009250342 177
584 3300005617 Ga0068859_100319072 Ga0068859_1003190722 177
585 3300005617 Ga0068859_100692883 Ga0068859_1006928832 177
586 3300005618 Ga0068864_100008889 Ga0068864_1000088894 177
587 3300005618 Ga0068864_100034866 Ga0068864_1000348665 177
588 3300005618 Ga0068864_100090299 Ga0068864_1000902992 177
589 3300005618 Ga0068864_100207308 Ga0068864_1002073082 177
590 3300005618 Ga0068864_100227472 Ga0068864_1002274722 177
591 3300005718 Ga0068866_10004238 Ga0068866_100042384 177
592 3300005719 Ga0068861_100029120 Ga0068861_1000291204 177
593 3300005719 Ga0068861_100203848 Ga0068861_1002038482 177
594 3300005834 Ga0068851_10037603 Ga0068851_100376032 177
595 3300005834 Ga0068851_10239381 Ga0068851_102393812 177
596 3300005840 Ga0068870_10129556 Ga0068870_101295562 177
597 3300005840 Ga0068870_10467270 Ga0068870_104672702 177
598 3300005841 Ga0068863_100006252 Ga0068863_1000062522 177
599 3300005841 Ga0068863_100045259 Ga0068863_1000452592 177
600 3300005841 Ga0068863_100062851 Ga0068863_1000628512 177
601 3300005841 Ga0068863_100802494 Ga0068863_1008024942 177
602 3300005842 Ga0068858_100060157 Ga0068858_1000601572 177
603 3300005842 Ga0068858_100125379 Ga0068858_1001253793 177
604 3300005843 Ga0068860_100015915 Ga0068860_1000159157 177
605 3300005844 Ga0068862_100041368 Ga0068862_1000413684 177
606 3300006042 Ga0075368_10047088 Ga0075368_100470881 177
607 3300006048 Ga0075363_100272563 Ga0075363_1002725632 177
608 3300006178 Ga0075367_10037421 Ga0075367_100374213 177
609 3300006195 Ga0075366_10006987 Ga0075366_100069874 177
610 3300006195 Ga0075366_10008243 Ga0075366_100082434 177
611 3300006195 Ga0075366_10064258 Ga0075366_100642582 177
612 3300006237 Ga0097621_100054084 Ga0097621_1000540842 177
613 3300006237 Ga0097621_100209158 Ga0097621_1002091582 177
614 3300006237 Ga0097621_100289894 Ga0097621_1002898942 177
615 3300006237 Ga0097621_100411394 Ga0097621_1004113942 177
616 3300006353 Ga0075370_10001022 Ga0075370_100010228 177
617 3300006353 Ga0075370_10022938 Ga0075370_100229382 177
618 3300006358 Ga0068871_100055678 Ga0068871_1000556783 177
619 3300006358 Ga0068871_100104270 Ga0068871_1001042702 177
620 3300006881 Ga0068865_100017387 Ga0068865_1000173874 177
621 3300006931 Ga0097620_100319058 Ga0097620_1003190582 177
622 3300006931 Ga0097620_100692914 Ga0097620_1006929142 177
623 3300009093 Ga0105240_10003122 Ga0105240_1000312217 177
624 3300009093 Ga0105240_10574098 Ga0105240_105740982 177
625 3300009098 Ga0105245_10054536 Ga0105245_100545365 177
626 3300009148 Ga0105243_10000295 Ga0105243_100002952 177
627 3300009148 Ga0105243_10067185 Ga0105243_100671854 177
628 3300009148 Ga0105243_10187960 Ga0105243_101879603 177
629 3300009148 Ga0105243_11559356 Ga0105243_115593562 177
630 3300009174 Ga0105241_10148197 Ga0105241_101481973 177
631 3300009176 Ga0105242_10674403 Ga0105242_106744032 177
632 3300009177 Ga0105248_10542651 Ga0105248_105426512 177
633 3300009545 Ga0105237_10000678 Ga0105237_1000067846 177
634 3300009545 Ga0105237_10237395 Ga0105237_102373952 177
635 3300009551 Ga0105238_10003973 Ga0105238_100039735 177
636 3300010375 Ga0105239_10000292 Ga0105239_1000029257 177
637 3300011119 Ga0105246_10387269 Ga0105246_103872692 177
638 3300013105 Ga0157369_10210924 Ga0157369_102109242 177
639 3300013296 Ga0157374_11232871 Ga0157374_112328711 177
640 3300013297 Ga0157378_10226603 Ga0157378_102266032 177
641 3300013306 Ga0163162_10047420 Ga0163162_100474202 177
642 3300013306 Ga0163162_10077078 Ga0163162_100770783 177
643 3300013306 Ga0163162_10354497 Ga0163162_103544972 177
644 3300013306 Ga0163162_11136547 Ga0163162_111365472 177
645 3300013308 Ga0157375_10015511 Ga0157375_100155112 177
646 3300013308 Ga0157375_10029760 Ga0157375_100297602 177
647 3300013308 Ga0157375_10137913 Ga0157375_101379133 177
648 3300013308 Ga0157375_10236646 Ga0157375_102366463 177
649 3300014325 Ga0163163_10089270 Ga0163163_100892702 177
650 3300014325 Ga0163163_10136840 Ga0163163_101368402 177
651 3300014326 Ga0157380_10007613 Ga0157380_100076132 177
652 3300014745 Ga0157377_10000021 Ga0157377_1000002189 177
653 3300014968 Ga0157379_10027561 Ga0157379_100275612 177
654 3300014968 Ga0157379_10060072 Ga0157379_100600722 177
655 3300014968 Ga0157379_10605442 Ga0157379_106054422 177
656 3300014969 Ga0157376_10333675 Ga0157376_103336752 177
657 3300014969 Ga0157376_10700712 Ga0157376_107007122 177
658 3300017792 Ga0163161_10013318 Ga0163161_100133184 177
659 3300025256 Ga0209759_1024975 Ga0209759_10249752 177
660 3300025302 Ga0207426_1002027 Ga0207426_10020276 177
661 3300025303 Ga0209051_1000454 Ga0209051_100045414 177
662 3300025304 Ga0209257_1000022 Ga0209257_1000022753 177
663 3300025304 Ga0209257_1035023 Ga0209257_10350233 177
664 3300025315 Ga0207697_10069502 Ga0207697_100695022 177
665 3300025315 Ga0207697_10163028 Ga0207697_101630282 177
666 3300025321 Ga0207656_10028373 Ga0207656_100283732 177
667 3300025735 Ga0207713_1012200 Ga0207713_10122002 177
668 3300025893 Ga0207682_10007232 Ga0207682_100072323 177
669 3300025893 Ga0207682_10008774 Ga0207682_100087744 177
670 3300025893 Ga0207682_10025014 Ga0207682_100250142 177
671 3300025899 Ga0207642_10023867 Ga0207642_100238672 177
672 3300025901 Ga0207688_10098459 Ga0207688_100984592 177
673 3300025901 Ga0207688_10137924 Ga0207688_101379242 177
674 3300025903 Ga0207680_10353091 Ga0207680_103530912 177
675 3300025903 Ga0207680_10369241 Ga0207680_103692412 177
676 3300025904 Ga0207647_10014971 Ga0207647_100149716 177
677 3300025907 Ga0207645_10007870 Ga0207645_100078702 177
678 3300025907 Ga0207645_10025599 Ga0207645_100255992 177
679 3300025908 Ga0207643_10009100 Ga0207643_100091006 177
680 3300025908 Ga0207643_10202288 Ga0207643_102022882 177
681 3300025908 Ga0207643_10401375 Ga0207643_104013752 177
682 3300025909 Ga0207705_10235797 Ga0207705_102357972 177
683 3300025913 Ga0207695_10020879 Ga0207695_100208796 177
684 3300025913 Ga0207695_10221785 Ga0207695_102217852 177
685 3300025914 Ga0207671_10018908 Ga0207671_100189086 177
686 3300025914 Ga0207671_10488171 Ga0207671_104881712 177
687 3300025918 Ga0207662_10028948 Ga0207662_100289482 177
688 3300025919 Ga0207657_10349702 Ga0207657_103497021 177
689 3300025920 Ga0207649_10150683 Ga0207649_101506831 177
690 3300025920 Ga0207649_10463720 Ga0207649_104637202 177
691 3300025923 Ga0207681_10001253 Ga0207681_1000125312 177
692 3300025923 Ga0207681_10007721 Ga0207681_100077216 177
693 3300025924 Ga0207694_10027495 Ga0207694_100274954 177
694 3300025925 Ga0207650_10002430 Ga0207650_100024306 177
695 3300025925 Ga0207650_10015531 Ga0207650_100155313 177
696 3300025925 Ga0207650_10100285 Ga0207650_101002852 177
697 3300025925 Ga0207650_10435358 Ga0207650_104353582 177
698 3300025926 Ga0207659_10001279 Ga0207659_1000127912 177
699 3300025926 Ga0207659_10038132 Ga0207659_100381324 177
700 3300025926 Ga0207659_10099463 Ga0207659_100994633 177
701 3300025926 Ga0207659_10203406 Ga0207659_102034062 177
702 3300025927 Ga0207687_10513729 Ga0207687_105137291 177
703 3300025931 Ga0207644_10001397 Ga0207644_100013979 177
704 3300025931 Ga0207644_10061998 Ga0207644_100619982 177
705 3300025931 Ga0207644_10266138 Ga0207644_102661382 177
706 3300025931 Ga0207644_10489797 Ga0207644_104897972 177
707 3300025933 Ga0207706_10042544 Ga0207706_100425442 177
708 3300025933 Ga0207706_10674342 Ga0207706_106743422 177
709 3300025935 Ga0207709_10027408 Ga0207709_100274082 177
710 3300025937 Ga0207669_10006020 Ga0207669_100060202 177
711 3300025937 Ga0207669_10092933 Ga0207669_100929332 177
712 3300025937 Ga0207669_10357561 Ga0207669_103575612 177
713 3300025937 Ga0207669_10499939 Ga0207669_104999392 177
714 3300025938 Ga0207704_10064764 Ga0207704_100647643 177
715 3300025939 Ga0207665_10112107 Ga0207665_101121072 177
716 3300025940 Ga0207691_10038531 Ga0207691_100385313 177
717 3300025940 Ga0207691_10073282 Ga0207691_100732822 177
718 3300025940 Ga0207691_10090505 Ga0207691_100905052 177
719 3300025940 Ga0207691_10096822 Ga0207691_100968222 177
720 3300025940 Ga0207691_10116063 Ga0207691_101160632 177
721 3300025941 Ga0207711_10008377 Ga0207711_100083779 177
722 3300025942 Ga0207689_10011343 Ga0207689_100113433 177
723 3300025942 Ga0207689_10396049 Ga0207689_103960492 177
724 3300025945 Ga0207679_10088897 Ga0207679_100888973 177
725 3300025945 Ga0207679_10421559 Ga0207679_104215592 177
726 3300025945 Ga0207679_11025148 Ga0207679_110251481 177
727 3300025949 Ga0207667_10097810 Ga0207667_100978104 177
728 3300025960 Ga0207651_10030385 Ga0207651_100303853 177
729 3300025960 Ga0207651_10036213 Ga0207651_100362132 177
730 3300025960 Ga0207651_10614659 Ga0207651_106146592 177
731 3300025972 Ga0207668_10004921 Ga0207668_100049217 177
732 3300025981 Ga0207640_10045816 Ga0207640_100458163 177
733 3300025981 Ga0207640_10211630 Ga0207640_102116302 177
734 3300025981 Ga0207640_10274683 Ga0207640_102746832 177
735 3300025986 Ga0207658_10000904 Ga0207658_1000090415 177
736 3300025986 Ga0207658_10025617 Ga0207658_100256175 177
737 3300025986 Ga0207658_10158931 Ga0207658_101589312 177
738 3300025986 Ga0207658_10289582 Ga0207658_102895822 177
739 3300025986 Ga0207658_10548540 Ga0207658_105485402 177
740 3300026023 Ga0207677_10054828 Ga0207677_100548282 177
741 3300026023 Ga0207677_10075708 Ga0207677_100757082 177
742 3300026023 Ga0207677_10089343 Ga0207677_100893432 177
743 3300026023 Ga0207677_10625621 Ga0207677_106256212 177
744 3300026035 Ga0207703_10009909 Ga0207703_100099097 177
745 3300026041 Ga0207639_10403733 Ga0207639_104037332 177
746 3300026067 Ga0207678_10000458 Ga0207678_1000045826 177
747 3300026067 Ga0207678_10022611 Ga0207678_100226114 177
748 3300026067 Ga0207678_10588794 Ga0207678_105887942 177
749 3300026075 Ga0207708_10023828 Ga0207708_100238283 177
750 3300026088 Ga0207641_10001982 Ga0207641_1000198211 177
751 3300026088 Ga0207641_10020017 Ga0207641_100200174 177
752 3300026089 Ga0207648_10002350 Ga0207648_100023505 177
753 3300026089 Ga0207648_10011629 Ga0207648_100116297 177
754 3300026089 Ga0207648_10017770 Ga0207648_100177702 177
755 3300026089 Ga0207648_10027125 Ga0207648_100271253 177
756 3300026089 Ga0207648_10035911 Ga0207648_100359112 177
757 3300026089 Ga0207648_10168093 Ga0207648_101680932 177
758 3300026089 Ga0207648_10588299 Ga0207648_105882992 177
759 3300026095 Ga0207676_10031295 Ga0207676_100312952 177
760 3300026095 Ga0207676_10042520 Ga0207676_100425202 177
761 3300026095 Ga0207676_10196763 Ga0207676_101967632 177
762 3300026095 Ga0207676_10278028 Ga0207676_102780282 177
763 3300026095 Ga0207676_10379405 Ga0207676_103794052 177
764 3300026116 Ga0207674_10420622 Ga0207674_104206222 177
765 3300026118 Ga0207675_100144609 Ga0207675_1001446093 177
766 3300026118 Ga0207675_100286865 Ga0207675_1002868652 177
767 3300026118 Ga0207675_100637240 Ga0207675_1006372402 177
768 3300026121 Ga0207683_10035749 Ga0207683_100357493 177
769 3300026121 Ga0207683_10053784 Ga0207683_100537844 177
770 3300026121 Ga0207683_10067351 Ga0207683_100673513 177
771 3300026121 Ga0207683_10122705 Ga0207683_101227052 177
772 3300026121 Ga0207683_10150801 Ga0207683_101508012 177
773 3300026121 Ga0207683_10207643 Ga0207683_102076433 177
774 3300026142 Ga0207698_10059494 Ga0207698_100594942 177
775 3300026142 Ga0207698_10059566 Ga0207698_100595662 177
776 3300026142 Ga0207698_10329869 Ga0207698_103298692 177
777 3300028379 Ga0268266_10035490 Ga0268266_100354902 177
778 3300028379 Ga0268266_10061938 Ga0268266_100619383 177
779 3300028379 Ga0268266_10294726 Ga0268266_102947261 177
780 3300028379 Ga0268266_10814288 Ga0268266_108142882 177
781 3300028380 Ga0268265_10202426 Ga0268265_102024262 177
782 3300028381 Ga0268264_10003895 Ga0268264_1000389510 177
783 3300028381 Ga0268264_10197332 Ga0268264_101973322 177
784 3300028786 Ga0307517_10004249 Ga0307517_100042495 177
785 3300028786 Ga0307517_10060587 Ga0307517_100605872 177
786 3300028786 Ga0307517_10214928 Ga0307517_102149282 177
787 3300028786 Ga0307517_10287749 Ga0307517_102877492 177
788 3300028794 Ga0307515_10000347 Ga0307515_1000034727 177
789 3300028794 Ga0307515_10001105 Ga0307515_1000110547 177
790 3300028794 Ga0307515_10002080 Ga0307515_100020802 177
791 3300028794 Ga0307515_10016105 Ga0307515_1001610511 177
792 3300028794 Ga0307515_10055358 Ga0307515_100553583 177
793 3300028794 Ga0307515_10069956 Ga0307515_100699562 177
794 3300028794 Ga0307515_10648512 Ga0307515_106485121 177
795 3300030521 Ga0307511_10233776 Ga0307511_102337762 177
796 3300030522 Ga0307512_10065289 Ga0307512_100652892 177
797 3300030522 Ga0307512_10148644 Ga0307512_101486442 177
798 3300031456 Ga0307513_10074096 Ga0307513_100740961 177
799 3300031456 Ga0307513_10074725 Ga0307513_100747252 177
800 3300031456 Ga0307513_10089596 Ga0307513_100895963 177
801 3300031456 Ga0307513_10111525 Ga0307513_101115253 177
802 3300031456 Ga0307513_10169671 Ga0307513_101696712 177
803 3300031456 Ga0307513_10362486 Ga0307513_103624862 177
804 3300031507 Ga0307509_10001361 Ga0307509_100013618 177
805 3300031507 Ga0307509_10010234 Ga0307509_100102348 177
806 3300031507 Ga0307509_10083130 Ga0307509_100831303 177
807 3300031507 Ga0307509_10135071 Ga0307509_101350712 177
808 3300031507 Ga0307509_10178311 Ga0307509_101783112 177
809 3300031507 Ga0307509_10257982 Ga0307509_102579822 177
810 3300031507 Ga0307509_10311736 Ga0307509_103117362 177
811 3300031548 Ga0307408_100033032 Ga0307408_1000330323 177
812 3300031548 Ga0307408_100239367 Ga0307408_1002393672 177
813 3300031616 Ga0307508_10000023 Ga0307508_1000002340 177
814 3300031616 Ga0307508_10035009 Ga0307508_100350095 177
815 3300031616 Ga0307508_10080654 Ga0307508_100806543 177
816 3300031649 Ga0307514_10002980 Ga0307514_1000298013 177
817 3300031649 Ga0307514_10028455 Ga0307514_100284556 177
818 3300031649 Ga0307514_10124924 Ga0307514_101249242 177
819 3300031649 Ga0307514_10340688 Ga0307514_103406881 177
820 3300031730 Ga0307516_10013210 Ga0307516_100132102 177
821 3300031730 Ga0307516_10019134 Ga0307516_100191345 177
822 3300031730 Ga0307516_10099929 Ga0307516_100999293 177
823 3300031730 Ga0307516_10165426 Ga0307516_101654262 177
824 3300031730 Ga0307516_10180438 Ga0307516_101804382 177
825 3300031731 Ga0307405_10032709 Ga0307405_100327092 177
826 3300031852 Ga0307410_10000671 Ga0307410_1000067112 177
827 3300031852 Ga0307410_10265588 Ga0307410_102655882 177
828 3300031901 Ga0307406_10013246 Ga0307406_100132462 177
829 3300031903 Ga0307407_10183932 Ga0307407_101839322 177
830 3300031911 Ga0307412_10150111 Ga0307412_101501113 177
831 3300032002 Ga0307416_100002710 Ga0307416_1000027107 177
832 3300032004 Ga0307414_10057246 Ga0307414_100572463 177
833 3300032004 Ga0307414_10720220 Ga0307414_107202202 177
834 3300032005 Ga0307411_10131550 Ga0307411_101315503 177
835 3300032126 Ga0307415_100224895 Ga0307415_1002248952 177
836 3300033179 Ga0307507_10169912 Ga0307507_101699122 177
837 3300033180 Ga0307510_10001484 Ga0307510_1000148414 177
838 3300033180 Ga0307510_10022280 Ga0307510_100222806 177
839 3300033180 Ga0307510_10104851 Ga0307510_101048512 177
840 3300033180 Ga0307510_10288733 Ga0307510_102887331 177
841 3300035170 Ga0373943_0138369 Ga0373943_0138369_505_1113 177
842 3300035410 Ga0373924_0342733 Ga0373924_0342733_28_636 177
843 3300035692 Ga0373935_0630148 Ga0373935_0630148_64_672 177
844 3300035695 Ga0373927_0215378 Ga0373927_0215378_643_1251 177
845 3300036401 Ga0373937_0068171 Ga0373937_0068171_2629_3237 177
846 3300036401 Ga0373937_0964849 Ga0373937_0964849_11_628 177
847 3300037068 Ga0373925_0208539 Ga0373925_0208539_714_1331 177
848 3300037068 Ga0373925_0404881 Ga0373925_0404881_144_752 177
849 3300037312 Ga0395899_0017956 Ga0395899_0017956_3902_4471 177
850 3300037418 Ga0395900_0056934 Ga0395900_0056934_3054_3623 177
851 3300037418 Ga0395900_0443378 Ga0395900_0443378_528_1097 177
852 3300037418 Ga0395900_0511723 Ga0395900_0511723_528_1097 177
853 3300037471 Ga0395905_0093908 Ga0395905_0093908_170_748 177
854 3300037471 Ga0395905_0294014 Ga0395905_0294014_130_699 177
855 3300038443 Ga0395901_0098131 Ga0395901_0098131_2479_3048 177
856 3300041501 Ga0451845_0394058 Ga0451845_0394058_130_738 177
857 3300041512 Ga0451853_1213795 Ga0451853_1213795_305_913 177
858 3300042135 Ga0450899_025886 Ga0450899_025886_50_619 177
859 3300042876 Ga0451577_0154121 Ga0451577_0154121_285_854 177
860 3300044735 Ga0466968_0098760 Ga0466968_0098760_613_1227 177
861 3300044842 Ga0466957_0124393 Ga0466957_0124393_764_1333 177
862 3300044842 Ga0466957_0526317 Ga0466957_0526317_29_595 177
863 3300045049 Ga0466959_0103594 Ga0466959_0103594_247_813 177
864 3300045049 Ga0466959_0344930 Ga0466959_0344930_31_651 177
865 3300045051 Ga0451576_0159444 Ga0451576_0159444_651_1220 177
866 3300046454 Ga0495592_0000495 Ga0495592_0000495_20335_20952 177
867 3300046454 Ga0495592_0400949 Ga0495592_0400949_214_822 177
868 3300046455 Ga0495603_0389379 Ga0495603_0389379_117_725 177
869 3300046457 Ga0495590_0001173 Ga0495590_0001173_1238_1810 177
870 3300046459 Ga0495629_0556838 Ga0495629_0556838_115_723 177
871 3300046460 Ga0495638_0040024 Ga0495638_0040024_1004_1621 177
872 3300046462 Ga0495651_0673394 Ga0495651_0673394_27_599 177
873 3300046463 Ga0495653_0035291 Ga0495653_0035291_2710_3282 177
874 3300046472 Ga0495580_0614608 Ga0495580_0614608_68_676 177
875 3300046473 Ga0495582_0200343 Ga0495582_0200343_351_968 177
876 3300046473 Ga0495582_0413651 Ga0495582_0413651_89_661 177
877 3300046475 Ga0495639_0063891 Ga0495639_0063891_833_1441 177
878 3300046491 Ga0495584_0012621 Ga0495584_0012621_2902_3474 177
879 3300046507 Ga0495606_0035152 Ga0495606_0035152_1035_1607 177
880 3300046512 Ga0495610_0065228 Ga0495610_0065228_669_1286 177
881 3300046516 Ga0495628_0386946 Ga0495628_0386946_368_940 177
882 3300046516 Ga0495628_0555003 Ga0495628_0555003_110_727 177
883 3300046517 Ga0495630_0389449 Ga0495630_0389449_174_746 177
884 3300046517 Ga0495630_0597093 Ga0495630_0597093_71_688 177
885 3300046519 Ga0495632_0043451 Ga0495632_0043451_453_1070 177
886 3300046522 Ga0495643_0038910 Ga0495643_0038910_1961_2569 177
887 3300046524 Ga0495648_0116953 Ga0495648_0116953_511_1122 177
888 3300046524 Ga0495648_0143650 Ga0495648_0143650_324_941 177
889 3300046528 Ga0495642_0126721 Ga0495642_0126721_312_929 177
890 3300046529 Ga0495652_0074591 Ga0495652_0074591_705_1277 177
891 3300046530 Ga0495654_0157225 Ga0495654_0157225_20_628 177
892 3300046531 Ga0495665_0036302 Ga0495665_0036302_138_710 177
893 3300046535 Ga0495586_0028974 Ga0495586_0028974_1806_2378 177
894 3300046539 Ga0495621_0045728 Ga0495621_0045728_257_865 177
895 3300046539 Ga0495621_0104122 Ga0495621_0104122_284_850 177
896 3300046539 Ga0495621_0188009 Ga0495621_0188009_49_657 177
897 3300046542 Ga0495597_0002647 Ga0495597_0002647_6866_7438 177
898 3300046543 Ga0495645_0111443 Ga0495645_0111443_1302_1874 177
899 3300046543 Ga0495645_0394373 Ga0495645_0394373_144_752 177
900 3300046616 Ga0495668_0021458 Ga0495668_0021458_852_1463 177
901 3300046616 Ga0495668_0212538 Ga0495668_0212538_10_627 177
902 3300046616 Ga0495668_0250847 Ga0495668_0250847_228_800 177
903 3300046660 Ga0495625_0001105 Ga0495625_0001105_2604_3212 177
904 3300046660 Ga0495625_0438235 Ga0495625_0438235_22_639 177
905 3300046663 Ga0495635_0160976 Ga0495635_0160976_842_1414 177
906 3300046678 Ga0495599_0248455 Ga0495599_0248455_418_990 177
907 3300046679 Ga0495623_0002817 Ga0495623_0002817_4386_4958 177
908 3300046681 Ga0495647_0010284 Ga0495647_0010284_2174_2782 177
909 3300046683 Ga0495658_0019071 Ga0495658_0019071_2361_2984 177
910 3300046683 Ga0495658_0086939 Ga0495658_0086939_1080_1688 177
911 3300046683 Ga0495658_0192379 Ga0495658_0192379_350_967 177
912 3300046683 Ga0495658_0425661 Ga0495658_0425661_57_665 177
913 3300046684 Ga0495669_0023054 Ga0495669_0023054_807_1379 177
914 3300046684 Ga0495669_0156332 Ga0495669_0156332_382_954 177
915 3300046690 Ga0495624_0056754 Ga0495624_0056754_593_1210 177
916 3300046690 Ga0495624_0104781 Ga0495624_0104781_482_1054 177
917 3300046691 Ga0495670_0065859 Ga0495670_0065859_809_1417 177
918 3300046692 Ga0495671_0020689 Ga0495671_0020689_876_1487 177
919 3300047317 Ga0495604_0052611 Ga0495604_0052611_2278_2850 177
920 3300047319 Ga0495674_0545441 Ga0495674_0545441_84_656 177
921 3300047321 Ga0495676_0015875 Ga0495676_0015875_2568_3185 177
922 3300047322 Ga0495680_0014284 Ga0495680_0014284_2244_2816 177
923 3300047323 Ga0495683_0003322 Ga0495683_0003322_6037_6609 177
924 3300047444 Ga0495675_0062194 Ga0495675_0062194_1443_2015 177
925 3300047444 Ga0495675_0152634 Ga0495675_0152634_163_735 177
926 3300047472 Ga0495686_0001863 Ga0495686_0001863_5103_5702 177
927 3300047472 Ga0495686_0182009 Ga0495686_0182009_29_637 177
928 3300047673 Ga0495593_0024457 Ga0495593_0024457_1938_2510 177
929 3300047673 Ga0495593_0035923 Ga0495593_0035923_1262_1834 177
930 3300047673 Ga0495593_0112648 Ga0495593_0112648_492_1109 177
931 3300048088 Ga0495602_0057269 Ga0495602_0057269_1590_2162 177
932 3300048903 Ga0496100_0044964 Ga0496100_0044964_1931_2503 177
933 3300048904 Ga0496101_0004607 Ga0496101_0004607_5982_6554 177
934 3300048904 Ga0496101_0339944 Ga0496101_0339944_332_949 177
935 3300048904 Ga0496101_0356684 Ga0496101_0356684_93_665 177
936 3300048905 Ga0496102_0010249 Ga0496102_0010249_4137_4736 177
937 3300048905 Ga0496102_0080150 Ga0496102_0080150_1555_2127 177
938 3300048905 Ga0496102_0172244 Ga0496102_0172244_151_759 177
939 3300048906 Ga0496103_0002171 Ga0496103_0002171_9869_10441 177
940 3300048907 Ga0496104_0155748 Ga0496104_0155748_1153_1725 177
941 3300048908 Ga0496105_0188458 Ga0496105_0188458_203_775 177
942 3300048908 Ga0496105_0604556 Ga0496105_0604556_40_612 177
943 3300048909 Ga0496106_0062545 Ga0496106_0062545_1487_2059 177
944 3300048909 Ga0496106_0065232 Ga0496106_0065232_1298_1906 177
945 3300048910 Ga0496107_0003373 Ga0496107_0003373_1285_1857 177
946 3300048911 Ga0496108_0431906 Ga0496108_0431906_70_642 177
947 3300048912 Ga0496109_0155391 Ga0496109_0155391_260_868 177
948 3300048912 Ga0496109_0197290 Ga0496109_0197290_1178_1750 177
949 3300048914 Ga0496111_0001327 Ga0496111_0001327_7269_7841 177
950 3300048915 Ga0496112_0466841 Ga0496112_0466841_464_1036 177
951 3300048916 Ga0496113_0024520 Ga0496113_0024520_2981_3553 177
952 3300048917 Ga0496114_0243045 Ga0496114_0243045_415_1023 177
953 3300048919 Ga0496116_0013099 Ga0496116_0013099_5262_5834 177
954 3300048920 Ga0496117_0033439 Ga0496117_0033439_833_1405 177
955 3300048922 Ga0496119_0102948 Ga0496119_0102948_443_1015 177
956 3300048923 Ga0496120_0123717 Ga0496120_0123717_574_1146 177
957 3300048924 Ga0496121_0013422 Ga0496121_0013422_4099_4671 177
958 3300048924 Ga0496121_0217818 Ga0496121_0217818_279_887 177
959 3300048925 Ga0496122_0013875 Ga0496122_0013875_6067_6639 177
960 3300048926 Ga0496123_0021967 Ga0496123_0021967_1853_2425 177
961 3300048927 Ga0496124_0010111 Ga0496124_0010111_613_1185 177
962 3300049459 Ga0495678_064357 Ga0495678_064357_762_1334 177
963 3300050492 nmdc:mga0yw44_396601_c1 nmdc:mga0yw44_396601_c1_13_585 177
964 3300050493 nmdc:mga0k408_1564_c1 nmdc:mga0k408_1564_c1_798_1418 177
965 3300050493 nmdc:mga0k408_42082_c1 nmdc:mga0k408_42082_c1_1068_1685 177
966 3300050494 nmdc:mga06z11_126989_c1 nmdc:mga06z11_126989_c1_589_1197 177
967 3300050496 nmdc:mga07m45_186925_c1 nmdc:mga07m45_186925_c1_134_742 177
968 3300050496 nmdc:mga07m45_390605_c1 nmdc:mga07m45_390605_c1_160_768 177
969 3300050496 nmdc:mga07m45_47080_c1 nmdc:mga07m45_47080_c1_17_634 177
970 3300053098 Ga0500650_0120701 Ga0500650_0120701_536_1153 177
971 3300053118 Ga0500594_0007947 Ga0500594_0007947_1126_1743 177
972 3300053134 Ga0500658_0019243 Ga0500658_0019243_858_1466 177
973 3300053136 Ga0500559_0001133 Ga0500559_0001133_2692_3309 177
974 3300053148 Ga0500590_015257 Ga0500590_015257_354_962 177
975 3300053154 Ga0500619_000054 Ga0500619_000054_11736_12335 177
976 3300053154 Ga0500619_004840 Ga0500619_004840_254_862 177
977 3300053155 Ga0500620_046921 Ga0500620_046921_467_1075 177
978 3300053739 Ga0500587_006581 Ga0500587_006581_104_712 177
979 iso_pu_bacteria 2643221654 2644303420 177
980 3300003322 rootL2_10285392 rootL2_102853922 178
981 3300005335 Ga0070666_10268319 Ga0070666_102683192 178
982 3300005343 Ga0070687_100177157 Ga0070687_1001771572 178
983 3300005353 Ga0070669_100096035 Ga0070669_1000960352 178
984 3300005366 Ga0070659_100332166 Ga0070659_1003321662 178
985 3300005367 Ga0070667_100006816 Ga0070667_1000068168 178
986 3300005539 Ga0068853_100391329 Ga0068853_1003913292 178
987 3300005543 Ga0070672_100048444 Ga0070672_1000484441 178
988 3300005617 Ga0068859_100053864 Ga0068859_1000538645 178
989 3300005842 Ga0068858_100006288 Ga0068858_1000062888 178
990 3300005843 Ga0068860_100049997 Ga0068860_1000499972 178
991 3300006195 Ga0075366_10203642 Ga0075366_102036422 178
992 3300006931 Ga0097620_100053863 Ga0097620_1000538635 178
993 3300009177 Ga0105248_10237055 Ga0105248_102370552 178
994 3300013308 Ga0157375_10043762 Ga0157375_100437624 178
995 3300014968 Ga0157379_10038696 Ga0157379_100386963 178
996 3300021384 Ga0213876_10119413 Ga0213876_101194132 178
997 3300025903 Ga0207680_10235920 Ga0207680_102359202 178
998 3300025918 Ga0207662_10084753 Ga0207662_100847532 178
999 3300025923 Ga0207681_10168567 Ga0207681_101685672 178
1000 3300025932 Ga0207690_10350906 Ga0207690_103509062 178
1001 3300025941 Ga0207711_10259114 Ga0207711_102591142 178
1002 3300026035 Ga0207703_10004545 Ga0207703_100045454 178
1003 3300026089 Ga0207648_10256291 Ga0207648_102562912 178
1004 3300028381 Ga0268264_10003117 Ga0268264_1000311714 178
1005 3300032168 Ga0316593_10000414 Ga0316593_100004144 178
1006 3300033524 Ga0316592_1083445 Ga0316592_10834451 178
1007 3300033541 Ga0316596_1000067 Ga0316596_100006710 178
1008 3300036712 Ga0316584_0532424 Ga0316584_0532424_189_746 178
1009 3300039437 Ga0436365_1158146 Ga0436365_1158146_2906_3517 178
1010 3300044658 Ga0466972_0003323 Ga0466972_0003323_2950_3507 178
1011 3300044683 Ga0466965_0000489 Ga0466965_0000489_13133_13690 178
1012 3300044706 Ga0466964_0002101 Ga0466964_0002101_1299_1856 178
1013 3300044706 Ga0466964_0040453 Ga0466964_0040453_1161_1718 178
1014 3300044712 Ga0453684_0064148 Ga0453684_0064148_3954_4580 178
1015 3300044735 Ga0466968_0019229 Ga0466968_0019229_904_1461 178
1016 3300044735 Ga0466968_0295889 Ga0466968_0295889_125_682 178
1017 3300044735 Ga0466968_0311059 Ga0466968_0311059_121_678 178
1018 3300045051 Ga0451576_1013033 Ga0451576_1013033_235_846 178
1019 3300046472 Ga0495580_0056837 Ga0495580_0056837_1680_2291 178
1020 3300050493 nmdc:mga0k408_246477_c1 nmdc:mga0k408_246477_c1_253_873 178
1021 3300028786 Ga0307517_10188580 Ga0307517_101885802 179
1022 3300030744 Ga0316181_1138066 Ga0316181_11380662 179
1023 3300031730 Ga0307516_10000045 Ga0307516_1000004571 179
1024 3300044842 Ga0466957_0020219 Ga0466957_0020219_295_855 179
1025 3300046525 Ga0495663_0005054 Ga0495663_0005054_1799_2353 179
1026 3300053137 Ga0500561_0027948 Ga0500561_0027948_202_825 179
1027 iso_pu_bacteria 2721755763 2723876415 179
1028 3300005293 Ga0065715_10166303 Ga0065715_101663031 180
1029 3300005458 Ga0070681_10763020 Ga0070681_107630202 180
1030 3300005471 Ga0070698_100079870 Ga0070698_1000798702 180
1031 3300009094 Ga0111539_10591810 Ga0111539_105918101 180
1032 3300013104 Ga0157370_10004672 Ga0157370_1000467210 180
1033 3300013104 Ga0157370_10049678 Ga0157370_100496782 180
1034 3300025250 Ga0209026_1004460 Ga0209026_10044604 180
1035 3300037312 Ga0395899_0001458 Ga0395899_0001458_731_1291 180
1036 3300037312 Ga0395899_0014962 Ga0395899_0014962_5271_5831 180
1037 3300037418 Ga0395900_0010138 Ga0395900_0010138_6480_7040 180
1038 3300037418 Ga0395900_0111797 Ga0395900_0111797_1548_2108 180
1039 3300037471 Ga0395905_0000589 Ga0395905_0000589_12133_12696 180
1040 3300037471 Ga0395905_0011379 Ga0395905_0011379_3444_4004 180
1041 3300038443 Ga0395901_0352205 Ga0395901_0352205_179_739 180
1042 3300044765 Ga0466970_0018403 Ga0466970_0018403_1852_2412 180
1043 3300045049 Ga0466959_0047561 Ga0466959_0047561_583_1143 180
1044 3300046457 Ga0495590_0000007 Ga0495590_0000007_41286_41846 180
1045 3300046458 Ga0495591_016927 Ga0495591_016927_804_1364 180
1046 3300046474 Ga0495605_0007136 Ga0495605_0007136_195_755 180
1047 3300046491 Ga0495584_0002713 Ga0495584_0002713_2727_3287 180
1048 3300046492 Ga0495585_0012863 Ga0495585_0012863_3731_4291 180
1049 3300046492 Ga0495585_0045420 Ga0495585_0045420_516_1076 180
1050 3300046500 Ga0495596_0002830 Ga0495596_0002830_4960_5520 180
1051 3300046501 Ga0495607_0003605 Ga0495607_0003605_6670_7230 180
1052 3300046501 Ga0495607_0057059 Ga0495607_0057059_1450_2010 180
1053 3300046506 Ga0495583_0002744 Ga0495583_0002744_11258_11818 180
1054 3300046506 Ga0495583_0016125 Ga0495583_0016125_2788_3348 180
1055 3300046506 Ga0495583_0027562 Ga0495583_0027562_726_1286 180
1056 3300046507 Ga0495606_0209924 Ga0495606_0209924_204_764 180
1057 3300046512 Ga0495610_0000583 Ga0495610_0000583_25971_26531 180
1058 3300046513 Ga0495616_0016448 Ga0495616_0016448_890_1450 180
1059 3300046513 Ga0495616_0063245 Ga0495616_0063245_800_1360 180
1060 3300046518 Ga0495631_0001383 Ga0495631_0001383_2934_3494 180
1061 3300046518 Ga0495631_0014780 Ga0495631_0014780_3116_3676 180
1062 3300046519 Ga0495632_0006665 Ga0495632_0006665_3720_4280 180
1063 3300046519 Ga0495632_0047781 Ga0495632_0047781_510_1070 180
1064 3300046520 Ga0495637_0000006 Ga0495637_0000006_293049_293609 180
1065 3300046522 Ga0495643_0015349 Ga0495643_0015349_1385_1945 180
1066 3300046522 Ga0495643_0166771 Ga0495643_0166771_201_761 180
1067 3300046524 Ga0495648_0012825 Ga0495648_0012825_101_661 180
1068 3300046524 Ga0495648_0030902 Ga0495648_0030902_1465_2025 180
1069 3300046528 Ga0495642_0010302 Ga0495642_0010302_800_1360 180
1070 3300046528 Ga0495642_0035367 Ga0495642_0035367_203_763 180
1071 3300046528 Ga0495642_0050668 Ga0495642_0050668_207_767 180
1072 3300046537 Ga0495598_0117729 Ga0495598_0117729_296_856 180
1073 3300046538 Ga0495609_0017111 Ga0495609_0017111_450_1010 180
1074 3300046538 Ga0495609_0024355 Ga0495609_0024355_1619_2179 180
1075 3300046558 Ga0495633_0007426 Ga0495633_0007426_1271_1831 180
1076 3300046615 Ga0495656_0074089 Ga0495656_0074089_109_669 180
1077 3300046616 Ga0495668_0098764 Ga0495668_0098764_351_911 180
1078 3300046648 Ga0495611_0001407 Ga0495611_0001407_8741_9301 180
1079 3300046648 Ga0495611_0011257 Ga0495611_0011257_1003_1563 180
1080 3300046660 Ga0495625_0124205 Ga0495625_0124205_959_1519 180
1081 3300046665 Ga0495661_0018647 Ga0495661_0018647_653_1213 180
1082 3300046665 Ga0495661_0040383 Ga0495661_0040383_591_1151 180
1083 3300046665 Ga0495661_0072068 Ga0495661_0072068_500_1060 180
1084 3300046691 Ga0495670_0019881 Ga0495670_0019881_767_1327 180
1085 3300046694 Ga0495649_0001583 Ga0495649_0001583_11322_11882 180
1086 3300046794 Ga0495589_0039507 Ga0495589_0039507_1049_1609 180
1087 3300046810 Ga0495660_0032918 Ga0495660_0032918_535_1095 180
1088 3300047318 Ga0495636_0048737 Ga0495636_0048737_1180_1740 180
1089 3300047318 Ga0495636_0317301 Ga0495636_0317301_146_706 180
1090 3300047320 Ga0495672_0000118 Ga0495672_0000118_46954_47514 180
1091 3300047320 Ga0495672_0048827 Ga0495672_0048827_1061_1621 180
1092 3300047443 Ga0495687_000166 Ga0495687_000166_55782_56342 180
1093 3300047445 Ga0495677_0001700 Ga0495677_0001700_5565_6125 180
1094 3300047445 Ga0495677_0139537 Ga0495677_0139537_151_711 180
1095 3300047446 Ga0495679_001920 Ga0495679_001920_859_1419 180
1096 3300047470 Ga0495681_0015148 Ga0495681_0015148_500_1060 180
1097 3300047472 Ga0495686_0003218 Ga0495686_0003218_2343_2903 180
1098 3300048091 Ga0495626_0004474 Ga0495626_0004474_4732_5292 180
1099 3300048906 Ga0496103_0065089 Ga0496103_0065089_571_1125 180
1100 3300048929 Ga0496126_0918858 Ga0496126_0918858_82_639 180
1101 3300049459 Ga0495678_000113 Ga0495678_000113_41161_41721 180
1102 3300049459 Ga0495678_052756 Ga0495678_052756_605_1165 180
1103 3300049460 Ga0495682_0024037 Ga0495682_0024037_810_1370 180
1104 3300049460 Ga0495682_0061653 Ga0495682_0061653_459_1019 180
1105 3300050511 nmdc:mga08y16_459834_c1 nmdc:mga08y16_459834_c1_588_1169 180
1106 iso_pu_bacteria 2858688981 2858692679 180
1107 3300006048 Ga0075363_100230892 Ga0075363_1002308922 181
1108 3300006195 Ga0075366_10083194 Ga0075366_100831942 181
1109 3300046474 Ga0495605_0060484 Ga0495605_0060484_804_1367 181
1110 3300046491 Ga0495584_0076567 Ga0495584_0076567_783_1346 181
1111 3300046500 Ga0495596_0013027 Ga0495596_0013027_2032_2595 181
1112 3300046507 Ga0495606_0002227 Ga0495606_0002227_7572_8135 181
1113 3300046518 Ga0495631_0044586 Ga0495631_0044586_1022_1585 181
1114 3300046616 Ga0495668_0025097 Ga0495668_0025097_925_1488 181
1115 3300046694 Ga0495649_0121427 Ga0495649_0121427_175_738 181
1116 3300046794 Ga0495589_0035270 Ga0495589_0035270_1577_2140 181
1117 3300047323 Ga0495683_0140221 Ga0495683_0140221_202_765 181
1118 3300048903 Ga0496100_0025801 Ga0496100_0025801_2815_3372 181
1119 3300050493 nmdc:mga0k408_150447_c1 nmdc:mga0k408_150447_c1_362_997 181
1120 3300025986 Ga0207658_10737848 Ga0207658_107378481 182
1121 3300046674 Ga0495588_0053875 Ga0495588_0053875_1234_1797 182
1122 3300003775 Ga0055524_1000029 Ga0055524_100002963 183
1123 3300005337 Ga0070682_100119355 Ga0070682_1001193552 183
1124 3300025263 Ga0209565_1008844 Ga0209565_10088442 183
1125 3300025299 Ga0209256_1000013 Ga0209256_1000013140 183
1126 3300037471 Ga0395905_0006561 Ga0395905_0006561_6261_6830 183
1127 iso_pu_bacteria 2513237150 2513954015 183
1128 iso_pu_bacteria 644736347 644746806 183
1129 3300003771 Ga0055526_1000526 Ga0055526_10005269 184
1130 3300046460 Ga0495638_0021407 Ga0495638_0021407_2993_3562 184
1131 3300046474 Ga0495605_0159944 Ga0495605_0159944_135_704 184
1132 3300046501 Ga0495607_0002447 Ga0495607_0002447_5002_5571 184
1133 3300046506 Ga0495583_0038999 Ga0495583_0038999_331_900 184
1134 3300046513 Ga0495616_0015635 Ga0495616_0015635_1012_1581 184
1135 3300046538 Ga0495609_0001477 Ga0495609_0001477_1048_1617 184
1136 3300046616 Ga0495668_0004131 Ga0495668_0004131_7983_8552 184
1137 3300046664 Ga0495659_0008842 Ga0495659_0008842_1837_2406 184
1138 3300046665 Ga0495661_0030072 Ga0495661_0030072_1136_1705 184
1139 3300046684 Ga0495669_0000597 Ga0495669_0000597_9874_10443 184
1140 3300046692 Ga0495671_0061381 Ga0495671_0061381_1071_1640 184
1141 3300046694 Ga0495649_0004743 Ga0495649_0004743_6143_6712 184
1142 3300046810 Ga0495660_0111133 Ga0495660_0111133_112_681 184
1143 3300047318 Ga0495636_0011053 Ga0495636_0011053_1907_2476 184
1144 3300047446 Ga0495679_014054 Ga0495679_014054_1509_2078 184
1145 3300047470 Ga0495681_0012047 Ga0495681_0012047_1707_2276 184
1146 3300048904 Ga0496101_0493517 Ga0496101_0493517_123_701 184
1147 3300048905 Ga0496102_0000425 Ga0496102_0000425_44612_45190 184
1148 3300048905 Ga0496102_0266147 Ga0496102_0266147_935_1513 184
1149 3300048906 Ga0496103_0057095 Ga0496103_0057095_1098_1676 184
1150 3300048907 Ga0496104_0624866 Ga0496104_0624866_349_927 184
1151 3300048919 Ga0496116_0014929 Ga0496116_0014929_927_1505 184
1152 3300031838 Ga0307518_10026365 Ga0307518_100263653 185
1153 3300046558 Ga0495633_0042129 Ga0495633_0042129_506_1090 185
1154 3300048917 Ga0496114_0007150 Ga0496114_0007150_5499_6083 185
1155 3300048928 Ga0496125_0002625 Ga0496125_0002625_14139_14723 185
1156 iso_pu_bacteria 2834641062 2834645434 185
1157 iso_pu_bacteria 2928115317 2928121194 185
1158 3300006946 Ga0079104_1004880 Ga0079104_10048802 186
1159 3300031901 Ga0307406_10296208 Ga0307406_102962081 186
1160 3300037471 Ga0395905_0011469 Ga0395905_0011469_5080_5673 186
1161 3300037471 Ga0395905_0151227 Ga0395905_0151227_1209_1802 186
1162 3300046528 Ga0495642_0050457 Ga0495642_0050457_265_861 186
1163 3300047443 Ga0495687_093389 Ga0495687_093389_23_619 186
1164 3300047472 Ga0495686_0025029 Ga0495686_0025029_3110_3724 186
1165 3300006948 Ga0099826_10000014 Ga0099826_10000014125 187
1166 3300009011 Ga0105251_10037988 Ga0105251_100379882 187
1167 3300025303 Ga0209051_1032132 Ga0209051_10321322 187
1168 3300027666 Ga0209282_1000046 Ga0209282_100004699 187
1169 3300046474 Ga0495605_0004593 Ga0495605_0004593_680_1276 187
1170 3300046500 Ga0495596_0007897 Ga0495596_0007897_3826_4422 187
1171 3300046501 Ga0495607_0018017 Ga0495607_0018017_410_1006 187
1172 3300046512 Ga0495610_0013836 Ga0495610_0013836_3683_4279 187
1173 3300046513 Ga0495616_0012802 Ga0495616_0012802_3693_4289 187
1174 3300046524 Ga0495648_0177411 Ga0495648_0177411_273_869 187
1175 3300046530 Ga0495654_0135295 Ga0495654_0135295_239_835 187
1176 3300046538 Ga0495609_0010243 Ga0495609_0010243_3586_4182 187
1177 3300046665 Ga0495661_0162470 Ga0495661_0162470_323_919 187
1178 3300046684 Ga0495669_0055160 Ga0495669_0055160_302_898 187
1179 3300046692 Ga0495671_0004937 Ga0495671_0004937_3526_4122 187
1180 3300047318 Ga0495636_0048126 Ga0495636_0048126_956_1543 187
1181 3300047320 Ga0495672_0020289 Ga0495672_0020289_3648_4244 187
1182 3300048919 Ga0496116_0019076 Ga0496116_0019076_117_713 187
1183 3300048924 Ga0496121_0032350 Ga0496121_0032350_3645_4241 187
1184 3300048925 Ga0496122_0028426 Ga0496122_0028426_3689_4285 187
1185 3300048926 Ga0496123_0060843 Ga0496123_0060843_452_1048 187
1186 3300048928 Ga0496125_0126401 Ga0496125_0126401_755_1351 187
1187 3300003187 JGI25151J46595_10015671 JGI25151J46595_100156712 188
1188 3300003322 rootL2_10258849 rootL2_102588492 188
1189 3300003771 Ga0055526_1015796 Ga0055526_10157961 188
1190 3300003771 Ga0055526_1025067 Ga0055526_10250672 188
1191 3300003781 Ga0055536_1000150 Ga0055536_100015044 188
1192 3300003784 Ga0055534_1007945 Ga0055534_10079452 188
1193 3300025263 Ga0209565_1006412 Ga0209565_10064123 188
1194 3300025291 Ga0209675_1000449 Ga0209675_100044910 188
1195 3300025292 Ga0209676_1000064 Ga0209676_1000064168 188
1196 3300025294 Ga0209025_1000690 Ga0209025_100069049 188
1197 3300025294 Ga0209025_1000746 Ga0209025_100074646 188
1198 3300025295 Ga0209564_1000891 Ga0209564_100089127 188
1199 3300025295 Ga0209564_1001109 Ga0209564_100110920 188
1200 3300025299 Ga0209256_1000193 Ga0209256_100019350 188
1201 3300025303 Ga0209051_1012476 Ga0209051_10124765 188
1202 iso_pu_bacteria 2513237165 2514040135 188
1203 iso_pu_bacteria 2596583598 2597030768 188
1204 iso_pu_bacteria 2599185178 2599446998 188
1205 iso_pu_bacteria 2885266251 2885268936 188
1206 iso_pu_bacteria 2900577576 2900579543 188
1207 iso_pu_bacteria 2900577576 2900582302 188
1208 iso_pu_bacteria 2928058823 2928061300 188
1209 3300003187 JGI25151J46595_10003399 JGI25151J46595_100033992 189
1210 3300003775 Ga0055524_1000300 Ga0055524_100030046 189
1211 3300003784 Ga0055534_1002058 Ga0055534_10020585 189
1212 3300025263 Ga0209565_1000045 Ga0209565_1000045102 189
1213 3300025291 Ga0209675_1000663 Ga0209675_10006637 189
1214 3300025294 Ga0209025_1000762 Ga0209025_100076220 189
1215 3300025294 Ga0209025_1001563 Ga0209025_100156319 189
1216 3300025294 Ga0209025_1069276 Ga0209025_10692762 189
1217 3300025295 Ga0209564_1000462 Ga0209564_100046265 189
1218 3300025297 Ga0209758_1027209 Ga0209758_10272092 189
1219 3300025299 Ga0209256_1000105 Ga0209256_100010571 189
1220 3300049571 Ga0501034_0000385 Ga0501034_0000385_66904_67506 189
1221 3300001979 JGI24740J21852_10000170 JGI24740J21852_1000017023 192
1222 3300001979 JGI24740J21852_10000394 JGI24740J21852_1000039418 192
1223 3300002705 JGI25156J39149_1009826 JGI25156J39149_10098262 192
1224 3300003751 Ga0055538_1007050 Ga0055538_10070502 192
1225 3300003751 Ga0055538_1007053 Ga0055538_10070532 192
1226 3300003752 Ga0055539_1000230 Ga0055539_10002307 192
1227 3300003752 Ga0055539_1000294 Ga0055539_10002947 192
1228 3300003756 Ga0055533_1007351 Ga0055533_10073512 192
1229 3300003756 Ga0055533_1007464 Ga0055533_10074641 192
1230 3300003758 Ga0055532_1000006 Ga0055532_1000006109 192
1231 3300003759 Ga0055525_1000414 Ga0055525_100041417 192
1232 3300003760 Ga0055527_1002364 Ga0055527_10023642 192
1233 3300003761 Ga0055535_1000004 Ga0055535_1000004109 192
1234 3300003762 Ga0055542_1001324 Ga0055542_100132410 192
1235 3300003763 Ga0055529_1000022 Ga0055529_1000022212 192
1236 3300003841 Ga0055541_1002414 Ga0055541_10024143 192
1237 3300003841 Ga0055541_1007377 Ga0055541_10073772 192
1238 3300003841 Ga0055541_1014989 Ga0055541_10149892 192
1239 3300005344 Ga0070661_100000012 Ga0070661_100000012160 192
1240 3300005366 Ga0070659_100042824 Ga0070659_1000428242 192
1241 3300005455 Ga0070663_100000020 Ga0070663_10000002018 192
1242 3300005564 Ga0070664_100000003 Ga0070664_100000003212 192
1243 3300005577 Ga0068857_100164971 Ga0068857_1001649712 192
1244 3300005578 Ga0068854_100000352 Ga0068854_10000035222 192
1245 3300005614 Ga0068856_100000011 Ga0068856_100000011111 192
1246 3300009093 Ga0105240_10063637 Ga0105240_100636375 192
1247 3300013102 Ga0157371_10000083 Ga0157371_10000083110 192
1248 3300013104 Ga0157370_10000141 Ga0157370_1000014150 192
1249 3300013105 Ga0157369_10003851 Ga0157369_100038512 192
1250 3300013307 Ga0157372_10000775 Ga0157372_100007757 192
1251 3300014497 Ga0182008_10205890 Ga0182008_102058902 192
1252 3300015261 Ga0182006_1001545 Ga0182006_10015456 192
1253 3300015262 Ga0182007_10003234 Ga0182007_100032345 192
1254 3300015265 Ga0182005_1100063 Ga0182005_11000632 192
1255 3300020077 Ga0206351_10502756 Ga0206351_1050275614 192
1256 3300020080 Ga0206350_10374774 Ga0206350_103747744 192
1257 3300020610 Ga0154015_1372279 Ga0154015_13722795 192
1258 3300025224 Ga0209784_100150 Ga0209784_10015023 192
1259 3300025224 Ga0209784_100517 Ga0209784_1005177 192
1260 3300025224 Ga0209784_100673 Ga0209784_1006736 192
1261 3300025224 Ga0209784_102726 Ga0209784_1027262 192
1262 3300025225 Ga0209566_100002 Ga0209566_100002961 192
1263 3300025225 Ga0209566_101174 Ga0209566_1011747 192
1264 3300025225 Ga0209566_102638 Ga0209566_1026382 192
1265 3300025226 Ga0209674_100010 Ga0209674_100010177 192
1266 3300025226 Ga0209674_100050 Ga0209674_100050112 192
1267 3300025226 Ga0209674_100248 Ga0209674_10024834 192
1268 3300025226 Ga0209674_109945 Ga0209674_1099451 192
1269 3300025228 Ga0209672_100218 Ga0209672_10021830 192
1270 3300025229 Ga0209147_100015 Ga0209147_100015434 192
1271 3300025230 Ga0209563_100004 Ga0209563_100004372 192
1272 3300025230 Ga0209563_100026 Ga0209563_100026377 192
1273 3300025230 Ga0209563_114570 Ga0209563_1145701 192
1274 3300025242 Ga0209258_100021 Ga0209258_100021434 192
1275 3300025246 Ga0209646_1000055 Ga0209646_1000055271 192
1276 3300025250 Ga0209026_1007223 Ga0209026_10072233 192
1277 3300025253 Ga0209677_100007 Ga0209677_100007960 192
1278 3300025253 Ga0209677_104511 Ga0209677_1045112 192
1279 3300025254 Ga0209148_1000109 Ga0209148_100010933 192
1280 3300025254 Ga0209148_1003918 Ga0209148_10039183 192
1281 3300025256 Ga0209759_1002759 Ga0209759_10027593 192
1282 3300025256 Ga0209759_1003327 Ga0209759_10033275 192
1283 3300025256 Ga0209759_1036187 Ga0209759_10361872 192
1284 3300025272 Ga0209455_1000028 Ga0209455_1000028434 192
1285 3300025913 Ga0207695_10032508 Ga0207695_100325086 192
1286 3300025920 Ga0207649_10000302 Ga0207649_1000030234 192
1287 3300025932 Ga0207690_10027687 Ga0207690_100276872 192
1288 3300025945 Ga0207679_10000007 Ga0207679_100000077 192
1289 3300025981 Ga0207640_10000255 Ga0207640_100002556 192
1290 3300026067 Ga0207678_10000030 Ga0207678_1000003018 192
1291 3300026078 Ga0207702_10000054 Ga0207702_1000005452 192
1292 3300026116 Ga0207674_10027431 Ga0207674_100274315 192
1293 3300026142 Ga0207698_10249519 Ga0207698_102495191 192
1294 3300037312 Ga0395899_0097580 Ga0395899_0097580_266_844 192
1295 3300037466 Ga0395898_0460454 Ga0395898_0460454_544_1122 192
1296 3300044656 Ga0466969_0034399 Ga0466969_0034399_832_1410 192
1297 3300044658 Ga0466972_0029231 Ga0466972_0029231_1106_1684 192
1298 3300044672 Ga0466982_0059055 Ga0466982_0059055_1169_1747 192
1299 3300044693 Ga0466961_0000499 Ga0466961_0000499_6075_6653 192
1300 3300044706 Ga0466964_0001971 Ga0466964_0001971_709_1287 192
1301 3300044735 Ga0466968_0162729 Ga0466968_0162729_108_686 192
1302 3300044765 Ga0466970_0023541 Ga0466970_0023541_692_1270 192
1303 3300044842 Ga0466957_0011423 Ga0466957_0011423_2799_3377 192
1304 3300045049 Ga0466959_0061189 Ga0466959_0061189_506_1084 192
1305 3300045976 Ga0466967_0059649 Ga0466967_0059649_1957_2535 192
1306 3300048928 Ga0496125_0260056 Ga0496125_0260056_292_870 192
1307 3300061719 Ga0466962_0085992 Ga0466962_0085992_47_625 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

33

159

0.83

PF08645

PNK3P

Polynucleotide kinase 3 phosphatase

23

152

0.81

PF13242

Hydrolase_like

HAD-hyrolase-like

119

197

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9958 6 181
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9737 6 181
4pnh-assembly1.cif.gz_A crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis 0.9309 6 181
4pnh-assembly1.cif.gz_A crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis 0.9137 6 181
2fpx-assembly1.cif.gz_A crystal structure of the n-terminal domain of e.coli hisb- sulfate complex. 0.8825 5 143
ID Description Score Start End Superfamily
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9918 6 181 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9749 6 181 3.40.50.1000
4jyrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9307 6 181 3.40.50.1000
4jyrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9136 6 181 3.40.50.1000
af_P9WMV3_2_164_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8698 2 170 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3D2R1F9-F1-model_v4 D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase 1.006 6 94 GO:0005975
GO:0016791
AF-A0A1G5TH41-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 1.001 6 179 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A3D1J0Y8-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 1.001 6 166 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A1J4YMS1-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 1 6 179 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A2M7J2C6-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 1 6 179 GO:0005737
GO:0005975
GO:0016791
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.19 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map