F492766
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1301 | 725 | 1031 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300048926|Ga0496123_0153197|Ga0496123_0153197_258_980 |
| Length | 240 |
| Sequence | MPVLPGSLTVPGASSLTGPGRHCLQNSTHYFMTYHYEMHGEEIYRQSFRIIRSEADLARFTPLEERVACRMIHAAGMVSLAQDIHFSADFAQAAEAALQRGAPILCDARMVSEGITRKRLPADNAIICTLQDARTPGLAQAMGNTRSAAALELWREHLDGAVVAIGNAPTALFHLLNMLEDPACPRPAAIIGCPVGFVGAAESKDALRAWGQIPFAIVQGRLGGSAITVAAVNALATAVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 3 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 4 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 5 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 6 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 9 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 10 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 11 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 12 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 13 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 14 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 15 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 16 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 17 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 18 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 19 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 20 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 21 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 22 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 23 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 24 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 25 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 26 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 27 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 28 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 29 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 30 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 31 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 32 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 33 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 34 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 35 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 36 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 37 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 38 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 39 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 40 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 41 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 42 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 43 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 44 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 45 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 46 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 47 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 48 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 49 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 50 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 51 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 52 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 53 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 54 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 55 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 56 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 57 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 58 | 2791355199 | |||
| 59 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 60 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 61 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 62 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 63 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 64 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 65 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 66 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 67 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 68 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 69 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 70 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 71 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 72 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 73 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 74 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 75 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 76 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 77 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 78 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 79 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 80 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 81 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 82 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 83 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 84 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 85 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 86 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 87 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 88 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 89 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 90 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 91 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 92 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 93 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 94 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 95 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 96 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 97 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 98 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 99 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 100 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 101 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 102 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 103 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 104 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 105 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 106 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 107 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 108 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 109 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 110 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 111 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 112 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 113 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 114 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 115 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 116 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 117 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 118 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 119 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 120 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 121 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 122 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 123 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 124 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 125 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 126 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 127 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 128 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 129 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 130 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 131 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 132 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 133 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 134 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 135 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 136 | 2904699407 | |||
| 137 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 138 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 139 | 2906610324 | |||
| 140 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 141 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 142 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 143 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 144 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 145 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 146 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 147 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 148 | 2922368715 | |||
| 149 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 150 | 2922425934 | |||
| 151 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 152 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 153 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 154 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 155 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 156 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 157 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 158 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 159 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 160 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 161 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 162 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 163 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 164 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 165 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 166 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 167 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 168 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 169 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 170 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 171 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 172 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 173 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 174 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 175 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 176 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 177 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 178 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 179 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 180 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 181 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 182 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 183 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 184 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 185 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 186 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 187 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 188 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 189 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 190 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 191 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 192 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 193 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 194 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 195 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 196 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 197 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 198 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 199 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 200 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 201 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 202 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 203 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 204 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 205 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 206 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 207 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 208 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 209 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 210 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 211 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 212 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 213 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 214 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 215 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 216 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 217 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 218 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 219 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 220 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 221 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 222 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 223 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 224 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 225 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 226 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 227 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 228 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 229 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 230 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 231 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 232 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 233 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 234 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 235 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 236 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 237 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 238 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 239 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 240 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 241 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 242 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 243 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 244 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 245 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 246 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 247 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 248 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 250 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 252 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 254 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 256 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 262 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 264 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 265 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 271 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 272 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 273 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 274 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 275 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 276 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 277 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 279 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 280 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 282 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 283 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 284 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 285 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 286 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 287 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 288 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 289 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 290 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 291 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 292 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 293 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 294 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 295 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 297 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 298 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 299 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 300 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 301 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 302 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 303 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 304 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 305 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 306 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 307 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 309 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 310 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 311 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 312 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 314 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 315 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 316 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 317 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 318 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 319 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 330 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 331 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 343 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 344 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 347 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 348 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 349 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 351 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 352 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 353 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 354 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 355 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 356 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 358 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 363 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 364 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 365 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 366 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 421 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 422 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 423 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 424 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 425 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 427 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 431 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 432 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 433 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 434 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 435 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 436 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 437 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 438 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 439 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 440 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 441 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 442 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 443 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 444 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 445 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 446 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 447 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 448 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 449 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 450 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 451 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 452 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 453 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 454 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 455 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 456 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 457 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 458 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 459 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 460 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 461 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 462 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 463 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 464 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 465 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 466 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 467 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 468 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 469 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 470 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 471 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 472 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 473 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 474 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 475 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 476 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 477 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 478 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 479 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 480 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 481 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 482 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 483 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 484 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 485 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 486 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 487 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 488 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 489 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 490 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 491 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 492 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 493 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 494 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 495 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 496 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 497 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 498 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 571 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 572 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 573 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 574 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 575 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 576 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 577 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 578 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 579 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 580 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 581 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 582 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 583 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 584 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 585 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 586 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 587 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 588 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 589 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 590 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 591 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 592 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 593 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 594 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 595 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 596 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 597 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 607 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 608 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 610 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 611 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 612 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 613 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 614 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 615 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 616 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 617 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 618 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 619 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 621 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 622 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 623 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 624 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 625 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 626 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 627 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 628 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 629 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 630 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 631 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 632 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 635 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 636 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 639 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 640 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 641 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 642 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 643 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 644 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 645 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 646 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 647 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 648 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 649 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 650 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 651 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 652 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 653 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 654 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 655 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 656 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 657 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 658 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 659 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 660 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 661 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 662 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 663 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 664 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 665 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 666 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 667 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 668 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 669 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 670 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 671 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 672 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 673 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 674 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 675 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 676 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 677 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 678 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 679 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 680 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 681 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 682 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 683 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 684 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 685 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 686 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 687 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 688 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 689 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 690 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 691 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 692 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 693 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 694 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 695 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 696 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 697 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 698 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 699 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 700 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 701 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 702 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 703 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 704 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 705 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 706 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 707 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 708 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 709 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 710 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 711 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 712 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 713 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 714 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 715 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 716 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 717 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 718 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 719 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 720 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 721 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 722 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 723 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 724 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 725 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.09 |
| Metatranscriptomes | 0.46 |
| Isolates | 20.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 14.37 |
| Nodule | 13.76 |
| Rhizoplane | 5.69 |
| Rhizosphere | 51.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_891765 | 2162886007 | Bacteria | 4489 |
| 2 | JGI24741J21665_1001372 | 3300001915 | Bacteria | 7032 |
| 3 | JGI24740J21852_10001088 | 3300001979 | Bacteria | 12273 |
| 4 | JGI24739J22299_10004944 | 3300001989 | Bacteria | 5076 |
| 5 | JGI24737J22298_10001478 | 3300001990 | Bacteria | 8373 |
| 6 | JGI24735J21928_10003371 | 3300002067 | Bacteria | 5452 |
| 7 | JGI24738J21930_10002858 | 3300002075 | Bacteria | 4427 |
| 8 | JGI25153J46596_10015897 | 3300003215 | Bacteria | 3041 |
| 9 | JGI25160J50197_1000991 | 3300003354 | Bacteria | 14757 |
| 10 | Ga0006562J51391_1080078 | 3300003578 | Bacteria | 1011 |
| 11 | Ga0055524_1031628 | 3300003775 | Bacteria | 1517 |
| 12 | Ga0055528_1042532 | 3300003790 | Bacteria | 999 |
| 13 | Ga0055531_10007448 | 3300003794 | Bacteria | 5972 |
| 14 | Ga0055543_1010842 | 3300004625 | Bacteria | 1893 |
| 15 | Ga0065165_1000420 | 3300005262 | Bacteria | 66966 |
| 16 | Ga0065165_1000556 | 3300005262 | Bacteria | 55512 |
| 17 | Ga0065165_1002861 | 3300005262 | Bacteria | 13344 |
| 18 | Ga0065165_1018469 | 3300005262 | Bacteria | 2522 |
| 19 | Ga0065165_1022530 | 3300005262 | Bacteria | 2157 |
| 20 | Ga0065714_10004054 | 3300005288 | Bacteria | 6658 |
| 21 | Ga0065704_10073969 | 3300005289 | Bacteria | 6631 |
| 22 | Ga0065704_10098518 | 3300005289 | Bacteria | 2350 |
| 23 | Ga0070658_10011650 | 3300005327 | Bacteria | 7052 |
| 24 | Ga0070683_100214615 | 3300005329 | Bacteria | 1828 |
| 25 | Ga0070670_100158239 | 3300005331 | Bacteria | 1963 |
| 26 | Ga0068869_100011273 | 3300005334 | Bacteria | 5856 |
| 27 | Ga0068869_100505077 | 3300005334 | Bacteria | 1010 |
| 28 | Ga0070666_10630426 | 3300005335 | Bacteria | 783 |
| 29 | Ga0070680_100127183 | 3300005336 | Bacteria | 2129 |
| 30 | Ga0070680_100144897 | 3300005336 | Bacteria | 1993 |
| 31 | Ga0070660_100108655 | 3300005339 | Bacteria | 2205 |
| 32 | Ga0070687_100771303 | 3300005343 | Bacteria | 678 |
| 33 | Ga0070668_100000159 | 3300005347 | Bacteria | 42625 |
| 34 | Ga0070668_100012970 | 3300005347 | Bacteria | 6205 |
| 35 | Ga0070668_100042914 | 3300005347 | Bacteria | 3466 |
| 36 | Ga0070668_100060893 | 3300005347 | Bacteria | 2924 |
| 37 | Ga0070668_100070156 | 3300005347 | Bacteria | 2727 |
| 38 | Ga0070669_100000502 | 3300005353 | Bacteria | 29455 |
| 39 | Ga0070669_100008694 | 3300005353 | Bacteria | 7243 |
| 40 | Ga0070669_100047738 | 3300005353 | Bacteria | 3124 |
| 41 | Ga0070669_100431815 | 3300005353 | Bacteria | 1083 |
| 42 | Ga0070671_100072841 | 3300005355 | Bacteria | 2869 |
| 43 | Ga0070671_100093311 | 3300005355 | Bacteria | 2523 |
| 44 | Ga0070659_100101177 | 3300005366 | Bacteria | 2320 |
| 45 | Ga0070659_100225312 | 3300005366 | Bacteria | 1548 |
| 46 | Ga0070667_100000120 | 3300005367 | Bacteria | 99936 |
| 47 | Ga0070667_100028009 | 3300005367 | Bacteria | 4689 |
| 48 | Ga0070667_100185115 | 3300005367 | Bacteria | 1843 |
| 49 | Ga0070667_100272476 | 3300005367 | Bacteria | 1518 |
| 50 | Ga0070709_10000412 | 3300005434 | Bacteria | 26060 |
| 51 | Ga0070709_10024335 | 3300005434 | Bacteria | 3563 |
| 52 | Ga0070709_10048056 | 3300005434 | Bacteria | 2661 |
| 53 | Ga0070709_10124190 | 3300005434 | Bacteria | 1754 |
| 54 | Ga0070714_100002292 | 3300005435 | Bacteria | 14079 |
| 55 | Ga0070714_100011447 | 3300005435 | Bacteria | 7037 |
| 56 | Ga0070714_100034015 | 3300005435 | Bacteria | 4267 |
| 57 | Ga0070714_100036225 | 3300005435 | Bacteria | 4137 |
| 58 | Ga0070714_100362590 | 3300005435 | Bacteria | 1363 |
| 59 | Ga0070713_100000950 | 3300005436 | Bacteria | 18532 |
| 60 | Ga0070713_100064714 | 3300005436 | Bacteria | 3070 |
| 61 | Ga0070713_100230108 | 3300005436 | Bacteria | 1685 |
| 62 | Ga0070713_100386640 | 3300005436 | Bacteria | 1304 |
| 63 | Ga0070713_100506776 | 3300005436 | Bacteria | 1139 |
| 64 | Ga0070710_10012033 | 3300005437 | Bacteria | 4290 |
| 65 | Ga0070710_10016226 | 3300005437 | Bacteria | 3786 |
| 66 | Ga0070710_10068077 | 3300005437 | Bacteria | 2045 |
| 67 | Ga0070710_10181543 | 3300005437 | Bacteria | 1318 |
| 68 | Ga0070710_10285744 | 3300005437 | Bacteria | 1072 |
| 69 | Ga0070711_100035424 | 3300005439 | Bacteria | 3337 |
| 70 | Ga0070711_100068759 | 3300005439 | Bacteria | 2490 |
| 71 | Ga0070711_100093251 | 3300005439 | Bacteria | 2174 |
| 72 | Ga0070711_100199402 | 3300005439 | Bacteria | 1543 |
| 73 | Ga0070705_100130127 | 3300005440 | Bacteria | 1640 |
| 74 | Ga0070663_100003672 | 3300005455 | Bacteria | 8894 |
| 75 | Ga0070678_100015171 | 3300005456 | Bacteria | 4889 |
| 76 | Ga0070662_100021506 | 3300005457 | Bacteria | 4405 |
| 77 | Ga0070662_100210093 | 3300005457 | Bacteria | 1548 |
| 78 | Ga0070681_10351005 | 3300005458 | Bacteria | 1385 |
| 79 | Ga0068867_100119352 | 3300005459 | Bacteria | 2036 |
| 80 | Ga0070706_100111923 | 3300005467 | Bacteria | 2541 |
| 81 | Ga0070679_100005105 | 3300005530 | Bacteria | 12131 |
| 82 | Ga0070684_100012778 | 3300005535 | Bacteria | 6744 |
| 83 | Ga0070684_100119046 | 3300005535 | Bacteria | 2374 |
| 84 | Ga0070697_100259244 | 3300005536 | Bacteria | 1488 |
| 85 | Ga0068853_100001299 | 3300005539 | Bacteria | 17940 |
| 86 | Ga0068853_100117771 | 3300005539 | Bacteria | 2366 |
| 87 | Ga0068853_100312689 | 3300005539 | Bacteria | 1455 |
| 88 | Ga0068853_100545458 | 3300005539 | Bacteria | 1098 |
| 89 | Ga0070665_100018399 | 3300005548 | Bacteria | 7002 |
| 90 | Ga0070704_100877963 | 3300005549 | Bacteria | 805 |
| 91 | Ga0068855_100093490 | 3300005563 | Bacteria | 3467 |
| 92 | Ga0068855_100514454 | 3300005563 | Bacteria | 1299 |
| 93 | Ga0070664_100100367 | 3300005564 | Bacteria | 2516 |
| 94 | Ga0068857_100068885 | 3300005577 | Bacteria | 3150 |
| 95 | Ga0068857_100074848 | 3300005577 | Bacteria | 3018 |
| 96 | Ga0068857_100148499 | 3300005577 | Bacteria | 2122 |
| 97 | Ga0068857_100622773 | 3300005577 | Bacteria | 1021 |
| 98 | Ga0068856_100004372 | 3300005614 | Bacteria | 14081 |
| 99 | Ga0068856_100085631 | 3300005614 | Bacteria | 3131 |
| 100 | Ga0068856_100189219 | 3300005614 | Bacteria | 2072 |
| 101 | Ga0068856_100770256 | 3300005614 | Bacteria | 982 |
| 102 | Ga0068852_100147625 | 3300005616 | Bacteria | 2183 |
| 103 | Ga0068852_100260037 | 3300005616 | Bacteria | 1666 |
| 104 | Ga0068859_100422237 | 3300005617 | Bacteria | 1430 |
| 105 | Ga0068859_100436313 | 3300005617 | Bacteria | 1406 |
| 106 | Ga0068859_100855479 | 3300005617 | Bacteria | 995 |
| 107 | Ga0068864_100287620 | 3300005618 | Bacteria | 1536 |
| 108 | Ga0068861_100919204 | 3300005719 | Bacteria | 830 |
| 109 | Ga0068851_10454633 | 3300005834 | Bacteria | 761 |
| 110 | Ga0068870_10070566 | 3300005840 | Bacteria | 1904 |
| 111 | Ga0068863_100000053 | 3300005841 | Bacteria | 125195 |
| 112 | Ga0068863_100042120 | 3300005841 | Bacteria | 4339 |
| 113 | Ga0068863_100043176 | 3300005841 | Bacteria | 4280 |
| 114 | Ga0068858_100066232 | 3300005842 | Bacteria | 3343 |
| 115 | Ga0068858_100273482 | 3300005842 | Bacteria | 1608 |
| 116 | Ga0068860_100000312 | 3300005843 | Bacteria | 66724 |
| 117 | Ga0068860_100003099 | 3300005843 | Bacteria | 17183 |
| 118 | Ga0068860_100013340 | 3300005843 | Bacteria | 8057 |
| 119 | Ga0068860_100081169 | 3300005843 | Bacteria | 3084 |
| 120 | Ga0068862_100000778 | 3300005844 | Bacteria | 31642 |
| 121 | Ga0068862_100084813 | 3300005844 | Bacteria | 2752 |
| 122 | Ga0068862_100235116 | 3300005844 | Bacteria | 1664 |
| 123 | Ga0068862_100444166 | 3300005844 | Bacteria | 1221 |
| 124 | Ga0068862_100722151 | 3300005844 | Bacteria | 967 |
| 125 | Ga0068862_100745364 | 3300005844 | Bacteria | 952 |
| 126 | Ga0081538_10022343 | 3300005981 | Bacteria | 4585 |
| 127 | Ga0081540_1006288 | 3300005983 | Bacteria | 8692 |
| 128 | Ga0081540_1011114 | 3300005983 | Bacteria | 6043 |
| 129 | Ga0081540_1052167 | 3300005983 | Bacteria | 2016 |
| 130 | Ga0081540_1062715 | 3300005983 | Bacteria | 1763 |
| 131 | Ga0070717_10007581 | 3300006028 | Bacteria | 8064 |
| 132 | Ga0070717_10009339 | 3300006028 | Bacteria | 7369 |
| 133 | Ga0070717_10240356 | 3300006028 | Bacteria | 1597 |
| 134 | Ga0075365_10043348 | 3300006038 | Bacteria | 2945 |
| 135 | Ga0075365_10051078 | 3300006038 | Bacteria | 2729 |
| 136 | Ga0075365_10082334 | 3300006038 | Bacteria | 2182 |
| 137 | Ga0075365_10100633 | 3300006038 | Bacteria | 1978 |
| 138 | Ga0075365_10118731 | 3300006038 | Bacteria | 1823 |
| 139 | Ga0075365_10218650 | 3300006038 | Bacteria | 1336 |
| 140 | Ga0075368_10000747 | 3300006042 | Bacteria | 9970 |
| 141 | Ga0075368_10002064 | 3300006042 | Bacteria | 6498 |
| 142 | Ga0075363_100002734 | 3300006048 | Bacteria | 7301 |
| 143 | Ga0075363_100019180 | 3300006048 | Bacteria | 3416 |
| 144 | Ga0075363_100134951 | 3300006048 | Bacteria | 1386 |
| 145 | Ga0075363_100190554 | 3300006048 | Bacteria | 1169 |
| 146 | Ga0075364_10009420 | 3300006051 | Bacteria | 5859 |
| 147 | Ga0075364_10014814 | 3300006051 | Bacteria | 4824 |
| 148 | Ga0075364_10015455 | 3300006051 | Bacteria | 4735 |
| 149 | Ga0075364_10049523 | 3300006051 | Bacteria | 2741 |
| 150 | Ga0075364_10089644 | 3300006051 | Bacteria | 2040 |
| 151 | Ga0075364_10119747 | 3300006051 | Bacteria | 1762 |
| 152 | Ga0075364_10122661 | 3300006051 | Bacteria | 1740 |
| 153 | Ga0075364_10129192 | 3300006051 | Bacteria | 1695 |
| 154 | Ga0075432_10000947 | 3300006058 | Bacteria | 9146 |
| 155 | Ga0070715_10001792 | 3300006163 | Bacteria | 6397 |
| 156 | Ga0070716_100001697 | 3300006173 | Bacteria | 9938 |
| 157 | Ga0070716_100065483 | 3300006173 | Bacteria | 2117 |
| 158 | Ga0070716_100192081 | 3300006173 | Bacteria | 1350 |
| 159 | Ga0070716_100526128 | 3300006173 | Bacteria | 877 |
| 160 | Ga0070712_100014502 | 3300006175 | Bacteria | 5057 |
| 161 | Ga0070712_100105643 | 3300006175 | Bacteria | 2092 |
| 162 | Ga0070712_100147941 | 3300006175 | Bacteria | 1800 |
| 163 | Ga0075367_10001262 | 3300006178 | Bacteria | 10667 |
| 164 | Ga0075367_10008575 | 3300006178 | Bacteria | 5303 |
| 165 | Ga0075367_10206064 | 3300006178 | Bacteria | 1229 |
| 166 | Ga0075367_10402848 | 3300006178 | Bacteria | 865 |
| 167 | Ga0075367_10549079 | 3300006178 | Bacteria | 734 |
| 168 | Ga0075369_10210616 | 3300006186 | Bacteria | 898 |
| 169 | Ga0075366_10004909 | 3300006195 | Bacteria | 7216 |
| 170 | Ga0075366_10005300 | 3300006195 | Bacteria | 6984 |
| 171 | Ga0075366_10148824 | 3300006195 | Bacteria | 1417 |
| 172 | Ga0097621_100089721 | 3300006237 | Bacteria | 2571 |
| 173 | Ga0075370_10001829 | 3300006353 | Bacteria | 9519 |
| 174 | Ga0075370_10143708 | 3300006353 | Bacteria | 1395 |
| 175 | Ga0075370_10193655 | 3300006353 | Bacteria | 1198 |
| 176 | Ga0075370_10258972 | 3300006353 | Bacteria | 1031 |
| 177 | Ga0068871_100255625 | 3300006358 | Bacteria | 1527 |
| 178 | Ga0075434_100065071 | 3300006871 | Bacteria | 3631 |
| 179 | Ga0075434_100120336 | 3300006871 | Bacteria | 2640 |
| 180 | Ga0075436_100060838 | 3300006914 | Bacteria | 2609 |
| 181 | Ga0097620_100422246 | 3300006931 | Bacteria | 1430 |
| 182 | Ga0097620_100436292 | 3300006931 | Bacteria | 1406 |
| 183 | Ga0097620_100855369 | 3300006931 | Bacteria | 995 |
| 184 | Ga0099825_1025128 | 3300006941 | Bacteria | 3365 |
| 185 | Ga0099824_1004605 | 3300006942 | Bacteria | 19784 |
| 186 | Ga0099824_1005450 | 3300006942 | Bacteria | 17919 |
| 187 | Ga0099822_1000031 | 3300006943 | Bacteria | 62575 |
| 188 | Ga0099823_1045510 | 3300006944 | Bacteria | 2922 |
| 189 | Ga0079104_1000167 | 3300006946 | Bacteria | 93750 |
| 190 | Ga0079104_1003511 | 3300006946 | Bacteria | 7236 |
| 191 | Ga0099795_10002064 | 3300007788 | Bacteria | 4610 |
| 192 | Ga0099795_10266265 | 3300007788 | Bacteria | 744 |
| 193 | Ga0105250_10000496 | 3300009092 | Bacteria | 27651 |
| 194 | Ga0105250_10070463 | 3300009092 | Bacteria | 1412 |
| 195 | Ga0105250_10269204 | 3300009092 | Bacteria | 731 |
| 196 | Ga0105240_10224017 | 3300009093 | Bacteria | 2189 |
| 197 | Ga0105240_10236670 | 3300009093 | Bacteria | 2119 |
| 198 | Ga0105240_10597280 | 3300009093 | Bacteria | 1216 |
| 199 | Ga0105240_10705407 | 3300009093 | Bacteria | 1101 |
| 200 | Ga0105245_10029674 | 3300009098 | Bacteria | 4834 |
| 201 | Ga0105245_10843520 | 3300009098 | Bacteria | 956 |
| 202 | Ga0105245_11126191 | 3300009098 | Bacteria | 831 |
| 203 | Ga0105247_10005744 | 3300009101 | Bacteria | 7768 |
| 204 | Ga0105247_10016235 | 3300009101 | Bacteria | 4460 |
| 205 | Ga0105247_10132234 | 3300009101 | Bacteria | 1627 |
| 206 | Ga0105247_10542970 | 3300009101 | Bacteria | 853 |
| 207 | Ga0105243_10099559 | 3300009148 | Bacteria | 2410 |
| 208 | Ga0105243_10124058 | 3300009148 | Bacteria | 2182 |
| 209 | Ga0105243_11522682 | 3300009148 | Bacteria | 693 |
| 210 | Ga0105241_10018413 | 3300009174 | Bacteria | 5138 |
| 211 | Ga0105241_10037419 | 3300009174 | Bacteria | 3655 |
| 212 | Ga0105241_10060960 | 3300009174 | Bacteria | 2904 |
| 213 | Ga0105241_10073639 | 3300009174 | Bacteria | 2658 |
| 214 | Ga0105241_10111980 | 3300009174 | Bacteria | 2186 |
| 215 | Ga0105241_10112845 | 3300009174 | Bacteria | 2178 |
| 216 | Ga0105248_10010634 | 3300009177 | Bacteria | 10148 |
| 217 | Ga0105248_10050368 | 3300009177 | Bacteria | 4670 |
| 218 | Ga0105248_10050394 | 3300009177 | Bacteria | 4669 |
| 219 | Ga0105248_10097135 | 3300009177 | Bacteria | 3319 |
| 220 | Ga0105248_10936489 | 3300009177 | Bacteria | 978 |
| 221 | Ga0105237_10010021 | 3300009545 | Bacteria | 10112 |
| 222 | Ga0105237_10030642 | 3300009545 | Bacteria | 5462 |
| 223 | Ga0105237_10038406 | 3300009545 | Bacteria | 4834 |
| 224 | Ga0105237_10049974 | 3300009545 | Bacteria | 4202 |
| 225 | Ga0105237_10091668 | 3300009545 | Bacteria | 3028 |
| 226 | Ga0105237_10126417 | 3300009545 | Bacteria | 2551 |
| 227 | Ga0105237_11196456 | 3300009545 | Bacteria | 767 |
| 228 | Ga0105238_10051030 | 3300009551 | Bacteria | 4162 |
| 229 | Ga0105238_10097805 | 3300009551 | Bacteria | 2920 |
| 230 | Ga0105238_10284461 | 3300009551 | Bacteria | 1635 |
| 231 | Ga0105249_10000479 | 3300009553 | Bacteria | 37143 |
| 232 | Ga0105148_100042 | 3300009978 | Bacteria | 18795 |
| 233 | Ga0099796_10011546 | 3300010159 | Bacteria | 2467 |
| 234 | Ga0105239_10022158 | 3300010375 | Bacteria | 7001 |
| 235 | Ga0105239_10608547 | 3300010375 | Bacteria | 1247 |
| 236 | Ga0105239_10623366 | 3300010375 | Bacteria | 1231 |
| 237 | Ga0105239_10668126 | 3300010375 | Bacteria | 1187 |
| 238 | Ga0105239_10907631 | 3300010375 | Bacteria | 1011 |
| 239 | Ga0105246_10061565 | 3300011119 | Bacteria | 2612 |
| 240 | Ga0157373_10530700 | 3300013100 | Bacteria | 852 |
| 241 | Ga0157371_10085823 | 3300013102 | Bacteria | 2230 |
| 242 | Ga0157370_10110273 | 3300013104 | Bacteria | 2572 |
| 243 | Ga0157370_10299109 | 3300013104 | Bacteria | 1486 |
| 244 | Ga0157369_10114195 | 3300013105 | Bacteria | 2868 |
| 245 | Ga0157369_10179697 | 3300013105 | Bacteria | 2227 |
| 246 | Ga0157369_10180113 | 3300013105 | Bacteria | 2224 |
| 247 | Ga0157369_10364629 | 3300013105 | Bacteria | 1500 |
| 248 | Ga0157374_10057825 | 3300013296 | Bacteria | 3623 |
| 249 | Ga0157374_10128458 | 3300013296 | Bacteria | 2451 |
| 250 | Ga0157374_10217974 | 3300013296 | Bacteria | 1872 |
| 251 | Ga0157378_10042553 | 3300013297 | Bacteria | 4032 |
| 252 | Ga0163162_10109119 | 3300013306 | Bacteria | 2864 |
| 253 | Ga0163162_10444626 | 3300013306 | Bacteria | 1428 |
| 254 | Ga0163162_10601242 | 3300013306 | Bacteria | 1226 |
| 255 | Ga0157375_10238752 | 3300013308 | Bacteria | 1977 |
| 256 | Ga0163163_10007677 | 3300014325 | Bacteria | 9530 |
| 257 | Ga0163163_10117815 | 3300014325 | Bacteria | 2688 |
| 258 | Ga0182008_10068896 | 3300014497 | Bacteria | 1741 |
| 259 | Ga0157379_10007477 | 3300014968 | Bacteria | 9459 |
| 260 | Ga0157379_10098603 | 3300014968 | Bacteria | 2623 |
| 261 | Ga0157376_10021572 | 3300014969 | Bacteria | 5005 |
| 262 | Ga0157376_10638139 | 3300014969 | Bacteria | 1064 |
| 263 | Ga0163161_10005250 | 3300017792 | Bacteria | 9015 |
| 264 | Ga0206356_11766087 | 3300020070 | Bacteria | 844 |
| 265 | Ga0206354_11418476 | 3300020081 | Bacteria | 1734 |
| 266 | Ga0206353_11597628 | 3300020082 | Bacteria | 1739 |
| 267 | Ga0206353_12023448 | 3300020082 | Bacteria | 6731 |
| 268 | Ga0154015_1264598 | 3300020610 | Bacteria | 1090 |
| 269 | Ga0214544_1000004 | 3300021320 | Bacteria | 455869 |
| 270 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 271 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 272 | Ga0214543_1000006 | 3300021327 | Bacteria | 443395 |
| 273 | Ga0213875_10079341 | 3300021388 | Bacteria | 1531 |
| 274 | Ga0213871_10007850 | 3300021441 | Bacteria | 2326 |
| 275 | Ga0213871_10021068 | 3300021441 | Bacteria | 1622 |
| 276 | Ga0209563_104631 | 3300025230 | Bacteria | 2604 |
| 277 | Ga0207425_1016340 | 3300025245 | Bacteria | 1648 |
| 278 | Ga0209677_101151 | 3300025253 | Bacteria | 12289 |
| 279 | Ga0209148_1000566 | 3300025254 | Bacteria | 34786 |
| 280 | Ga0209233_1001516 | 3300025261 | Bacteria | 9113 |
| 281 | Ga0209233_1002707 | 3300025261 | Bacteria | 6398 |
| 282 | Ga0209233_1026960 | 3300025261 | Bacteria | 1398 |
| 283 | Ga0209455_1001114 | 3300025272 | Bacteria | 13145 |
| 284 | Ga0209673_1001167 | 3300025273 | Bacteria | 28647 |
| 285 | Ga0209564_1039126 | 3300025295 | Bacteria | 1308 |
| 286 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 287 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 288 | Ga0209758_1002049 | 3300025297 | Bacteria | 21606 |
| 289 | Ga0209758_1005922 | 3300025297 | Bacteria | 9090 |
| 290 | Ga0209758_1032747 | 3300025297 | Bacteria | 2103 |
| 291 | Ga0209256_1008038 | 3300025299 | Bacteria | 4997 |
| 292 | Ga0207426_1000120 | 3300025302 | Bacteria | 219117 |
| 293 | Ga0207426_1000673 | 3300025302 | Bacteria | 41533 |
| 294 | Ga0207426_1004196 | 3300025302 | Bacteria | 7183 |
| 295 | Ga0209257_1001327 | 3300025304 | Bacteria | 30091 |
| 296 | Ga0207656_10077493 | 3300025321 | Bacteria | 1488 |
| 297 | Ga0207696_1005868 | 3300025711 | Bacteria | 5037 |
| 298 | Ga0207696_1015915 | 3300025711 | Bacteria | 2532 |
| 299 | Ga0207692_10004793 | 3300025898 | Bacteria | 5377 |
| 300 | Ga0207642_10483461 | 3300025899 | Bacteria | 756 |
| 301 | Ga0207710_10072977 | 3300025900 | Bacteria | 1577 |
| 302 | Ga0207710_10074572 | 3300025900 | Bacteria | 1562 |
| 303 | Ga0207680_10001161 | 3300025903 | Bacteria | 12411 |
| 304 | Ga0207680_10143421 | 3300025903 | Bacteria | 1585 |
| 305 | Ga0207647_10035303 | 3300025904 | Bacteria | 3187 |
| 306 | Ga0207685_10270433 | 3300025905 | Bacteria | 830 |
| 307 | Ga0207699_10005077 | 3300025906 | Bacteria | 6297 |
| 308 | Ga0207699_10046323 | 3300025906 | Bacteria | 2543 |
| 309 | Ga0207699_10053444 | 3300025906 | Bacteria | 2395 |
| 310 | Ga0207699_10275526 | 3300025906 | Bacteria | 1167 |
| 311 | Ga0207705_10015903 | 3300025909 | Bacteria | 5402 |
| 312 | Ga0207684_10122127 | 3300025910 | Bacteria | 2233 |
| 313 | Ga0207654_10080134 | 3300025911 | Bacteria | 1963 |
| 314 | Ga0207654_10092881 | 3300025911 | Bacteria | 1843 |
| 315 | Ga0207654_10247339 | 3300025911 | Bacteria | 1194 |
| 316 | Ga0207654_10283197 | 3300025911 | Bacteria | 1122 |
| 317 | Ga0207707_10184089 | 3300025912 | Bacteria | 1823 |
| 318 | Ga0207707_10195323 | 3300025912 | Bacteria | 1765 |
| 319 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 320 | Ga0207695_10022582 | 3300025913 | Bacteria | 7137 |
| 321 | Ga0207695_10186796 | 3300025913 | Bacteria | 1991 |
| 322 | Ga0207671_10049564 | 3300025914 | Bacteria | 3109 |
| 323 | Ga0207671_10070742 | 3300025914 | Bacteria | 2602 |
| 324 | Ga0207671_10101602 | 3300025914 | Bacteria | 2179 |
| 325 | Ga0207671_10156010 | 3300025914 | Bacteria | 1766 |
| 326 | Ga0207671_10164936 | 3300025914 | Bacteria | 1717 |
| 327 | Ga0207671_10691826 | 3300025914 | Bacteria | 811 |
| 328 | Ga0207693_10000217 | 3300025915 | Bacteria | 52791 |
| 329 | Ga0207693_10267676 | 3300025915 | Bacteria | 1339 |
| 330 | Ga0207693_10741960 | 3300025915 | Bacteria | 759 |
| 331 | Ga0207663_10000151 | 3300025916 | Bacteria | 32258 |
| 332 | Ga0207663_10059235 | 3300025916 | Bacteria | 2421 |
| 333 | Ga0207663_10161919 | 3300025916 | Bacteria | 1580 |
| 334 | Ga0207660_10038888 | 3300025917 | Bacteria | 3323 |
| 335 | Ga0207660_10305166 | 3300025917 | Bacteria | 1268 |
| 336 | Ga0207657_10013873 | 3300025919 | Bacteria | 7885 |
| 337 | Ga0207657_10395794 | 3300025919 | Bacteria | 1087 |
| 338 | Ga0207652_10182875 | 3300025921 | Bacteria | 1884 |
| 339 | Ga0207652_10440571 | 3300025921 | Bacteria | 1174 |
| 340 | Ga0207681_10000358 | 3300025923 | Bacteria | 32494 |
| 341 | Ga0207681_10006344 | 3300025923 | Bacteria | 7259 |
| 342 | Ga0207681_10133722 | 3300025923 | Bacteria | 1837 |
| 343 | Ga0207681_10497069 | 3300025923 | Bacteria | 998 |
| 344 | Ga0207694_10170272 | 3300025924 | Bacteria | 1763 |
| 345 | Ga0207650_10269207 | 3300025925 | Bacteria | 1384 |
| 346 | Ga0207659_10141181 | 3300025926 | Bacteria | 1870 |
| 347 | Ga0207687_10068316 | 3300025927 | Bacteria | 2531 |
| 348 | Ga0207687_10748539 | 3300025927 | Bacteria | 831 |
| 349 | Ga0207700_10005260 | 3300025928 | Bacteria | 7716 |
| 350 | Ga0207700_10034019 | 3300025928 | Bacteria | 3654 |
| 351 | Ga0207700_10067405 | 3300025928 | Bacteria | 2739 |
| 352 | Ga0207700_10433784 | 3300025928 | Bacteria | 1156 |
| 353 | Ga0207700_10449174 | 3300025928 | Bacteria | 1136 |
| 354 | Ga0207664_10013911 | 3300025929 | Bacteria | 5798 |
| 355 | Ga0207664_10015026 | 3300025929 | Bacteria | 5607 |
| 356 | Ga0207664_10015966 | 3300025929 | Bacteria | 5469 |
| 357 | Ga0207664_10040259 | 3300025929 | Bacteria | 3633 |
| 358 | Ga0207664_10414343 | 3300025929 | Bacteria | 1199 |
| 359 | Ga0207644_10003443 | 3300025931 | Bacteria | 10228 |
| 360 | Ga0207644_10015682 | 3300025931 | Bacteria | 5091 |
| 361 | Ga0207644_10017154 | 3300025931 | Bacteria | 4884 |
| 362 | Ga0207690_10761991 | 3300025932 | Bacteria | 798 |
| 363 | Ga0207706_10022693 | 3300025933 | Bacteria | 5634 |
| 364 | Ga0207706_10054128 | 3300025933 | Bacteria | 3542 |
| 365 | Ga0207706_10077856 | 3300025933 | Bacteria | 2916 |
| 366 | Ga0207706_10194661 | 3300025933 | Bacteria | 1778 |
| 367 | Ga0207706_10614595 | 3300025933 | Bacteria | 933 |
| 368 | Ga0207709_10000143 | 3300025935 | Bacteria | 99457 |
| 369 | Ga0207709_10639423 | 3300025935 | Bacteria | 846 |
| 370 | Ga0207665_10000493 | 3300025939 | Bacteria | 26653 |
| 371 | Ga0207665_10272241 | 3300025939 | Bacteria | 1258 |
| 372 | Ga0207711_10063926 | 3300025941 | Bacteria | 3178 |
| 373 | Ga0207711_10065464 | 3300025941 | Bacteria | 3142 |
| 374 | Ga0207689_10001713 | 3300025942 | Bacteria | 20753 |
| 375 | Ga0207689_10113725 | 3300025942 | Bacteria | 2225 |
| 376 | Ga0207661_10024510 | 3300025944 | Bacteria | 4573 |
| 377 | Ga0207661_10069955 | 3300025944 | Bacteria | 2863 |
| 378 | Ga0207679_10564102 | 3300025945 | Bacteria | 1023 |
| 379 | Ga0207679_10655042 | 3300025945 | Bacteria | 950 |
| 380 | Ga0207667_10044360 | 3300025949 | Bacteria | 4712 |
| 381 | Ga0207667_10054301 | 3300025949 | Bacteria | 4214 |
| 382 | Ga0207667_10799326 | 3300025949 | Bacteria | 940 |
| 383 | Ga0207712_10000405 | 3300025961 | Bacteria | 37152 |
| 384 | Ga0207712_10200412 | 3300025961 | Bacteria | 1582 |
| 385 | Ga0207668_10000027 | 3300025972 | Bacteria | 125575 |
| 386 | Ga0207668_10000119 | 3300025972 | Bacteria | 55547 |
| 387 | Ga0207668_10015543 | 3300025972 | Bacteria | 4731 |
| 388 | Ga0207668_10020385 | 3300025972 | Bacteria | 4211 |
| 389 | Ga0207668_10106114 | 3300025972 | Bacteria | 2098 |
| 390 | Ga0207668_10351107 | 3300025972 | Bacteria | 1233 |
| 391 | Ga0207640_10002550 | 3300025981 | Bacteria | 9765 |
| 392 | Ga0207640_10073577 | 3300025981 | Bacteria | 2310 |
| 393 | Ga0207658_10000091 | 3300025986 | Bacteria | 99970 |
| 394 | Ga0207658_10057561 | 3300025986 | Bacteria | 2889 |
| 395 | Ga0207658_10068456 | 3300025986 | Bacteria | 2679 |
| 396 | Ga0207658_10293074 | 3300025986 | Bacteria | 1399 |
| 397 | Ga0207677_10024255 | 3300026023 | Bacteria | 3765 |
| 398 | Ga0207703_10060972 | 3300026035 | Bacteria | 3087 |
| 399 | Ga0207703_10106018 | 3300026035 | Bacteria | 2390 |
| 400 | Ga0207703_10150352 | 3300026035 | Bacteria | 2030 |
| 401 | Ga0207703_10224120 | 3300026035 | Bacteria | 1683 |
| 402 | Ga0207639_10003038 | 3300026041 | Bacteria | 11299 |
| 403 | Ga0207639_10046719 | 3300026041 | Bacteria | 3268 |
| 404 | Ga0207639_10049046 | 3300026041 | Bacteria | 3199 |
| 405 | Ga0207639_10176128 | 3300026041 | Bacteria | 1816 |
| 406 | Ga0207639_11100196 | 3300026041 | Bacteria | 745 |
| 407 | Ga0207678_10000053 | 3300026067 | Bacteria | 88489 |
| 408 | Ga0207678_10094685 | 3300026067 | Bacteria | 2552 |
| 409 | Ga0207702_10007174 | 3300026078 | Bacteria | 9536 |
| 410 | Ga0207702_10146400 | 3300026078 | Bacteria | 2144 |
| 411 | Ga0207702_10156921 | 3300026078 | Bacteria | 2075 |
| 412 | Ga0207702_10222708 | 3300026078 | Bacteria | 1758 |
| 413 | Ga0207702_10714325 | 3300026078 | Bacteria | 988 |
| 414 | Ga0207641_10000093 | 3300026088 | Bacteria | 125747 |
| 415 | Ga0207641_10027610 | 3300026088 | Bacteria | 4688 |
| 416 | Ga0207641_10068221 | 3300026088 | Bacteria | 3049 |
| 417 | Ga0207641_10819375 | 3300026088 | Bacteria | 921 |
| 418 | Ga0207676_10063189 | 3300026095 | Bacteria | 2940 |
| 419 | Ga0207676_10117273 | 3300026095 | Bacteria | 2239 |
| 420 | Ga0207674_10018107 | 3300026116 | Bacteria | 7664 |
| 421 | Ga0207674_10075668 | 3300026116 | Bacteria | 3376 |
| 422 | Ga0207674_10306908 | 3300026116 | Bacteria | 1536 |
| 423 | Ga0207675_100003788 | 3300026118 | Bacteria | 14726 |
| 424 | Ga0207675_100288328 | 3300026118 | Bacteria | 1596 |
| 425 | Ga0207683_10026771 | 3300026121 | Bacteria | 4981 |
| 426 | Ga0207698_10024978 | 3300026142 | Bacteria | 4200 |
| 427 | Ga0207698_10027523 | 3300026142 | Bacteria | 4037 |
| 428 | Ga0207698_10055947 | 3300026142 | Bacteria | 3044 |
| 429 | Ga0207698_10067408 | 3300026142 | Bacteria | 2822 |
| 430 | Ga0207698_11307182 | 3300026142 | Bacteria | 740 |
| 431 | Ga0209281_1000017 | 3300027111 | Bacteria | 583251 |
| 432 | Ga0209389_1000010 | 3300027296 | Bacteria | 223892 |
| 433 | Ga0209389_1000149 | 3300027296 | Bacteria | 59631 |
| 434 | Ga0209589_1000016 | 3300027357 | Bacteria | 223788 |
| 435 | Ga0209589_1000025 | 3300027357 | Bacteria | 165546 |
| 436 | Ga0209489_100016 | 3300027361 | Bacteria | 223873 |
| 437 | Ga0209489_100039 | 3300027361 | Bacteria | 165546 |
| 438 | Ga0209700_100030 | 3300027363 | Bacteria | 212982 |
| 439 | Ga0209700_100043 | 3300027363 | Bacteria | 167890 |
| 440 | Ga0209813_10000012 | 3300027866 | Bacteria | 91374 |
| 441 | Ga0209813_10186011 | 3300027866 | Bacteria | 762 |
| 442 | Ga0207428_10113849 | 3300027907 | Bacteria | 2079 |
| 443 | Ga0268266_10006810 | 3300028379 | Bacteria | 10409 |
| 444 | Ga0268266_10016057 | 3300028379 | Bacteria | 6399 |
| 445 | Ga0268266_10387098 | 3300028379 | Bacteria | 1320 |
| 446 | Ga0268266_10794120 | 3300028379 | Bacteria | 914 |
| 447 | Ga0268265_10000633 | 3300028380 | Bacteria | 35043 |
| 448 | Ga0268265_10067570 | 3300028380 | Bacteria | 2768 |
| 449 | Ga0268265_10296466 | 3300028380 | Bacteria | 1454 |
| 450 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 451 | Ga0268264_10000980 | 3300028381 | Bacteria | 29223 |
| 452 | Ga0268264_10008606 | 3300028381 | Bacteria | 8479 |
| 453 | Ga0268264_10058148 | 3300028381 | Bacteria | 3237 |
| 454 | Ga0307515_10000626 | 3300028794 | Bacteria | 82165 |
| 455 | Ga0307511_10068998 | 3300030521 | Bacteria | 2604 |
| 456 | Ga0265340_10011093 | 3300031247 | Bacteria | 4802 |
| 457 | Ga0265339_10002090 | 3300031249 | Bacteria | 14588 |
| 458 | Ga0307513_10011751 | 3300031456 | Bacteria | 10858 |
| 459 | Ga0307513_10114409 | 3300031456 | Bacteria | 2683 |
| 460 | Ga0307509_10012996 | 3300031507 | Bacteria | 9891 |
| 461 | Ga0307408_100007475 | 3300031548 | Bacteria | 7223 |
| 462 | Ga0307508_10330955 | 3300031616 | Bacteria | 1115 |
| 463 | Ga0307514_10000861 | 3300031649 | Bacteria | 48344 |
| 464 | Ga0307516_10004326 | 3300031730 | Bacteria | 17593 |
| 465 | Ga0307516_10059170 | 3300031730 | Bacteria | 3727 |
| 466 | Ga0307516_10204047 | 3300031730 | Bacteria | 1694 |
| 467 | Ga0307405_10008013 | 3300031731 | Bacteria | 5327 |
| 468 | Ga0307405_10064861 | 3300031731 | Bacteria | 2323 |
| 469 | Ga0307413_10111485 | 3300031824 | Bacteria | 1832 |
| 470 | Ga0307406_10024841 | 3300031901 | Bacteria | 3582 |
| 471 | Ga0307406_10350463 | 3300031901 | Bacteria | 1153 |
| 472 | Ga0307406_10506305 | 3300031901 | Bacteria | 980 |
| 473 | Ga0307412_10002798 | 3300031911 | Bacteria | 9692 |
| 474 | Ga0307412_10067707 | 3300031911 | Bacteria | 2425 |
| 475 | Ga0307416_100008101 | 3300032002 | Bacteria | 6744 |
| 476 | Ga0307510_10032342 | 3300033180 | Bacteria | 5894 |
| 477 | Ga0307510_10069078 | 3300033180 | Bacteria | 3541 |
| 478 | Ga0307510_10235298 | 3300033180 | Bacteria | 1331 |
| 479 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 480 | Ga0373934_0023398 | 3300035086 | Bacteria | 2387 |
| 481 | Ga0373944_0069693 | 3300035089 | Bacteria | 1143 |
| 482 | Ga0373923_0033070 | 3300035111 | Bacteria | 2092 |
| 483 | Ga0373936_0018408 | 3300035113 | Bacteria | 2698 |
| 484 | Ga0373936_0078370 | 3300035113 | Bacteria | 1372 |
| 485 | Ga0373953_0042756 | 3300035117 | Bacteria | 1807 |
| 486 | Ga0373954_0022313 | 3300035118 | Bacteria | 2870 |
| 487 | Ga0373956_0126661 | 3300035119 | Bacteria | 1194 |
| 488 | Ga0373943_0046835 | 3300035170 | Bacteria | 2112 |
| 489 | Ga0373955_0531326 | 3300035172 | Bacteria | 719 |
| 490 | Ga0373924_0013501 | 3300035410 | Bacteria | 3070 |
| 491 | Ga0373931_0149272 | 3300035691 | Bacteria | 1361 |
| 492 | Ga0373935_0100224 | 3300035692 | Bacteria | 1908 |
| 493 | Ga0373927_0003407 | 3300035695 | Bacteria | 11427 |
| 494 | Ga0373933_0454989 | 3300035724 | Bacteria | 837 |
| 495 | Ga0373947_0146864 | 3300035725 | Bacteria | 1517 |
| 496 | Ga0373937_0194238 | 3300036401 | Bacteria | 1907 |
| 497 | Ga0373925_0052030 | 3300037068 | Bacteria | 3059 |
| 498 | Ga0373925_0070598 | 3300037068 | Bacteria | 2640 |
| 499 | Ga0373925_0490920 | 3300037068 | Bacteria | 1008 |
| 500 | Ga0395899_0039807 | 3300037312 | Bacteria | 3517 |
| 501 | Ga0395900_0055181 | 3300037418 | Bacteria | 4091 |
| 502 | Ga0395900_0062858 | 3300037418 | Bacteria | 3816 |
| 503 | Ga0395900_0064716 | 3300037418 | Bacteria | 3757 |
| 504 | Ga0395900_0221809 | 3300037418 | Bacteria | 1905 |
| 505 | Ga0395898_0050420 | 3300037466 | Bacteria | 4073 |
| 506 | Ga0395898_0144970 | 3300037466 | Bacteria | 2273 |
| 507 | Ga0395905_0009332 | 3300037471 | Bacteria | 9596 |
| 508 | Ga0395905_0010197 | 3300037471 | Bacteria | 9157 |
| 509 | Ga0395905_0228767 | 3300037471 | Bacteria | 1739 |
| 510 | Ga0395905_0624322 | 3300037471 | Bacteria | 980 |
| 511 | Ga0436364_0341967 | 3300037853 | Bacteria | 5735 |
| 512 | Ga0436364_0476301 | 3300037853 | Bacteria | 4366 |
| 513 | Ga0436364_0752290 | 3300037853 | Bacteria | 1214 |
| 514 | Ga0436364_0926030 | 3300037853 | Bacteria | 5519 |
| 515 | Ga0395901_0058273 | 3300038443 | Bacteria | 4018 |
| 516 | Ga0395901_0091636 | 3300038443 | Bacteria | 3181 |
| 517 | Ga0395901_0343297 | 3300038443 | Bacteria | 1542 |
| 518 | Ga0400483_126259 | 3300039062 | Bacteria | 1732 |
| 519 | Ga0436360_0460772 | 3300039438 | Bacteria | 2137 |
| 520 | Ga0436360_0732042 | 3300039438 | Bacteria | 2945 |
| 521 | Ga0436360_1138676 | 3300039438 | Bacteria | 5712 |
| 522 | Ga0436361_0149759 | 3300039447 | Bacteria | 1692 |
| 523 | Ga0436361_0263958 | 3300039447 | Bacteria | 1797 |
| 524 | Ga0436361_0319705 | 3300039447 | Bacteria | 2631 |
| 525 | Ga0439436_0024372 | 3300041404 | Bacteria | 1787 |
| 526 | Ga0451793_1165256 | 3300041452 | Bacteria | 3322 |
| 527 | Ga0451797_1163837 | 3300041453 | Bacteria | 1220 |
| 528 | Ga0451833_0257326 | 3300041491 | Bacteria | 1139 |
| 529 | Ga0451833_0290422 | 3300041491 | Bacteria | 6389 |
| 530 | Ga0451833_0896395 | 3300041491 | Bacteria | 6302 |
| 531 | Ga0451837_1397189 | 3300041494 | Bacteria | 5637 |
| 532 | Ga0451839_0842413 | 3300041496 | Bacteria | 2242 |
| 533 | Ga0451853_0261175 | 3300041512 | Bacteria | 1021 |
| 534 | Ga0439445_0003192 | 3300042004 | Bacteria | 3676 |
| 535 | Ga0439445_0007938 | 3300042004 | Bacteria | 2475 |
| 536 | Ga0450911_000342 | 3300042115 | Bacteria | 16356 |
| 537 | Ga0450907_007576 | 3300042146 | Bacteria | 1810 |
| 538 | Ga0466969_0004164 | 3300044656 | Bacteria | 7680 |
| 539 | Ga0466969_0114560 | 3300044656 | Bacteria | 1259 |
| 540 | Ga0466972_0000148 | 3300044658 | Bacteria | 57158 |
| 541 | Ga0466972_0003448 | 3300044658 | Bacteria | 7842 |
| 542 | Ga0466972_0017113 | 3300044658 | Bacteria | 3626 |
| 543 | Ga0466972_0169946 | 3300044658 | Bacteria | 1023 |
| 544 | Ga0466965_0369115 | 3300044683 | Bacteria | 789 |
| 545 | Ga0466966_0012261 | 3300044684 | Bacteria | 5679 |
| 546 | Ga0466966_0249042 | 3300044684 | Bacteria | 1070 |
| 547 | Ga0466966_0255610 | 3300044684 | Bacteria | 1055 |
| 548 | Ga0466966_0292965 | 3300044684 | Bacteria | 978 |
| 549 | Ga0466961_0000008 | 3300044693 | Bacteria | 142607 |
| 550 | Ga0466961_0227358 | 3300044693 | Bacteria | 1149 |
| 551 | Ga0466963_0483240 | 3300044694 | Bacteria | 874 |
| 552 | Ga0466964_0042755 | 3300044706 | Bacteria | 1837 |
| 553 | Ga0466971_0139384 | 3300044719 | Bacteria | 1129 |
| 554 | Ga0466968_0038023 | 3300044735 | Bacteria | 2021 |
| 555 | Ga0466968_0155839 | 3300044735 | Bacteria | 1052 |
| 556 | Ga0466968_0292198 | 3300044735 | Bacteria | 782 |
| 557 | Ga0466970_0053407 | 3300044765 | Bacteria | 2158 |
| 558 | Ga0466970_0054266 | 3300044765 | Bacteria | 2140 |
| 559 | Ga0466970_0058552 | 3300044765 | Bacteria | 2062 |
| 560 | Ga0466970_0077125 | 3300044765 | Bacteria | 1796 |
| 561 | Ga0466970_0370827 | 3300044765 | Bacteria | 814 |
| 562 | Ga0466957_0089469 | 3300044842 | Bacteria | 1927 |
| 563 | Ga0466957_0309867 | 3300044842 | Bacteria | 1063 |
| 564 | Ga0466960_0016548 | 3300044901 | Bacteria | 3202 |
| 565 | Ga0466960_0051615 | 3300044901 | Bacteria | 1987 |
| 566 | Ga0466960_0090662 | 3300044901 | Bacteria | 1557 |
| 567 | Ga0466960_0117920 | 3300044901 | Bacteria | 1387 |
| 568 | Ga0466959_0009565 | 3300045049 | Bacteria | 6896 |
| 569 | Ga0466959_0012592 | 3300045049 | Bacteria | 6117 |
| 570 | Ga0466959_0016679 | 3300045049 | Bacteria | 5372 |
| 571 | Ga0466959_0473556 | 3300045049 | Bacteria | 848 |
| 572 | Ga0466958_0290849 | 3300045836 | Bacteria | 1048 |
| 573 | Ga0466967_0057572 | 3300045976 | Bacteria | 3432 |
| 574 | Ga0466967_0127399 | 3300045976 | Bacteria | 2359 |
| 575 | Ga0466967_0325825 | 3300045976 | Bacteria | 1482 |
| 576 | Ga0495617_004580 | 3300046452 | Bacteria | 5007 |
| 577 | Ga0495617_092613 | 3300046452 | Bacteria | 985 |
| 578 | Ga0495627_013822 | 3300046453 | Bacteria | 2834 |
| 579 | Ga0495592_0010915 | 3300046454 | Bacteria | 6853 |
| 580 | Ga0495603_0223516 | 3300046455 | Bacteria | 1086 |
| 581 | Ga0495590_0080137 | 3300046457 | Bacteria | 1150 |
| 582 | Ga0495629_0059289 | 3300046459 | Bacteria | 2675 |
| 583 | Ga0495629_0130940 | 3300046459 | Bacteria | 1747 |
| 584 | Ga0495638_0000073 | 3300046460 | Bacteria | 164378 |
| 585 | Ga0495638_0002880 | 3300046460 | Bacteria | 13779 |
| 586 | Ga0495641_0332186 | 3300046461 | Bacteria | 686 |
| 587 | Ga0495651_0001984 | 3300046462 | Bacteria | 15854 |
| 588 | Ga0495651_0029080 | 3300046462 | Bacteria | 4310 |
| 589 | Ga0495651_0085311 | 3300046462 | Bacteria | 2378 |
| 590 | Ga0495653_0019076 | 3300046463 | Bacteria | 5564 |
| 591 | Ga0495653_0200081 | 3300046463 | Bacteria | 1356 |
| 592 | Ga0495650_0001348 | 3300046471 | Bacteria | 24429 |
| 593 | Ga0495582_0020660 | 3300046473 | Bacteria | 3605 |
| 594 | Ga0495605_0092373 | 3300046474 | Bacteria | 1401 |
| 595 | Ga0495639_0004491 | 3300046475 | Bacteria | 5982 |
| 596 | Ga0495639_0295463 | 3300046475 | Bacteria | 807 |
| 597 | Ga0495664_0028535 | 3300046477 | Bacteria | 3258 |
| 598 | Ga0495664_0161810 | 3300046477 | Bacteria | 1358 |
| 599 | Ga0495584_0126854 | 3300046491 | Bacteria | 1294 |
| 600 | Ga0495594_0109427 | 3300046499 | Bacteria | 1558 |
| 601 | Ga0495596_0003376 | 3300046500 | Bacteria | 8110 |
| 602 | Ga0495583_0000087 | 3300046506 | Bacteria | 164974 |
| 603 | Ga0495606_0061205 | 3300046507 | Bacteria | 2409 |
| 604 | Ga0495606_0284202 | 3300046507 | Bacteria | 903 |
| 605 | Ga0495610_0005333 | 3300046512 | Bacteria | 9174 |
| 606 | Ga0495610_0027469 | 3300046512 | Bacteria | 3023 |
| 607 | Ga0495616_0012946 | 3300046513 | Bacteria | 4717 |
| 608 | Ga0495618_0034740 | 3300046514 | Bacteria | 3163 |
| 609 | Ga0495618_0076428 | 3300046514 | Bacteria | 2134 |
| 610 | Ga0495618_0141470 | 3300046514 | Bacteria | 1539 |
| 611 | Ga0495628_0011313 | 3300046516 | Bacteria | 7548 |
| 612 | Ga0495628_0110653 | 3300046516 | Bacteria | 2113 |
| 613 | Ga0495630_0058231 | 3300046517 | Bacteria | 2896 |
| 614 | Ga0495630_0159930 | 3300046517 | Bacteria | 1715 |
| 615 | Ga0495630_0220274 | 3300046517 | Bacteria | 1449 |
| 616 | Ga0495632_0000049 | 3300046519 | Bacteria | 134597 |
| 617 | Ga0495632_0002653 | 3300046519 | Bacteria | 13424 |
| 618 | Ga0495632_0235837 | 3300046519 | Bacteria | 824 |
| 619 | Ga0495637_0014164 | 3300046520 | Bacteria | 3766 |
| 620 | Ga0495643_0000047 | 3300046522 | Bacteria | 217914 |
| 621 | Ga0495643_0020094 | 3300046522 | Bacteria | 3857 |
| 622 | Ga0495648_0000049 | 3300046524 | Bacteria | 164366 |
| 623 | Ga0495648_0032189 | 3300046524 | Bacteria | 3445 |
| 624 | Ga0495648_0135824 | 3300046524 | Bacteria | 1301 |
| 625 | Ga0495663_0000009 | 3300046525 | Bacteria | 256308 |
| 626 | Ga0495666_0029362 | 3300046526 | Bacteria | 2705 |
| 627 | Ga0495652_0010482 | 3300046529 | Bacteria | 8398 |
| 628 | Ga0495652_0035658 | 3300046529 | Bacteria | 4328 |
| 629 | Ga0495654_0002730 | 3300046530 | Bacteria | 11144 |
| 630 | Ga0495665_0013511 | 3300046531 | Bacteria | 4413 |
| 631 | Ga0495640_0016765 | 3300046533 | Bacteria | 5476 |
| 632 | Ga0495640_0031232 | 3300046533 | Bacteria | 3803 |
| 633 | Ga0495640_0049025 | 3300046533 | Bacteria | 2915 |
| 634 | Ga0495587_0004347 | 3300046536 | Bacteria | 9353 |
| 635 | Ga0495597_0000024 | 3300046542 | Bacteria | 143948 |
| 636 | Ga0495597_0004357 | 3300046542 | Bacteria | 7805 |
| 637 | Ga0495597_0104029 | 3300046542 | Bacteria | 1195 |
| 638 | Ga0495645_0001873 | 3300046543 | Bacteria | 14306 |
| 639 | Ga0495645_0113493 | 3300046543 | Bacteria | 1915 |
| 640 | Ga0495622_0039624 | 3300046557 | Bacteria | 2194 |
| 641 | Ga0495622_0206056 | 3300046557 | Bacteria | 875 |
| 642 | Ga0495633_0000290 | 3300046558 | Bacteria | 57790 |
| 643 | Ga0495633_0000319 | 3300046558 | Bacteria | 54580 |
| 644 | Ga0495633_0043026 | 3300046558 | Bacteria | 2143 |
| 645 | Ga0495633_0111654 | 3300046558 | Bacteria | 1267 |
| 646 | Ga0495667_0003300 | 3300046559 | Bacteria | 10818 |
| 647 | Ga0495667_0039255 | 3300046559 | Bacteria | 3148 |
| 648 | Ga0495668_0025664 | 3300046616 | Bacteria | 3347 |
| 649 | Ga0495668_0124753 | 3300046616 | Bacteria | 1409 |
| 650 | Ga0495668_0144762 | 3300046616 | Bacteria | 1301 |
| 651 | Ga0495634_0024720 | 3300046642 | Bacteria | 4211 |
| 652 | Ga0495634_0401407 | 3300046642 | Bacteria | 814 |
| 653 | Ga0495611_0133439 | 3300046648 | Bacteria | 1159 |
| 654 | Ga0495625_0000238 | 3300046660 | Bacteria | 85959 |
| 655 | Ga0495625_0004416 | 3300046660 | Bacteria | 13309 |
| 656 | Ga0495635_0001999 | 3300046663 | Bacteria | 13856 |
| 657 | Ga0495635_0009596 | 3300046663 | Bacteria | 6765 |
| 658 | Ga0495635_0089364 | 3300046663 | Bacteria | 2108 |
| 659 | Ga0495661_0167203 | 3300046665 | Bacteria | 1176 |
| 660 | Ga0495588_0007284 | 3300046674 | Bacteria | 5028 |
| 661 | Ga0495657_0001200 | 3300046675 | Bacteria | 22691 |
| 662 | Ga0495657_0079975 | 3300046675 | Bacteria | 2116 |
| 663 | Ga0495599_0004074 | 3300046678 | Bacteria | 8611 |
| 664 | Ga0495599_0103104 | 3300046678 | Bacteria | 1778 |
| 665 | Ga0495623_0012871 | 3300046679 | Bacteria | 5418 |
| 666 | Ga0495646_0040750 | 3300046680 | Bacteria | 2858 |
| 667 | Ga0495646_0042675 | 3300046680 | Bacteria | 2782 |
| 668 | Ga0495646_0307381 | 3300046680 | Bacteria | 837 |
| 669 | Ga0495647_0010474 | 3300046681 | Bacteria | 3158 |
| 670 | Ga0495613_0028267 | 3300046689 | Bacteria | 4171 |
| 671 | Ga0495624_0014716 | 3300046690 | Bacteria | 5298 |
| 672 | Ga0495624_0024527 | 3300046690 | Bacteria | 3967 |
| 673 | Ga0495671_0000038 | 3300046692 | Bacteria | 173693 |
| 674 | Ga0495671_0000042 | 3300046692 | Bacteria | 165201 |
| 675 | Ga0495649_0038769 | 3300046694 | Bacteria | 2613 |
| 676 | Ga0495649_0189318 | 3300046694 | Bacteria | 1071 |
| 677 | Ga0495600_0002291 | 3300046809 | Bacteria | 10909 |
| 678 | Ga0495600_0110545 | 3300046809 | Bacteria | 1789 |
| 679 | Ga0495600_0157089 | 3300046809 | Bacteria | 1471 |
| 680 | Ga0495604_0009383 | 3300047317 | Bacteria | 7739 |
| 681 | Ga0495604_0111017 | 3300047317 | Bacteria | 1999 |
| 682 | Ga0495674_0009389 | 3300047319 | Bacteria | 9296 |
| 683 | Ga0495674_0023697 | 3300047319 | Bacteria | 5653 |
| 684 | Ga0495676_0041792 | 3300047321 | Bacteria | 3770 |
| 685 | Ga0495680_0007048 | 3300047322 | Bacteria | 10359 |
| 686 | Ga0495680_0292367 | 3300047322 | Bacteria | 1146 |
| 687 | Ga0495687_016477 | 3300047443 | Bacteria | 3715 |
| 688 | Ga0495675_0001461 | 3300047444 | Bacteria | 14304 |
| 689 | Ga0495673_0000111 | 3300047469 | Bacteria | 164974 |
| 690 | Ga0495673_0032421 | 3300047469 | Bacteria | 2436 |
| 691 | Ga0495673_0106846 | 3300047469 | Bacteria | 1124 |
| 692 | Ga0495681_0000050 | 3300047470 | Bacteria | 109433 |
| 693 | Ga0495681_0000953 | 3300047470 | Bacteria | 22221 |
| 694 | Ga0495684_0004997 | 3300047471 | Bacteria | 10348 |
| 695 | Ga0495684_0076471 | 3300047471 | Bacteria | 2543 |
| 696 | Ga0495686_0000131 | 3300047472 | Bacteria | 152064 |
| 697 | Ga0495686_0044217 | 3300047472 | Bacteria | 2820 |
| 698 | Ga0495686_0078545 | 3300047472 | Bacteria | 2020 |
| 699 | Ga0495593_0031083 | 3300047673 | Bacteria | 2919 |
| 700 | Ga0495593_0066345 | 3300047673 | Bacteria | 1881 |
| 701 | Ga0495593_0067395 | 3300047673 | Bacteria | 1863 |
| 702 | Ga0495602_0016196 | 3300048088 | Bacteria | 7500 |
| 703 | Ga0495602_0110878 | 3300048088 | Bacteria | 2229 |
| 704 | Ga0495602_0249852 | 3300048088 | Bacteria | 1322 |
| 705 | Ga0495615_0000002 | 3300048090 | Bacteria | 167871 |
| 706 | Ga0495626_0001710 | 3300048091 | Bacteria | 16808 |
| 707 | Ga0496100_0158966 | 3300048903 | Bacteria | 1619 |
| 708 | Ga0496100_0254925 | 3300048903 | Bacteria | 1299 |
| 709 | Ga0496100_0324336 | 3300048903 | Bacteria | 1157 |
| 710 | Ga0496100_0491266 | 3300048903 | Bacteria | 945 |
| 711 | Ga0496101_0063166 | 3300048904 | Bacteria | 2695 |
| 712 | Ga0496101_0193098 | 3300048904 | Bacteria | 1572 |
| 713 | Ga0496101_0749993 | 3300048904 | Bacteria | 770 |
| 714 | Ga0496102_0001289 | 3300048905 | Bacteria | 22550 |
| 715 | Ga0496102_0014553 | 3300048905 | Bacteria | 6836 |
| 716 | Ga0496102_0022385 | 3300048905 | Bacteria | 5599 |
| 717 | Ga0496102_0056751 | 3300048905 | Bacteria | 3573 |
| 718 | Ga0496102_0098004 | 3300048905 | Bacteria | 2720 |
| 719 | Ga0496103_0000163 | 3300048906 | Bacteria | 70387 |
| 720 | Ga0496103_0011719 | 3300048906 | Bacteria | 5201 |
| 721 | Ga0496103_0049786 | 3300048906 | Bacteria | 2591 |
| 722 | Ga0496104_0003456 | 3300048907 | Bacteria | 13613 |
| 723 | Ga0496104_0003849 | 3300048907 | Bacteria | 12988 |
| 724 | Ga0496104_0021120 | 3300048907 | Bacteria | 5973 |
| 725 | Ga0496104_0575930 | 3300048907 | Bacteria | 1036 |
| 726 | Ga0496104_0839004 | 3300048907 | Bacteria | 825 |
| 727 | Ga0496105_0001070 | 3300048908 | Bacteria | 18947 |
| 728 | Ga0496105_0007451 | 3300048908 | Bacteria | 8471 |
| 729 | Ga0496105_0074881 | 3300048908 | Bacteria | 2797 |
| 730 | Ga0496105_0205474 | 3300048908 | Bacteria | 1607 |
| 731 | Ga0496105_0417999 | 3300048908 | Bacteria | 1062 |
| 732 | Ga0496106_0000358 | 3300048909 | Bacteria | 32366 |
| 733 | Ga0496106_0010950 | 3300048909 | Bacteria | 6704 |
| 734 | Ga0496107_0085414 | 3300048910 | Bacteria | 2303 |
| 735 | Ga0496107_0103996 | 3300048910 | Bacteria | 2084 |
| 736 | Ga0496107_0184332 | 3300048910 | Bacteria | 1550 |
| 737 | Ga0496108_0069872 | 3300048911 | Bacteria | 2963 |
| 738 | Ga0496108_0078137 | 3300048911 | Bacteria | 2801 |
| 739 | Ga0496108_0249567 | 3300048911 | Bacteria | 1544 |
| 740 | Ga0496108_0845861 | 3300048911 | Bacteria | 788 |
| 741 | Ga0496109_0024779 | 3300048912 | Bacteria | 5337 |
| 742 | Ga0496109_0080914 | 3300048912 | Bacteria | 2993 |
| 743 | Ga0496109_0371301 | 3300048912 | Bacteria | 1351 |
| 744 | Ga0496109_0465790 | 3300048912 | Bacteria | 1193 |
| 745 | Ga0496109_0680925 | 3300048912 | Bacteria | 966 |
| 746 | Ga0496110_0010631 | 3300048913 | Bacteria | 7493 |
| 747 | Ga0496110_0079158 | 3300048913 | Bacteria | 2926 |
| 748 | Ga0496110_0098432 | 3300048913 | Bacteria | 2621 |
| 749 | Ga0496110_0149483 | 3300048913 | Bacteria | 2114 |
| 750 | Ga0496110_0241914 | 3300048913 | Bacteria | 1642 |
| 751 | Ga0496110_0296096 | 3300048913 | Bacteria | 1474 |
| 752 | Ga0496111_0042941 | 3300048914 | Bacteria | 3248 |
| 753 | Ga0496111_0110967 | 3300048914 | Bacteria | 2020 |
| 754 | Ga0496111_0206713 | 3300048914 | Bacteria | 1459 |
| 755 | Ga0496112_0004169 | 3300048915 | Bacteria | 12180 |
| 756 | Ga0496112_0005313 | 3300048915 | Bacteria | 11115 |
| 757 | Ga0496112_0033125 | 3300048915 | Bacteria | 5020 |
| 758 | Ga0496112_0048480 | 3300048915 | Bacteria | 4164 |
| 759 | Ga0496112_0199250 | 3300048915 | Bacteria | 1962 |
| 760 | Ga0496112_0299729 | 3300048915 | Bacteria | 1553 |
| 761 | Ga0496112_0629522 | 3300048915 | Bacteria | 1003 |
| 762 | Ga0496112_0730787 | 3300048915 | Bacteria | 917 |
| 763 | Ga0496113_0000519 | 3300048916 | Bacteria | 19033 |
| 764 | Ga0496113_0009379 | 3300048916 | Bacteria | 6417 |
| 765 | Ga0496113_0015207 | 3300048916 | Bacteria | 5281 |
| 766 | Ga0496113_0043989 | 3300048916 | Bacteria | 3307 |
| 767 | Ga0496113_0061925 | 3300048916 | Bacteria | 2824 |
| 768 | Ga0496113_0131023 | 3300048916 | Bacteria | 1968 |
| 769 | Ga0496113_0226339 | 3300048916 | Bacteria | 1491 |
| 770 | Ga0496113_0727822 | 3300048916 | Bacteria | 791 |
| 771 | Ga0496114_0101393 | 3300048917 | Bacteria | 2458 |
| 772 | Ga0496114_0705007 | 3300048917 | Bacteria | 885 |
| 773 | Ga0496115_0031252 | 3300048918 | Bacteria | 4194 |
| 774 | Ga0496115_0186263 | 3300048918 | Bacteria | 1715 |
| 775 | Ga0496115_0208849 | 3300048918 | Bacteria | 1613 |
| 776 | Ga0496115_0371747 | 3300048918 | Bacteria | 1164 |
| 777 | Ga0496116_0042437 | 3300048919 | Bacteria | 3109 |
| 778 | Ga0496117_0001164 | 3300048920 | Bacteria | 39543 |
| 779 | Ga0496117_0072211 | 3300048920 | Bacteria | 2309 |
| 780 | Ga0496117_0074790 | 3300048920 | Bacteria | 2253 |
| 781 | Ga0496117_0184712 | 3300048920 | Bacteria | 1194 |
| 782 | Ga0496118_0000618 | 3300048921 | Bacteria | 58468 |
| 783 | Ga0496118_0019810 | 3300048921 | Bacteria | 6000 |
| 784 | Ga0496118_0023183 | 3300048921 | Bacteria | 5400 |
| 785 | Ga0496118_0070937 | 3300048921 | Bacteria | 2511 |
| 786 | Ga0496118_0070938 | 3300048921 | Bacteria | 2511 |
| 787 | Ga0496119_0003597 | 3300048922 | Bacteria | 15945 |
| 788 | Ga0496119_0011321 | 3300048922 | Bacteria | 7406 |
| 789 | Ga0496119_0022385 | 3300048922 | Bacteria | 4527 |
| 790 | Ga0496119_0031381 | 3300048922 | Bacteria | 3565 |
| 791 | Ga0496120_0022344 | 3300048923 | Bacteria | 3981 |
| 792 | Ga0496120_0055355 | 3300048923 | Bacteria | 2243 |
| 793 | Ga0496120_0061066 | 3300048923 | Bacteria | 2105 |
| 794 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 795 | Ga0496121_0000212 | 3300048924 | Bacteria | 127508 |
| 796 | Ga0496121_0011514 | 3300048924 | Bacteria | 9802 |
| 797 | Ga0496121_0014846 | 3300048924 | Bacteria | 8219 |
| 798 | Ga0496121_0035076 | 3300048924 | Bacteria | 4501 |
| 799 | Ga0496121_0043707 | 3300048924 | Bacteria | 3875 |
| 800 | Ga0496121_0057029 | 3300048924 | Bacteria | 3240 |
| 801 | Ga0496121_0059460 | 3300048924 | Bacteria | 3151 |
| 802 | Ga0496121_0061598 | 3300048924 | Bacteria | 3078 |
| 803 | Ga0496121_0063034 | 3300048924 | Bacteria | 3032 |
| 804 | Ga0496121_0093883 | 3300048924 | Bacteria | 2335 |
| 805 | Ga0496121_0166887 | 3300048924 | Bacteria | 1603 |
| 806 | Ga0496121_0194799 | 3300048924 | Bacteria | 1450 |
| 807 | Ga0496121_0216279 | 3300048924 | Bacteria | 1353 |
| 808 | Ga0496121_0413651 | 3300048924 | Bacteria | 879 |
| 809 | Ga0496122_0001302 | 3300048925 | Bacteria | 41169 |
| 810 | Ga0496122_0001656 | 3300048925 | Bacteria | 34600 |
| 811 | Ga0496122_0015581 | 3300048925 | Bacteria | 7256 |
| 812 | Ga0496122_0070871 | 3300048925 | Bacteria | 2487 |
| 813 | Ga0496122_0078710 | 3300048925 | Bacteria | 2308 |
| 814 | Ga0496122_0131977 | 3300048925 | Bacteria | 1585 |
| 815 | Ga0496123_0001454 | 3300048926 | Bacteria | 32962 |
| 816 | Ga0496123_0003614 | 3300048926 | Bacteria | 17136 |
| 817 | Ga0496123_0005223 | 3300048926 | Bacteria | 13192 |
| 818 | Ga0496123_0048070 | 3300048926 | Bacteria | 2874 |
| 819 | Ga0496123_0123319 | 3300048926 | Bacteria | 1452 |
| 820 | Ga0496123_0153197 | 3300048926 | Bacteria | 1240 |
| 821 | Ga0496124_0000204 | 3300048927 | Bacteria | 116976 |
| 822 | Ga0496124_0000861 | 3300048927 | Bacteria | 49579 |
| 823 | Ga0496124_0000988 | 3300048927 | Bacteria | 45089 |
| 824 | Ga0496124_0002175 | 3300048927 | Bacteria | 26179 |
| 825 | Ga0496124_0056740 | 3300048927 | Bacteria | 3302 |
| 826 | Ga0496124_0062229 | 3300048927 | Bacteria | 3124 |
| 827 | Ga0496124_0097847 | 3300048927 | Bacteria | 2382 |
| 828 | Ga0496124_0233617 | 3300048927 | Bacteria | 1373 |
| 829 | Ga0496124_0258241 | 3300048927 | Bacteria | 1284 |
| 830 | Ga0496125_0000841 | 3300048928 | Bacteria | 49307 |
| 831 | Ga0496125_0003958 | 3300048928 | Bacteria | 17459 |
| 832 | Ga0496125_0004293 | 3300048928 | Bacteria | 16548 |
| 833 | Ga0496125_0071000 | 3300048928 | Bacteria | 2723 |
| 834 | Ga0496125_0076091 | 3300048928 | Bacteria | 2593 |
| 835 | Ga0496125_0090717 | 3300048928 | Bacteria | 2292 |
| 836 | Ga0496125_0101131 | 3300048928 | Bacteria | 2123 |
| 837 | Ga0496125_0200646 | 3300048928 | Bacteria | 1306 |
| 838 | Ga0496126_0000066 | 3300048929 | Bacteria | 252188 |
| 839 | Ga0496126_0005496 | 3300048929 | Bacteria | 14446 |
| 840 | Ga0496126_0017234 | 3300048929 | Bacteria | 7199 |
| 841 | Ga0496126_0032656 | 3300048929 | Bacteria | 4902 |
| 842 | Ga0496126_0034196 | 3300048929 | Bacteria | 4775 |
| 843 | Ga0496126_0039311 | 3300048929 | Bacteria | 4390 |
| 844 | Ga0496126_0080413 | 3300048929 | Bacteria | 2884 |
| 845 | Ga0496126_0116161 | 3300048929 | Bacteria | 2326 |
| 846 | Ga0496126_0132632 | 3300048929 | Bacteria | 2151 |
| 847 | Ga0496126_0134066 | 3300048929 | Bacteria | 2138 |
| 848 | Ga0496126_0216201 | 3300048929 | Bacteria | 1612 |
| 849 | Ga0496126_0439538 | 3300048929 | Bacteria | 1052 |
| 850 | Ga0496126_0449882 | 3300048929 | Bacteria | 1037 |
| 851 | Ga0501032_0006654 | 3300049569 | Bacteria | 8483 |
| 852 | Ga0501032_0072599 | 3300049569 | Bacteria | 2294 |
| 853 | Ga0501033_0000471 | 3300049570 | Bacteria | 38100 |
| 854 | Ga0501033_0018472 | 3300049570 | Bacteria | 5268 |
| 855 | Ga0501033_0110068 | 3300049570 | Bacteria | 2005 |
| 856 | Ga0501033_0247601 | 3300049570 | Bacteria | 1264 |
| 857 | Ga0501034_0040304 | 3300049571 | Bacteria | 4727 |
| 858 | Ga0501034_0283137 | 3300049571 | Bacteria | 1597 |
| 859 | Ga0501036_0371046 | 3300049572 | Bacteria | 1194 |
| 860 | Ga0501037_0008873 | 3300049573 | Bacteria | 7362 |
| 861 | Ga0501038_0011583 | 3300049574 | Bacteria | 8046 |
| 862 | Ga0501039_0004382 | 3300049575 | Bacteria | 10645 |
| 863 | Ga0501041_0171979 | 3300049577 | Bacteria | 1356 |
| 864 | Ga0501042_0001444 | 3300049578 | Bacteria | 13979 |
| 865 | Ga0501042_0365522 | 3300049578 | Bacteria | 1044 |
| 866 | Ga0501043_0001496 | 3300049579 | Bacteria | 20418 |
| 867 | Ga0501043_0121079 | 3300049579 | Bacteria | 2052 |
| 868 | Ga0501043_0157870 | 3300049579 | Bacteria | 1773 |
| 869 | Ga0501043_0521033 | 3300049579 | Bacteria | 886 |
| 870 | Ga0501046_0002161 | 3300049580 | Bacteria | 18563 |
| 871 | Ga0501046_0033631 | 3300049580 | Bacteria | 4140 |
| 872 | Ga0501046_0339381 | 3300049580 | Bacteria | 1092 |
| 873 | Ga0501047_0013306 | 3300049581 | Bacteria | 7793 |
| 874 | Ga0501047_0026404 | 3300049581 | Bacteria | 5588 |
| 875 | Ga0501047_0132914 | 3300049581 | Bacteria | 2368 |
| 876 | Ga0501048_0003202 | 3300049582 | Bacteria | 12475 |
| 877 | Ga0501068_0069665 | 3300049584 | Bacteria | 2145 |
| 878 | Ga0501068_0081139 | 3300049584 | Bacteria | 1991 |
| 879 | Ga0501069_0039315 | 3300049585 | Bacteria | 2613 |
| 880 | Ga0501069_0295419 | 3300049585 | Bacteria | 949 |
| 881 | Ga0501070_0072795 | 3300049586 | Bacteria | 2844 |
| 882 | Ga0501070_0132879 | 3300049586 | Bacteria | 2055 |
| 883 | Ga0501070_0359142 | 3300049586 | Bacteria | 1182 |
| 884 | Ga0501074_0051742 | 3300049590 | Bacteria | 2964 |
| 885 | Ga0501074_0113300 | 3300049590 | Bacteria | 1940 |
| 886 | Ga0501074_0300397 | 3300049590 | Bacteria | 1140 |
| 887 | Ga0501223_000031 | 3300049663 | Bacteria | 51024 |
| 888 | Ga0501233_000027 | 3300049668 | Bacteria | 19963 |
| 889 | Ga0501225_0006588 | 3300049705 | Bacteria | 3389 |
| 890 | Ga0501225_0014677 | 3300049705 | Bacteria | 2186 |
| 891 | Ga0501080_0003940 | 3300049742 | Bacteria | 13143 |
| 892 | Ga0501080_0021921 | 3300049742 | Bacteria | 5917 |
| 893 | Ga0501080_0132729 | 3300049742 | Bacteria | 2305 |
| 894 | Ga0501035_0000184 | 3300049822 | Bacteria | 76560 |
| 895 | Ga0501035_0086193 | 3300049822 | Bacteria | 2767 |
| 896 | Ga0501035_0438108 | 3300049822 | Bacteria | 1083 |
| 897 | Ga0501044_0009899 | 3300049823 | Bacteria | 10360 |
| 898 | Ga0501044_0031820 | 3300049823 | Bacteria | 5548 |
| 899 | Ga0501044_0056476 | 3300049823 | Bacteria | 4031 |
| 900 | Ga0501045_0543177 | 3300049824 | Bacteria | 862 |
| 901 | nmdc:mga03683_18922_c1 | 3300050489 | Bacteria | 2624 |
| 902 | nmdc:mga03n38_106837_c1 | 3300050490 | Bacteria | 1358 |
| 903 | nmdc:mga03n38_19312_c1 | 3300050490 | Bacteria | 2707 |
| 904 | nmdc:mga03n38_46090_c1 | 3300050490 | Bacteria | 1923 |
| 905 | nmdc:mga00v17_45380_c1 | 3300050491 | Bacteria | 2655 |
| 906 | nmdc:mga00v17_95707_c1 | 3300050491 | Bacteria | 1870 |
| 907 | nmdc:mga0yw44_171177_c1 | 3300050492 | Bacteria | 1426 |
| 908 | nmdc:mga0yw44_19812_c1 | 3300050492 | Bacteria | 3718 |
| 909 | nmdc:mga0yw44_198383_c1 | 3300050492 | Bacteria | 1325 |
| 910 | nmdc:mga0yw44_239601_c1 | 3300050492 | Bacteria | 1205 |
| 911 | nmdc:mga0yw44_30835_c1 | 3300050492 | Bacteria | 3112 |
| 912 | nmdc:mga0yw44_35076_c1 | 3300050492 | Bacteria | 2945 |
| 913 | nmdc:mga0yw44_46356_c1 | 3300050492 | Bacteria | 2610 |
| 914 | nmdc:mga0yw44_7980_c1 | 3300050492 | Bacteria | 5248 |
| 915 | nmdc:mga0yw44_83120_c1 | 3300050492 | Bacteria | 2011 |
| 916 | nmdc:mga0k408_168650_c1 | 3300050493 | Bacteria | 1305 |
| 917 | nmdc:mga0k408_4184_c1 | 3300050493 | Bacteria | 7658 |
| 918 | nmdc:mga0k408_43269_c1 | 3300050493 | Bacteria | 2595 |
| 919 | nmdc:mga06z11_108_c1 | 3300050494 | Bacteria | 33977 |
| 920 | nmdc:mga06z11_162081_c1 | 3300050494 | Bacteria | 1279 |
| 921 | nmdc:mga06z11_18525_c1 | 3300050494 | Bacteria | 3182 |
| 922 | nmdc:mga06z11_318564_c1 | 3300050494 | Bacteria | 927 |
| 923 | nmdc:mga06z11_453005_c1 | 3300050494 | Bacteria | 775 |
| 924 | nmdc:mga06z11_58537_c1 | 3300050494 | Bacteria | 2000 |
| 925 | nmdc:mga06z11_67065_c1 | 3300050494 | Bacteria | 1888 |
| 926 | nmdc:mga04h51_10764_c1 | 3300050495 | Bacteria | 2522 |
| 927 | nmdc:mga04h51_11_c1 | 3300050495 | Bacteria | 101578 |
| 928 | nmdc:mga07m45_118389_c1 | 3300050496 | Bacteria | 1529 |
| 929 | nmdc:mga07m45_323868_c1 | 3300050496 | Bacteria | 896 |
| 930 | nmdc:mga07m45_3791_c1 | 3300050496 | Bacteria | 7316 |
| 931 | nmdc:mga07m45_41409_c1 | 3300050496 | Bacteria | 2580 |
| 932 | nmdc:mga0n895_202296_c1 | 3300050512 | Bacteria | 2016 |
| 933 | nmdc:mga0n895_62695_c1 | 3300050512 | Bacteria | 3675 |
| 934 | nmdc:mga08x19_48563_c1 | 3300050514 | Bacteria | 2719 |
| 935 | nmdc:mga0sz30_106040_c1 | 3300050516 | Bacteria | 1230 |
| 936 | nmdc:mga0sz30_17191_c1 | 3300050516 | Bacteria | 2883 |
| 937 | Ga0495601_0135539 | 3300053077 | Bacteria | 1605 |
| 938 | Ga0495601_0144005 | 3300053077 | Bacteria | 1555 |
| 939 | Ga0495612_0015011 | 3300053078 | Bacteria | 3107 |
| 940 | Ga0500610_0030564 | 3300053079 | Bacteria | 2731 |
| 941 | Ga0500635_0000497 | 3300053080 | Bacteria | 10901 |
| 942 | Ga0500635_0002088 | 3300053080 | Bacteria | 4900 |
| 943 | Ga0500635_0052409 | 3300053080 | Bacteria | 1401 |
| 944 | Ga0495655_0057445 | 3300053083 | Bacteria | 1050 |
| 945 | Ga0495595_0128276 | 3300053084 | Bacteria | 1238 |
| 946 | Ga0500578_0201782 | 3300053086 | Bacteria | 1217 |
| 947 | Ga0500578_0292072 | 3300053086 | Bacteria | 969 |
| 948 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 949 | Ga0500643_126723 | 3300053087 | Bacteria | 687 |
| 950 | Ga0500647_0004594 | 3300053091 | Bacteria | 5586 |
| 951 | Ga0500647_0023075 | 3300053091 | Bacteria | 2916 |
| 952 | Ga0500583_0024081 | 3300053092 | Bacteria | 2577 |
| 953 | Ga0500651_0054309 | 3300053093 | Bacteria | 2511 |
| 954 | Ga0500651_0097056 | 3300053093 | Bacteria | 1811 |
| 955 | Ga0500566_0000011 | 3300053094 | Bacteria | 118644 |
| 956 | Ga0500566_0000613 | 3300053094 | Bacteria | 20005 |
| 957 | Ga0500566_0049910 | 3300053094 | Bacteria | 2397 |
| 958 | Ga0500566_0198287 | 3300053094 | Bacteria | 1016 |
| 959 | Ga0500640_002917 | 3300053095 | Bacteria | 5809 |
| 960 | Ga0500650_0070352 | 3300053098 | Bacteria | 1636 |
| 961 | Ga0500555_003600 | 3300053103 | Bacteria | 4412 |
| 962 | Ga0500556_0000621 | 3300053104 | Bacteria | 22523 |
| 963 | Ga0500557_000009 | 3300053105 | Bacteria | 125806 |
| 964 | Ga0500562_009630 | 3300053108 | Bacteria | 2442 |
| 965 | Ga0500569_009092 | 3300053109 | Bacteria | 2298 |
| 966 | Ga0500572_000119 | 3300053111 | Bacteria | 26209 |
| 967 | Ga0500593_010824 | 3300053117 | Bacteria | 3837 |
| 968 | Ga0500594_0005732 | 3300053118 | Bacteria | 2762 |
| 969 | Ga0500595_000111 | 3300053119 | Bacteria | 55013 |
| 970 | Ga0500595_013847 | 3300053119 | Bacteria | 3078 |
| 971 | Ga0500595_037477 | 3300053119 | Bacteria | 1581 |
| 972 | Ga0500608_000420 | 3300053122 | Bacteria | 16146 |
| 973 | Ga0500608_001840 | 3300053122 | Bacteria | 7555 |
| 974 | Ga0500614_000712 | 3300053123 | Bacteria | 8500 |
| 975 | Ga0500614_022418 | 3300053123 | Bacteria | 1474 |
| 976 | Ga0500618_000755 | 3300053125 | Bacteria | 18296 |
| 977 | Ga0500621_159539 | 3300053126 | Bacteria | 838 |
| 978 | Ga0500626_044699 | 3300053128 | Bacteria | 1999 |
| 979 | Ga0500642_0000154 | 3300053130 | Bacteria | 28564 |
| 980 | Ga0500642_0021161 | 3300053130 | Bacteria | 2571 |
| 981 | Ga0500655_000008 | 3300053133 | Bacteria | 67575 |
| 982 | Ga0500655_022379 | 3300053133 | Bacteria | 1189 |
| 983 | Ga0500658_0049679 | 3300053134 | Bacteria | 1710 |
| 984 | Ga0500658_0230201 | 3300053134 | Bacteria | 850 |
| 985 | Ga0500559_0000335 | 3300053136 | Bacteria | 35252 |
| 986 | Ga0500559_0000891 | 3300053136 | Bacteria | 19105 |
| 987 | Ga0500559_0003742 | 3300053136 | Bacteria | 7393 |
| 988 | Ga0500559_0036328 | 3300053136 | Bacteria | 2130 |
| 989 | Ga0500559_0082526 | 3300053136 | Bacteria | 1463 |
| 990 | Ga0500559_0129670 | 3300053136 | Bacteria | 1177 |
| 991 | Ga0500564_004667 | 3300053138 | Bacteria | 5513 |
| 992 | Ga0500564_093280 | 3300053138 | Bacteria | 1338 |
| 993 | Ga0500573_0028168 | 3300053140 | Bacteria | 3234 |
| 994 | Ga0500573_0059303 | 3300053140 | Bacteria | 2193 |
| 995 | Ga0500585_099151 | 3300053144 | Bacteria | 1050 |
| 996 | Ga0500588_0032258 | 3300053146 | Bacteria | 1518 |
| 997 | Ga0500590_000889 | 3300053148 | Bacteria | 11325 |
| 998 | Ga0500590_042265 | 3300053148 | Bacteria | 2341 |
| 999 | Ga0500603_000056 | 3300053150 | Bacteria | 27646 |
| 1000 | Ga0500603_000222 | 3300053150 | Bacteria | 15001 |
| 1001 | Ga0500603_021701 | 3300053150 | Bacteria | 1582 |
| 1002 | Ga0500604_0009791 | 3300053151 | Bacteria | 2555 |
| 1003 | Ga0500620_056124 | 3300053155 | Bacteria | 1331 |
| 1004 | Ga0500624_000021 | 3300053157 | Bacteria | 117511 |
| 1005 | Ga0500630_000088 | 3300053159 | Bacteria | 29175 |
| 1006 | Ga0500630_123730 | 3300053159 | Bacteria | 1141 |
| 1007 | Ga0500638_000096 | 3300053162 | Bacteria | 16139 |
| 1008 | Ga0500638_087189 | 3300053162 | Bacteria | 1475 |
| 1009 | Ga0500638_135664 | 3300053162 | Bacteria | 1111 |
| 1010 | Ga0500639_000009 | 3300053163 | Bacteria | 139043 |
| 1011 | Ga0500639_090584 | 3300053163 | Bacteria | 1524 |
| 1012 | Ga0500636_0000228 | 3300053177 | Bacteria | 30746 |
| 1013 | Ga0500636_0106617 | 3300053177 | Bacteria | 1587 |
| 1014 | Ga0500636_0233003 | 3300053177 | Bacteria | 951 |
| 1015 | Ga0500637_0000708 | 3300053178 | Bacteria | 13298 |
| 1016 | Ga0500637_0001960 | 3300053178 | Bacteria | 8942 |
| 1017 | Ga0500637_0022686 | 3300053178 | Bacteria | 3424 |
| 1018 | Ga0500637_0083980 | 3300053178 | Bacteria | 1841 |
| 1019 | Ga0500567_004223 | 3300053723 | Bacteria | 6519 |
| 1020 | Ga0500625_000012 | 3300053729 | Bacteria | 127269 |
| 1021 | Ga0500625_000053 | 3300053729 | Bacteria | 23355 |
| 1022 | Ga0500645_011994 | 3300053730 | Bacteria | 2811 |
| 1023 | Ga0500609_003435 | 3300053731 | Bacteria | 2223 |
| 1024 | Ga0500596_000288 | 3300053735 | Bacteria | 8901 |
| 1025 | Ga0500596_022511 | 3300053735 | Bacteria | 953 |
| 1026 | Ga0500599_004512 | 3300053736 | Bacteria | 1725 |
| 1027 | Ga0500601_000488 | 3300053737 | Bacteria | 6175 |
| 1028 | Ga0500601_001930 | 3300053737 | Bacteria | 2230 |
| 1029 | Ga0500661_000582 | 3300055283 | Bacteria | 6821 |
| 1030 | Ga0501082_0875078 | 3300060353 | Bacteria | 786 |
| 1031 | Ga0466962_0122766 | 3300061719 | Bacteria | 1254 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031649 | Ga0307514_10000861 | Ga0307514_1000086129 | 194 |
| 2 | 3300037471 | Ga0395905_0624322 | Ga0395905_0624322_77_706 | 194 |
| 3 | 3300028794 | Ga0307515_10000626 | Ga0307515_100006263 | 195 |
| 4 | 3300031456 | Ga0307513_10011751 | Ga0307513_100117518 | 195 |
| 5 | 3300026035 | Ga0207703_10150352 | Ga0207703_101503522 | 197 |
| 6 | 3300005439 | Ga0070711_100093251 | Ga0070711_1000932512 | 198 |
| 7 | 3300013100 | Ga0157373_10530700 | Ga0157373_105307002 | 198 |
| 8 | 3300025916 | Ga0207663_10161919 | Ga0207663_101619192 | 198 |
| 9 | 3300031548 | Ga0307408_100007475 | Ga0307408_1000074752 | 199 |
| 10 | 3300031731 | Ga0307405_10008013 | Ga0307405_100080137 | 199 |
| 11 | 3300031824 | Ga0307413_10111485 | Ga0307413_101114852 | 199 |
| 12 | 3300031901 | Ga0307406_10024841 | Ga0307406_100248414 | 199 |
| 13 | 3300032002 | Ga0307416_100008101 | Ga0307416_1000081012 | 199 |
| 14 | 3300047322 | Ga0495680_0292367 | Ga0495680_0292367_519_1118 | 199 |
| 15 | 3300005434 | Ga0070709_10000412 | Ga0070709_100004123 | 202 |
| 16 | 3300005435 | Ga0070714_100002292 | Ga0070714_1000022929 | 202 |
| 17 | 3300005436 | Ga0070713_100000950 | Ga0070713_1000009501 | 202 |
| 18 | 3300005437 | Ga0070710_10012033 | Ga0070710_100120333 | 202 |
| 19 | 3300005439 | Ga0070711_100199402 | Ga0070711_1001994021 | 202 |
| 20 | 3300006028 | Ga0070717_10009339 | Ga0070717_100093397 | 202 |
| 21 | 3300006163 | Ga0070715_10001792 | Ga0070715_100017927 | 202 |
| 22 | 3300006173 | Ga0070716_100001697 | Ga0070716_1000016977 | 202 |
| 23 | 3300006175 | Ga0070712_100014502 | Ga0070712_1000145026 | 202 |
| 24 | 3300025898 | Ga0207692_10004793 | Ga0207692_100047933 | 202 |
| 25 | 3300025906 | Ga0207699_10005077 | Ga0207699_100050778 | 202 |
| 26 | 3300025915 | Ga0207693_10000217 | Ga0207693_1000021712 | 202 |
| 27 | 3300025916 | Ga0207663_10000151 | Ga0207663_1000015118 | 202 |
| 28 | 3300025928 | Ga0207700_10067405 | Ga0207700_100674053 | 202 |
| 29 | 3300025929 | Ga0207664_10040259 | Ga0207664_100402593 | 202 |
| 30 | 3300025939 | Ga0207665_10000493 | Ga0207665_1000049315 | 202 |
| 31 | 3300025905 | Ga0207685_10270433 | Ga0207685_102704332 | 203 |
| 32 | 3300033180 | Ga0307510_10235298 | Ga0307510_102352982 | 203 |
| 33 | iso_pu_bacteria | 2891088606 | 2891089731 | 204 |
| 34 | iso_pu_bacteria | 2945945610 | 2945950751 | 204 |
| 35 | iso_pu_bacteria | 3005587118 | 3005587367 | 204 |
| 36 | iso_pu_bacteria | 2507262055 | 2507507979 | 205 |
| 37 | iso_pu_bacteria | 2508501009 | 2508542086 | 205 |
| 38 | iso_pu_bacteria | 2508501042 | 2508692367 | 205 |
| 39 | iso_pu_bacteria | 2508501128 | 2509151083 | 205 |
| 40 | iso_pu_bacteria | 2511231028 | 2511397997 | 205 |
| 41 | iso_pu_bacteria | 2512564014 | 2512642191 | 205 |
| 42 | iso_pu_bacteria | 2513237092 | 2513622572 | 205 |
| 43 | iso_pu_bacteria | 2513237094 | 2513639405 | 205 |
| 44 | iso_pu_bacteria | 2513237095 | 2513647192 | 205 |
| 45 | iso_pu_bacteria | 2513237096 | 2513653750 | 205 |
| 46 | iso_pu_bacteria | 2513237098 | 2513671730 | 205 |
| 47 | iso_pu_bacteria | 2513237101 | 2513695568 | 205 |
| 48 | iso_pu_bacteria | 2513237101 | 2513696594 | 205 |
| 49 | iso_pu_bacteria | 2513237102 | 2513700780 | 205 |
| 50 | iso_pu_bacteria | 2513237104 | 2513715173 | 205 |
| 51 | iso_pu_bacteria | 2513237137 | 2513856187 | 205 |
| 52 | iso_pu_bacteria | 2513237139 | 2513877606 | 205 |
| 53 | iso_pu_bacteria | 2513237141 | 2513887367 | 205 |
| 54 | iso_pu_bacteria | 2513237145 | 2513918090 | 205 |
| 55 | iso_pu_bacteria | 2513237161 | 2514009751 | 205 |
| 56 | iso_pu_bacteria | 2515154112 | 2515626866 | 205 |
| 57 | iso_pu_bacteria | 2517093001 | 2517103807 | 205 |
| 58 | iso_pu_bacteria | 2517572143 | 2517891672 | 205 |
| 59 | iso_pu_bacteria | 2524023210 | 2524470112 | 205 |
| 60 | iso_pu_bacteria | 2524023210 | 2524470177 | 205 |
| 61 | iso_pu_bacteria | 2524023228 | 2524536723 | 205 |
| 62 | iso_pu_bacteria | 2528768022 | 2528850836 | 205 |
| 63 | iso_pu_bacteria | 2574179768 | 2574430755 | 205 |
| 64 | iso_pu_bacteria | 2599185354 | 2600200273 | 205 |
| 65 | iso_pu_bacteria | 2599185359 | 2600226155 | 205 |
| 66 | iso_pu_bacteria | 2617270735 | 2617346477 | 205 |
| 67 | iso_pu_bacteria | 2617270741 | 2617378582 | 205 |
| 68 | iso_pu_bacteria | 2643221609 | 2644059157 | 205 |
| 69 | iso_pu_bacteria | 2643221611 | 2644075801 | 205 |
| 70 | iso_pu_bacteria | 2713897090 | 2715501557 | 205 |
| 71 | iso_pu_bacteria | 2721755523 | 2722881597 | 205 |
| 72 | iso_pu_bacteria | 2721755755 | 2723843971 | 205 |
| 73 | iso_pu_bacteria | 2728368998 | 2728751907 | 205 |
| 74 | iso_pu_bacteria | 2738541275 | 2738712230 | 205 |
| 75 | iso_pu_bacteria | 2738541301 | 2738850655 | 205 |
| 76 | iso_pu_bacteria | 2738541304 | 2738866384 | 205 |
| 77 | iso_pu_bacteria | 2738543012 | 2739245560 | 205 |
| 78 | iso_pu_bacteria | 2738543022 | 2739298902 | 205 |
| 79 | iso_pu_bacteria | 2738543033 | 2739360580 | 205 |
| 80 | iso_pu_bacteria | 2775507255 | 2778126384 | 205 |
| 81 | iso_pu_bacteria | 2791355197 | 2793067044 | 205 |
| 82 | iso_pu_bacteria | 2791355199 | 2793081124 | 205 |
| 83 | iso_pu_bacteria | 2802429603 | 2805918384 | 205 |
| 84 | iso_pu_bacteria | 2816332133 | 2816472282 | 205 |
| 85 | iso_pu_bacteria | 2816332527 | 2818236229 | 205 |
| 86 | iso_pu_bacteria | 2818991466 | 2819712799 | 205 |
| 87 | iso_pu_bacteria | 2824600985 | 2824605318 | 205 |
| 88 | iso_pu_bacteria | 2824609381 | 2824615568 | 205 |
| 89 | iso_pu_bacteria | 2824617872 | 2824626461 | 205 |
| 90 | iso_pu_bacteria | 2824626560 | 2824634780 | 205 |
| 91 | iso_pu_bacteria | 2824635225 | 2824643739 | 205 |
| 92 | iso_pu_bacteria | 2824644064 | 2824652896 | 205 |
| 93 | iso_pu_bacteria | 2824653114 | 2824656696 | 205 |
| 94 | iso_pu_bacteria | 2824661429 | 2824670624 | 205 |
| 95 | iso_pu_bacteria | 2824671348 | 2824678726 | 205 |
| 96 | iso_pu_bacteria | 2824687955 | 2824696147 | 205 |
| 97 | iso_pu_bacteria | 2824696289 | 2824703497 | 205 |
| 98 | iso_pu_bacteria | 2824704595 | 2824714372 | 205 |
| 99 | iso_pu_bacteria | 2824714736 | 2824723583 | 205 |
| 100 | iso_pu_bacteria | 2824723954 | 2824732587 | 205 |
| 101 | iso_pu_bacteria | 2824732956 | 2824740391 | 205 |
| 102 | iso_pu_bacteria | 2824746037 | 2824752805 | 205 |
| 103 | iso_pu_bacteria | 2824753945 | 2824763330 | 205 |
| 104 | iso_pu_bacteria | 2824763712 | 2824773089 | 205 |
| 105 | iso_pu_bacteria | 2824773399 | 2824774737 | 205 |
| 106 | iso_pu_bacteria | 2834578030 | 2834579060 | 205 |
| 107 | iso_pu_bacteria | 2838122688 | 2838122983 | 205 |
| 108 | iso_pu_bacteria | 2839138175 | 2839139750 | 205 |
| 109 | iso_pu_bacteria | 2841941048 | 2841944732 | 205 |
| 110 | iso_pu_bacteria | 2841949485 | 2841955976 | 205 |
| 111 | iso_pu_bacteria | 2841957949 | 2841960028 | 205 |
| 112 | iso_pu_bacteria | 2841966195 | 2841969887 | 205 |
| 113 | iso_pu_bacteria | 2841974524 | 2841978683 | 205 |
| 114 | iso_pu_bacteria | 2841983080 | 2841984191 | 205 |
| 115 | iso_pu_bacteria | 2842038055 | 2842040332 | 205 |
| 116 | iso_pu_bacteria | 2842045827 | 2842046724 | 205 |
| 117 | iso_pu_bacteria | 2842718218 | 2842719139 | 205 |
| 118 | iso_pu_bacteria | 2844315083 | 2844319698 | 205 |
| 119 | iso_pu_bacteria | 2847930680 | 2847937019 | 205 |
| 120 | iso_pu_bacteria | 2847939898 | 2847947419 | 205 |
| 121 | iso_pu_bacteria | 2849076700 | 2849078689 | 205 |
| 122 | iso_pu_bacteria | 2857509624 | 2857513100 | 205 |
| 123 | iso_pu_bacteria | 2874590934 | 2874599072 | 205 |
| 124 | iso_pu_bacteria | 2874604998 | 2874612044 | 205 |
| 125 | iso_pu_bacteria | 2874612657 | 2874617247 | 205 |
| 126 | iso_pu_bacteria | 2874620515 | 2874626619 | 205 |
| 127 | iso_pu_bacteria | 2874628541 | 2874635338 | 205 |
| 128 | iso_pu_bacteria | 2874645413 | 2874650483 | 205 |
| 129 | iso_pu_bacteria | 2876761206 | 2876764338 | 205 |
| 130 | iso_pu_bacteria | 2876771140 | 2876779111 | 205 |
| 131 | iso_pu_bacteria | 2876818435 | 2876822715 | 205 |
| 132 | iso_pu_bacteria | 2879074833 | 2879082904 | 205 |
| 133 | iso_pu_bacteria | 2879083081 | 2879083880 | 205 |
| 134 | iso_pu_bacteria | 2879099564 | 2879106053 | 205 |
| 135 | iso_pu_bacteria | 2879110137 | 2879113969 | 205 |
| 136 | iso_pu_bacteria | 2879127579 | 2879133031 | 205 |
| 137 | iso_pu_bacteria | 2879142872 | 2879149318 | 205 |
| 138 | iso_pu_bacteria | 2879163058 | 2879165909 | 205 |
| 139 | iso_pu_bacteria | 2881364244 | 2881368110 | 205 |
| 140 | iso_pu_bacteria | 2881665667 | 2881667806 | 205 |
| 141 | iso_pu_bacteria | 2885366525 | 2885369586 | 205 |
| 142 | iso_pu_bacteria | 2885383462 | 2885389129 | 205 |
| 143 | iso_pu_bacteria | 2885409591 | 2885414791 | 205 |
| 144 | iso_pu_bacteria | 2888378607 | 2888385119 | 205 |
| 145 | iso_pu_bacteria | 2888388044 | 2888393108 | 205 |
| 146 | iso_pu_bacteria | 2888419890 | 2888425266 | 205 |
| 147 | iso_pu_bacteria | 2889033259 | 2889041861 | 205 |
| 148 | iso_pu_bacteria | 2894023352 | 2894023995 | 205 |
| 149 | iso_pu_bacteria | 2898795034 | 2898798063 | 205 |
| 150 | iso_pu_bacteria | 2899259804 | 2899261408 | 205 |
| 151 | iso_pu_bacteria | 2903727486 | 2903730621 | 205 |
| 152 | iso_pu_bacteria | 2903748898 | 2903755796 | 205 |
| 153 | iso_pu_bacteria | 2903768456 | 2903776260 | 205 |
| 154 | iso_pu_bacteria | 2904666416 | 2904671960 | 205 |
| 155 | iso_pu_bacteria | 2904690495 | 2904697881 | 205 |
| 156 | iso_pu_bacteria | 2904699407 | 2904704588 | 205 |
| 157 | iso_pu_bacteria | 2904711408 | 2904712316 | 205 |
| 158 | iso_pu_bacteria | 2906602504 | 2906609571 | 205 |
| 159 | iso_pu_bacteria | 2906610324 | 2906616845 | 205 |
| 160 | iso_pu_bacteria | 2906626472 | 2906628884 | 205 |
| 161 | iso_pu_bacteria | 2906635258 | 2906642886 | 205 |
| 162 | iso_pu_bacteria | 2906643746 | 2906649868 | 205 |
| 163 | iso_pu_bacteria | 2906660503 | 2906667176 | 205 |
| 164 | iso_pu_bacteria | 2908756301 | 2908759704 | 205 |
| 165 | iso_pu_bacteria | 2908775508 | 2908780826 | 205 |
| 166 | iso_pu_bacteria | 2919138771 | 2919140963 | 205 |
| 167 | iso_pu_bacteria | 2922361189 | 2922366318 | 205 |
| 168 | iso_pu_bacteria | 2922368715 | 2922372765 | 205 |
| 169 | iso_pu_bacteria | 2922386360 | 2922386624 | 205 |
| 170 | iso_pu_bacteria | 2922425934 | 2922431082 | 205 |
| 171 | iso_pu_bacteria | 2928027323 | 2928030438 | 205 |
| 172 | iso_pu_bacteria | 2928100450 | 2928102718 | 205 |
| 173 | iso_pu_bacteria | 2928959182 | 2928959197 | 205 |
| 174 | iso_pu_bacteria | 2928968154 | 2928969124 | 205 |
| 175 | iso_pu_bacteria | 2929615660 | 2929620587 | 205 |
| 176 | iso_pu_bacteria | 2929624759 | 2929626481 | 205 |
| 177 | iso_pu_bacteria | 2932784394 | 2932784652 | 205 |
| 178 | iso_pu_bacteria | 2932794094 | 2932795446 | 205 |
| 179 | iso_pu_bacteria | 2932801729 | 2932807960 | 205 |
| 180 | iso_pu_bacteria | 2932809354 | 2932809632 | 205 |
| 181 | iso_pu_bacteria | 2932818245 | 2932818625 | 205 |
| 182 | iso_pu_bacteria | 2932828146 | 2932828420 | 205 |
| 183 | iso_pu_bacteria | 2933577622 | 2933582504 | 205 |
| 184 | iso_pu_bacteria | 2935608549 | 2935609525 | 205 |
| 185 | iso_pu_bacteria | 2935616580 | 2935617393 | 205 |
| 186 | iso_pu_bacteria | 2935638405 | 2935639125 | 205 |
| 187 | iso_pu_bacteria | 2935648319 | 2935652324 | 205 |
| 188 | iso_pu_bacteria | 2935656913 | 2935660906 | 205 |
| 189 | iso_pu_bacteria | 2935665750 | 2935666023 | 205 |
| 190 | iso_pu_bacteria | 2935675223 | 2935675671 | 205 |
| 191 | iso_pu_bacteria | 2935684952 | 2935685320 | 205 |
| 192 | iso_pu_bacteria | 2935694250 | 2935698569 | 205 |
| 193 | iso_pu_bacteria | 2935703347 | 2935704132 | 205 |
| 194 | iso_pu_bacteria | 2935713505 | 2935713873 | 205 |
| 195 | iso_pu_bacteria | 2935722832 | 2935724492 | 205 |
| 196 | iso_pu_bacteria | 2935732158 | 2935733150 | 205 |
| 197 | iso_pu_bacteria | 2935741537 | 2935742529 | 205 |
| 198 | iso_pu_bacteria | 2935750917 | 2935751285 | 205 |
| 199 | iso_pu_bacteria | 2935760218 | 2935765944 | 205 |
| 200 | iso_pu_bacteria | 2935769743 | 2935769925 | 205 |
| 201 | iso_pu_bacteria | 2935777560 | 2935782055 | 205 |
| 202 | iso_pu_bacteria | 2935785616 | 2935785833 | 205 |
| 203 | iso_pu_bacteria | 2935793552 | 2935794239 | 205 |
| 204 | iso_pu_bacteria | 2935801545 | 2935802215 | 205 |
| 205 | iso_pu_bacteria | 2935810662 | 2935811039 | 205 |
| 206 | iso_pu_bacteria | 2935819856 | 2935822687 | 205 |
| 207 | iso_pu_bacteria | 2935827899 | 2935828620 | 205 |
| 208 | iso_pu_bacteria | 2935837841 | 2935839996 | 205 |
| 209 | iso_pu_bacteria | 2935847175 | 2935848269 | 205 |
| 210 | iso_pu_bacteria | 2935855204 | 2935856018 | 205 |
| 211 | iso_pu_bacteria | 2935864058 | 2935866038 | 205 |
| 212 | iso_pu_bacteria | 2935873716 | 2935877637 | 205 |
| 213 | iso_pu_bacteria | 2935883170 | 2935883654 | 205 |
| 214 | iso_pu_bacteria | 2935908558 | 2935909928 | 205 |
| 215 | iso_pu_bacteria | 2935916978 | 2935917654 | 205 |
| 216 | iso_pu_bacteria | 2935926038 | 2935927408 | 205 |
| 217 | iso_pu_bacteria | 2935934488 | 2935936747 | 205 |
| 218 | iso_pu_bacteria | 2935942939 | 2935944950 | 205 |
| 219 | iso_pu_bacteria | 2935951376 | 2935953387 | 205 |
| 220 | iso_pu_bacteria | 2935959822 | 2935961120 | 205 |
| 221 | iso_pu_bacteria | 2935967501 | 2935970227 | 205 |
| 222 | iso_pu_bacteria | 2935975950 | 2935981048 | 205 |
| 223 | iso_pu_bacteria | 2935984226 | 2935986795 | 205 |
| 224 | iso_pu_bacteria | 2935992306 | 2935992581 | 205 |
| 225 | iso_pu_bacteria | 2936002035 | 2936002453 | 205 |
| 226 | iso_pu_bacteria | 2936011229 | 2936014962 | 205 |
| 227 | iso_pu_bacteria | 2936019824 | 2936022057 | 205 |
| 228 | iso_pu_bacteria | 2936028420 | 2936032745 | 205 |
| 229 | iso_pu_bacteria | 2936037263 | 2936037542 | 205 |
| 230 | iso_pu_bacteria | 2936046547 | 2936050703 | 205 |
| 231 | iso_pu_bacteria | 2936055302 | 2936059520 | 205 |
| 232 | iso_pu_bacteria | 2940556831 | 2940557913 | 205 |
| 233 | iso_pu_bacteria | 2941531003 | 2941536756 | 205 |
| 234 | iso_pu_bacteria | 2941538514 | 2941540664 | 205 |
| 235 | iso_pu_bacteria | 2946787523 | 2946788598 | 205 |
| 236 | iso_pu_bacteria | 2974320154 | 2974324223 | 205 |
| 237 | iso_pu_bacteria | 2984555340 | 2984557365 | 205 |
| 238 | iso_pu_bacteria | 2984564862 | 2984568238 | 205 |
| 239 | iso_pu_bacteria | 2990265787 | 2990267977 | 205 |
| 240 | iso_pu_bacteria | 2993356040 | 2993359318 | 205 |
| 241 | iso_pu_bacteria | 2993693658 | 2993697004 | 205 |
| 242 | iso_pu_bacteria | 3000017691 | 3000018470 | 205 |
| 243 | iso_pu_bacteria | 3005474847 | 3005480904 | 205 |
| 244 | iso_pu_bacteria | 3005483717 | 3005485070 | 205 |
| 245 | iso_pu_bacteria | 3005506211 | 3005507409 | 205 |
| 246 | iso_pu_bacteria | 3005594810 | 3005599926 | 205 |
| 247 | iso_pu_bacteria | 3005710791 | 3005715520 | 205 |
| 248 | iso_pu_bacteria | 3005718088 | 3005722856 | 205 |
| 249 | iso_pu_bacteria | 8006926726 | 8006930662 | 205 |
| 250 | iso_pu_bacteria | 8006933436 | 8006939806 | 205 |
| 251 | iso_pu_bacteria | 8006964411 | 8006970930 | 205 |
| 252 | iso_pu_bacteria | 8006973647 | 8006979575 | 205 |
| 253 | iso_pu_bacteria | 8006984368 | 8006990313 | 205 |
| 254 | iso_pu_bacteria | 8006994254 | 8006999337 | 205 |
| 255 | iso_pu_bacteria | 8016511872 | 8016521097 | 205 |
| 256 | iso_pu_bacteria | 8016522445 | 8016528993 | 205 |
| 257 | iso_pu_bacteria | 8016530956 | 8016534194 | 205 |
| 258 | iso_pu_bacteria | 8016548790 | 8016554717 | 205 |
| 259 | iso_pu_bacteria | 8016557553 | 8016563089 | 205 |
| 260 | iso_pu_bacteria | 8016566248 | 8016572536 | 205 |
| 261 | iso_pu_bacteria | 8016575299 | 8016576704 | 205 |
| 262 | iso_pu_bacteria | 8016583857 | 8016593790 | 205 |
| 263 | iso_pu_bacteria | 8016595262 | 8016600846 | 205 |
| 264 | iso_pu_bacteria | 8016603502 | 8016609647 | 205 |
| 265 | iso_pu_bacteria | 8016613128 | 8016615281 | 205 |
| 266 | iso_pu_bacteria | 8016622563 | 8016625927 | 205 |
| 267 | iso_pu_bacteria | 8016630954 | 8016639509 | 205 |
| 268 | iso_pu_bacteria | 8017057580 | 8017064510 | 205 |
| 269 | iso_pu_bacteria | 8019530166 | 8019533966 | 205 |
| 270 | iso_pu_bacteria | 8019538911 | 8019545705 | 205 |
| 271 | iso_pu_bacteria | 8019547302 | 8019553008 | 205 |
| 272 | iso_pu_bacteria | 8019576017 | 8019583875 | 205 |
| 273 | iso_pu_bacteria | 8019586578 | 8019591686 | 205 |
| 274 | iso_pu_bacteria | 8019597564 | 8019599650 | 205 |
| 275 | iso_pu_bacteria | 8019608314 | 8019618899 | 205 |
| 276 | iso_pu_bacteria | 8019619141 | 8019619486 | 205 |
| 277 | iso_pu_bacteria | 8019638758 | 8019646270 | 205 |
| 278 | iso_pu_bacteria | 8019648815 | 8019649022 | 205 |
| 279 | iso_pu_bacteria | 8019659431 | 8019661513 | 205 |
| 280 | iso_pu_bacteria | 8019668869 | 8019671046 | 205 |
| 281 | iso_pu_bacteria | 8019687851 | 8019690736 | 205 |
| 282 | iso_pu_bacteria | 8055742211 | 8055745449 | 205 |
| 283 | iso_pu_bacteria | 8056673599 | 8056680042 | 205 |
| 284 | iso_pu_bacteria | 8056681323 | 8056687865 | 205 |
| 285 | iso_pu_bacteria | 8056967851 | 8056968713 | 205 |
| 286 | iso_pu_bacteria | 2739367898 | 2740165810 | 206 |
| 287 | 3300005719 | Ga0068861_100919204 | Ga0068861_1009192041 | 207 |
| 288 | 3300003578 | Ga0006562J51391_1080078 | Ga0006562J51391_10800782 | 208 |
| 289 | 3300003790 | Ga0055528_1042532 | Ga0055528_10425321 | 208 |
| 290 | 3300005288 | Ga0065714_10004054 | Ga0065714_100040545 | 208 |
| 291 | 3300005329 | Ga0070683_100214615 | Ga0070683_1002146152 | 208 |
| 292 | 3300005367 | Ga0070667_100028009 | Ga0070667_1000280093 | 208 |
| 293 | 3300005434 | Ga0070709_10124190 | Ga0070709_101241902 | 208 |
| 294 | 3300005435 | Ga0070714_100011447 | Ga0070714_1000114472 | 208 |
| 295 | 3300005435 | Ga0070714_100036225 | Ga0070714_1000362252 | 208 |
| 296 | 3300005436 | Ga0070713_100386640 | Ga0070713_1003866402 | 208 |
| 297 | 3300005459 | Ga0068867_100119352 | Ga0068867_1001193523 | 208 |
| 298 | 3300005614 | Ga0068856_100189219 | Ga0068856_1001892192 | 208 |
| 299 | 3300005616 | Ga0068852_100147625 | Ga0068852_1001476253 | 208 |
| 300 | 3300005840 | Ga0068870_10070566 | Ga0068870_100705662 | 208 |
| 301 | 3300005843 | Ga0068860_100003099 | Ga0068860_10000309915 | 208 |
| 302 | 3300006038 | Ga0075365_10051078 | Ga0075365_100510782 | 208 |
| 303 | 3300006038 | Ga0075365_10100633 | Ga0075365_101006332 | 208 |
| 304 | 3300006038 | Ga0075365_10118731 | Ga0075365_101187312 | 208 |
| 305 | 3300006038 | Ga0075365_10218650 | Ga0075365_102186502 | 208 |
| 306 | 3300006042 | Ga0075368_10002064 | Ga0075368_100020644 | 208 |
| 307 | 3300006048 | Ga0075363_100002734 | Ga0075363_1000027345 | 208 |
| 308 | 3300006048 | Ga0075363_100190554 | Ga0075363_1001905542 | 208 |
| 309 | 3300006051 | Ga0075364_10009420 | Ga0075364_100094205 | 208 |
| 310 | 3300006051 | Ga0075364_10089644 | Ga0075364_100896442 | 208 |
| 311 | 3300006051 | Ga0075364_10122661 | Ga0075364_101226612 | 208 |
| 312 | 3300006051 | Ga0075364_10129192 | Ga0075364_101291923 | 208 |
| 313 | 3300006058 | Ga0075432_10000947 | Ga0075432_100009476 | 208 |
| 314 | 3300006178 | Ga0075367_10008575 | Ga0075367_100085753 | 208 |
| 315 | 3300006178 | Ga0075367_10206064 | Ga0075367_102060642 | 208 |
| 316 | 3300006353 | Ga0075370_10193655 | Ga0075370_101936552 | 208 |
| 317 | 3300009098 | Ga0105245_10843520 | Ga0105245_108435202 | 208 |
| 318 | 3300014497 | Ga0182008_10068896 | Ga0182008_100688962 | 208 |
| 319 | 3300020081 | Ga0206354_11418476 | Ga0206354_114184762 | 208 |
| 320 | 3300020082 | Ga0206353_12023448 | Ga0206353_120234484 | 208 |
| 321 | 3300020610 | Ga0154015_1264598 | Ga0154015_12645982 | 208 |
| 322 | 3300021388 | Ga0213875_10079341 | Ga0213875_100793412 | 208 |
| 323 | 3300025273 | Ga0209673_1001167 | Ga0209673_100116727 | 208 |
| 324 | 3300025906 | Ga0207699_10053444 | Ga0207699_100534442 | 208 |
| 325 | 3300025915 | Ga0207693_10741960 | Ga0207693_107419601 | 208 |
| 326 | 3300025928 | Ga0207700_10005260 | Ga0207700_100052605 | 208 |
| 327 | 3300025928 | Ga0207700_10433784 | Ga0207700_104337842 | 208 |
| 328 | 3300025929 | Ga0207664_10013911 | Ga0207664_100139114 | 208 |
| 329 | 3300025929 | Ga0207664_10015966 | Ga0207664_100159661 | 208 |
| 330 | 3300025935 | Ga0207709_10639423 | Ga0207709_106394231 | 208 |
| 331 | 3300025942 | Ga0207689_10113725 | Ga0207689_101137252 | 208 |
| 332 | 3300025986 | Ga0207658_10057561 | Ga0207658_100575614 | 208 |
| 333 | 3300026078 | Ga0207702_10156921 | Ga0207702_101569212 | 208 |
| 334 | 3300026142 | Ga0207698_10067408 | Ga0207698_100674083 | 208 |
| 335 | 3300026142 | Ga0207698_11307182 | Ga0207698_113071821 | 208 |
| 336 | 3300027866 | Ga0209813_10186011 | Ga0209813_101860111 | 208 |
| 337 | 3300027907 | Ga0207428_10113849 | Ga0207428_101138493 | 208 |
| 338 | 3300028381 | Ga0268264_10000980 | Ga0268264_100009804 | 208 |
| 339 | 3300037312 | Ga0395899_0039807 | Ga0395899_0039807_1970_2635 | 208 |
| 340 | 3300037418 | Ga0395900_0055181 | Ga0395900_0055181_2016_2681 | 208 |
| 341 | 3300037418 | Ga0395900_0062858 | Ga0395900_0062858_678_1349 | 208 |
| 342 | 3300037418 | Ga0395900_0064716 | Ga0395900_0064716_1750_2415 | 208 |
| 343 | 3300037418 | Ga0395900_0221809 | Ga0395900_0221809_466_1131 | 208 |
| 344 | 3300037466 | Ga0395898_0050420 | Ga0395898_0050420_756_1421 | 208 |
| 345 | 3300037466 | Ga0395898_0144970 | Ga0395898_0144970_862_1527 | 208 |
| 346 | 3300037471 | Ga0395905_0010197 | Ga0395905_0010197_5967_6632 | 208 |
| 347 | 3300037853 | Ga0436364_0341967 | Ga0436364_0341967_1276_1947 | 208 |
| 348 | 3300037853 | Ga0436364_0476301 | Ga0436364_0476301_223_858 | 208 |
| 349 | 3300037853 | Ga0436364_0752290 | Ga0436364_0752290_205_831 | 208 |
| 350 | 3300038443 | Ga0395901_0091636 | Ga0395901_0091636_389_1054 | 208 |
| 351 | 3300038443 | Ga0395901_0343297 | Ga0395901_0343297_735_1400 | 208 |
| 352 | 3300041404 | Ga0439436_0024372 | Ga0439436_0024372_1047_1712 | 208 |
| 353 | 3300041452 | Ga0451793_1165256 | Ga0451793_1165256_1433_2089 | 208 |
| 354 | 3300041453 | Ga0451797_1163837 | Ga0451797_1163837_342_995 | 208 |
| 355 | 3300041491 | Ga0451833_0257326 | Ga0451833_0257326_291_968 | 208 |
| 356 | 3300041491 | Ga0451833_0290422 | Ga0451833_0290422_455_1111 | 208 |
| 357 | 3300041491 | Ga0451833_0896395 | Ga0451833_0896395_2179_2835 | 208 |
| 358 | 3300041494 | Ga0451837_1397189 | Ga0451837_1397189_3503_4159 | 208 |
| 359 | 3300041496 | Ga0451839_0842413 | Ga0451839_0842413_1223_1879 | 208 |
| 360 | 3300041512 | Ga0451853_0261175 | Ga0451853_0261175_54_719 | 208 |
| 361 | 3300042004 | Ga0439445_0007938 | Ga0439445_0007938_801_1484 | 208 |
| 362 | 3300042146 | Ga0450907_007576 | Ga0450907_007576_332_997 | 208 |
| 363 | 3300044658 | Ga0466972_0017113 | Ga0466972_0017113_2423_3088 | 208 |
| 364 | 3300044658 | Ga0466972_0169946 | Ga0466972_0169946_40_735 | 208 |
| 365 | 3300044684 | Ga0466966_0292965 | Ga0466966_0292965_212_880 | 208 |
| 366 | 3300044765 | Ga0466970_0054266 | Ga0466970_0054266_303_998 | 208 |
| 367 | 3300044765 | Ga0466970_0058552 | Ga0466970_0058552_764_1432 | 208 |
| 368 | 3300044765 | Ga0466970_0077125 | Ga0466970_0077125_123_791 | 208 |
| 369 | 3300044842 | Ga0466957_0309867 | Ga0466957_0309867_128_796 | 208 |
| 370 | 3300044901 | Ga0466960_0090662 | Ga0466960_0090662_75_770 | 208 |
| 371 | 3300044901 | Ga0466960_0117920 | Ga0466960_0117920_32_697 | 208 |
| 372 | 3300045976 | Ga0466967_0057572 | Ga0466967_0057572_1861_2529 | 208 |
| 373 | 3300046477 | Ga0495664_0161810 | Ga0495664_0161810_236_901 | 208 |
| 374 | 3300046660 | Ga0495625_0000238 | Ga0495625_0000238_10362_10988 | 208 |
| 375 | 3300046663 | Ga0495635_0089364 | Ga0495635_0089364_1023_1688 | 208 |
| 376 | 3300048903 | Ga0496100_0158966 | Ga0496100_0158966_511_1137 | 208 |
| 377 | 3300048905 | Ga0496102_0098004 | Ga0496102_0098004_1680_2348 | 208 |
| 378 | 3300048907 | Ga0496104_0575930 | Ga0496104_0575930_364_990 | 208 |
| 379 | 3300048908 | Ga0496105_0074881 | Ga0496105_0074881_662_1348 | 208 |
| 380 | 3300048911 | Ga0496108_0845861 | Ga0496108_0845861_21_689 | 208 |
| 381 | 3300048912 | Ga0496109_0465790 | Ga0496109_0465790_40_708 | 208 |
| 382 | 3300048913 | Ga0496110_0149483 | Ga0496110_0149483_972_1640 | 208 |
| 383 | 3300048913 | Ga0496110_0296096 | Ga0496110_0296096_570_1235 | 208 |
| 384 | 3300048914 | Ga0496111_0042941 | Ga0496111_0042941_915_1580 | 208 |
| 385 | 3300048915 | Ga0496112_0033125 | Ga0496112_0033125_3127_3753 | 208 |
| 386 | 3300048916 | Ga0496113_0226339 | Ga0496113_0226339_219_887 | 208 |
| 387 | 3300048927 | Ga0496124_0056740 | Ga0496124_0056740_713_1378 | 208 |
| 388 | 3300048929 | Ga0496126_0039311 | Ga0496126_0039311_2217_2909 | 208 |
| 389 | 3300049569 | Ga0501032_0006654 | Ga0501032_0006654_1087_1752 | 208 |
| 390 | 3300049569 | Ga0501032_0072599 | Ga0501032_0072599_917_1585 | 208 |
| 391 | 3300049570 | Ga0501033_0000471 | Ga0501033_0000471_30640_31305 | 208 |
| 392 | 3300049570 | Ga0501033_0018472 | Ga0501033_0018472_340_1008 | 208 |
| 393 | 3300049570 | Ga0501033_0110068 | Ga0501033_0110068_436_1101 | 208 |
| 394 | 3300049571 | Ga0501034_0040304 | Ga0501034_0040304_1404_2072 | 208 |
| 395 | 3300049571 | Ga0501034_0283137 | Ga0501034_0283137_789_1454 | 208 |
| 396 | 3300049572 | Ga0501036_0371046 | Ga0501036_0371046_428_1093 | 208 |
| 397 | 3300049573 | Ga0501037_0008873 | Ga0501037_0008873_3770_4435 | 208 |
| 398 | 3300049574 | Ga0501038_0011583 | Ga0501038_0011583_7258_7923 | 208 |
| 399 | 3300049575 | Ga0501039_0004382 | Ga0501039_0004382_4639_5304 | 208 |
| 400 | 3300049577 | Ga0501041_0171979 | Ga0501041_0171979_82_747 | 208 |
| 401 | 3300049578 | Ga0501042_0001444 | Ga0501042_0001444_8545_9210 | 208 |
| 402 | 3300049578 | Ga0501042_0365522 | Ga0501042_0365522_112_777 | 208 |
| 403 | 3300049579 | Ga0501043_0001496 | Ga0501043_0001496_4456_5121 | 208 |
| 404 | 3300049579 | Ga0501043_0121079 | Ga0501043_0121079_551_1216 | 208 |
| 405 | 3300049579 | Ga0501043_0157870 | Ga0501043_0157870_852_1517 | 208 |
| 406 | 3300049579 | Ga0501043_0521033 | Ga0501043_0521033_52_720 | 208 |
| 407 | 3300049580 | Ga0501046_0002161 | Ga0501046_0002161_981_1646 | 208 |
| 408 | 3300049580 | Ga0501046_0033631 | Ga0501046_0033631_1099_1764 | 208 |
| 409 | 3300049580 | Ga0501046_0339381 | Ga0501046_0339381_276_944 | 208 |
| 410 | 3300049581 | Ga0501047_0013306 | Ga0501047_0013306_868_1533 | 208 |
| 411 | 3300049581 | Ga0501047_0026404 | Ga0501047_0026404_2694_3362 | 208 |
| 412 | 3300049582 | Ga0501048_0003202 | Ga0501048_0003202_4984_5649 | 208 |
| 413 | 3300049584 | Ga0501068_0069665 | Ga0501068_0069665_233_901 | 208 |
| 414 | 3300049584 | Ga0501068_0081139 | Ga0501068_0081139_235_891 | 208 |
| 415 | 3300049585 | Ga0501069_0039315 | Ga0501069_0039315_840_1505 | 208 |
| 416 | 3300049585 | Ga0501069_0295419 | Ga0501069_0295419_209_874 | 208 |
| 417 | 3300049586 | Ga0501070_0132879 | Ga0501070_0132879_1207_1872 | 208 |
| 418 | 3300049586 | Ga0501070_0359142 | Ga0501070_0359142_160_825 | 208 |
| 419 | 3300049590 | Ga0501074_0051742 | Ga0501074_0051742_473_1138 | 208 |
| 420 | 3300049590 | Ga0501074_0300397 | Ga0501074_0300397_449_1114 | 208 |
| 421 | 3300049742 | Ga0501080_0003940 | Ga0501080_0003940_8747_9412 | 208 |
| 422 | 3300049742 | Ga0501080_0021921 | Ga0501080_0021921_5135_5800 | 208 |
| 423 | 3300049822 | Ga0501035_0000184 | Ga0501035_0000184_72655_73323 | 208 |
| 424 | 3300049822 | Ga0501035_0086193 | Ga0501035_0086193_895_1560 | 208 |
| 425 | 3300049822 | Ga0501035_0438108 | Ga0501035_0438108_123_785 | 208 |
| 426 | 3300049823 | Ga0501044_0009899 | Ga0501044_0009899_8307_8975 | 208 |
| 427 | 3300049823 | Ga0501044_0031820 | Ga0501044_0031820_3398_4063 | 208 |
| 428 | 3300049824 | Ga0501045_0543177 | Ga0501045_0543177_65_730 | 208 |
| 429 | 3300050489 | nmdc:mga03683_18922_c1 | nmdc:mga03683_18922_c1_853_1479 | 208 |
| 430 | 3300050490 | nmdc:mga03n38_106837_c1 | nmdc:mga03n38_106837_c1_585_1211 | 208 |
| 431 | 3300050490 | nmdc:mga03n38_19312_c1 | nmdc:mga03n38_19312_c1_970_1635 | 208 |
| 432 | 3300050491 | nmdc:mga00v17_45380_c1 | nmdc:mga00v17_45380_c1_1317_1982 | 208 |
| 433 | 3300050491 | nmdc:mga00v17_95707_c1 | nmdc:mga00v17_95707_c1_472_1098 | 208 |
| 434 | 3300050492 | nmdc:mga0yw44_19812_c1 | nmdc:mga0yw44_19812_c1_439_1104 | 208 |
| 435 | 3300050492 | nmdc:mga0yw44_198383_c1 | nmdc:mga0yw44_198383_c1_185_850 | 208 |
| 436 | 3300050492 | nmdc:mga0yw44_7980_c1 | nmdc:mga0yw44_7980_c1_40_666 | 208 |
| 437 | 3300050492 | nmdc:mga0yw44_83120_c1 | nmdc:mga0yw44_83120_c1_245_910 | 208 |
| 438 | 3300050493 | nmdc:mga0k408_43269_c1 | nmdc:mga0k408_43269_c1_823_1449 | 208 |
| 439 | 3300050494 | nmdc:mga06z11_453005_c1 | nmdc:mga06z11_453005_c1_65_730 | 208 |
| 440 | 3300050494 | nmdc:mga06z11_58537_c1 | nmdc:mga06z11_58537_c1_23_688 | 208 |
| 441 | 3300050494 | nmdc:mga06z11_67065_c1 | nmdc:mga06z11_67065_c1_25_651 | 208 |
| 442 | 3300050495 | nmdc:mga04h51_10764_c1 | nmdc:mga04h51_10764_c1_23_688 | 208 |
| 443 | 3300053104 | Ga0500556_0000621 | Ga0500556_0000621_14910_15587 | 208 |
| 444 | 3300053117 | Ga0500593_010824 | Ga0500593_010824_2355_3020 | 208 |
| 445 | 3300060353 | Ga0501082_0875078 | Ga0501082_0875078_52_717 | 208 |
| 446 | iso_pu_bacteria | 2501939600 | 2501943015 | 208 |
| 447 | iso_pu_bacteria | 2643221561 | 2643823970 | 208 |
| 448 | iso_pu_bacteria | 2643221576 | 2643891255 | 208 |
| 449 | iso_pu_bacteria | 2643221590 | 2643960303 | 208 |
| 450 | iso_pu_bacteria | 2643221604 | 2644036263 | 208 |
| 451 | iso_pu_bacteria | 2643221615 | 2644088953 | 208 |
| 452 | iso_pu_bacteria | 2643221617 | 2644101967 | 208 |
| 453 | iso_pu_bacteria | 2643221620 | 2644115190 | 208 |
| 454 | iso_pu_bacteria | 2643221657 | 2644318798 | 208 |
| 455 | iso_pu_bacteria | 2643221697 | 2644538945 | 208 |
| 456 | iso_pu_bacteria | 2738541305 | 2738870159 | 208 |
| 457 | iso_pu_bacteria | 2811994874 | 2812333478 | 208 |
| 458 | iso_pu_bacteria | 2856858025 | 2856863807 | 208 |
| 459 | iso_pu_bacteria | 2857481737 | 2857481992 | 208 |
| 460 | iso_pu_bacteria | 2984592036 | 2984592600 | 208 |
| 461 | iso_pu_bacteria | 649633069 | 649814464 | 208 |
| 462 | 2162886007 | SwRhRL2b_contig_891765 | SwRhRL2b_0885.00003280 | 209 |
| 463 | 3300001915 | JGI24741J21665_1001372 | JGI24741J21665_10013728 | 209 |
| 464 | 3300001979 | JGI24740J21852_10001088 | JGI24740J21852_100010887 | 209 |
| 465 | 3300001989 | JGI24739J22299_10004944 | JGI24739J22299_100049442 | 209 |
| 466 | 3300001990 | JGI24737J22298_10001478 | JGI24737J22298_100014785 | 209 |
| 467 | 3300002067 | JGI24735J21928_10003371 | JGI24735J21928_100033715 | 209 |
| 468 | 3300002075 | JGI24738J21930_10002858 | JGI24738J21930_100028585 | 209 |
| 469 | 3300003215 | JGI25153J46596_10015897 | JGI25153J46596_100158973 | 209 |
| 470 | 3300003354 | JGI25160J50197_1000991 | JGI25160J50197_10009914 | 209 |
| 471 | 3300003775 | Ga0055524_1031628 | Ga0055524_10316282 | 209 |
| 472 | 3300003794 | Ga0055531_10007448 | Ga0055531_100074483 | 209 |
| 473 | 3300004625 | Ga0055543_1010842 | Ga0055543_10108422 | 209 |
| 474 | 3300005262 | Ga0065165_1000420 | Ga0065165_100042052 | 209 |
| 475 | 3300005262 | Ga0065165_1000556 | Ga0065165_100055643 | 209 |
| 476 | 3300005262 | Ga0065165_1002861 | Ga0065165_10028615 | 209 |
| 477 | 3300005262 | Ga0065165_1018469 | Ga0065165_10184692 | 209 |
| 478 | 3300005262 | Ga0065165_1022530 | Ga0065165_10225301 | 209 |
| 479 | 3300005289 | Ga0065704_10073969 | Ga0065704_100739694 | 209 |
| 480 | 3300005289 | Ga0065704_10098518 | Ga0065704_100985183 | 209 |
| 481 | 3300005327 | Ga0070658_10011650 | Ga0070658_100116504 | 209 |
| 482 | 3300005331 | Ga0070670_100158239 | Ga0070670_1001582393 | 209 |
| 483 | 3300005334 | Ga0068869_100011273 | Ga0068869_1000112738 | 209 |
| 484 | 3300005334 | Ga0068869_100505077 | Ga0068869_1005050772 | 209 |
| 485 | 3300005335 | Ga0070666_10630426 | Ga0070666_106304261 | 209 |
| 486 | 3300005336 | Ga0070680_100127183 | Ga0070680_1001271832 | 209 |
| 487 | 3300005336 | Ga0070680_100144897 | Ga0070680_1001448973 | 209 |
| 488 | 3300005339 | Ga0070660_100108655 | Ga0070660_1001086553 | 209 |
| 489 | 3300005343 | Ga0070687_100771303 | Ga0070687_1007713031 | 209 |
| 490 | 3300005347 | Ga0070668_100000159 | Ga0070668_10000015918 | 209 |
| 491 | 3300005347 | Ga0070668_100012970 | Ga0070668_1000129703 | 209 |
| 492 | 3300005347 | Ga0070668_100042914 | Ga0070668_1000429143 | 209 |
| 493 | 3300005347 | Ga0070668_100060893 | Ga0070668_1000608931 | 209 |
| 494 | 3300005347 | Ga0070668_100070156 | Ga0070668_1000701563 | 209 |
| 495 | 3300005353 | Ga0070669_100000502 | Ga0070669_10000050212 | 209 |
| 496 | 3300005353 | Ga0070669_100008694 | Ga0070669_1000086944 | 209 |
| 497 | 3300005353 | Ga0070669_100047738 | Ga0070669_1000477383 | 209 |
| 498 | 3300005353 | Ga0070669_100431815 | Ga0070669_1004318151 | 209 |
| 499 | 3300005355 | Ga0070671_100072841 | Ga0070671_1000728414 | 209 |
| 500 | 3300005355 | Ga0070671_100093311 | Ga0070671_1000933113 | 209 |
| 501 | 3300005366 | Ga0070659_100101177 | Ga0070659_1001011772 | 209 |
| 502 | 3300005366 | Ga0070659_100225312 | Ga0070659_1002253122 | 209 |
| 503 | 3300005367 | Ga0070667_100000120 | Ga0070667_10000012034 | 209 |
| 504 | 3300005367 | Ga0070667_100185115 | Ga0070667_1001851152 | 209 |
| 505 | 3300005367 | Ga0070667_100272476 | Ga0070667_1002724762 | 209 |
| 506 | 3300005434 | Ga0070709_10024335 | Ga0070709_100243352 | 209 |
| 507 | 3300005434 | Ga0070709_10048056 | Ga0070709_100480563 | 209 |
| 508 | 3300005435 | Ga0070714_100034015 | Ga0070714_1000340152 | 209 |
| 509 | 3300005435 | Ga0070714_100362590 | Ga0070714_1003625902 | 209 |
| 510 | 3300005436 | Ga0070713_100064714 | Ga0070713_1000647142 | 209 |
| 511 | 3300005436 | Ga0070713_100230108 | Ga0070713_1002301082 | 209 |
| 512 | 3300005436 | Ga0070713_100506776 | Ga0070713_1005067762 | 209 |
| 513 | 3300005437 | Ga0070710_10016226 | Ga0070710_100162263 | 209 |
| 514 | 3300005437 | Ga0070710_10068077 | Ga0070710_100680772 | 209 |
| 515 | 3300005437 | Ga0070710_10181543 | Ga0070710_101815432 | 209 |
| 516 | 3300005437 | Ga0070710_10285744 | Ga0070710_102857442 | 209 |
| 517 | 3300005439 | Ga0070711_100035424 | Ga0070711_1000354242 | 209 |
| 518 | 3300005439 | Ga0070711_100068759 | Ga0070711_1000687592 | 209 |
| 519 | 3300005440 | Ga0070705_100130127 | Ga0070705_1001301272 | 209 |
| 520 | 3300005455 | Ga0070663_100003672 | Ga0070663_1000036725 | 209 |
| 521 | 3300005456 | Ga0070678_100015171 | Ga0070678_1000151712 | 209 |
| 522 | 3300005457 | Ga0070662_100021506 | Ga0070662_1000215063 | 209 |
| 523 | 3300005457 | Ga0070662_100210093 | Ga0070662_1002100931 | 209 |
| 524 | 3300005458 | Ga0070681_10351005 | Ga0070681_103510052 | 209 |
| 525 | 3300005467 | Ga0070706_100111923 | Ga0070706_1001119232 | 209 |
| 526 | 3300005530 | Ga0070679_100005105 | Ga0070679_1000051052 | 209 |
| 527 | 3300005535 | Ga0070684_100012778 | Ga0070684_1000127782 | 209 |
| 528 | 3300005535 | Ga0070684_100119046 | Ga0070684_1001190463 | 209 |
| 529 | 3300005536 | Ga0070697_100259244 | Ga0070697_1002592442 | 209 |
| 530 | 3300005539 | Ga0068853_100001299 | Ga0068853_10000129920 | 209 |
| 531 | 3300005539 | Ga0068853_100117771 | Ga0068853_1001177713 | 209 |
| 532 | 3300005539 | Ga0068853_100312689 | Ga0068853_1003126892 | 209 |
| 533 | 3300005539 | Ga0068853_100545458 | Ga0068853_1005454582 | 209 |
| 534 | 3300005548 | Ga0070665_100018399 | Ga0070665_1000183993 | 209 |
| 535 | 3300005549 | Ga0070704_100877963 | Ga0070704_1008779632 | 209 |
| 536 | 3300005563 | Ga0068855_100093490 | Ga0068855_1000934903 | 209 |
| 537 | 3300005563 | Ga0068855_100514454 | Ga0068855_1005144542 | 209 |
| 538 | 3300005564 | Ga0070664_100100367 | Ga0070664_1001003672 | 209 |
| 539 | 3300005577 | Ga0068857_100068885 | Ga0068857_1000688853 | 209 |
| 540 | 3300005577 | Ga0068857_100074848 | Ga0068857_1000748482 | 209 |
| 541 | 3300005577 | Ga0068857_100148499 | Ga0068857_1001484993 | 209 |
| 542 | 3300005577 | Ga0068857_100622773 | Ga0068857_1006227732 | 209 |
| 543 | 3300005614 | Ga0068856_100004372 | Ga0068856_1000043728 | 209 |
| 544 | 3300005614 | Ga0068856_100085631 | Ga0068856_1000856312 | 209 |
| 545 | 3300005614 | Ga0068856_100770256 | Ga0068856_1007702562 | 209 |
| 546 | 3300005616 | Ga0068852_100260037 | Ga0068852_1002600372 | 209 |
| 547 | 3300005617 | Ga0068859_100422237 | Ga0068859_1004222371 | 209 |
| 548 | 3300005617 | Ga0068859_100436313 | Ga0068859_1004363131 | 209 |
| 549 | 3300005617 | Ga0068859_100855479 | Ga0068859_1008554791 | 209 |
| 550 | 3300005618 | Ga0068864_100287620 | Ga0068864_1002876202 | 209 |
| 551 | 3300005834 | Ga0068851_10454633 | Ga0068851_104546331 | 209 |
| 552 | 3300005841 | Ga0068863_100000053 | Ga0068863_10000005335 | 209 |
| 553 | 3300005841 | Ga0068863_100042120 | Ga0068863_1000421206 | 209 |
| 554 | 3300005841 | Ga0068863_100043176 | Ga0068863_1000431762 | 209 |
| 555 | 3300005842 | Ga0068858_100066232 | Ga0068858_1000662323 | 209 |
| 556 | 3300005842 | Ga0068858_100273482 | Ga0068858_1002734822 | 209 |
| 557 | 3300005843 | Ga0068860_100000312 | Ga0068860_10000031216 | 209 |
| 558 | 3300005843 | Ga0068860_100013340 | Ga0068860_1000133405 | 209 |
| 559 | 3300005843 | Ga0068860_100081169 | Ga0068860_1000811692 | 209 |
| 560 | 3300005844 | Ga0068862_100000778 | Ga0068862_10000077823 | 209 |
| 561 | 3300005844 | Ga0068862_100084813 | Ga0068862_1000848132 | 209 |
| 562 | 3300005844 | Ga0068862_100235116 | Ga0068862_1002351162 | 209 |
| 563 | 3300005844 | Ga0068862_100444166 | Ga0068862_1004441662 | 209 |
| 564 | 3300005844 | Ga0068862_100722151 | Ga0068862_1007221512 | 209 |
| 565 | 3300005844 | Ga0068862_100745364 | Ga0068862_1007453641 | 209 |
| 566 | 3300005981 | Ga0081538_10022343 | Ga0081538_100223432 | 209 |
| 567 | 3300005983 | Ga0081540_1006288 | Ga0081540_10062883 | 209 |
| 568 | 3300005983 | Ga0081540_1011114 | Ga0081540_10111147 | 209 |
| 569 | 3300005983 | Ga0081540_1052167 | Ga0081540_10521673 | 209 |
| 570 | 3300005983 | Ga0081540_1062715 | Ga0081540_10627152 | 209 |
| 571 | 3300006028 | Ga0070717_10007581 | Ga0070717_100075815 | 209 |
| 572 | 3300006028 | Ga0070717_10240356 | Ga0070717_102403563 | 209 |
| 573 | 3300006038 | Ga0075365_10043348 | Ga0075365_100433483 | 209 |
| 574 | 3300006038 | Ga0075365_10082334 | Ga0075365_100823342 | 209 |
| 575 | 3300006042 | Ga0075368_10000747 | Ga0075368_100007476 | 209 |
| 576 | 3300006048 | Ga0075363_100019180 | Ga0075363_1000191804 | 209 |
| 577 | 3300006048 | Ga0075363_100134951 | Ga0075363_1001349512 | 209 |
| 578 | 3300006051 | Ga0075364_10014814 | Ga0075364_100148142 | 209 |
| 579 | 3300006051 | Ga0075364_10015455 | Ga0075364_100154553 | 209 |
| 580 | 3300006051 | Ga0075364_10049523 | Ga0075364_100495233 | 209 |
| 581 | 3300006051 | Ga0075364_10119747 | Ga0075364_101197472 | 209 |
| 582 | 3300006173 | Ga0070716_100065483 | Ga0070716_1000654833 | 209 |
| 583 | 3300006173 | Ga0070716_100192081 | Ga0070716_1001920812 | 209 |
| 584 | 3300006173 | Ga0070716_100526128 | Ga0070716_1005261281 | 209 |
| 585 | 3300006175 | Ga0070712_100105643 | Ga0070712_1001056433 | 209 |
| 586 | 3300006175 | Ga0070712_100147941 | Ga0070712_1001479412 | 209 |
| 587 | 3300006178 | Ga0075367_10001262 | Ga0075367_100012622 | 209 |
| 588 | 3300006178 | Ga0075367_10402848 | Ga0075367_104028482 | 209 |
| 589 | 3300006178 | Ga0075367_10549079 | Ga0075367_105490791 | 209 |
| 590 | 3300006186 | Ga0075369_10210616 | Ga0075369_102106162 | 209 |
| 591 | 3300006195 | Ga0075366_10004909 | Ga0075366_100049098 | 209 |
| 592 | 3300006195 | Ga0075366_10005300 | Ga0075366_100053003 | 209 |
| 593 | 3300006195 | Ga0075366_10148824 | Ga0075366_101488242 | 209 |
| 594 | 3300006237 | Ga0097621_100089721 | Ga0097621_1000897212 | 209 |
| 595 | 3300006353 | Ga0075370_10001829 | Ga0075370_100018298 | 209 |
| 596 | 3300006353 | Ga0075370_10143708 | Ga0075370_101437082 | 209 |
| 597 | 3300006353 | Ga0075370_10258972 | Ga0075370_102589722 | 209 |
| 598 | 3300006358 | Ga0068871_100255625 | Ga0068871_1002556252 | 209 |
| 599 | 3300006871 | Ga0075434_100065071 | Ga0075434_1000650713 | 209 |
| 600 | 3300006871 | Ga0075434_100120336 | Ga0075434_1001203364 | 209 |
| 601 | 3300006914 | Ga0075436_100060838 | Ga0075436_1000608383 | 209 |
| 602 | 3300006931 | Ga0097620_100422246 | Ga0097620_1004222462 | 209 |
| 603 | 3300006931 | Ga0097620_100436292 | Ga0097620_1004362921 | 209 |
| 604 | 3300006931 | Ga0097620_100855369 | Ga0097620_1008553692 | 209 |
| 605 | 3300006941 | Ga0099825_1025128 | Ga0099825_10251285 | 209 |
| 606 | 3300006942 | Ga0099824_1004605 | Ga0099824_100460510 | 209 |
| 607 | 3300006942 | Ga0099824_1005450 | Ga0099824_100545017 | 209 |
| 608 | 3300006943 | Ga0099822_1000031 | Ga0099822_100003112 | 209 |
| 609 | 3300006944 | Ga0099823_1045510 | Ga0099823_10455102 | 209 |
| 610 | 3300006946 | Ga0079104_1000167 | Ga0079104_100016718 | 209 |
| 611 | 3300006946 | Ga0079104_1003511 | Ga0079104_10035112 | 209 |
| 612 | 3300007788 | Ga0099795_10002064 | Ga0099795_100020645 | 209 |
| 613 | 3300007788 | Ga0099795_10266265 | Ga0099795_102662651 | 209 |
| 614 | 3300009092 | Ga0105250_10000496 | Ga0105250_100004964 | 209 |
| 615 | 3300009092 | Ga0105250_10070463 | Ga0105250_100704631 | 209 |
| 616 | 3300009092 | Ga0105250_10269204 | Ga0105250_102692041 | 209 |
| 617 | 3300009093 | Ga0105240_10224017 | Ga0105240_102240172 | 209 |
| 618 | 3300009093 | Ga0105240_10236670 | Ga0105240_102366702 | 209 |
| 619 | 3300009093 | Ga0105240_10597280 | Ga0105240_105972802 | 209 |
| 620 | 3300009093 | Ga0105240_10705407 | Ga0105240_107054072 | 209 |
| 621 | 3300009098 | Ga0105245_10029674 | Ga0105245_100296743 | 209 |
| 622 | 3300009098 | Ga0105245_11126191 | Ga0105245_111261912 | 209 |
| 623 | 3300009101 | Ga0105247_10005744 | Ga0105247_100057447 | 209 |
| 624 | 3300009101 | Ga0105247_10016235 | Ga0105247_100162352 | 209 |
| 625 | 3300009101 | Ga0105247_10132234 | Ga0105247_101322341 | 209 |
| 626 | 3300009101 | Ga0105247_10542970 | Ga0105247_105429701 | 209 |
| 627 | 3300009148 | Ga0105243_10099559 | Ga0105243_100995592 | 209 |
| 628 | 3300009148 | Ga0105243_10124058 | Ga0105243_101240582 | 209 |
| 629 | 3300009148 | Ga0105243_11522682 | Ga0105243_115226821 | 209 |
| 630 | 3300009174 | Ga0105241_10018413 | Ga0105241_100184134 | 209 |
| 631 | 3300009174 | Ga0105241_10037419 | Ga0105241_100374194 | 209 |
| 632 | 3300009174 | Ga0105241_10060960 | Ga0105241_100609602 | 209 |
| 633 | 3300009174 | Ga0105241_10073639 | Ga0105241_100736394 | 209 |
| 634 | 3300009174 | Ga0105241_10111980 | Ga0105241_101119803 | 209 |
| 635 | 3300009174 | Ga0105241_10112845 | Ga0105241_101128453 | 209 |
| 636 | 3300009177 | Ga0105248_10010634 | Ga0105248_1001063413 | 209 |
| 637 | 3300009177 | Ga0105248_10050368 | Ga0105248_100503682 | 209 |
| 638 | 3300009177 | Ga0105248_10050394 | Ga0105248_100503942 | 209 |
| 639 | 3300009177 | Ga0105248_10097135 | Ga0105248_100971353 | 209 |
| 640 | 3300009177 | Ga0105248_10936489 | Ga0105248_109364892 | 209 |
| 641 | 3300009545 | Ga0105237_10010021 | Ga0105237_1001002112 | 209 |
| 642 | 3300009545 | Ga0105237_10030642 | Ga0105237_100306423 | 209 |
| 643 | 3300009545 | Ga0105237_10038406 | Ga0105237_100384063 | 209 |
| 644 | 3300009545 | Ga0105237_10049974 | Ga0105237_100499743 | 209 |
| 645 | 3300009545 | Ga0105237_10091668 | Ga0105237_100916682 | 209 |
| 646 | 3300009545 | Ga0105237_10126417 | Ga0105237_101264172 | 209 |
| 647 | 3300009545 | Ga0105237_11196456 | Ga0105237_111964561 | 209 |
| 648 | 3300009551 | Ga0105238_10051030 | Ga0105238_100510302 | 209 |
| 649 | 3300009551 | Ga0105238_10097805 | Ga0105238_100978052 | 209 |
| 650 | 3300009551 | Ga0105238_10284461 | Ga0105238_102844612 | 209 |
| 651 | 3300009553 | Ga0105249_10000479 | Ga0105249_1000047926 | 209 |
| 652 | 3300009978 | Ga0105148_100042 | Ga0105148_10004218 | 209 |
| 653 | 3300010159 | Ga0099796_10011546 | Ga0099796_100115462 | 209 |
| 654 | 3300010375 | Ga0105239_10022158 | Ga0105239_100221582 | 209 |
| 655 | 3300010375 | Ga0105239_10608547 | Ga0105239_106085472 | 209 |
| 656 | 3300010375 | Ga0105239_10623366 | Ga0105239_106233662 | 209 |
| 657 | 3300010375 | Ga0105239_10668126 | Ga0105239_106681261 | 209 |
| 658 | 3300010375 | Ga0105239_10907631 | Ga0105239_109076312 | 209 |
| 659 | 3300011119 | Ga0105246_10061565 | Ga0105246_100615653 | 209 |
| 660 | 3300013102 | Ga0157371_10085823 | Ga0157371_100858232 | 209 |
| 661 | 3300013104 | Ga0157370_10110273 | Ga0157370_101102731 | 209 |
| 662 | 3300013104 | Ga0157370_10299109 | Ga0157370_102991092 | 209 |
| 663 | 3300013105 | Ga0157369_10114195 | Ga0157369_101141953 | 209 |
| 664 | 3300013105 | Ga0157369_10179697 | Ga0157369_101796973 | 209 |
| 665 | 3300013105 | Ga0157369_10180113 | Ga0157369_101801133 | 209 |
| 666 | 3300013105 | Ga0157369_10364629 | Ga0157369_103646292 | 209 |
| 667 | 3300013296 | Ga0157374_10057825 | Ga0157374_100578254 | 209 |
| 668 | 3300013296 | Ga0157374_10128458 | Ga0157374_101284582 | 209 |
| 669 | 3300013296 | Ga0157374_10217974 | Ga0157374_102179742 | 209 |
| 670 | 3300013297 | Ga0157378_10042553 | Ga0157378_100425534 | 209 |
| 671 | 3300013306 | Ga0163162_10109119 | Ga0163162_101091192 | 209 |
| 672 | 3300013306 | Ga0163162_10444626 | Ga0163162_104446261 | 209 |
| 673 | 3300013306 | Ga0163162_10601242 | Ga0163162_106012421 | 209 |
| 674 | 3300013308 | Ga0157375_10238752 | Ga0157375_102387522 | 209 |
| 675 | 3300014325 | Ga0163163_10007677 | Ga0163163_100076773 | 209 |
| 676 | 3300014325 | Ga0163163_10117815 | Ga0163163_101178154 | 209 |
| 677 | 3300014968 | Ga0157379_10007477 | Ga0157379_100074778 | 209 |
| 678 | 3300014968 | Ga0157379_10098603 | Ga0157379_100986032 | 209 |
| 679 | 3300014969 | Ga0157376_10021572 | Ga0157376_100215723 | 209 |
| 680 | 3300014969 | Ga0157376_10638139 | Ga0157376_106381391 | 209 |
| 681 | 3300017792 | Ga0163161_10005250 | Ga0163161_100052509 | 209 |
| 682 | 3300020070 | Ga0206356_11766087 | Ga0206356_117660871 | 209 |
| 683 | 3300020082 | Ga0206353_11597628 | Ga0206353_115976282 | 209 |
| 684 | 3300021320 | Ga0214544_1000004 | Ga0214544_1000004210 | 209 |
| 685 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001143 | 209 |
| 686 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001210 | 209 |
| 687 | 3300021327 | Ga0214543_1000006 | Ga0214543_1000006207 | 209 |
| 688 | 3300021441 | Ga0213871_10007850 | Ga0213871_100078502 | 209 |
| 689 | 3300021441 | Ga0213871_10021068 | Ga0213871_100210682 | 209 |
| 690 | 3300025230 | Ga0209563_104631 | Ga0209563_1046312 | 209 |
| 691 | 3300025245 | Ga0207425_1016340 | Ga0207425_10163402 | 209 |
| 692 | 3300025253 | Ga0209677_101151 | Ga0209677_10115110 | 209 |
| 693 | 3300025254 | Ga0209148_1000566 | Ga0209148_100056625 | 209 |
| 694 | 3300025261 | Ga0209233_1001516 | Ga0209233_10015162 | 209 |
| 695 | 3300025261 | Ga0209233_1002707 | Ga0209233_10027076 | 209 |
| 696 | 3300025261 | Ga0209233_1026960 | Ga0209233_10269602 | 209 |
| 697 | 3300025272 | Ga0209455_1001114 | Ga0209455_10011145 | 209 |
| 698 | 3300025295 | Ga0209564_1039126 | Ga0209564_10391262 | 209 |
| 699 | 3300025297 | Ga0209758_1000024 | Ga0209758_1000024538 | 209 |
| 700 | 3300025297 | Ga0209758_1000068 | Ga0209758_1000068310 | 209 |
| 701 | 3300025297 | Ga0209758_1002049 | Ga0209758_100204912 | 209 |
| 702 | 3300025297 | Ga0209758_1005922 | Ga0209758_10059229 | 209 |
| 703 | 3300025297 | Ga0209758_1032747 | Ga0209758_10327473 | 209 |
| 704 | 3300025299 | Ga0209256_1008038 | Ga0209256_10080385 | 209 |
| 705 | 3300025302 | Ga0207426_1000120 | Ga0207426_100012042 | 209 |
| 706 | 3300025302 | Ga0207426_1000673 | Ga0207426_100067314 | 209 |
| 707 | 3300025302 | Ga0207426_1004196 | Ga0207426_10041962 | 209 |
| 708 | 3300025304 | Ga0209257_1001327 | Ga0209257_100132719 | 209 |
| 709 | 3300025321 | Ga0207656_10077493 | Ga0207656_100774933 | 209 |
| 710 | 3300025711 | Ga0207696_1005868 | Ga0207696_10058683 | 209 |
| 711 | 3300025711 | Ga0207696_1015915 | Ga0207696_10159152 | 209 |
| 712 | 3300025899 | Ga0207642_10483461 | Ga0207642_104834611 | 209 |
| 713 | 3300025900 | Ga0207710_10072977 | Ga0207710_100729773 | 209 |
| 714 | 3300025900 | Ga0207710_10074572 | Ga0207710_100745721 | 209 |
| 715 | 3300025903 | Ga0207680_10001161 | Ga0207680_1000116110 | 209 |
| 716 | 3300025903 | Ga0207680_10143421 | Ga0207680_101434212 | 209 |
| 717 | 3300025904 | Ga0207647_10035303 | Ga0207647_100353034 | 209 |
| 718 | 3300025906 | Ga0207699_10046323 | Ga0207699_100463232 | 209 |
| 719 | 3300025906 | Ga0207699_10275526 | Ga0207699_102755262 | 209 |
| 720 | 3300025909 | Ga0207705_10015903 | Ga0207705_100159035 | 209 |
| 721 | 3300025910 | Ga0207684_10122127 | Ga0207684_101221273 | 209 |
| 722 | 3300025911 | Ga0207654_10080134 | Ga0207654_100801342 | 209 |
| 723 | 3300025911 | Ga0207654_10092881 | Ga0207654_100928812 | 209 |
| 724 | 3300025911 | Ga0207654_10247339 | Ga0207654_102473392 | 209 |
| 725 | 3300025911 | Ga0207654_10283197 | Ga0207654_102831972 | 209 |
| 726 | 3300025912 | Ga0207707_10184089 | Ga0207707_101840892 | 209 |
| 727 | 3300025912 | Ga0207707_10195323 | Ga0207707_101953232 | 209 |
| 728 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008492 | 209 |
| 729 | 3300025913 | Ga0207695_10022582 | Ga0207695_100225825 | 209 |
| 730 | 3300025913 | Ga0207695_10186796 | Ga0207695_101867963 | 209 |
| 731 | 3300025914 | Ga0207671_10049564 | Ga0207671_100495642 | 209 |
| 732 | 3300025914 | Ga0207671_10070742 | Ga0207671_100707424 | 209 |
| 733 | 3300025914 | Ga0207671_10101602 | Ga0207671_101016022 | 209 |
| 734 | 3300025914 | Ga0207671_10156010 | Ga0207671_101560102 | 209 |
| 735 | 3300025914 | Ga0207671_10164936 | Ga0207671_101649362 | 209 |
| 736 | 3300025914 | Ga0207671_10691826 | Ga0207671_106918261 | 209 |
| 737 | 3300025915 | Ga0207693_10267676 | Ga0207693_102676762 | 209 |
| 738 | 3300025916 | Ga0207663_10059235 | Ga0207663_100592352 | 209 |
| 739 | 3300025917 | Ga0207660_10038888 | Ga0207660_100388882 | 209 |
| 740 | 3300025917 | Ga0207660_10305166 | Ga0207660_103051662 | 209 |
| 741 | 3300025919 | Ga0207657_10013873 | Ga0207657_100138734 | 209 |
| 742 | 3300025919 | Ga0207657_10395794 | Ga0207657_103957942 | 209 |
| 743 | 3300025921 | Ga0207652_10182875 | Ga0207652_101828752 | 209 |
| 744 | 3300025921 | Ga0207652_10440571 | Ga0207652_104405712 | 209 |
| 745 | 3300025923 | Ga0207681_10000358 | Ga0207681_1000035820 | 209 |
| 746 | 3300025923 | Ga0207681_10006344 | Ga0207681_100063445 | 209 |
| 747 | 3300025923 | Ga0207681_10133722 | Ga0207681_101337222 | 209 |
| 748 | 3300025923 | Ga0207681_10497069 | Ga0207681_104970691 | 209 |
| 749 | 3300025924 | Ga0207694_10170272 | Ga0207694_101702723 | 209 |
| 750 | 3300025925 | Ga0207650_10269207 | Ga0207650_102692072 | 209 |
| 751 | 3300025926 | Ga0207659_10141181 | Ga0207659_101411812 | 209 |
| 752 | 3300025927 | Ga0207687_10068316 | Ga0207687_100683162 | 209 |
| 753 | 3300025927 | Ga0207687_10748539 | Ga0207687_107485391 | 209 |
| 754 | 3300025928 | Ga0207700_10034019 | Ga0207700_100340192 | 209 |
| 755 | 3300025928 | Ga0207700_10449174 | Ga0207700_104491741 | 209 |
| 756 | 3300025929 | Ga0207664_10015026 | Ga0207664_100150264 | 209 |
| 757 | 3300025929 | Ga0207664_10414343 | Ga0207664_104143432 | 209 |
| 758 | 3300025931 | Ga0207644_10003443 | Ga0207644_1000344312 | 209 |
| 759 | 3300025931 | Ga0207644_10015682 | Ga0207644_100156822 | 209 |
| 760 | 3300025931 | Ga0207644_10017154 | Ga0207644_100171546 | 209 |
| 761 | 3300025932 | Ga0207690_10761991 | Ga0207690_107619912 | 209 |
| 762 | 3300025933 | Ga0207706_10022693 | Ga0207706_100226932 | 209 |
| 763 | 3300025933 | Ga0207706_10054128 | Ga0207706_100541285 | 209 |
| 764 | 3300025933 | Ga0207706_10077856 | Ga0207706_100778562 | 209 |
| 765 | 3300025933 | Ga0207706_10194661 | Ga0207706_101946612 | 209 |
| 766 | 3300025933 | Ga0207706_10614595 | Ga0207706_106145952 | 209 |
| 767 | 3300025935 | Ga0207709_10000143 | Ga0207709_1000014356 | 209 |
| 768 | 3300025939 | Ga0207665_10272241 | Ga0207665_102722412 | 209 |
| 769 | 3300025941 | Ga0207711_10063926 | Ga0207711_100639264 | 209 |
| 770 | 3300025941 | Ga0207711_10065464 | Ga0207711_100654642 | 209 |
| 771 | 3300025942 | Ga0207689_10001713 | Ga0207689_100017138 | 209 |
| 772 | 3300025944 | Ga0207661_10024510 | Ga0207661_100245102 | 209 |
| 773 | 3300025944 | Ga0207661_10069955 | Ga0207661_100699552 | 209 |
| 774 | 3300025945 | Ga0207679_10564102 | Ga0207679_105641022 | 209 |
| 775 | 3300025945 | Ga0207679_10655042 | Ga0207679_106550422 | 209 |
| 776 | 3300025949 | Ga0207667_10044360 | Ga0207667_100443603 | 209 |
| 777 | 3300025949 | Ga0207667_10054301 | Ga0207667_100543012 | 209 |
| 778 | 3300025949 | Ga0207667_10799326 | Ga0207667_107993262 | 209 |
| 779 | 3300025961 | Ga0207712_10000405 | Ga0207712_1000040526 | 209 |
| 780 | 3300025961 | Ga0207712_10200412 | Ga0207712_102004122 | 209 |
| 781 | 3300025972 | Ga0207668_10000027 | Ga0207668_1000002735 | 209 |
| 782 | 3300025972 | Ga0207668_10000119 | Ga0207668_100001198 | 209 |
| 783 | 3300025972 | Ga0207668_10015543 | Ga0207668_100155432 | 209 |
| 784 | 3300025972 | Ga0207668_10020385 | Ga0207668_100203855 | 209 |
| 785 | 3300025972 | Ga0207668_10106114 | Ga0207668_101061142 | 209 |
| 786 | 3300025972 | Ga0207668_10351107 | Ga0207668_103511072 | 209 |
| 787 | 3300025981 | Ga0207640_10002550 | Ga0207640_100025505 | 209 |
| 788 | 3300025981 | Ga0207640_10073577 | Ga0207640_100735772 | 209 |
| 789 | 3300025986 | Ga0207658_10000091 | Ga0207658_1000009134 | 209 |
| 790 | 3300025986 | Ga0207658_10068456 | Ga0207658_100684562 | 209 |
| 791 | 3300025986 | Ga0207658_10293074 | Ga0207658_102930742 | 209 |
| 792 | 3300026023 | Ga0207677_10024255 | Ga0207677_100242553 | 209 |
| 793 | 3300026035 | Ga0207703_10060972 | Ga0207703_100609722 | 209 |
| 794 | 3300026035 | Ga0207703_10106018 | Ga0207703_101060182 | 209 |
| 795 | 3300026035 | Ga0207703_10224120 | Ga0207703_102241202 | 209 |
| 796 | 3300026041 | Ga0207639_10003038 | Ga0207639_100030389 | 209 |
| 797 | 3300026041 | Ga0207639_10046719 | Ga0207639_100467193 | 209 |
| 798 | 3300026041 | Ga0207639_10049046 | Ga0207639_100490464 | 209 |
| 799 | 3300026041 | Ga0207639_10176128 | Ga0207639_101761282 | 209 |
| 800 | 3300026041 | Ga0207639_11100196 | Ga0207639_111001961 | 209 |
| 801 | 3300026067 | Ga0207678_10000053 | Ga0207678_1000005380 | 209 |
| 802 | 3300026067 | Ga0207678_10094685 | Ga0207678_100946853 | 209 |
| 803 | 3300026078 | Ga0207702_10007174 | Ga0207702_100071744 | 209 |
| 804 | 3300026078 | Ga0207702_10146400 | Ga0207702_101464002 | 209 |
| 805 | 3300026078 | Ga0207702_10222708 | Ga0207702_102227082 | 209 |
| 806 | 3300026078 | Ga0207702_10714325 | Ga0207702_107143252 | 209 |
| 807 | 3300026088 | Ga0207641_10000093 | Ga0207641_1000009387 | 209 |
| 808 | 3300026088 | Ga0207641_10027610 | Ga0207641_100276106 | 209 |
| 809 | 3300026088 | Ga0207641_10068221 | Ga0207641_100682212 | 209 |
| 810 | 3300026088 | Ga0207641_10819375 | Ga0207641_108193752 | 209 |
| 811 | 3300026095 | Ga0207676_10063189 | Ga0207676_100631892 | 209 |
| 812 | 3300026095 | Ga0207676_10117273 | Ga0207676_101172732 | 209 |
| 813 | 3300026116 | Ga0207674_10018107 | Ga0207674_100181073 | 209 |
| 814 | 3300026116 | Ga0207674_10075668 | Ga0207674_100756682 | 209 |
| 815 | 3300026116 | Ga0207674_10306908 | Ga0207674_103069082 | 209 |
| 816 | 3300026118 | Ga0207675_100003788 | Ga0207675_1000037884 | 209 |
| 817 | 3300026118 | Ga0207675_100288328 | Ga0207675_1002883282 | 209 |
| 818 | 3300026121 | Ga0207683_10026771 | Ga0207683_100267715 | 209 |
| 819 | 3300026142 | Ga0207698_10024978 | Ga0207698_100249781 | 209 |
| 820 | 3300026142 | Ga0207698_10027523 | Ga0207698_100275232 | 209 |
| 821 | 3300026142 | Ga0207698_10055947 | Ga0207698_100559474 | 209 |
| 822 | 3300027111 | Ga0209281_1000017 | Ga0209281_1000017362 | 209 |
| 823 | 3300027296 | Ga0209389_1000010 | Ga0209389_1000010117 | 209 |
| 824 | 3300027296 | Ga0209389_1000149 | Ga0209389_100014937 | 209 |
| 825 | 3300027357 | Ga0209589_1000016 | Ga0209589_100001697 | 209 |
| 826 | 3300027357 | Ga0209589_1000025 | Ga0209589_100002581 | 209 |
| 827 | 3300027361 | Ga0209489_100016 | Ga0209489_100016117 | 209 |
| 828 | 3300027361 | Ga0209489_100039 | Ga0209489_10003981 | 209 |
| 829 | 3300027363 | Ga0209700_100030 | Ga0209700_100030181 | 209 |
| 830 | 3300027363 | Ga0209700_100043 | Ga0209700_10004384 | 209 |
| 831 | 3300027866 | Ga0209813_10000012 | Ga0209813_1000001211 | 209 |
| 832 | 3300028379 | Ga0268266_10006810 | Ga0268266_100068106 | 209 |
| 833 | 3300028379 | Ga0268266_10016057 | Ga0268266_100160576 | 209 |
| 834 | 3300028379 | Ga0268266_10387098 | Ga0268266_103870982 | 209 |
| 835 | 3300028379 | Ga0268266_10794120 | Ga0268266_107941201 | 209 |
| 836 | 3300028380 | Ga0268265_10000633 | Ga0268265_1000063312 | 209 |
| 837 | 3300028380 | Ga0268265_10067570 | Ga0268265_100675702 | 209 |
| 838 | 3300028380 | Ga0268265_10296466 | Ga0268265_102964662 | 209 |
| 839 | 3300028381 | Ga0268264_10000030 | Ga0268264_1000003046 | 209 |
| 840 | 3300028381 | Ga0268264_10008606 | Ga0268264_100086067 | 209 |
| 841 | 3300028381 | Ga0268264_10058148 | Ga0268264_100581482 | 209 |
| 842 | 3300030521 | Ga0307511_10068998 | Ga0307511_100689982 | 209 |
| 843 | 3300031247 | Ga0265340_10011093 | Ga0265340_100110933 | 209 |
| 844 | 3300031249 | Ga0265339_10002090 | Ga0265339_100020909 | 209 |
| 845 | 3300031456 | Ga0307513_10114409 | Ga0307513_101144093 | 209 |
| 846 | 3300031507 | Ga0307509_10012996 | Ga0307509_100129964 | 209 |
| 847 | 3300031616 | Ga0307508_10330955 | Ga0307508_103309552 | 209 |
| 848 | 3300031730 | Ga0307516_10004326 | Ga0307516_1000432614 | 209 |
| 849 | 3300031730 | Ga0307516_10059170 | Ga0307516_100591704 | 209 |
| 850 | 3300031730 | Ga0307516_10204047 | Ga0307516_102040471 | 209 |
| 851 | 3300031731 | Ga0307405_10064861 | Ga0307405_100648613 | 209 |
| 852 | 3300031901 | Ga0307406_10350463 | Ga0307406_103504632 | 209 |
| 853 | 3300031901 | Ga0307406_10506305 | Ga0307406_105063052 | 209 |
| 854 | 3300031911 | Ga0307412_10002798 | Ga0307412_100027985 | 209 |
| 855 | 3300031911 | Ga0307412_10067707 | Ga0307412_100677074 | 209 |
| 856 | 3300033180 | Ga0307510_10032342 | Ga0307510_100323424 | 209 |
| 857 | 3300033180 | Ga0307510_10069078 | Ga0307510_100690785 | 209 |
| 858 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002476 | 209 |
| 859 | 3300035086 | Ga0373934_0023398 | Ga0373934_0023398_757_1389 | 209 |
| 860 | 3300035089 | Ga0373944_0069693 | Ga0373944_0069693_310_939 | 209 |
| 861 | 3300035111 | Ga0373923_0033070 | Ga0373923_0033070_592_1224 | 209 |
| 862 | 3300035113 | Ga0373936_0018408 | Ga0373936_0018408_947_1579 | 209 |
| 863 | 3300035113 | Ga0373936_0078370 | Ga0373936_0078370_217_846 | 209 |
| 864 | 3300035117 | Ga0373953_0042756 | Ga0373953_0042756_594_1226 | 209 |
| 865 | 3300035118 | Ga0373954_0022313 | Ga0373954_0022313_1115_1747 | 209 |
| 866 | 3300035119 | Ga0373956_0126661 | Ga0373956_0126661_447_1079 | 209 |
| 867 | 3300035170 | Ga0373943_0046835 | Ga0373943_0046835_590_1219 | 209 |
| 868 | 3300035172 | Ga0373955_0531326 | Ga0373955_0531326_69_701 | 209 |
| 869 | 3300035410 | Ga0373924_0013501 | Ga0373924_0013501_132_764 | 209 |
| 870 | 3300035691 | Ga0373931_0149272 | Ga0373931_0149272_566_1195 | 209 |
| 871 | 3300035692 | Ga0373935_0100224 | Ga0373935_0100224_795_1424 | 209 |
| 872 | 3300035695 | Ga0373927_0003407 | Ga0373927_0003407_9248_9877 | 209 |
| 873 | 3300035724 | Ga0373933_0454989 | Ga0373933_0454989_180_809 | 209 |
| 874 | 3300035725 | Ga0373947_0146864 | Ga0373947_0146864_494_1123 | 209 |
| 875 | 3300036401 | Ga0373937_0194238 | Ga0373937_0194238_1244_1876 | 209 |
| 876 | 3300037068 | Ga0373925_0052030 | Ga0373925_0052030_1543_2175 | 209 |
| 877 | 3300037068 | Ga0373925_0070598 | Ga0373925_0070598_203_835 | 209 |
| 878 | 3300037068 | Ga0373925_0490920 | Ga0373925_0490920_83_712 | 209 |
| 879 | 3300037471 | Ga0395905_0009332 | Ga0395905_0009332_4050_4679 | 209 |
| 880 | 3300037471 | Ga0395905_0228767 | Ga0395905_0228767_1089_1721 | 209 |
| 881 | 3300037853 | Ga0436364_0926030 | Ga0436364_0926030_4344_4973 | 209 |
| 882 | 3300038443 | Ga0395901_0058273 | Ga0395901_0058273_3288_3917 | 209 |
| 883 | 3300039062 | Ga0400483_126259 | Ga0400483_126259_381_1010 | 209 |
| 884 | 3300039438 | Ga0436360_0460772 | Ga0436360_0460772_282_911 | 209 |
| 885 | 3300039438 | Ga0436360_0732042 | Ga0436360_0732042_2084_2713 | 209 |
| 886 | 3300039438 | Ga0436360_1138676 | Ga0436360_1138676_2488_3117 | 209 |
| 887 | 3300039447 | Ga0436361_0149759 | Ga0436361_0149759_951_1580 | 209 |
| 888 | 3300039447 | Ga0436361_0263958 | Ga0436361_0263958_836_1465 | 209 |
| 889 | 3300039447 | Ga0436361_0319705 | Ga0436361_0319705_94_726 | 209 |
| 890 | 3300042004 | Ga0439445_0003192 | Ga0439445_0003192_499_1143 | 209 |
| 891 | 3300042115 | Ga0450911_000342 | Ga0450911_000342_3943_4587 | 209 |
| 892 | 3300044656 | Ga0466969_0004164 | Ga0466969_0004164_6490_7119 | 209 |
| 893 | 3300044656 | Ga0466969_0114560 | Ga0466969_0114560_394_1023 | 209 |
| 894 | 3300044658 | Ga0466972_0000148 | Ga0466972_0000148_12817_13446 | 209 |
| 895 | 3300044658 | Ga0466972_0003448 | Ga0466972_0003448_1631_2260 | 209 |
| 896 | 3300044683 | Ga0466965_0369115 | Ga0466965_0369115_88_717 | 209 |
| 897 | 3300044684 | Ga0466966_0012261 | Ga0466966_0012261_1177_1806 | 209 |
| 898 | 3300044684 | Ga0466966_0249042 | Ga0466966_0249042_417_1046 | 209 |
| 899 | 3300044684 | Ga0466966_0255610 | Ga0466966_0255610_157_786 | 209 |
| 900 | 3300044693 | Ga0466961_0000008 | Ga0466961_0000008_67743_68372 | 209 |
| 901 | 3300044693 | Ga0466961_0227358 | Ga0466961_0227358_50_679 | 209 |
| 902 | 3300044694 | Ga0466963_0483240 | Ga0466963_0483240_232_861 | 209 |
| 903 | 3300044706 | Ga0466964_0042755 | Ga0466964_0042755_1037_1666 | 209 |
| 904 | 3300044719 | Ga0466971_0139384 | Ga0466971_0139384_486_1115 | 209 |
| 905 | 3300044735 | Ga0466968_0038023 | Ga0466968_0038023_787_1416 | 209 |
| 906 | 3300044735 | Ga0466968_0155839 | Ga0466968_0155839_119_748 | 209 |
| 907 | 3300044735 | Ga0466968_0292198 | Ga0466968_0292198_106_735 | 209 |
| 908 | 3300044765 | Ga0466970_0053407 | Ga0466970_0053407_360_989 | 209 |
| 909 | 3300044765 | Ga0466970_0370827 | Ga0466970_0370827_146_775 | 209 |
| 910 | 3300044842 | Ga0466957_0089469 | Ga0466957_0089469_899_1528 | 209 |
| 911 | 3300044901 | Ga0466960_0016548 | Ga0466960_0016548_1964_2593 | 209 |
| 912 | 3300044901 | Ga0466960_0051615 | Ga0466960_0051615_1138_1767 | 209 |
| 913 | 3300045049 | Ga0466959_0009565 | Ga0466959_0009565_3472_4101 | 209 |
| 914 | 3300045049 | Ga0466959_0012592 | Ga0466959_0012592_5443_6072 | 209 |
| 915 | 3300045049 | Ga0466959_0016679 | Ga0466959_0016679_857_1486 | 209 |
| 916 | 3300045049 | Ga0466959_0473556 | Ga0466959_0473556_164_793 | 209 |
| 917 | 3300045836 | Ga0466958_0290849 | Ga0466958_0290849_390_1019 | 209 |
| 918 | 3300045976 | Ga0466967_0127399 | Ga0466967_0127399_712_1341 | 209 |
| 919 | 3300045976 | Ga0466967_0325825 | Ga0466967_0325825_212_844 | 209 |
| 920 | 3300046452 | Ga0495617_004580 | Ga0495617_004580_3281_3910 | 209 |
| 921 | 3300046452 | Ga0495617_092613 | Ga0495617_092613_259_888 | 209 |
| 922 | 3300046453 | Ga0495627_013822 | Ga0495627_013822_1004_1633 | 209 |
| 923 | 3300046454 | Ga0495592_0010915 | Ga0495592_0010915_2943_3575 | 209 |
| 924 | 3300046455 | Ga0495603_0223516 | Ga0495603_0223516_216_845 | 209 |
| 925 | 3300046457 | Ga0495590_0080137 | Ga0495590_0080137_241_870 | 209 |
| 926 | 3300046459 | Ga0495629_0059289 | Ga0495629_0059289_679_1308 | 209 |
| 927 | 3300046459 | Ga0495629_0130940 | Ga0495629_0130940_1076_1708 | 209 |
| 928 | 3300046460 | Ga0495638_0000073 | Ga0495638_0000073_97404_98033 | 209 |
| 929 | 3300046460 | Ga0495638_0002880 | Ga0495638_0002880_10301_10930 | 209 |
| 930 | 3300046461 | Ga0495641_0332186 | Ga0495641_0332186_24_653 | 209 |
| 931 | 3300046462 | Ga0495651_0001984 | Ga0495651_0001984_3849_4478 | 209 |
| 932 | 3300046462 | Ga0495651_0029080 | Ga0495651_0029080_2027_2656 | 209 |
| 933 | 3300046462 | Ga0495651_0085311 | Ga0495651_0085311_1391_2020 | 209 |
| 934 | 3300046463 | Ga0495653_0019076 | Ga0495653_0019076_1199_1828 | 209 |
| 935 | 3300046463 | Ga0495653_0200081 | Ga0495653_0200081_235_864 | 209 |
| 936 | 3300046471 | Ga0495650_0001348 | Ga0495650_0001348_19741_20370 | 209 |
| 937 | 3300046473 | Ga0495582_0020660 | Ga0495582_0020660_1169_1801 | 209 |
| 938 | 3300046474 | Ga0495605_0092373 | Ga0495605_0092373_731_1360 | 209 |
| 939 | 3300046475 | Ga0495639_0004491 | Ga0495639_0004491_1004_1636 | 209 |
| 940 | 3300046475 | Ga0495639_0295463 | Ga0495639_0295463_43_672 | 209 |
| 941 | 3300046477 | Ga0495664_0028535 | Ga0495664_0028535_403_1035 | 209 |
| 942 | 3300046491 | Ga0495584_0126854 | Ga0495584_0126854_115_744 | 209 |
| 943 | 3300046499 | Ga0495594_0109427 | Ga0495594_0109427_759_1391 | 209 |
| 944 | 3300046500 | Ga0495596_0003376 | Ga0495596_0003376_6698_7327 | 209 |
| 945 | 3300046506 | Ga0495583_0000087 | Ga0495583_0000087_97364_97993 | 209 |
| 946 | 3300046507 | Ga0495606_0061205 | Ga0495606_0061205_521_1150 | 209 |
| 947 | 3300046507 | Ga0495606_0284202 | Ga0495606_0284202_214_843 | 209 |
| 948 | 3300046512 | Ga0495610_0005333 | Ga0495610_0005333_4477_5106 | 209 |
| 949 | 3300046512 | Ga0495610_0027469 | Ga0495610_0027469_1863_2492 | 209 |
| 950 | 3300046513 | Ga0495616_0012946 | Ga0495616_0012946_1096_1725 | 209 |
| 951 | 3300046514 | Ga0495618_0034740 | Ga0495618_0034740_2088_2717 | 209 |
| 952 | 3300046514 | Ga0495618_0076428 | Ga0495618_0076428_1093_1722 | 209 |
| 953 | 3300046514 | Ga0495618_0141470 | Ga0495618_0141470_342_971 | 209 |
| 954 | 3300046516 | Ga0495628_0011313 | Ga0495628_0011313_3308_3937 | 209 |
| 955 | 3300046516 | Ga0495628_0110653 | Ga0495628_0110653_1016_1648 | 209 |
| 956 | 3300046517 | Ga0495630_0058231 | Ga0495630_0058231_1115_1747 | 209 |
| 957 | 3300046517 | Ga0495630_0159930 | Ga0495630_0159930_59_688 | 209 |
| 958 | 3300046517 | Ga0495630_0220274 | Ga0495630_0220274_543_1172 | 209 |
| 959 | 3300046519 | Ga0495632_0000049 | Ga0495632_0000049_86905_87534 | 209 |
| 960 | 3300046519 | Ga0495632_0002653 | Ga0495632_0002653_7282_7911 | 209 |
| 961 | 3300046519 | Ga0495632_0235837 | Ga0495632_0235837_127_756 | 209 |
| 962 | 3300046520 | Ga0495637_0014164 | Ga0495637_0014164_991_1620 | 209 |
| 963 | 3300046522 | Ga0495643_0000047 | Ga0495643_0000047_65170_65799 | 209 |
| 964 | 3300046522 | Ga0495643_0020094 | Ga0495643_0020094_922_1551 | 209 |
| 965 | 3300046524 | Ga0495648_0000049 | Ga0495648_0000049_97404_98033 | 209 |
| 966 | 3300046524 | Ga0495648_0032189 | Ga0495648_0032189_1285_1914 | 209 |
| 967 | 3300046524 | Ga0495648_0135824 | Ga0495648_0135824_421_1050 | 209 |
| 968 | 3300046525 | Ga0495663_0000009 | Ga0495663_0000009_142545_143174 | 209 |
| 969 | 3300046526 | Ga0495666_0029362 | Ga0495666_0029362_1695_2327 | 209 |
| 970 | 3300046529 | Ga0495652_0010482 | Ga0495652_0010482_1536_2165 | 209 |
| 971 | 3300046529 | Ga0495652_0035658 | Ga0495652_0035658_3144_3773 | 209 |
| 972 | 3300046530 | Ga0495654_0002730 | Ga0495654_0002730_267_941 | 209 |
| 973 | 3300046531 | Ga0495665_0013511 | Ga0495665_0013511_3214_3846 | 209 |
| 974 | 3300046533 | Ga0495640_0016765 | Ga0495640_0016765_2333_2962 | 209 |
| 975 | 3300046533 | Ga0495640_0031232 | Ga0495640_0031232_2731_3363 | 209 |
| 976 | 3300046533 | Ga0495640_0049025 | Ga0495640_0049025_770_1399 | 209 |
| 977 | 3300046536 | Ga0495587_0004347 | Ga0495587_0004347_325_954 | 209 |
| 978 | 3300046542 | Ga0495597_0000024 | Ga0495597_0000024_45452_46081 | 209 |
| 979 | 3300046542 | Ga0495597_0004357 | Ga0495597_0004357_3458_4087 | 209 |
| 980 | 3300046542 | Ga0495597_0104029 | Ga0495597_0104029_199_828 | 209 |
| 981 | 3300046543 | Ga0495645_0001873 | Ga0495645_0001873_5911_6540 | 209 |
| 982 | 3300046543 | Ga0495645_0113493 | Ga0495645_0113493_836_1465 | 209 |
| 983 | 3300046557 | Ga0495622_0039624 | Ga0495622_0039624_976_1605 | 209 |
| 984 | 3300046557 | Ga0495622_0206056 | Ga0495622_0206056_193_822 | 209 |
| 985 | 3300046558 | Ga0495633_0000290 | Ga0495633_0000290_9189_9818 | 209 |
| 986 | 3300046558 | Ga0495633_0000319 | Ga0495633_0000319_31908_32537 | 209 |
| 987 | 3300046558 | Ga0495633_0043026 | Ga0495633_0043026_1443_2072 | 209 |
| 988 | 3300046558 | Ga0495633_0111654 | Ga0495633_0111654_390_1019 | 209 |
| 989 | 3300046559 | Ga0495667_0003300 | Ga0495667_0003300_6181_6810 | 209 |
| 990 | 3300046559 | Ga0495667_0039255 | Ga0495667_0039255_1491_2123 | 209 |
| 991 | 3300046616 | Ga0495668_0025664 | Ga0495668_0025664_2228_2857 | 209 |
| 992 | 3300046616 | Ga0495668_0124753 | Ga0495668_0124753_571_1200 | 209 |
| 993 | 3300046616 | Ga0495668_0144762 | Ga0495668_0144762_14_643 | 209 |
| 994 | 3300046642 | Ga0495634_0024720 | Ga0495634_0024720_2235_2864 | 209 |
| 995 | 3300046642 | Ga0495634_0401407 | Ga0495634_0401407_124_756 | 209 |
| 996 | 3300046648 | Ga0495611_0133439 | Ga0495611_0133439_373_1002 | 209 |
| 997 | 3300046660 | Ga0495625_0004416 | Ga0495625_0004416_5671_6300 | 209 |
| 998 | 3300046663 | Ga0495635_0001999 | Ga0495635_0001999_10813_11442 | 209 |
| 999 | 3300046663 | Ga0495635_0009596 | Ga0495635_0009596_4517_5146 | 209 |
| 1000 | 3300046665 | Ga0495661_0167203 | Ga0495661_0167203_80_709 | 209 |
| 1001 | 3300046674 | Ga0495588_0007284 | Ga0495588_0007284_1061_1690 | 209 |
| 1002 | 3300046675 | Ga0495657_0001200 | Ga0495657_0001200_15308_15937 | 209 |
| 1003 | 3300046675 | Ga0495657_0079975 | Ga0495657_0079975_433_1062 | 209 |
| 1004 | 3300046678 | Ga0495599_0004074 | Ga0495599_0004074_675_1304 | 209 |
| 1005 | 3300046678 | Ga0495599_0103104 | Ga0495599_0103104_808_1437 | 209 |
| 1006 | 3300046679 | Ga0495623_0012871 | Ga0495623_0012871_4731_5360 | 209 |
| 1007 | 3300046680 | Ga0495646_0040750 | Ga0495646_0040750_460_1089 | 209 |
| 1008 | 3300046680 | Ga0495646_0042675 | Ga0495646_0042675_928_1557 | 209 |
| 1009 | 3300046680 | Ga0495646_0307381 | Ga0495646_0307381_62_691 | 209 |
| 1010 | 3300046681 | Ga0495647_0010474 | Ga0495647_0010474_2088_2720 | 209 |
| 1011 | 3300046689 | Ga0495613_0028267 | Ga0495613_0028267_2734_3363 | 209 |
| 1012 | 3300046690 | Ga0495624_0014716 | Ga0495624_0014716_4142_4771 | 209 |
| 1013 | 3300046690 | Ga0495624_0024527 | Ga0495624_0024527_2716_3348 | 209 |
| 1014 | 3300046692 | Ga0495671_0000038 | Ga0495671_0000038_107895_108524 | 209 |
| 1015 | 3300046692 | Ga0495671_0000042 | Ga0495671_0000042_97591_98220 | 209 |
| 1016 | 3300046694 | Ga0495649_0038769 | Ga0495649_0038769_520_1149 | 209 |
| 1017 | 3300046694 | Ga0495649_0189318 | Ga0495649_0189318_361_990 | 209 |
| 1018 | 3300046809 | Ga0495600_0002291 | Ga0495600_0002291_6401_7030 | 209 |
| 1019 | 3300046809 | Ga0495600_0110545 | Ga0495600_0110545_222_851 | 209 |
| 1020 | 3300046809 | Ga0495600_0157089 | Ga0495600_0157089_178_810 | 209 |
| 1021 | 3300047317 | Ga0495604_0009383 | Ga0495604_0009383_3272_3901 | 209 |
| 1022 | 3300047317 | Ga0495604_0111017 | Ga0495604_0111017_820_1449 | 209 |
| 1023 | 3300047319 | Ga0495674_0009389 | Ga0495674_0009389_3966_4595 | 209 |
| 1024 | 3300047319 | Ga0495674_0023697 | Ga0495674_0023697_462_1091 | 209 |
| 1025 | 3300047321 | Ga0495676_0041792 | Ga0495676_0041792_586_1215 | 209 |
| 1026 | 3300047322 | Ga0495680_0007048 | Ga0495680_0007048_6422_7051 | 209 |
| 1027 | 3300047443 | Ga0495687_016477 | Ga0495687_016477_2898_3527 | 209 |
| 1028 | 3300047444 | Ga0495675_0001461 | Ga0495675_0001461_3037_3666 | 209 |
| 1029 | 3300047469 | Ga0495673_0000111 | Ga0495673_0000111_66982_67611 | 209 |
| 1030 | 3300047469 | Ga0495673_0032421 | Ga0495673_0032421_994_1623 | 209 |
| 1031 | 3300047469 | Ga0495673_0106846 | Ga0495673_0106846_51_680 | 209 |
| 1032 | 3300047470 | Ga0495681_0000050 | Ga0495681_0000050_94158_94787 | 209 |
| 1033 | 3300047470 | Ga0495681_0000953 | Ga0495681_0000953_5611_6240 | 209 |
| 1034 | 3300047471 | Ga0495684_0004997 | Ga0495684_0004997_8253_8885 | 209 |
| 1035 | 3300047471 | Ga0495684_0076471 | Ga0495684_0076471_1582_2211 | 209 |
| 1036 | 3300047472 | Ga0495686_0000131 | Ga0495686_0000131_62703_63332 | 209 |
| 1037 | 3300047472 | Ga0495686_0044217 | Ga0495686_0044217_1839_2468 | 209 |
| 1038 | 3300047472 | Ga0495686_0078545 | Ga0495686_0078545_1036_1665 | 209 |
| 1039 | 3300047673 | Ga0495593_0031083 | Ga0495593_0031083_2152_2781 | 209 |
| 1040 | 3300047673 | Ga0495593_0066345 | Ga0495593_0066345_130_759 | 209 |
| 1041 | 3300047673 | Ga0495593_0067395 | Ga0495593_0067395_1219_1851 | 209 |
| 1042 | 3300048088 | Ga0495602_0016196 | Ga0495602_0016196_3192_3821 | 209 |
| 1043 | 3300048088 | Ga0495602_0110878 | Ga0495602_0110878_551_1180 | 209 |
| 1044 | 3300048088 | Ga0495602_0249852 | Ga0495602_0249852_119_748 | 209 |
| 1045 | 3300048090 | Ga0495615_0000002 | Ga0495615_0000002_95640_96269 | 209 |
| 1046 | 3300048091 | Ga0495626_0001710 | Ga0495626_0001710_6711_7340 | 209 |
| 1047 | 3300048903 | Ga0496100_0254925 | Ga0496100_0254925_355_984 | 209 |
| 1048 | 3300048903 | Ga0496100_0324336 | Ga0496100_0324336_157_786 | 209 |
| 1049 | 3300048903 | Ga0496100_0491266 | Ga0496100_0491266_168_797 | 209 |
| 1050 | 3300048904 | Ga0496101_0063166 | Ga0496101_0063166_1193_1822 | 209 |
| 1051 | 3300048904 | Ga0496101_0193098 | Ga0496101_0193098_467_1096 | 209 |
| 1052 | 3300048904 | Ga0496101_0749993 | Ga0496101_0749993_43_672 | 209 |
| 1053 | 3300048905 | Ga0496102_0001289 | Ga0496102_0001289_13867_14496 | 209 |
| 1054 | 3300048905 | Ga0496102_0014553 | Ga0496102_0014553_2098_2727 | 209 |
| 1055 | 3300048905 | Ga0496102_0022385 | Ga0496102_0022385_2677_3306 | 209 |
| 1056 | 3300048905 | Ga0496102_0056751 | Ga0496102_0056751_795_1424 | 209 |
| 1057 | 3300048906 | Ga0496103_0000163 | Ga0496103_0000163_69705_70334 | 209 |
| 1058 | 3300048906 | Ga0496103_0011719 | Ga0496103_0011719_2670_3299 | 209 |
| 1059 | 3300048906 | Ga0496103_0049786 | Ga0496103_0049786_1511_2140 | 209 |
| 1060 | 3300048907 | Ga0496104_0003456 | Ga0496104_0003456_12419_13048 | 209 |
| 1061 | 3300048907 | Ga0496104_0003849 | Ga0496104_0003849_6962_7591 | 209 |
| 1062 | 3300048907 | Ga0496104_0021120 | Ga0496104_0021120_430_1059 | 209 |
| 1063 | 3300048907 | Ga0496104_0839004 | Ga0496104_0839004_23_652 | 209 |
| 1064 | 3300048908 | Ga0496105_0001070 | Ga0496105_0001070_12269_12898 | 209 |
| 1065 | 3300048908 | Ga0496105_0007451 | Ga0496105_0007451_5594_6223 | 209 |
| 1066 | 3300048908 | Ga0496105_0205474 | Ga0496105_0205474_210_839 | 209 |
| 1067 | 3300048908 | Ga0496105_0417999 | Ga0496105_0417999_157_786 | 209 |
| 1068 | 3300048909 | Ga0496106_0000358 | Ga0496106_0000358_15219_15848 | 209 |
| 1069 | 3300048909 | Ga0496106_0010950 | Ga0496106_0010950_5395_6024 | 209 |
| 1070 | 3300048910 | Ga0496107_0085414 | Ga0496107_0085414_1168_1797 | 209 |
| 1071 | 3300048910 | Ga0496107_0103996 | Ga0496107_0103996_345_974 | 209 |
| 1072 | 3300048910 | Ga0496107_0184332 | Ga0496107_0184332_184_813 | 209 |
| 1073 | 3300048911 | Ga0496108_0069872 | Ga0496108_0069872_1864_2493 | 209 |
| 1074 | 3300048911 | Ga0496108_0078137 | Ga0496108_0078137_1461_2090 | 209 |
| 1075 | 3300048911 | Ga0496108_0249567 | Ga0496108_0249567_595_1224 | 209 |
| 1076 | 3300048912 | Ga0496109_0024779 | Ga0496109_0024779_1202_1831 | 209 |
| 1077 | 3300048912 | Ga0496109_0080914 | Ga0496109_0080914_1300_1929 | 209 |
| 1078 | 3300048912 | Ga0496109_0371301 | Ga0496109_0371301_547_1179 | 209 |
| 1079 | 3300048912 | Ga0496109_0680925 | Ga0496109_0680925_145_774 | 209 |
| 1080 | 3300048913 | Ga0496110_0010631 | Ga0496110_0010631_4733_5362 | 209 |
| 1081 | 3300048913 | Ga0496110_0079158 | Ga0496110_0079158_763_1392 | 209 |
| 1082 | 3300048913 | Ga0496110_0098432 | Ga0496110_0098432_621_1250 | 209 |
| 1083 | 3300048913 | Ga0496110_0241914 | Ga0496110_0241914_205_834 | 209 |
| 1084 | 3300048914 | Ga0496111_0110967 | Ga0496111_0110967_56_685 | 209 |
| 1085 | 3300048914 | Ga0496111_0206713 | Ga0496111_0206713_499_1128 | 209 |
| 1086 | 3300048915 | Ga0496112_0004169 | Ga0496112_0004169_5411_6040 | 209 |
| 1087 | 3300048915 | Ga0496112_0005313 | Ga0496112_0005313_5126_5755 | 209 |
| 1088 | 3300048915 | Ga0496112_0048480 | Ga0496112_0048480_2192_2821 | 209 |
| 1089 | 3300048915 | Ga0496112_0199250 | Ga0496112_0199250_644_1273 | 209 |
| 1090 | 3300048915 | Ga0496112_0299729 | Ga0496112_0299729_345_974 | 209 |
| 1091 | 3300048915 | Ga0496112_0629522 | Ga0496112_0629522_40_669 | 209 |
| 1092 | 3300048915 | Ga0496112_0730787 | Ga0496112_0730787_59_688 | 209 |
| 1093 | 3300048916 | Ga0496113_0000519 | Ga0496113_0000519_6926_7555 | 209 |
| 1094 | 3300048916 | Ga0496113_0009379 | Ga0496113_0009379_198_827 | 209 |
| 1095 | 3300048916 | Ga0496113_0015207 | Ga0496113_0015207_1536_2168 | 209 |
| 1096 | 3300048916 | Ga0496113_0043989 | Ga0496113_0043989_2172_2801 | 209 |
| 1097 | 3300048916 | Ga0496113_0061925 | Ga0496113_0061925_325_954 | 209 |
| 1098 | 3300048916 | Ga0496113_0131023 | Ga0496113_0131023_632_1261 | 209 |
| 1099 | 3300048916 | Ga0496113_0727822 | Ga0496113_0727822_104_733 | 209 |
| 1100 | 3300048917 | Ga0496114_0101393 | Ga0496114_0101393_1653_2282 | 209 |
| 1101 | 3300048917 | Ga0496114_0705007 | Ga0496114_0705007_70_699 | 209 |
| 1102 | 3300048918 | Ga0496115_0031252 | Ga0496115_0031252_1270_1899 | 209 |
| 1103 | 3300048918 | Ga0496115_0186263 | Ga0496115_0186263_629_1258 | 209 |
| 1104 | 3300048918 | Ga0496115_0208849 | Ga0496115_0208849_615_1244 | 209 |
| 1105 | 3300048918 | Ga0496115_0371747 | Ga0496115_0371747_276_905 | 209 |
| 1106 | 3300048919 | Ga0496116_0042437 | Ga0496116_0042437_465_1094 | 209 |
| 1107 | 3300048920 | Ga0496117_0001164 | Ga0496117_0001164_14588_15217 | 209 |
| 1108 | 3300048920 | Ga0496117_0072211 | Ga0496117_0072211_1485_2114 | 209 |
| 1109 | 3300048920 | Ga0496117_0074790 | Ga0496117_0074790_562_1191 | 209 |
| 1110 | 3300048920 | Ga0496117_0184712 | Ga0496117_0184712_507_1136 | 209 |
| 1111 | 3300048921 | Ga0496118_0000618 | Ga0496118_0000618_19461_20090 | 209 |
| 1112 | 3300048921 | Ga0496118_0019810 | Ga0496118_0019810_4485_5114 | 209 |
| 1113 | 3300048921 | Ga0496118_0023183 | Ga0496118_0023183_3564_4193 | 209 |
| 1114 | 3300048921 | Ga0496118_0070937 | Ga0496118_0070937_751_1380 | 209 |
| 1115 | 3300048921 | Ga0496118_0070938 | Ga0496118_0070938_1132_1761 | 209 |
| 1116 | 3300048922 | Ga0496119_0003597 | Ga0496119_0003597_9295_9924 | 209 |
| 1117 | 3300048922 | Ga0496119_0011321 | Ga0496119_0011321_5553_6182 | 209 |
| 1118 | 3300048922 | Ga0496119_0022385 | Ga0496119_0022385_734_1363 | 209 |
| 1119 | 3300048922 | Ga0496119_0031381 | Ga0496119_0031381_2723_3352 | 209 |
| 1120 | 3300048923 | Ga0496120_0022344 | Ga0496120_0022344_2370_2999 | 209 |
| 1121 | 3300048923 | Ga0496120_0055355 | Ga0496120_0055355_87_716 | 209 |
| 1122 | 3300048923 | Ga0496120_0061066 | Ga0496120_0061066_416_1045 | 209 |
| 1123 | 3300048924 | Ga0496121_0000017 | Ga0496121_0000017_313483_314112 | 209 |
| 1124 | 3300048924 | Ga0496121_0000212 | Ga0496121_0000212_37485_38114 | 209 |
| 1125 | 3300048924 | Ga0496121_0011514 | Ga0496121_0011514_8205_8837 | 209 |
| 1126 | 3300048924 | Ga0496121_0014846 | Ga0496121_0014846_3501_4130 | 209 |
| 1127 | 3300048924 | Ga0496121_0035076 | Ga0496121_0035076_857_1486 | 209 |
| 1128 | 3300048924 | Ga0496121_0043707 | Ga0496121_0043707_2115_2744 | 209 |
| 1129 | 3300048924 | Ga0496121_0057029 | Ga0496121_0057029_328_957 | 209 |
| 1130 | 3300048924 | Ga0496121_0059460 | Ga0496121_0059460_963_1592 | 209 |
| 1131 | 3300048924 | Ga0496121_0061598 | Ga0496121_0061598_153_782 | 209 |
| 1132 | 3300048924 | Ga0496121_0063034 | Ga0496121_0063034_2210_2839 | 209 |
| 1133 | 3300048924 | Ga0496121_0093883 | Ga0496121_0093883_598_1227 | 209 |
| 1134 | 3300048924 | Ga0496121_0166887 | Ga0496121_0166887_23_652 | 209 |
| 1135 | 3300048924 | Ga0496121_0194799 | Ga0496121_0194799_579_1211 | 209 |
| 1136 | 3300048924 | Ga0496121_0216279 | Ga0496121_0216279_646_1275 | 209 |
| 1137 | 3300048924 | Ga0496121_0413651 | Ga0496121_0413651_23_652 | 209 |
| 1138 | 3300048925 | Ga0496122_0001302 | Ga0496122_0001302_35686_36315 | 209 |
| 1139 | 3300048925 | Ga0496122_0001656 | Ga0496122_0001656_19425_20054 | 209 |
| 1140 | 3300048925 | Ga0496122_0015581 | Ga0496122_0015581_6616_7245 | 209 |
| 1141 | 3300048925 | Ga0496122_0070871 | Ga0496122_0070871_1194_1823 | 209 |
| 1142 | 3300048925 | Ga0496122_0078710 | Ga0496122_0078710_1214_1843 | 209 |
| 1143 | 3300048925 | Ga0496122_0131977 | Ga0496122_0131977_472_1101 | 209 |
| 1144 | 3300048926 | Ga0496123_0001454 | Ga0496123_0001454_27479_28108 | 209 |
| 1145 | 3300048926 | Ga0496123_0003614 | Ga0496123_0003614_2898_3527 | 209 |
| 1146 | 3300048926 | Ga0496123_0005223 | Ga0496123_0005223_3799_4428 | 209 |
| 1147 | 3300048926 | Ga0496123_0048070 | Ga0496123_0048070_2184_2813 | 209 |
| 1148 | 3300048926 | Ga0496123_0123319 | Ga0496123_0123319_348_977 | 209 |
| 1149 | 3300048926 | Ga0496123_0153197 | Ga0496123_0153197_258_980 | 209 |
| 1150 | 3300048927 | Ga0496124_0000204 | Ga0496124_0000204_31212_31841 | 209 |
| 1151 | 3300048927 | Ga0496124_0000861 | Ga0496124_0000861_34298_34927 | 209 |
| 1152 | 3300048927 | Ga0496124_0000988 | Ga0496124_0000988_38617_39246 | 209 |
| 1153 | 3300048927 | Ga0496124_0002175 | Ga0496124_0002175_11135_11764 | 209 |
| 1154 | 3300048927 | Ga0496124_0062229 | Ga0496124_0062229_1697_2326 | 209 |
| 1155 | 3300048927 | Ga0496124_0097847 | Ga0496124_0097847_1454_2083 | 209 |
| 1156 | 3300048927 | Ga0496124_0233617 | Ga0496124_0233617_226_855 | 209 |
| 1157 | 3300048927 | Ga0496124_0258241 | Ga0496124_0258241_200_829 | 209 |
| 1158 | 3300048928 | Ga0496125_0000841 | Ga0496125_0000841_8154_8783 | 209 |
| 1159 | 3300048928 | Ga0496125_0003958 | Ga0496125_0003958_6067_6696 | 209 |
| 1160 | 3300048928 | Ga0496125_0004293 | Ga0496125_0004293_2052_2684 | 209 |
| 1161 | 3300048928 | Ga0496125_0071000 | Ga0496125_0071000_1655_2284 | 209 |
| 1162 | 3300048928 | Ga0496125_0076091 | Ga0496125_0076091_1405_2034 | 209 |
| 1163 | 3300048928 | Ga0496125_0090717 | Ga0496125_0090717_1428_2072 | 209 |
| 1164 | 3300048928 | Ga0496125_0101131 | Ga0496125_0101131_391_1020 | 209 |
| 1165 | 3300048928 | Ga0496125_0200646 | Ga0496125_0200646_265_894 | 209 |
| 1166 | 3300048929 | Ga0496126_0000066 | Ga0496126_0000066_17713_18342 | 209 |
| 1167 | 3300048929 | Ga0496126_0005496 | Ga0496126_0005496_696_1325 | 209 |
| 1168 | 3300048929 | Ga0496126_0017234 | Ga0496126_0017234_2057_2686 | 209 |
| 1169 | 3300048929 | Ga0496126_0032656 | Ga0496126_0032656_674_1303 | 209 |
| 1170 | 3300048929 | Ga0496126_0034196 | Ga0496126_0034196_1206_1835 | 209 |
| 1171 | 3300048929 | Ga0496126_0080413 | Ga0496126_0080413_1812_2441 | 209 |
| 1172 | 3300048929 | Ga0496126_0116161 | Ga0496126_0116161_1259_1888 | 209 |
| 1173 | 3300048929 | Ga0496126_0132632 | Ga0496126_0132632_1031_1660 | 209 |
| 1174 | 3300048929 | Ga0496126_0134066 | Ga0496126_0134066_1133_1762 | 209 |
| 1175 | 3300048929 | Ga0496126_0216201 | Ga0496126_0216201_938_1567 | 209 |
| 1176 | 3300048929 | Ga0496126_0439538 | Ga0496126_0439538_262_891 | 209 |
| 1177 | 3300048929 | Ga0496126_0449882 | Ga0496126_0449882_383_1012 | 209 |
| 1178 | 3300049570 | Ga0501033_0247601 | Ga0501033_0247601_189_818 | 209 |
| 1179 | 3300049581 | Ga0501047_0132914 | Ga0501047_0132914_707_1336 | 209 |
| 1180 | 3300049586 | Ga0501070_0072795 | Ga0501070_0072795_738_1367 | 209 |
| 1181 | 3300049590 | Ga0501074_0113300 | Ga0501074_0113300_189_818 | 209 |
| 1182 | 3300049663 | Ga0501223_000031 | Ga0501223_000031_42017_42649 | 209 |
| 1183 | 3300049668 | Ga0501233_000027 | Ga0501233_000027_14796_15425 | 209 |
| 1184 | 3300049705 | Ga0501225_0006588 | Ga0501225_0006588_639_1271 | 209 |
| 1185 | 3300049705 | Ga0501225_0014677 | Ga0501225_0014677_1248_1877 | 209 |
| 1186 | 3300049742 | Ga0501080_0132729 | Ga0501080_0132729_771_1400 | 209 |
| 1187 | 3300049823 | Ga0501044_0056476 | Ga0501044_0056476_1916_2545 | 209 |
| 1188 | 3300050490 | nmdc:mga03n38_46090_c1 | nmdc:mga03n38_46090_c1_1038_1667 | 209 |
| 1189 | 3300050492 | nmdc:mga0yw44_171177_c1 | nmdc:mga0yw44_171177_c1_138_767 | 209 |
| 1190 | 3300050492 | nmdc:mga0yw44_239601_c1 | nmdc:mga0yw44_239601_c1_552_1181 | 209 |
| 1191 | 3300050492 | nmdc:mga0yw44_30835_c1 | nmdc:mga0yw44_30835_c1_55_684 | 209 |
| 1192 | 3300050492 | nmdc:mga0yw44_35076_c1 | nmdc:mga0yw44_35076_c1_843_1472 | 209 |
| 1193 | 3300050492 | nmdc:mga0yw44_46356_c1 | nmdc:mga0yw44_46356_c1_1490_2119 | 209 |
| 1194 | 3300050493 | nmdc:mga0k408_168650_c1 | nmdc:mga0k408_168650_c1_601_1230 | 209 |
| 1195 | 3300050493 | nmdc:mga0k408_4184_c1 | nmdc:mga0k408_4184_c1_1767_2399 | 209 |
| 1196 | 3300050494 | nmdc:mga06z11_108_c1 | nmdc:mga06z11_108_c1_13176_13805 | 209 |
| 1197 | 3300050494 | nmdc:mga06z11_162081_c1 | nmdc:mga06z11_162081_c1_303_932 | 209 |
| 1198 | 3300050494 | nmdc:mga06z11_18525_c1 | nmdc:mga06z11_18525_c1_2506_3135 | 209 |
| 1199 | 3300050494 | nmdc:mga06z11_318564_c1 | nmdc:mga06z11_318564_c1_113_742 | 209 |
| 1200 | 3300050495 | nmdc:mga04h51_11_c1 | nmdc:mga04h51_11_c1_18079_18708 | 209 |
| 1201 | 3300050496 | nmdc:mga07m45_118389_c1 | nmdc:mga07m45_118389_c1_387_1016 | 209 |
| 1202 | 3300050496 | nmdc:mga07m45_323868_c1 | nmdc:mga07m45_323868_c1_107_736 | 209 |
| 1203 | 3300050496 | nmdc:mga07m45_3791_c1 | nmdc:mga07m45_3791_c1_3609_4238 | 209 |
| 1204 | 3300050496 | nmdc:mga07m45_41409_c1 | nmdc:mga07m45_41409_c1_1844_2473 | 209 |
| 1205 | 3300050512 | nmdc:mga0n895_202296_c1 | nmdc:mga0n895_202296_c1_264_893 | 209 |
| 1206 | 3300050512 | nmdc:mga0n895_62695_c1 | nmdc:mga0n895_62695_c1_1329_1958 | 209 |
| 1207 | 3300050514 | nmdc:mga08x19_48563_c1 | nmdc:mga08x19_48563_c1_862_1491 | 209 |
| 1208 | 3300050516 | nmdc:mga0sz30_106040_c1 | nmdc:mga0sz30_106040_c1_40_669 | 209 |
| 1209 | 3300050516 | nmdc:mga0sz30_17191_c1 | nmdc:mga0sz30_17191_c1_202_831 | 209 |
| 1210 | 3300053077 | Ga0495601_0135539 | Ga0495601_0135539_636_1265 | 209 |
| 1211 | 3300053077 | Ga0495601_0144005 | Ga0495601_0144005_202_834 | 209 |
| 1212 | 3300053078 | Ga0495612_0015011 | Ga0495612_0015011_59_691 | 209 |
| 1213 | 3300053079 | Ga0500610_0030564 | Ga0500610_0030564_1849_2478 | 209 |
| 1214 | 3300053080 | Ga0500635_0000497 | Ga0500635_0000497_1830_2459 | 209 |
| 1215 | 3300053080 | Ga0500635_0002088 | Ga0500635_0002088_1620_2249 | 209 |
| 1216 | 3300053080 | Ga0500635_0052409 | Ga0500635_0052409_306_935 | 209 |
| 1217 | 3300053083 | Ga0495655_0057445 | Ga0495655_0057445_144_773 | 209 |
| 1218 | 3300053084 | Ga0495595_0128276 | Ga0495595_0128276_557_1186 | 209 |
| 1219 | 3300053086 | Ga0500578_0201782 | Ga0500578_0201782_574_1203 | 209 |
| 1220 | 3300053086 | Ga0500578_0292072 | Ga0500578_0292072_98_727 | 209 |
| 1221 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_450696_451325 | 209 |
| 1222 | 3300053087 | Ga0500643_126723 | Ga0500643_126723_34_663 | 209 |
| 1223 | 3300053091 | Ga0500647_0004594 | Ga0500647_0004594_425_1054 | 209 |
| 1224 | 3300053091 | Ga0500647_0023075 | Ga0500647_0023075_1039_1668 | 209 |
| 1225 | 3300053092 | Ga0500583_0024081 | Ga0500583_0024081_623_1252 | 209 |
| 1226 | 3300053093 | Ga0500651_0054309 | Ga0500651_0054309_84_713 | 209 |
| 1227 | 3300053093 | Ga0500651_0097056 | Ga0500651_0097056_496_1125 | 209 |
| 1228 | 3300053094 | Ga0500566_0000011 | Ga0500566_0000011_17689_18318 | 209 |
| 1229 | 3300053094 | Ga0500566_0000613 | Ga0500566_0000613_6178_6807 | 209 |
| 1230 | 3300053094 | Ga0500566_0049910 | Ga0500566_0049910_55_684 | 209 |
| 1231 | 3300053094 | Ga0500566_0198287 | Ga0500566_0198287_126_755 | 209 |
| 1232 | 3300053095 | Ga0500640_002917 | Ga0500640_002917_3712_4341 | 209 |
| 1233 | 3300053098 | Ga0500650_0070352 | Ga0500650_0070352_658_1287 | 209 |
| 1234 | 3300053103 | Ga0500555_003600 | Ga0500555_003600_922_1551 | 209 |
| 1235 | 3300053105 | Ga0500557_000009 | Ga0500557_000009_77431_78060 | 209 |
| 1236 | 3300053108 | Ga0500562_009630 | Ga0500562_009630_1193_1822 | 209 |
| 1237 | 3300053109 | Ga0500569_009092 | Ga0500569_009092_429_1058 | 209 |
| 1238 | 3300053111 | Ga0500572_000119 | Ga0500572_000119_19306_19935 | 209 |
| 1239 | 3300053118 | Ga0500594_0005732 | Ga0500594_0005732_1659_2288 | 209 |
| 1240 | 3300053119 | Ga0500595_000111 | Ga0500595_000111_15380_16009 | 209 |
| 1241 | 3300053119 | Ga0500595_013847 | Ga0500595_013847_690_1319 | 209 |
| 1242 | 3300053119 | Ga0500595_037477 | Ga0500595_037477_83_712 | 209 |
| 1243 | 3300053122 | Ga0500608_000420 | Ga0500608_000420_3614_4243 | 209 |
| 1244 | 3300053122 | Ga0500608_001840 | Ga0500608_001840_4028_4657 | 209 |
| 1245 | 3300053123 | Ga0500614_000712 | Ga0500614_000712_3367_3996 | 209 |
| 1246 | 3300053123 | Ga0500614_022418 | Ga0500614_022418_475_1104 | 209 |
| 1247 | 3300053125 | Ga0500618_000755 | Ga0500618_000755_4020_4649 | 209 |
| 1248 | 3300053126 | Ga0500621_159539 | Ga0500621_159539_144_773 | 209 |
| 1249 | 3300053128 | Ga0500626_044699 | Ga0500626_044699_387_1016 | 209 |
| 1250 | 3300053130 | Ga0500642_0000154 | Ga0500642_0000154_2831_3460 | 209 |
| 1251 | 3300053130 | Ga0500642_0021161 | Ga0500642_0021161_786_1415 | 209 |
| 1252 | 3300053133 | Ga0500655_000008 | Ga0500655_000008_38342_38971 | 209 |
| 1253 | 3300053133 | Ga0500655_022379 | Ga0500655_022379_103_732 | 209 |
| 1254 | 3300053134 | Ga0500658_0049679 | Ga0500658_0049679_273_902 | 209 |
| 1255 | 3300053134 | Ga0500658_0230201 | Ga0500658_0230201_156_785 | 209 |
| 1256 | 3300053136 | Ga0500559_0000335 | Ga0500559_0000335_24121_24750 | 209 |
| 1257 | 3300053136 | Ga0500559_0000891 | Ga0500559_0000891_6829_7458 | 209 |
| 1258 | 3300053136 | Ga0500559_0003742 | Ga0500559_0003742_3618_4247 | 209 |
| 1259 | 3300053136 | Ga0500559_0036328 | Ga0500559_0036328_1047_1676 | 209 |
| 1260 | 3300053136 | Ga0500559_0082526 | Ga0500559_0082526_690_1319 | 209 |
| 1261 | 3300053136 | Ga0500559_0129670 | Ga0500559_0129670_101_730 | 209 |
| 1262 | 3300053138 | Ga0500564_004667 | Ga0500564_004667_1658_2287 | 209 |
| 1263 | 3300053138 | Ga0500564_093280 | Ga0500564_093280_89_718 | 209 |
| 1264 | 3300053140 | Ga0500573_0028168 | Ga0500573_0028168_368_997 | 209 |
| 1265 | 3300053140 | Ga0500573_0059303 | Ga0500573_0059303_246_875 | 209 |
| 1266 | 3300053144 | Ga0500585_099151 | Ga0500585_099151_342_971 | 209 |
| 1267 | 3300053146 | Ga0500588_0032258 | Ga0500588_0032258_830_1459 | 209 |
| 1268 | 3300053148 | Ga0500590_000889 | Ga0500590_000889_9935_10564 | 209 |
| 1269 | 3300053148 | Ga0500590_042265 | Ga0500590_042265_851_1480 | 209 |
| 1270 | 3300053150 | Ga0500603_000056 | Ga0500603_000056_13486_14115 | 209 |
| 1271 | 3300053150 | Ga0500603_000222 | Ga0500603_000222_8293_8922 | 209 |
| 1272 | 3300053150 | Ga0500603_021701 | Ga0500603_021701_526_1155 | 209 |
| 1273 | 3300053151 | Ga0500604_0009791 | Ga0500604_0009791_207_836 | 209 |
| 1274 | 3300053155 | Ga0500620_056124 | Ga0500620_056124_177_806 | 209 |
| 1275 | 3300053157 | Ga0500624_000021 | Ga0500624_000021_82433_83062 | 209 |
| 1276 | 3300053159 | Ga0500630_000088 | Ga0500630_000088_9159_9788 | 209 |
| 1277 | 3300053159 | Ga0500630_123730 | Ga0500630_123730_326_955 | 209 |
| 1278 | 3300053162 | Ga0500638_000096 | Ga0500638_000096_6536_7165 | 209 |
| 1279 | 3300053162 | Ga0500638_087189 | Ga0500638_087189_522_1151 | 209 |
| 1280 | 3300053162 | Ga0500638_135664 | Ga0500638_135664_461_1090 | 209 |
| 1281 | 3300053163 | Ga0500639_000009 | Ga0500639_000009_21032_21661 | 209 |
| 1282 | 3300053163 | Ga0500639_090584 | Ga0500639_090584_206_835 | 209 |
| 1283 | 3300053177 | Ga0500636_0000228 | Ga0500636_0000228_15603_16232 | 209 |
| 1284 | 3300053177 | Ga0500636_0106617 | Ga0500636_0106617_135_764 | 209 |
| 1285 | 3300053177 | Ga0500636_0233003 | Ga0500636_0233003_55_684 | 209 |
| 1286 | 3300053178 | Ga0500637_0000708 | Ga0500637_0000708_1107_1736 | 209 |
| 1287 | 3300053178 | Ga0500637_0001960 | Ga0500637_0001960_606_1235 | 209 |
| 1288 | 3300053178 | Ga0500637_0022686 | Ga0500637_0022686_300_929 | 209 |
| 1289 | 3300053178 | Ga0500637_0083980 | Ga0500637_0083980_70_699 | 209 |
| 1290 | 3300053723 | Ga0500567_004223 | Ga0500567_004223_3828_4457 | 209 |
| 1291 | 3300053729 | Ga0500625_000012 | Ga0500625_000012_68286_68915 | 209 |
| 1292 | 3300053729 | Ga0500625_000053 | Ga0500625_000053_20354_20983 | 209 |
| 1293 | 3300053730 | Ga0500645_011994 | Ga0500645_011994_1460_2089 | 209 |
| 1294 | 3300053731 | Ga0500609_003435 | Ga0500609_003435_497_1126 | 209 |
| 1295 | 3300053735 | Ga0500596_000288 | Ga0500596_000288_8258_8887 | 209 |
| 1296 | 3300053735 | Ga0500596_022511 | Ga0500596_022511_133_762 | 209 |
| 1297 | 3300053736 | Ga0500599_004512 | Ga0500599_004512_334_963 | 209 |
| 1298 | 3300053737 | Ga0500601_000488 | Ga0500601_000488_1107_1736 | 209 |
| 1299 | 3300053737 | Ga0500601_001930 | Ga0500601_001930_22_651 | 209 |
| 1300 | 3300055283 | Ga0500661_000582 | Ga0500661_000582_4894_5523 | 209 |
| 1301 | 3300061719 | Ga0466962_0122766 | Ga0466962_0122766_477_1106 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4au1-assembly1.cif.gz_A | crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba | 0.9998 | 2 | 209 |
| 5n0g-assembly1.cif.gz_A-2 | crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba | 0.9982 | 2 | 209 |
| 4au1-assembly1.cif.gz_A | crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba | 0.995 | 2 | 209 |
| 5n0g-assembly1.cif.gz_A-2 | crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba | 0.9934 | 2 | 209 |
| 3e7d-assembly1.cif.gz_A | crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis | 0.9792 | 5 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e7dD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9815 | 5 | 207 | 3.40.50.10230 |
| 3e7dD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9721 | 5 | 207 | 3.40.50.10230 |
| 2afvB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9258 | 3 | 204 | 3.40.50.10230 |
| 1v9cA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.9176 | 11 | 204 | 3.40.50.10230 |
| af_Q58340_4_210_3.40.50.10230 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase | 0.911 | 5 | 204 | 3.40.50.10230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L9G7R4-F1-model_v4 | Precorrin-8X methylmutase (EC 5.4.99.61) | 1.004 | 71 | 176 |
GO:0009236
GO:0016993 |
| AF-A0A0C9M4D2-F1-model_v4 | CobH protein | 1.002 | 39 | 209 |
GO:0009236
GO:0016993 |
| AF-A0A519QW32-F1-model_v4 | Precorrin-8X methylmutase (EC 5.4.99.61) | 1.002 | 71 | 209 |
GO:0009236
GO:0016993 |
| AF-A0A2N8FP27-F1-model_v4 | deleted | 1.002 | 97 | 209 |
|
| AF-A0A7Y5QQ20-F1-model_v4 | Precorrin-8X methylmutase | 1.001 | 123 | 203 |
GO:0009236
GO:0016993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar