F492766

General Info

Members Datasets Scaffolds Average Seq Length
1301 725 1031 209

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0153197|Ga0496123_0153197_258_980
Length 240
Sequence MPVLPGSLTVPGASSLTGPGRHCLQNSTHYFMTYHYEMHGEEIYRQSFRIIRSEADLARFTPLEERVACRMIHAAGMVSLAQDIHFSADFAQAAEAALQRGAPILCDARMVSEGITRKRLPADNAIICTLQDARTPGLAQAMGNTRSAAALELWREHLDGAVVAIGNAPTALFHLLNMLEDPACPRPAAIIGCPVGFVGAAESKDALRAWGQIPFAIVQGRLGGSAITVAAVNALATAVE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501939600 Micromonospora sp. L5 Isolate Unclassified
3 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
4 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
5 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
11 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
12 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
13 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
14 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
15 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
16 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
17 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
18 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
19 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
20 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
21 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
22 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
23 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
24 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
25 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
26 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
27 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
28 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
29 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
30 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
31 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
32 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
33 2643221561 Nocardioides sp. Root151 Isolate Unclassified
34 2643221576 Nocardioides sp. Root614 Isolate Unclassified
35 2643221590 Nocardioides sp. Root682 Isolate Unclassified
36 2643221604 Nocardioides sp. Root190 Isolate Unclassified
37 2643221609 Acidovorax sp. Root217 Isolate Unclassified
38 2643221611 Acidovorax sp. Root219 Isolate Unclassified
39 2643221615 Nocardioides sp. Root224 Isolate Unclassified
40 2643221617 Nocardioides sp. Root79 Isolate Unclassified
41 2643221620 Nocardioides sp. Root240 Isolate Unclassified
42 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
43 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
44 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
45 2721755523 Delftia sp. HK171 Isolate Unclassified
46 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
47 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
48 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
49 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
50 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
51 2738541305 Nocardioides sp. CF167 Isolate Unclassified
52 2738543012 Acidovorax sp. CF301 Isolate Unclassified
53 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
54 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
55 2739367898 Nocardioides sp. CF479 Isolate Unclassified
56 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
57 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
58 2791355199
59 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
60 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
61 2816332133 Acidovorax radicis 2721A Isolate Unclassified
62 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
63 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
64 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
65 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
66 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
67 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
68 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
69 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
70 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
71 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
72 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
73 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
74 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
75 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
76 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
77 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
78 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
79 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
80 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
81 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
82 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
83 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
84 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
85 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
86 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
87 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
88 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
89 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
90 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
91 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
92 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
93 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
94 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
95 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
96 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
97 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
98 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
99 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
100 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
101 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
102 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
103 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
104 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
105 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
106 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
107 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
108 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
109 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
110 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
111 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
112 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
113 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
114 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
115 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
116 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
117 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
118 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
119 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
120 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
121 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
122 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
123 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
124 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
125 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
126 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
127 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
128 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
129 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
130 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
131 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
132 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
133 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
134 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
135 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
136 2904699407
137 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
138 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
139 2906610324
140 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
141 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
142 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
143 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
144 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
145 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
146 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
147 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
148 2922368715
149 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
150 2922425934
151 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
152 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
153 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
154 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
155 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
156 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
157 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
158 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
159 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
160 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
161 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
162 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
163 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
164 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
165 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
166 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
167 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
168 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
169 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
170 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
171 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
172 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
173 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
174 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
175 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
176 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
177 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
178 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
179 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
180 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
181 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
182 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
183 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
184 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
185 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
186 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
187 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
188 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
189 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
190 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
191 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
192 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
193 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
194 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
195 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
196 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
197 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
198 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
199 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
200 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
201 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
202 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
203 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
204 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
205 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
206 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
207 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
208 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
209 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
210 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
211 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
212 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
213 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
214 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
215 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
216 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
217 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
218 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
219 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
220 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
221 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
222 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
223 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
224 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
225 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
226 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
227 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
228 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
229 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
230 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
231 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
232 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
233 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
234 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
235 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
236 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
237 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
238 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
239 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
240 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
241 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
242 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
243 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
244 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
245 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
246 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
247 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
248 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
249 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
250 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
251 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
252 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
253 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
254 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
255 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
256 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
257 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
258 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
259 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
260 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
261 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
262 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
263 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
264 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
265 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
266 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
267 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
268 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
269 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
270 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
271 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
272 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
273 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
274 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
275 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
276 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
277 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
278 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
279 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
280 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
281 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
282 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
283 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
284 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
285 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
286 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
287 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
288 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
289 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
290 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
291 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
292 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
293 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
294 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
295 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
296 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
297 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
298 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
299 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
300 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
301 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
302 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
303 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
304 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
305 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
306 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
307 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
308 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
309 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
310 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
311 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
312 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
313 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
314 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
315 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
316 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
317 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
318 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
319 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
320 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
321 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
322 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
323 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
324 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
325 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
326 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
327 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
328 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
329 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
330 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
331 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
332 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
333 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
334 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
335 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
336 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
337 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
338 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
339 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
340 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
341 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
342 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
343 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
344 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
345 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
346 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
347 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
348 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
349 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
351 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
352 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
353 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
354 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
355 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
356 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
358 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
361 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
363 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
364 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
365 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
366 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
367 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
421 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
422 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
423 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
424 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
425 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
426 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
427 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
431 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
432 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
433 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
434 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
435 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
436 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
437 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
438 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
439 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
440 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
441 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
442 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
443 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
444 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
445 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
446 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
447 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
448 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
449 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
450 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
451 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
452 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
453 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
454 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
455 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
456 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
457 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
458 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
459 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
460 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
461 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
462 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
463 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
464 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
465 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
466 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
467 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
468 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
469 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
470 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
471 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
472 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
473 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
474 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
475 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
476 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
477 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
478 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
479 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
480 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
481 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
482 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
483 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
484 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
485 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
486 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
487 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
488 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
489 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
490 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
491 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
492 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
493 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
494 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
495 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
496 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
497 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
498 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
499 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
500 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
501 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
502 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
503 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
504 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
505 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
506 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
507 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
508 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
509 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
510 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
511 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
512 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
513 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
514 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
515 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
516 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
517 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
518 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
519 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
520 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
521 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
522 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
523 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
524 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
525 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
526 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
527 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
528 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
529 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
530 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
531 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
532 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
533 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
534 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
535 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
536 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
537 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
538 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
539 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
540 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
541 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
542 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
543 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
544 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
545 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
546 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
547 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
548 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
549 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
550 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
551 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
552 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
553 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
554 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
555 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
556 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
557 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
558 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
559 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
560 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
561 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
562 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
563 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
564 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
565 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
566 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
567 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
568 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
569 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
570 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
571 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
572 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
573 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
574 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
575 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
576 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
577 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
578 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
579 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
580 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
581 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
582 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
583 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
584 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
585 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
586 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
587 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
588 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
589 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
590 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
591 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
592 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
593 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
594 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
595 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
596 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
597 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
601 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
611 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
612 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
613 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
614 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
615 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
616 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
617 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
618 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
621 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
622 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
623 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
624 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
625 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
626 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
627 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
628 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
629 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
630 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
631 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
632 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
633 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
634 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
635 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
636 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
637 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
638 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
639 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
640 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
641 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
642 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
643 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
644 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
645 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
646 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
647 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
648 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
649 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
650 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
651 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
652 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
653 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
654 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
655 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
656 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
657 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
658 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
659 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
660 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
661 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
662 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
663 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
664 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
665 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
666 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
667 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
668 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
669 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
670 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
671 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
672 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
673 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
674 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
675 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
676 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
677 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
678 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
679 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
680 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
681 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
682 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
683 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
684 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
685 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
686 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
687 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
688 649633069 Micromonospora sp. L5 Isolate Unclassified
689 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
690 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
691 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
692 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
693 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
694 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
695 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
696 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
697 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
698 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
699 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
700 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
701 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
702 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
703 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
704 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
705 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
706 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
707 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
708 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
709 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
710 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
711 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
712 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
713 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
714 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
715 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
716 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
717 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
718 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
719 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
720 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
721 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
722 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
723 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
724 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
725 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.09
Metatranscriptomes 0.46
Isolates 20.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 14.37
Nodule 13.76
Rhizoplane 5.69
Rhizosphere 51.04
Stem 0
Stem Tuber 0
Unclassified 14.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_891765 2162886007 Bacteria 4489
2 JGI24741J21665_1001372 3300001915 Bacteria 7032
3 JGI24740J21852_10001088 3300001979 Bacteria 12273
4 JGI24739J22299_10004944 3300001989 Bacteria 5076
5 JGI24737J22298_10001478 3300001990 Bacteria 8373
6 JGI24735J21928_10003371 3300002067 Bacteria 5452
7 JGI24738J21930_10002858 3300002075 Bacteria 4427
8 JGI25153J46596_10015897 3300003215 Bacteria 3041
9 JGI25160J50197_1000991 3300003354 Bacteria 14757
10 Ga0006562J51391_1080078 3300003578 Bacteria 1011
11 Ga0055524_1031628 3300003775 Bacteria 1517
12 Ga0055528_1042532 3300003790 Bacteria 999
13 Ga0055531_10007448 3300003794 Bacteria 5972
14 Ga0055543_1010842 3300004625 Bacteria 1893
15 Ga0065165_1000420 3300005262 Bacteria 66966
16 Ga0065165_1000556 3300005262 Bacteria 55512
17 Ga0065165_1002861 3300005262 Bacteria 13344
18 Ga0065165_1018469 3300005262 Bacteria 2522
19 Ga0065165_1022530 3300005262 Bacteria 2157
20 Ga0065714_10004054 3300005288 Bacteria 6658
21 Ga0065704_10073969 3300005289 Bacteria 6631
22 Ga0065704_10098518 3300005289 Bacteria 2350
23 Ga0070658_10011650 3300005327 Bacteria 7052
24 Ga0070683_100214615 3300005329 Bacteria 1828
25 Ga0070670_100158239 3300005331 Bacteria 1963
26 Ga0068869_100011273 3300005334 Bacteria 5856
27 Ga0068869_100505077 3300005334 Bacteria 1010
28 Ga0070666_10630426 3300005335 Bacteria 783
29 Ga0070680_100127183 3300005336 Bacteria 2129
30 Ga0070680_100144897 3300005336 Bacteria 1993
31 Ga0070660_100108655 3300005339 Bacteria 2205
32 Ga0070687_100771303 3300005343 Bacteria 678
33 Ga0070668_100000159 3300005347 Bacteria 42625
34 Ga0070668_100012970 3300005347 Bacteria 6205
35 Ga0070668_100042914 3300005347 Bacteria 3466
36 Ga0070668_100060893 3300005347 Bacteria 2924
37 Ga0070668_100070156 3300005347 Bacteria 2727
38 Ga0070669_100000502 3300005353 Bacteria 29455
39 Ga0070669_100008694 3300005353 Bacteria 7243
40 Ga0070669_100047738 3300005353 Bacteria 3124
41 Ga0070669_100431815 3300005353 Bacteria 1083
42 Ga0070671_100072841 3300005355 Bacteria 2869
43 Ga0070671_100093311 3300005355 Bacteria 2523
44 Ga0070659_100101177 3300005366 Bacteria 2320
45 Ga0070659_100225312 3300005366 Bacteria 1548
46 Ga0070667_100000120 3300005367 Bacteria 99936
47 Ga0070667_100028009 3300005367 Bacteria 4689
48 Ga0070667_100185115 3300005367 Bacteria 1843
49 Ga0070667_100272476 3300005367 Bacteria 1518
50 Ga0070709_10000412 3300005434 Bacteria 26060
51 Ga0070709_10024335 3300005434 Bacteria 3563
52 Ga0070709_10048056 3300005434 Bacteria 2661
53 Ga0070709_10124190 3300005434 Bacteria 1754
54 Ga0070714_100002292 3300005435 Bacteria 14079
55 Ga0070714_100011447 3300005435 Bacteria 7037
56 Ga0070714_100034015 3300005435 Bacteria 4267
57 Ga0070714_100036225 3300005435 Bacteria 4137
58 Ga0070714_100362590 3300005435 Bacteria 1363
59 Ga0070713_100000950 3300005436 Bacteria 18532
60 Ga0070713_100064714 3300005436 Bacteria 3070
61 Ga0070713_100230108 3300005436 Bacteria 1685
62 Ga0070713_100386640 3300005436 Bacteria 1304
63 Ga0070713_100506776 3300005436 Bacteria 1139
64 Ga0070710_10012033 3300005437 Bacteria 4290
65 Ga0070710_10016226 3300005437 Bacteria 3786
66 Ga0070710_10068077 3300005437 Bacteria 2045
67 Ga0070710_10181543 3300005437 Bacteria 1318
68 Ga0070710_10285744 3300005437 Bacteria 1072
69 Ga0070711_100035424 3300005439 Bacteria 3337
70 Ga0070711_100068759 3300005439 Bacteria 2490
71 Ga0070711_100093251 3300005439 Bacteria 2174
72 Ga0070711_100199402 3300005439 Bacteria 1543
73 Ga0070705_100130127 3300005440 Bacteria 1640
74 Ga0070663_100003672 3300005455 Bacteria 8894
75 Ga0070678_100015171 3300005456 Bacteria 4889
76 Ga0070662_100021506 3300005457 Bacteria 4405
77 Ga0070662_100210093 3300005457 Bacteria 1548
78 Ga0070681_10351005 3300005458 Bacteria 1385
79 Ga0068867_100119352 3300005459 Bacteria 2036
80 Ga0070706_100111923 3300005467 Bacteria 2541
81 Ga0070679_100005105 3300005530 Bacteria 12131
82 Ga0070684_100012778 3300005535 Bacteria 6744
83 Ga0070684_100119046 3300005535 Bacteria 2374
84 Ga0070697_100259244 3300005536 Bacteria 1488
85 Ga0068853_100001299 3300005539 Bacteria 17940
86 Ga0068853_100117771 3300005539 Bacteria 2366
87 Ga0068853_100312689 3300005539 Bacteria 1455
88 Ga0068853_100545458 3300005539 Bacteria 1098
89 Ga0070665_100018399 3300005548 Bacteria 7002
90 Ga0070704_100877963 3300005549 Bacteria 805
91 Ga0068855_100093490 3300005563 Bacteria 3467
92 Ga0068855_100514454 3300005563 Bacteria 1299
93 Ga0070664_100100367 3300005564 Bacteria 2516
94 Ga0068857_100068885 3300005577 Bacteria 3150
95 Ga0068857_100074848 3300005577 Bacteria 3018
96 Ga0068857_100148499 3300005577 Bacteria 2122
97 Ga0068857_100622773 3300005577 Bacteria 1021
98 Ga0068856_100004372 3300005614 Bacteria 14081
99 Ga0068856_100085631 3300005614 Bacteria 3131
100 Ga0068856_100189219 3300005614 Bacteria 2072
101 Ga0068856_100770256 3300005614 Bacteria 982
102 Ga0068852_100147625 3300005616 Bacteria 2183
103 Ga0068852_100260037 3300005616 Bacteria 1666
104 Ga0068859_100422237 3300005617 Bacteria 1430
105 Ga0068859_100436313 3300005617 Bacteria 1406
106 Ga0068859_100855479 3300005617 Bacteria 995
107 Ga0068864_100287620 3300005618 Bacteria 1536
108 Ga0068861_100919204 3300005719 Bacteria 830
109 Ga0068851_10454633 3300005834 Bacteria 761
110 Ga0068870_10070566 3300005840 Bacteria 1904
111 Ga0068863_100000053 3300005841 Bacteria 125195
112 Ga0068863_100042120 3300005841 Bacteria 4339
113 Ga0068863_100043176 3300005841 Bacteria 4280
114 Ga0068858_100066232 3300005842 Bacteria 3343
115 Ga0068858_100273482 3300005842 Bacteria 1608
116 Ga0068860_100000312 3300005843 Bacteria 66724
117 Ga0068860_100003099 3300005843 Bacteria 17183
118 Ga0068860_100013340 3300005843 Bacteria 8057
119 Ga0068860_100081169 3300005843 Bacteria 3084
120 Ga0068862_100000778 3300005844 Bacteria 31642
121 Ga0068862_100084813 3300005844 Bacteria 2752
122 Ga0068862_100235116 3300005844 Bacteria 1664
123 Ga0068862_100444166 3300005844 Bacteria 1221
124 Ga0068862_100722151 3300005844 Bacteria 967
125 Ga0068862_100745364 3300005844 Bacteria 952
126 Ga0081538_10022343 3300005981 Bacteria 4585
127 Ga0081540_1006288 3300005983 Bacteria 8692
128 Ga0081540_1011114 3300005983 Bacteria 6043
129 Ga0081540_1052167 3300005983 Bacteria 2016
130 Ga0081540_1062715 3300005983 Bacteria 1763
131 Ga0070717_10007581 3300006028 Bacteria 8064
132 Ga0070717_10009339 3300006028 Bacteria 7369
133 Ga0070717_10240356 3300006028 Bacteria 1597
134 Ga0075365_10043348 3300006038 Bacteria 2945
135 Ga0075365_10051078 3300006038 Bacteria 2729
136 Ga0075365_10082334 3300006038 Bacteria 2182
137 Ga0075365_10100633 3300006038 Bacteria 1978
138 Ga0075365_10118731 3300006038 Bacteria 1823
139 Ga0075365_10218650 3300006038 Bacteria 1336
140 Ga0075368_10000747 3300006042 Bacteria 9970
141 Ga0075368_10002064 3300006042 Bacteria 6498
142 Ga0075363_100002734 3300006048 Bacteria 7301
143 Ga0075363_100019180 3300006048 Bacteria 3416
144 Ga0075363_100134951 3300006048 Bacteria 1386
145 Ga0075363_100190554 3300006048 Bacteria 1169
146 Ga0075364_10009420 3300006051 Bacteria 5859
147 Ga0075364_10014814 3300006051 Bacteria 4824
148 Ga0075364_10015455 3300006051 Bacteria 4735
149 Ga0075364_10049523 3300006051 Bacteria 2741
150 Ga0075364_10089644 3300006051 Bacteria 2040
151 Ga0075364_10119747 3300006051 Bacteria 1762
152 Ga0075364_10122661 3300006051 Bacteria 1740
153 Ga0075364_10129192 3300006051 Bacteria 1695
154 Ga0075432_10000947 3300006058 Bacteria 9146
155 Ga0070715_10001792 3300006163 Bacteria 6397
156 Ga0070716_100001697 3300006173 Bacteria 9938
157 Ga0070716_100065483 3300006173 Bacteria 2117
158 Ga0070716_100192081 3300006173 Bacteria 1350
159 Ga0070716_100526128 3300006173 Bacteria 877
160 Ga0070712_100014502 3300006175 Bacteria 5057
161 Ga0070712_100105643 3300006175 Bacteria 2092
162 Ga0070712_100147941 3300006175 Bacteria 1800
163 Ga0075367_10001262 3300006178 Bacteria 10667
164 Ga0075367_10008575 3300006178 Bacteria 5303
165 Ga0075367_10206064 3300006178 Bacteria 1229
166 Ga0075367_10402848 3300006178 Bacteria 865
167 Ga0075367_10549079 3300006178 Bacteria 734
168 Ga0075369_10210616 3300006186 Bacteria 898
169 Ga0075366_10004909 3300006195 Bacteria 7216
170 Ga0075366_10005300 3300006195 Bacteria 6984
171 Ga0075366_10148824 3300006195 Bacteria 1417
172 Ga0097621_100089721 3300006237 Bacteria 2571
173 Ga0075370_10001829 3300006353 Bacteria 9519
174 Ga0075370_10143708 3300006353 Bacteria 1395
175 Ga0075370_10193655 3300006353 Bacteria 1198
176 Ga0075370_10258972 3300006353 Bacteria 1031
177 Ga0068871_100255625 3300006358 Bacteria 1527
178 Ga0075434_100065071 3300006871 Bacteria 3631
179 Ga0075434_100120336 3300006871 Bacteria 2640
180 Ga0075436_100060838 3300006914 Bacteria 2609
181 Ga0097620_100422246 3300006931 Bacteria 1430
182 Ga0097620_100436292 3300006931 Bacteria 1406
183 Ga0097620_100855369 3300006931 Bacteria 995
184 Ga0099825_1025128 3300006941 Bacteria 3365
185 Ga0099824_1004605 3300006942 Bacteria 19784
186 Ga0099824_1005450 3300006942 Bacteria 17919
187 Ga0099822_1000031 3300006943 Bacteria 62575
188 Ga0099823_1045510 3300006944 Bacteria 2922
189 Ga0079104_1000167 3300006946 Bacteria 93750
190 Ga0079104_1003511 3300006946 Bacteria 7236
191 Ga0099795_10002064 3300007788 Bacteria 4610
192 Ga0099795_10266265 3300007788 Bacteria 744
193 Ga0105250_10000496 3300009092 Bacteria 27651
194 Ga0105250_10070463 3300009092 Bacteria 1412
195 Ga0105250_10269204 3300009092 Bacteria 731
196 Ga0105240_10224017 3300009093 Bacteria 2189
197 Ga0105240_10236670 3300009093 Bacteria 2119
198 Ga0105240_10597280 3300009093 Bacteria 1216
199 Ga0105240_10705407 3300009093 Bacteria 1101
200 Ga0105245_10029674 3300009098 Bacteria 4834
201 Ga0105245_10843520 3300009098 Bacteria 956
202 Ga0105245_11126191 3300009098 Bacteria 831
203 Ga0105247_10005744 3300009101 Bacteria 7768
204 Ga0105247_10016235 3300009101 Bacteria 4460
205 Ga0105247_10132234 3300009101 Bacteria 1627
206 Ga0105247_10542970 3300009101 Bacteria 853
207 Ga0105243_10099559 3300009148 Bacteria 2410
208 Ga0105243_10124058 3300009148 Bacteria 2182
209 Ga0105243_11522682 3300009148 Bacteria 693
210 Ga0105241_10018413 3300009174 Bacteria 5138
211 Ga0105241_10037419 3300009174 Bacteria 3655
212 Ga0105241_10060960 3300009174 Bacteria 2904
213 Ga0105241_10073639 3300009174 Bacteria 2658
214 Ga0105241_10111980 3300009174 Bacteria 2186
215 Ga0105241_10112845 3300009174 Bacteria 2178
216 Ga0105248_10010634 3300009177 Bacteria 10148
217 Ga0105248_10050368 3300009177 Bacteria 4670
218 Ga0105248_10050394 3300009177 Bacteria 4669
219 Ga0105248_10097135 3300009177 Bacteria 3319
220 Ga0105248_10936489 3300009177 Bacteria 978
221 Ga0105237_10010021 3300009545 Bacteria 10112
222 Ga0105237_10030642 3300009545 Bacteria 5462
223 Ga0105237_10038406 3300009545 Bacteria 4834
224 Ga0105237_10049974 3300009545 Bacteria 4202
225 Ga0105237_10091668 3300009545 Bacteria 3028
226 Ga0105237_10126417 3300009545 Bacteria 2551
227 Ga0105237_11196456 3300009545 Bacteria 767
228 Ga0105238_10051030 3300009551 Bacteria 4162
229 Ga0105238_10097805 3300009551 Bacteria 2920
230 Ga0105238_10284461 3300009551 Bacteria 1635
231 Ga0105249_10000479 3300009553 Bacteria 37143
232 Ga0105148_100042 3300009978 Bacteria 18795
233 Ga0099796_10011546 3300010159 Bacteria 2467
234 Ga0105239_10022158 3300010375 Bacteria 7001
235 Ga0105239_10608547 3300010375 Bacteria 1247
236 Ga0105239_10623366 3300010375 Bacteria 1231
237 Ga0105239_10668126 3300010375 Bacteria 1187
238 Ga0105239_10907631 3300010375 Bacteria 1011
239 Ga0105246_10061565 3300011119 Bacteria 2612
240 Ga0157373_10530700 3300013100 Bacteria 852
241 Ga0157371_10085823 3300013102 Bacteria 2230
242 Ga0157370_10110273 3300013104 Bacteria 2572
243 Ga0157370_10299109 3300013104 Bacteria 1486
244 Ga0157369_10114195 3300013105 Bacteria 2868
245 Ga0157369_10179697 3300013105 Bacteria 2227
246 Ga0157369_10180113 3300013105 Bacteria 2224
247 Ga0157369_10364629 3300013105 Bacteria 1500
248 Ga0157374_10057825 3300013296 Bacteria 3623
249 Ga0157374_10128458 3300013296 Bacteria 2451
250 Ga0157374_10217974 3300013296 Bacteria 1872
251 Ga0157378_10042553 3300013297 Bacteria 4032
252 Ga0163162_10109119 3300013306 Bacteria 2864
253 Ga0163162_10444626 3300013306 Bacteria 1428
254 Ga0163162_10601242 3300013306 Bacteria 1226
255 Ga0157375_10238752 3300013308 Bacteria 1977
256 Ga0163163_10007677 3300014325 Bacteria 9530
257 Ga0163163_10117815 3300014325 Bacteria 2688
258 Ga0182008_10068896 3300014497 Bacteria 1741
259 Ga0157379_10007477 3300014968 Bacteria 9459
260 Ga0157379_10098603 3300014968 Bacteria 2623
261 Ga0157376_10021572 3300014969 Bacteria 5005
262 Ga0157376_10638139 3300014969 Bacteria 1064
263 Ga0163161_10005250 3300017792 Bacteria 9015
264 Ga0206356_11766087 3300020070 Bacteria 844
265 Ga0206354_11418476 3300020081 Bacteria 1734
266 Ga0206353_11597628 3300020082 Bacteria 1739
267 Ga0206353_12023448 3300020082 Bacteria 6731
268 Ga0154015_1264598 3300020610 Bacteria 1090
269 Ga0214544_1000004 3300021320 Bacteria 455869
270 Ga0214542_1000001 3300021321 Bacteria 1018696
271 Ga0214545_1000001 3300021324 Bacteria 1092817
272 Ga0214543_1000006 3300021327 Bacteria 443395
273 Ga0213875_10079341 3300021388 Bacteria 1531
274 Ga0213871_10007850 3300021441 Bacteria 2326
275 Ga0213871_10021068 3300021441 Bacteria 1622
276 Ga0209563_104631 3300025230 Bacteria 2604
277 Ga0207425_1016340 3300025245 Bacteria 1648
278 Ga0209677_101151 3300025253 Bacteria 12289
279 Ga0209148_1000566 3300025254 Bacteria 34786
280 Ga0209233_1001516 3300025261 Bacteria 9113
281 Ga0209233_1002707 3300025261 Bacteria 6398
282 Ga0209233_1026960 3300025261 Bacteria 1398
283 Ga0209455_1001114 3300025272 Bacteria 13145
284 Ga0209673_1001167 3300025273 Bacteria 28647
285 Ga0209564_1039126 3300025295 Bacteria 1308
286 Ga0209758_1000024 3300025297 Bacteria 591966
287 Ga0209758_1000068 3300025297 Bacteria 286488
288 Ga0209758_1002049 3300025297 Bacteria 21606
289 Ga0209758_1005922 3300025297 Bacteria 9090
290 Ga0209758_1032747 3300025297 Bacteria 2103
291 Ga0209256_1008038 3300025299 Bacteria 4997
292 Ga0207426_1000120 3300025302 Bacteria 219117
293 Ga0207426_1000673 3300025302 Bacteria 41533
294 Ga0207426_1004196 3300025302 Bacteria 7183
295 Ga0209257_1001327 3300025304 Bacteria 30091
296 Ga0207656_10077493 3300025321 Bacteria 1488
297 Ga0207696_1005868 3300025711 Bacteria 5037
298 Ga0207696_1015915 3300025711 Bacteria 2532
299 Ga0207692_10004793 3300025898 Bacteria 5377
300 Ga0207642_10483461 3300025899 Bacteria 756
301 Ga0207710_10072977 3300025900 Bacteria 1577
302 Ga0207710_10074572 3300025900 Bacteria 1562
303 Ga0207680_10001161 3300025903 Bacteria 12411
304 Ga0207680_10143421 3300025903 Bacteria 1585
305 Ga0207647_10035303 3300025904 Bacteria 3187
306 Ga0207685_10270433 3300025905 Bacteria 830
307 Ga0207699_10005077 3300025906 Bacteria 6297
308 Ga0207699_10046323 3300025906 Bacteria 2543
309 Ga0207699_10053444 3300025906 Bacteria 2395
310 Ga0207699_10275526 3300025906 Bacteria 1167
311 Ga0207705_10015903 3300025909 Bacteria 5402
312 Ga0207684_10122127 3300025910 Bacteria 2233
313 Ga0207654_10080134 3300025911 Bacteria 1963
314 Ga0207654_10092881 3300025911 Bacteria 1843
315 Ga0207654_10247339 3300025911 Bacteria 1194
316 Ga0207654_10283197 3300025911 Bacteria 1122
317 Ga0207707_10184089 3300025912 Bacteria 1823
318 Ga0207707_10195323 3300025912 Bacteria 1765
319 Ga0207695_10000008 3300025913 Bacteria 1058268
320 Ga0207695_10022582 3300025913 Bacteria 7137
321 Ga0207695_10186796 3300025913 Bacteria 1991
322 Ga0207671_10049564 3300025914 Bacteria 3109
323 Ga0207671_10070742 3300025914 Bacteria 2602
324 Ga0207671_10101602 3300025914 Bacteria 2179
325 Ga0207671_10156010 3300025914 Bacteria 1766
326 Ga0207671_10164936 3300025914 Bacteria 1717
327 Ga0207671_10691826 3300025914 Bacteria 811
328 Ga0207693_10000217 3300025915 Bacteria 52791
329 Ga0207693_10267676 3300025915 Bacteria 1339
330 Ga0207693_10741960 3300025915 Bacteria 759
331 Ga0207663_10000151 3300025916 Bacteria 32258
332 Ga0207663_10059235 3300025916 Bacteria 2421
333 Ga0207663_10161919 3300025916 Bacteria 1580
334 Ga0207660_10038888 3300025917 Bacteria 3323
335 Ga0207660_10305166 3300025917 Bacteria 1268
336 Ga0207657_10013873 3300025919 Bacteria 7885
337 Ga0207657_10395794 3300025919 Bacteria 1087
338 Ga0207652_10182875 3300025921 Bacteria 1884
339 Ga0207652_10440571 3300025921 Bacteria 1174
340 Ga0207681_10000358 3300025923 Bacteria 32494
341 Ga0207681_10006344 3300025923 Bacteria 7259
342 Ga0207681_10133722 3300025923 Bacteria 1837
343 Ga0207681_10497069 3300025923 Bacteria 998
344 Ga0207694_10170272 3300025924 Bacteria 1763
345 Ga0207650_10269207 3300025925 Bacteria 1384
346 Ga0207659_10141181 3300025926 Bacteria 1870
347 Ga0207687_10068316 3300025927 Bacteria 2531
348 Ga0207687_10748539 3300025927 Bacteria 831
349 Ga0207700_10005260 3300025928 Bacteria 7716
350 Ga0207700_10034019 3300025928 Bacteria 3654
351 Ga0207700_10067405 3300025928 Bacteria 2739
352 Ga0207700_10433784 3300025928 Bacteria 1156
353 Ga0207700_10449174 3300025928 Bacteria 1136
354 Ga0207664_10013911 3300025929 Bacteria 5798
355 Ga0207664_10015026 3300025929 Bacteria 5607
356 Ga0207664_10015966 3300025929 Bacteria 5469
357 Ga0207664_10040259 3300025929 Bacteria 3633
358 Ga0207664_10414343 3300025929 Bacteria 1199
359 Ga0207644_10003443 3300025931 Bacteria 10228
360 Ga0207644_10015682 3300025931 Bacteria 5091
361 Ga0207644_10017154 3300025931 Bacteria 4884
362 Ga0207690_10761991 3300025932 Bacteria 798
363 Ga0207706_10022693 3300025933 Bacteria 5634
364 Ga0207706_10054128 3300025933 Bacteria 3542
365 Ga0207706_10077856 3300025933 Bacteria 2916
366 Ga0207706_10194661 3300025933 Bacteria 1778
367 Ga0207706_10614595 3300025933 Bacteria 933
368 Ga0207709_10000143 3300025935 Bacteria 99457
369 Ga0207709_10639423 3300025935 Bacteria 846
370 Ga0207665_10000493 3300025939 Bacteria 26653
371 Ga0207665_10272241 3300025939 Bacteria 1258
372 Ga0207711_10063926 3300025941 Bacteria 3178
373 Ga0207711_10065464 3300025941 Bacteria 3142
374 Ga0207689_10001713 3300025942 Bacteria 20753
375 Ga0207689_10113725 3300025942 Bacteria 2225
376 Ga0207661_10024510 3300025944 Bacteria 4573
377 Ga0207661_10069955 3300025944 Bacteria 2863
378 Ga0207679_10564102 3300025945 Bacteria 1023
379 Ga0207679_10655042 3300025945 Bacteria 950
380 Ga0207667_10044360 3300025949 Bacteria 4712
381 Ga0207667_10054301 3300025949 Bacteria 4214
382 Ga0207667_10799326 3300025949 Bacteria 940
383 Ga0207712_10000405 3300025961 Bacteria 37152
384 Ga0207712_10200412 3300025961 Bacteria 1582
385 Ga0207668_10000027 3300025972 Bacteria 125575
386 Ga0207668_10000119 3300025972 Bacteria 55547
387 Ga0207668_10015543 3300025972 Bacteria 4731
388 Ga0207668_10020385 3300025972 Bacteria 4211
389 Ga0207668_10106114 3300025972 Bacteria 2098
390 Ga0207668_10351107 3300025972 Bacteria 1233
391 Ga0207640_10002550 3300025981 Bacteria 9765
392 Ga0207640_10073577 3300025981 Bacteria 2310
393 Ga0207658_10000091 3300025986 Bacteria 99970
394 Ga0207658_10057561 3300025986 Bacteria 2889
395 Ga0207658_10068456 3300025986 Bacteria 2679
396 Ga0207658_10293074 3300025986 Bacteria 1399
397 Ga0207677_10024255 3300026023 Bacteria 3765
398 Ga0207703_10060972 3300026035 Bacteria 3087
399 Ga0207703_10106018 3300026035 Bacteria 2390
400 Ga0207703_10150352 3300026035 Bacteria 2030
401 Ga0207703_10224120 3300026035 Bacteria 1683
402 Ga0207639_10003038 3300026041 Bacteria 11299
403 Ga0207639_10046719 3300026041 Bacteria 3268
404 Ga0207639_10049046 3300026041 Bacteria 3199
405 Ga0207639_10176128 3300026041 Bacteria 1816
406 Ga0207639_11100196 3300026041 Bacteria 745
407 Ga0207678_10000053 3300026067 Bacteria 88489
408 Ga0207678_10094685 3300026067 Bacteria 2552
409 Ga0207702_10007174 3300026078 Bacteria 9536
410 Ga0207702_10146400 3300026078 Bacteria 2144
411 Ga0207702_10156921 3300026078 Bacteria 2075
412 Ga0207702_10222708 3300026078 Bacteria 1758
413 Ga0207702_10714325 3300026078 Bacteria 988
414 Ga0207641_10000093 3300026088 Bacteria 125747
415 Ga0207641_10027610 3300026088 Bacteria 4688
416 Ga0207641_10068221 3300026088 Bacteria 3049
417 Ga0207641_10819375 3300026088 Bacteria 921
418 Ga0207676_10063189 3300026095 Bacteria 2940
419 Ga0207676_10117273 3300026095 Bacteria 2239
420 Ga0207674_10018107 3300026116 Bacteria 7664
421 Ga0207674_10075668 3300026116 Bacteria 3376
422 Ga0207674_10306908 3300026116 Bacteria 1536
423 Ga0207675_100003788 3300026118 Bacteria 14726
424 Ga0207675_100288328 3300026118 Bacteria 1596
425 Ga0207683_10026771 3300026121 Bacteria 4981
426 Ga0207698_10024978 3300026142 Bacteria 4200
427 Ga0207698_10027523 3300026142 Bacteria 4037
428 Ga0207698_10055947 3300026142 Bacteria 3044
429 Ga0207698_10067408 3300026142 Bacteria 2822
430 Ga0207698_11307182 3300026142 Bacteria 740
431 Ga0209281_1000017 3300027111 Bacteria 583251
432 Ga0209389_1000010 3300027296 Bacteria 223892
433 Ga0209389_1000149 3300027296 Bacteria 59631
434 Ga0209589_1000016 3300027357 Bacteria 223788
435 Ga0209589_1000025 3300027357 Bacteria 165546
436 Ga0209489_100016 3300027361 Bacteria 223873
437 Ga0209489_100039 3300027361 Bacteria 165546
438 Ga0209700_100030 3300027363 Bacteria 212982
439 Ga0209700_100043 3300027363 Bacteria 167890
440 Ga0209813_10000012 3300027866 Bacteria 91374
441 Ga0209813_10186011 3300027866 Bacteria 762
442 Ga0207428_10113849 3300027907 Bacteria 2079
443 Ga0268266_10006810 3300028379 Bacteria 10409
444 Ga0268266_10016057 3300028379 Bacteria 6399
445 Ga0268266_10387098 3300028379 Bacteria 1320
446 Ga0268266_10794120 3300028379 Bacteria 914
447 Ga0268265_10000633 3300028380 Bacteria 35043
448 Ga0268265_10067570 3300028380 Bacteria 2768
449 Ga0268265_10296466 3300028380 Bacteria 1454
450 Ga0268264_10000030 3300028381 Bacteria 418542
451 Ga0268264_10000980 3300028381 Bacteria 29223
452 Ga0268264_10008606 3300028381 Bacteria 8479
453 Ga0268264_10058148 3300028381 Bacteria 3237
454 Ga0307515_10000626 3300028794 Bacteria 82165
455 Ga0307511_10068998 3300030521 Bacteria 2604
456 Ga0265340_10011093 3300031247 Bacteria 4802
457 Ga0265339_10002090 3300031249 Bacteria 14588
458 Ga0307513_10011751 3300031456 Bacteria 10858
459 Ga0307513_10114409 3300031456 Bacteria 2683
460 Ga0307509_10012996 3300031507 Bacteria 9891
461 Ga0307408_100007475 3300031548 Bacteria 7223
462 Ga0307508_10330955 3300031616 Bacteria 1115
463 Ga0307514_10000861 3300031649 Bacteria 48344
464 Ga0307516_10004326 3300031730 Bacteria 17593
465 Ga0307516_10059170 3300031730 Bacteria 3727
466 Ga0307516_10204047 3300031730 Bacteria 1694
467 Ga0307405_10008013 3300031731 Bacteria 5327
468 Ga0307405_10064861 3300031731 Bacteria 2323
469 Ga0307413_10111485 3300031824 Bacteria 1832
470 Ga0307406_10024841 3300031901 Bacteria 3582
471 Ga0307406_10350463 3300031901 Bacteria 1153
472 Ga0307406_10506305 3300031901 Bacteria 980
473 Ga0307412_10002798 3300031911 Bacteria 9692
474 Ga0307412_10067707 3300031911 Bacteria 2425
475 Ga0307416_100008101 3300032002 Bacteria 6744
476 Ga0307510_10032342 3300033180 Bacteria 5894
477 Ga0307510_10069078 3300033180 Bacteria 3541
478 Ga0307510_10235298 3300033180 Bacteria 1331
479 Ga0315911_1000002 3300033442 Bacteria 926833
480 Ga0373934_0023398 3300035086 Bacteria 2387
481 Ga0373944_0069693 3300035089 Bacteria 1143
482 Ga0373923_0033070 3300035111 Bacteria 2092
483 Ga0373936_0018408 3300035113 Bacteria 2698
484 Ga0373936_0078370 3300035113 Bacteria 1372
485 Ga0373953_0042756 3300035117 Bacteria 1807
486 Ga0373954_0022313 3300035118 Bacteria 2870
487 Ga0373956_0126661 3300035119 Bacteria 1194
488 Ga0373943_0046835 3300035170 Bacteria 2112
489 Ga0373955_0531326 3300035172 Bacteria 719
490 Ga0373924_0013501 3300035410 Bacteria 3070
491 Ga0373931_0149272 3300035691 Bacteria 1361
492 Ga0373935_0100224 3300035692 Bacteria 1908
493 Ga0373927_0003407 3300035695 Bacteria 11427
494 Ga0373933_0454989 3300035724 Bacteria 837
495 Ga0373947_0146864 3300035725 Bacteria 1517
496 Ga0373937_0194238 3300036401 Bacteria 1907
497 Ga0373925_0052030 3300037068 Bacteria 3059
498 Ga0373925_0070598 3300037068 Bacteria 2640
499 Ga0373925_0490920 3300037068 Bacteria 1008
500 Ga0395899_0039807 3300037312 Bacteria 3517
501 Ga0395900_0055181 3300037418 Bacteria 4091
502 Ga0395900_0062858 3300037418 Bacteria 3816
503 Ga0395900_0064716 3300037418 Bacteria 3757
504 Ga0395900_0221809 3300037418 Bacteria 1905
505 Ga0395898_0050420 3300037466 Bacteria 4073
506 Ga0395898_0144970 3300037466 Bacteria 2273
507 Ga0395905_0009332 3300037471 Bacteria 9596
508 Ga0395905_0010197 3300037471 Bacteria 9157
509 Ga0395905_0228767 3300037471 Bacteria 1739
510 Ga0395905_0624322 3300037471 Bacteria 980
511 Ga0436364_0341967 3300037853 Bacteria 5735
512 Ga0436364_0476301 3300037853 Bacteria 4366
513 Ga0436364_0752290 3300037853 Bacteria 1214
514 Ga0436364_0926030 3300037853 Bacteria 5519
515 Ga0395901_0058273 3300038443 Bacteria 4018
516 Ga0395901_0091636 3300038443 Bacteria 3181
517 Ga0395901_0343297 3300038443 Bacteria 1542
518 Ga0400483_126259 3300039062 Bacteria 1732
519 Ga0436360_0460772 3300039438 Bacteria 2137
520 Ga0436360_0732042 3300039438 Bacteria 2945
521 Ga0436360_1138676 3300039438 Bacteria 5712
522 Ga0436361_0149759 3300039447 Bacteria 1692
523 Ga0436361_0263958 3300039447 Bacteria 1797
524 Ga0436361_0319705 3300039447 Bacteria 2631
525 Ga0439436_0024372 3300041404 Bacteria 1787
526 Ga0451793_1165256 3300041452 Bacteria 3322
527 Ga0451797_1163837 3300041453 Bacteria 1220
528 Ga0451833_0257326 3300041491 Bacteria 1139
529 Ga0451833_0290422 3300041491 Bacteria 6389
530 Ga0451833_0896395 3300041491 Bacteria 6302
531 Ga0451837_1397189 3300041494 Bacteria 5637
532 Ga0451839_0842413 3300041496 Bacteria 2242
533 Ga0451853_0261175 3300041512 Bacteria 1021
534 Ga0439445_0003192 3300042004 Bacteria 3676
535 Ga0439445_0007938 3300042004 Bacteria 2475
536 Ga0450911_000342 3300042115 Bacteria 16356
537 Ga0450907_007576 3300042146 Bacteria 1810
538 Ga0466969_0004164 3300044656 Bacteria 7680
539 Ga0466969_0114560 3300044656 Bacteria 1259
540 Ga0466972_0000148 3300044658 Bacteria 57158
541 Ga0466972_0003448 3300044658 Bacteria 7842
542 Ga0466972_0017113 3300044658 Bacteria 3626
543 Ga0466972_0169946 3300044658 Bacteria 1023
544 Ga0466965_0369115 3300044683 Bacteria 789
545 Ga0466966_0012261 3300044684 Bacteria 5679
546 Ga0466966_0249042 3300044684 Bacteria 1070
547 Ga0466966_0255610 3300044684 Bacteria 1055
548 Ga0466966_0292965 3300044684 Bacteria 978
549 Ga0466961_0000008 3300044693 Bacteria 142607
550 Ga0466961_0227358 3300044693 Bacteria 1149
551 Ga0466963_0483240 3300044694 Bacteria 874
552 Ga0466964_0042755 3300044706 Bacteria 1837
553 Ga0466971_0139384 3300044719 Bacteria 1129
554 Ga0466968_0038023 3300044735 Bacteria 2021
555 Ga0466968_0155839 3300044735 Bacteria 1052
556 Ga0466968_0292198 3300044735 Bacteria 782
557 Ga0466970_0053407 3300044765 Bacteria 2158
558 Ga0466970_0054266 3300044765 Bacteria 2140
559 Ga0466970_0058552 3300044765 Bacteria 2062
560 Ga0466970_0077125 3300044765 Bacteria 1796
561 Ga0466970_0370827 3300044765 Bacteria 814
562 Ga0466957_0089469 3300044842 Bacteria 1927
563 Ga0466957_0309867 3300044842 Bacteria 1063
564 Ga0466960_0016548 3300044901 Bacteria 3202
565 Ga0466960_0051615 3300044901 Bacteria 1987
566 Ga0466960_0090662 3300044901 Bacteria 1557
567 Ga0466960_0117920 3300044901 Bacteria 1387
568 Ga0466959_0009565 3300045049 Bacteria 6896
569 Ga0466959_0012592 3300045049 Bacteria 6117
570 Ga0466959_0016679 3300045049 Bacteria 5372
571 Ga0466959_0473556 3300045049 Bacteria 848
572 Ga0466958_0290849 3300045836 Bacteria 1048
573 Ga0466967_0057572 3300045976 Bacteria 3432
574 Ga0466967_0127399 3300045976 Bacteria 2359
575 Ga0466967_0325825 3300045976 Bacteria 1482
576 Ga0495617_004580 3300046452 Bacteria 5007
577 Ga0495617_092613 3300046452 Bacteria 985
578 Ga0495627_013822 3300046453 Bacteria 2834
579 Ga0495592_0010915 3300046454 Bacteria 6853
580 Ga0495603_0223516 3300046455 Bacteria 1086
581 Ga0495590_0080137 3300046457 Bacteria 1150
582 Ga0495629_0059289 3300046459 Bacteria 2675
583 Ga0495629_0130940 3300046459 Bacteria 1747
584 Ga0495638_0000073 3300046460 Bacteria 164378
585 Ga0495638_0002880 3300046460 Bacteria 13779
586 Ga0495641_0332186 3300046461 Bacteria 686
587 Ga0495651_0001984 3300046462 Bacteria 15854
588 Ga0495651_0029080 3300046462 Bacteria 4310
589 Ga0495651_0085311 3300046462 Bacteria 2378
590 Ga0495653_0019076 3300046463 Bacteria 5564
591 Ga0495653_0200081 3300046463 Bacteria 1356
592 Ga0495650_0001348 3300046471 Bacteria 24429
593 Ga0495582_0020660 3300046473 Bacteria 3605
594 Ga0495605_0092373 3300046474 Bacteria 1401
595 Ga0495639_0004491 3300046475 Bacteria 5982
596 Ga0495639_0295463 3300046475 Bacteria 807
597 Ga0495664_0028535 3300046477 Bacteria 3258
598 Ga0495664_0161810 3300046477 Bacteria 1358
599 Ga0495584_0126854 3300046491 Bacteria 1294
600 Ga0495594_0109427 3300046499 Bacteria 1558
601 Ga0495596_0003376 3300046500 Bacteria 8110
602 Ga0495583_0000087 3300046506 Bacteria 164974
603 Ga0495606_0061205 3300046507 Bacteria 2409
604 Ga0495606_0284202 3300046507 Bacteria 903
605 Ga0495610_0005333 3300046512 Bacteria 9174
606 Ga0495610_0027469 3300046512 Bacteria 3023
607 Ga0495616_0012946 3300046513 Bacteria 4717
608 Ga0495618_0034740 3300046514 Bacteria 3163
609 Ga0495618_0076428 3300046514 Bacteria 2134
610 Ga0495618_0141470 3300046514 Bacteria 1539
611 Ga0495628_0011313 3300046516 Bacteria 7548
612 Ga0495628_0110653 3300046516 Bacteria 2113
613 Ga0495630_0058231 3300046517 Bacteria 2896
614 Ga0495630_0159930 3300046517 Bacteria 1715
615 Ga0495630_0220274 3300046517 Bacteria 1449
616 Ga0495632_0000049 3300046519 Bacteria 134597
617 Ga0495632_0002653 3300046519 Bacteria 13424
618 Ga0495632_0235837 3300046519 Bacteria 824
619 Ga0495637_0014164 3300046520 Bacteria 3766
620 Ga0495643_0000047 3300046522 Bacteria 217914
621 Ga0495643_0020094 3300046522 Bacteria 3857
622 Ga0495648_0000049 3300046524 Bacteria 164366
623 Ga0495648_0032189 3300046524 Bacteria 3445
624 Ga0495648_0135824 3300046524 Bacteria 1301
625 Ga0495663_0000009 3300046525 Bacteria 256308
626 Ga0495666_0029362 3300046526 Bacteria 2705
627 Ga0495652_0010482 3300046529 Bacteria 8398
628 Ga0495652_0035658 3300046529 Bacteria 4328
629 Ga0495654_0002730 3300046530 Bacteria 11144
630 Ga0495665_0013511 3300046531 Bacteria 4413
631 Ga0495640_0016765 3300046533 Bacteria 5476
632 Ga0495640_0031232 3300046533 Bacteria 3803
633 Ga0495640_0049025 3300046533 Bacteria 2915
634 Ga0495587_0004347 3300046536 Bacteria 9353
635 Ga0495597_0000024 3300046542 Bacteria 143948
636 Ga0495597_0004357 3300046542 Bacteria 7805
637 Ga0495597_0104029 3300046542 Bacteria 1195
638 Ga0495645_0001873 3300046543 Bacteria 14306
639 Ga0495645_0113493 3300046543 Bacteria 1915
640 Ga0495622_0039624 3300046557 Bacteria 2194
641 Ga0495622_0206056 3300046557 Bacteria 875
642 Ga0495633_0000290 3300046558 Bacteria 57790
643 Ga0495633_0000319 3300046558 Bacteria 54580
644 Ga0495633_0043026 3300046558 Bacteria 2143
645 Ga0495633_0111654 3300046558 Bacteria 1267
646 Ga0495667_0003300 3300046559 Bacteria 10818
647 Ga0495667_0039255 3300046559 Bacteria 3148
648 Ga0495668_0025664 3300046616 Bacteria 3347
649 Ga0495668_0124753 3300046616 Bacteria 1409
650 Ga0495668_0144762 3300046616 Bacteria 1301
651 Ga0495634_0024720 3300046642 Bacteria 4211
652 Ga0495634_0401407 3300046642 Bacteria 814
653 Ga0495611_0133439 3300046648 Bacteria 1159
654 Ga0495625_0000238 3300046660 Bacteria 85959
655 Ga0495625_0004416 3300046660 Bacteria 13309
656 Ga0495635_0001999 3300046663 Bacteria 13856
657 Ga0495635_0009596 3300046663 Bacteria 6765
658 Ga0495635_0089364 3300046663 Bacteria 2108
659 Ga0495661_0167203 3300046665 Bacteria 1176
660 Ga0495588_0007284 3300046674 Bacteria 5028
661 Ga0495657_0001200 3300046675 Bacteria 22691
662 Ga0495657_0079975 3300046675 Bacteria 2116
663 Ga0495599_0004074 3300046678 Bacteria 8611
664 Ga0495599_0103104 3300046678 Bacteria 1778
665 Ga0495623_0012871 3300046679 Bacteria 5418
666 Ga0495646_0040750 3300046680 Bacteria 2858
667 Ga0495646_0042675 3300046680 Bacteria 2782
668 Ga0495646_0307381 3300046680 Bacteria 837
669 Ga0495647_0010474 3300046681 Bacteria 3158
670 Ga0495613_0028267 3300046689 Bacteria 4171
671 Ga0495624_0014716 3300046690 Bacteria 5298
672 Ga0495624_0024527 3300046690 Bacteria 3967
673 Ga0495671_0000038 3300046692 Bacteria 173693
674 Ga0495671_0000042 3300046692 Bacteria 165201
675 Ga0495649_0038769 3300046694 Bacteria 2613
676 Ga0495649_0189318 3300046694 Bacteria 1071
677 Ga0495600_0002291 3300046809 Bacteria 10909
678 Ga0495600_0110545 3300046809 Bacteria 1789
679 Ga0495600_0157089 3300046809 Bacteria 1471
680 Ga0495604_0009383 3300047317 Bacteria 7739
681 Ga0495604_0111017 3300047317 Bacteria 1999
682 Ga0495674_0009389 3300047319 Bacteria 9296
683 Ga0495674_0023697 3300047319 Bacteria 5653
684 Ga0495676_0041792 3300047321 Bacteria 3770
685 Ga0495680_0007048 3300047322 Bacteria 10359
686 Ga0495680_0292367 3300047322 Bacteria 1146
687 Ga0495687_016477 3300047443 Bacteria 3715
688 Ga0495675_0001461 3300047444 Bacteria 14304
689 Ga0495673_0000111 3300047469 Bacteria 164974
690 Ga0495673_0032421 3300047469 Bacteria 2436
691 Ga0495673_0106846 3300047469 Bacteria 1124
692 Ga0495681_0000050 3300047470 Bacteria 109433
693 Ga0495681_0000953 3300047470 Bacteria 22221
694 Ga0495684_0004997 3300047471 Bacteria 10348
695 Ga0495684_0076471 3300047471 Bacteria 2543
696 Ga0495686_0000131 3300047472 Bacteria 152064
697 Ga0495686_0044217 3300047472 Bacteria 2820
698 Ga0495686_0078545 3300047472 Bacteria 2020
699 Ga0495593_0031083 3300047673 Bacteria 2919
700 Ga0495593_0066345 3300047673 Bacteria 1881
701 Ga0495593_0067395 3300047673 Bacteria 1863
702 Ga0495602_0016196 3300048088 Bacteria 7500
703 Ga0495602_0110878 3300048088 Bacteria 2229
704 Ga0495602_0249852 3300048088 Bacteria 1322
705 Ga0495615_0000002 3300048090 Bacteria 167871
706 Ga0495626_0001710 3300048091 Bacteria 16808
707 Ga0496100_0158966 3300048903 Bacteria 1619
708 Ga0496100_0254925 3300048903 Bacteria 1299
709 Ga0496100_0324336 3300048903 Bacteria 1157
710 Ga0496100_0491266 3300048903 Bacteria 945
711 Ga0496101_0063166 3300048904 Bacteria 2695
712 Ga0496101_0193098 3300048904 Bacteria 1572
713 Ga0496101_0749993 3300048904 Bacteria 770
714 Ga0496102_0001289 3300048905 Bacteria 22550
715 Ga0496102_0014553 3300048905 Bacteria 6836
716 Ga0496102_0022385 3300048905 Bacteria 5599
717 Ga0496102_0056751 3300048905 Bacteria 3573
718 Ga0496102_0098004 3300048905 Bacteria 2720
719 Ga0496103_0000163 3300048906 Bacteria 70387
720 Ga0496103_0011719 3300048906 Bacteria 5201
721 Ga0496103_0049786 3300048906 Bacteria 2591
722 Ga0496104_0003456 3300048907 Bacteria 13613
723 Ga0496104_0003849 3300048907 Bacteria 12988
724 Ga0496104_0021120 3300048907 Bacteria 5973
725 Ga0496104_0575930 3300048907 Bacteria 1036
726 Ga0496104_0839004 3300048907 Bacteria 825
727 Ga0496105_0001070 3300048908 Bacteria 18947
728 Ga0496105_0007451 3300048908 Bacteria 8471
729 Ga0496105_0074881 3300048908 Bacteria 2797
730 Ga0496105_0205474 3300048908 Bacteria 1607
731 Ga0496105_0417999 3300048908 Bacteria 1062
732 Ga0496106_0000358 3300048909 Bacteria 32366
733 Ga0496106_0010950 3300048909 Bacteria 6704
734 Ga0496107_0085414 3300048910 Bacteria 2303
735 Ga0496107_0103996 3300048910 Bacteria 2084
736 Ga0496107_0184332 3300048910 Bacteria 1550
737 Ga0496108_0069872 3300048911 Bacteria 2963
738 Ga0496108_0078137 3300048911 Bacteria 2801
739 Ga0496108_0249567 3300048911 Bacteria 1544
740 Ga0496108_0845861 3300048911 Bacteria 788
741 Ga0496109_0024779 3300048912 Bacteria 5337
742 Ga0496109_0080914 3300048912 Bacteria 2993
743 Ga0496109_0371301 3300048912 Bacteria 1351
744 Ga0496109_0465790 3300048912 Bacteria 1193
745 Ga0496109_0680925 3300048912 Bacteria 966
746 Ga0496110_0010631 3300048913 Bacteria 7493
747 Ga0496110_0079158 3300048913 Bacteria 2926
748 Ga0496110_0098432 3300048913 Bacteria 2621
749 Ga0496110_0149483 3300048913 Bacteria 2114
750 Ga0496110_0241914 3300048913 Bacteria 1642
751 Ga0496110_0296096 3300048913 Bacteria 1474
752 Ga0496111_0042941 3300048914 Bacteria 3248
753 Ga0496111_0110967 3300048914 Bacteria 2020
754 Ga0496111_0206713 3300048914 Bacteria 1459
755 Ga0496112_0004169 3300048915 Bacteria 12180
756 Ga0496112_0005313 3300048915 Bacteria 11115
757 Ga0496112_0033125 3300048915 Bacteria 5020
758 Ga0496112_0048480 3300048915 Bacteria 4164
759 Ga0496112_0199250 3300048915 Bacteria 1962
760 Ga0496112_0299729 3300048915 Bacteria 1553
761 Ga0496112_0629522 3300048915 Bacteria 1003
762 Ga0496112_0730787 3300048915 Bacteria 917
763 Ga0496113_0000519 3300048916 Bacteria 19033
764 Ga0496113_0009379 3300048916 Bacteria 6417
765 Ga0496113_0015207 3300048916 Bacteria 5281
766 Ga0496113_0043989 3300048916 Bacteria 3307
767 Ga0496113_0061925 3300048916 Bacteria 2824
768 Ga0496113_0131023 3300048916 Bacteria 1968
769 Ga0496113_0226339 3300048916 Bacteria 1491
770 Ga0496113_0727822 3300048916 Bacteria 791
771 Ga0496114_0101393 3300048917 Bacteria 2458
772 Ga0496114_0705007 3300048917 Bacteria 885
773 Ga0496115_0031252 3300048918 Bacteria 4194
774 Ga0496115_0186263 3300048918 Bacteria 1715
775 Ga0496115_0208849 3300048918 Bacteria 1613
776 Ga0496115_0371747 3300048918 Bacteria 1164
777 Ga0496116_0042437 3300048919 Bacteria 3109
778 Ga0496117_0001164 3300048920 Bacteria 39543
779 Ga0496117_0072211 3300048920 Bacteria 2309
780 Ga0496117_0074790 3300048920 Bacteria 2253
781 Ga0496117_0184712 3300048920 Bacteria 1194
782 Ga0496118_0000618 3300048921 Bacteria 58468
783 Ga0496118_0019810 3300048921 Bacteria 6000
784 Ga0496118_0023183 3300048921 Bacteria 5400
785 Ga0496118_0070937 3300048921 Bacteria 2511
786 Ga0496118_0070938 3300048921 Bacteria 2511
787 Ga0496119_0003597 3300048922 Bacteria 15945
788 Ga0496119_0011321 3300048922 Bacteria 7406
789 Ga0496119_0022385 3300048922 Bacteria 4527
790 Ga0496119_0031381 3300048922 Bacteria 3565
791 Ga0496120_0022344 3300048923 Bacteria 3981
792 Ga0496120_0055355 3300048923 Bacteria 2243
793 Ga0496120_0061066 3300048923 Bacteria 2105
794 Ga0496121_0000017 3300048924 Bacteria 546415
795 Ga0496121_0000212 3300048924 Bacteria 127508
796 Ga0496121_0011514 3300048924 Bacteria 9802
797 Ga0496121_0014846 3300048924 Bacteria 8219
798 Ga0496121_0035076 3300048924 Bacteria 4501
799 Ga0496121_0043707 3300048924 Bacteria 3875
800 Ga0496121_0057029 3300048924 Bacteria 3240
801 Ga0496121_0059460 3300048924 Bacteria 3151
802 Ga0496121_0061598 3300048924 Bacteria 3078
803 Ga0496121_0063034 3300048924 Bacteria 3032
804 Ga0496121_0093883 3300048924 Bacteria 2335
805 Ga0496121_0166887 3300048924 Bacteria 1603
806 Ga0496121_0194799 3300048924 Bacteria 1450
807 Ga0496121_0216279 3300048924 Bacteria 1353
808 Ga0496121_0413651 3300048924 Bacteria 879
809 Ga0496122_0001302 3300048925 Bacteria 41169
810 Ga0496122_0001656 3300048925 Bacteria 34600
811 Ga0496122_0015581 3300048925 Bacteria 7256
812 Ga0496122_0070871 3300048925 Bacteria 2487
813 Ga0496122_0078710 3300048925 Bacteria 2308
814 Ga0496122_0131977 3300048925 Bacteria 1585
815 Ga0496123_0001454 3300048926 Bacteria 32962
816 Ga0496123_0003614 3300048926 Bacteria 17136
817 Ga0496123_0005223 3300048926 Bacteria 13192
818 Ga0496123_0048070 3300048926 Bacteria 2874
819 Ga0496123_0123319 3300048926 Bacteria 1452
820 Ga0496123_0153197 3300048926 Bacteria 1240
821 Ga0496124_0000204 3300048927 Bacteria 116976
822 Ga0496124_0000861 3300048927 Bacteria 49579
823 Ga0496124_0000988 3300048927 Bacteria 45089
824 Ga0496124_0002175 3300048927 Bacteria 26179
825 Ga0496124_0056740 3300048927 Bacteria 3302
826 Ga0496124_0062229 3300048927 Bacteria 3124
827 Ga0496124_0097847 3300048927 Bacteria 2382
828 Ga0496124_0233617 3300048927 Bacteria 1373
829 Ga0496124_0258241 3300048927 Bacteria 1284
830 Ga0496125_0000841 3300048928 Bacteria 49307
831 Ga0496125_0003958 3300048928 Bacteria 17459
832 Ga0496125_0004293 3300048928 Bacteria 16548
833 Ga0496125_0071000 3300048928 Bacteria 2723
834 Ga0496125_0076091 3300048928 Bacteria 2593
835 Ga0496125_0090717 3300048928 Bacteria 2292
836 Ga0496125_0101131 3300048928 Bacteria 2123
837 Ga0496125_0200646 3300048928 Bacteria 1306
838 Ga0496126_0000066 3300048929 Bacteria 252188
839 Ga0496126_0005496 3300048929 Bacteria 14446
840 Ga0496126_0017234 3300048929 Bacteria 7199
841 Ga0496126_0032656 3300048929 Bacteria 4902
842 Ga0496126_0034196 3300048929 Bacteria 4775
843 Ga0496126_0039311 3300048929 Bacteria 4390
844 Ga0496126_0080413 3300048929 Bacteria 2884
845 Ga0496126_0116161 3300048929 Bacteria 2326
846 Ga0496126_0132632 3300048929 Bacteria 2151
847 Ga0496126_0134066 3300048929 Bacteria 2138
848 Ga0496126_0216201 3300048929 Bacteria 1612
849 Ga0496126_0439538 3300048929 Bacteria 1052
850 Ga0496126_0449882 3300048929 Bacteria 1037
851 Ga0501032_0006654 3300049569 Bacteria 8483
852 Ga0501032_0072599 3300049569 Bacteria 2294
853 Ga0501033_0000471 3300049570 Bacteria 38100
854 Ga0501033_0018472 3300049570 Bacteria 5268
855 Ga0501033_0110068 3300049570 Bacteria 2005
856 Ga0501033_0247601 3300049570 Bacteria 1264
857 Ga0501034_0040304 3300049571 Bacteria 4727
858 Ga0501034_0283137 3300049571 Bacteria 1597
859 Ga0501036_0371046 3300049572 Bacteria 1194
860 Ga0501037_0008873 3300049573 Bacteria 7362
861 Ga0501038_0011583 3300049574 Bacteria 8046
862 Ga0501039_0004382 3300049575 Bacteria 10645
863 Ga0501041_0171979 3300049577 Bacteria 1356
864 Ga0501042_0001444 3300049578 Bacteria 13979
865 Ga0501042_0365522 3300049578 Bacteria 1044
866 Ga0501043_0001496 3300049579 Bacteria 20418
867 Ga0501043_0121079 3300049579 Bacteria 2052
868 Ga0501043_0157870 3300049579 Bacteria 1773
869 Ga0501043_0521033 3300049579 Bacteria 886
870 Ga0501046_0002161 3300049580 Bacteria 18563
871 Ga0501046_0033631 3300049580 Bacteria 4140
872 Ga0501046_0339381 3300049580 Bacteria 1092
873 Ga0501047_0013306 3300049581 Bacteria 7793
874 Ga0501047_0026404 3300049581 Bacteria 5588
875 Ga0501047_0132914 3300049581 Bacteria 2368
876 Ga0501048_0003202 3300049582 Bacteria 12475
877 Ga0501068_0069665 3300049584 Bacteria 2145
878 Ga0501068_0081139 3300049584 Bacteria 1991
879 Ga0501069_0039315 3300049585 Bacteria 2613
880 Ga0501069_0295419 3300049585 Bacteria 949
881 Ga0501070_0072795 3300049586 Bacteria 2844
882 Ga0501070_0132879 3300049586 Bacteria 2055
883 Ga0501070_0359142 3300049586 Bacteria 1182
884 Ga0501074_0051742 3300049590 Bacteria 2964
885 Ga0501074_0113300 3300049590 Bacteria 1940
886 Ga0501074_0300397 3300049590 Bacteria 1140
887 Ga0501223_000031 3300049663 Bacteria 51024
888 Ga0501233_000027 3300049668 Bacteria 19963
889 Ga0501225_0006588 3300049705 Bacteria 3389
890 Ga0501225_0014677 3300049705 Bacteria 2186
891 Ga0501080_0003940 3300049742 Bacteria 13143
892 Ga0501080_0021921 3300049742 Bacteria 5917
893 Ga0501080_0132729 3300049742 Bacteria 2305
894 Ga0501035_0000184 3300049822 Bacteria 76560
895 Ga0501035_0086193 3300049822 Bacteria 2767
896 Ga0501035_0438108 3300049822 Bacteria 1083
897 Ga0501044_0009899 3300049823 Bacteria 10360
898 Ga0501044_0031820 3300049823 Bacteria 5548
899 Ga0501044_0056476 3300049823 Bacteria 4031
900 Ga0501045_0543177 3300049824 Bacteria 862
901 nmdc:mga03683_18922_c1 3300050489 Bacteria 2624
902 nmdc:mga03n38_106837_c1 3300050490 Bacteria 1358
903 nmdc:mga03n38_19312_c1 3300050490 Bacteria 2707
904 nmdc:mga03n38_46090_c1 3300050490 Bacteria 1923
905 nmdc:mga00v17_45380_c1 3300050491 Bacteria 2655
906 nmdc:mga00v17_95707_c1 3300050491 Bacteria 1870
907 nmdc:mga0yw44_171177_c1 3300050492 Bacteria 1426
908 nmdc:mga0yw44_19812_c1 3300050492 Bacteria 3718
909 nmdc:mga0yw44_198383_c1 3300050492 Bacteria 1325
910 nmdc:mga0yw44_239601_c1 3300050492 Bacteria 1205
911 nmdc:mga0yw44_30835_c1 3300050492 Bacteria 3112
912 nmdc:mga0yw44_35076_c1 3300050492 Bacteria 2945
913 nmdc:mga0yw44_46356_c1 3300050492 Bacteria 2610
914 nmdc:mga0yw44_7980_c1 3300050492 Bacteria 5248
915 nmdc:mga0yw44_83120_c1 3300050492 Bacteria 2011
916 nmdc:mga0k408_168650_c1 3300050493 Bacteria 1305
917 nmdc:mga0k408_4184_c1 3300050493 Bacteria 7658
918 nmdc:mga0k408_43269_c1 3300050493 Bacteria 2595
919 nmdc:mga06z11_108_c1 3300050494 Bacteria 33977
920 nmdc:mga06z11_162081_c1 3300050494 Bacteria 1279
921 nmdc:mga06z11_18525_c1 3300050494 Bacteria 3182
922 nmdc:mga06z11_318564_c1 3300050494 Bacteria 927
923 nmdc:mga06z11_453005_c1 3300050494 Bacteria 775
924 nmdc:mga06z11_58537_c1 3300050494 Bacteria 2000
925 nmdc:mga06z11_67065_c1 3300050494 Bacteria 1888
926 nmdc:mga04h51_10764_c1 3300050495 Bacteria 2522
927 nmdc:mga04h51_11_c1 3300050495 Bacteria 101578
928 nmdc:mga07m45_118389_c1 3300050496 Bacteria 1529
929 nmdc:mga07m45_323868_c1 3300050496 Bacteria 896
930 nmdc:mga07m45_3791_c1 3300050496 Bacteria 7316
931 nmdc:mga07m45_41409_c1 3300050496 Bacteria 2580
932 nmdc:mga0n895_202296_c1 3300050512 Bacteria 2016
933 nmdc:mga0n895_62695_c1 3300050512 Bacteria 3675
934 nmdc:mga08x19_48563_c1 3300050514 Bacteria 2719
935 nmdc:mga0sz30_106040_c1 3300050516 Bacteria 1230
936 nmdc:mga0sz30_17191_c1 3300050516 Bacteria 2883
937 Ga0495601_0135539 3300053077 Bacteria 1605
938 Ga0495601_0144005 3300053077 Bacteria 1555
939 Ga0495612_0015011 3300053078 Bacteria 3107
940 Ga0500610_0030564 3300053079 Bacteria 2731
941 Ga0500635_0000497 3300053080 Bacteria 10901
942 Ga0500635_0002088 3300053080 Bacteria 4900
943 Ga0500635_0052409 3300053080 Bacteria 1401
944 Ga0495655_0057445 3300053083 Bacteria 1050
945 Ga0495595_0128276 3300053084 Bacteria 1238
946 Ga0500578_0201782 3300053086 Bacteria 1217
947 Ga0500578_0292072 3300053086 Bacteria 969
948 Ga0500643_000007 3300053087 Bacteria 462836
949 Ga0500643_126723 3300053087 Bacteria 687
950 Ga0500647_0004594 3300053091 Bacteria 5586
951 Ga0500647_0023075 3300053091 Bacteria 2916
952 Ga0500583_0024081 3300053092 Bacteria 2577
953 Ga0500651_0054309 3300053093 Bacteria 2511
954 Ga0500651_0097056 3300053093 Bacteria 1811
955 Ga0500566_0000011 3300053094 Bacteria 118644
956 Ga0500566_0000613 3300053094 Bacteria 20005
957 Ga0500566_0049910 3300053094 Bacteria 2397
958 Ga0500566_0198287 3300053094 Bacteria 1016
959 Ga0500640_002917 3300053095 Bacteria 5809
960 Ga0500650_0070352 3300053098 Bacteria 1636
961 Ga0500555_003600 3300053103 Bacteria 4412
962 Ga0500556_0000621 3300053104 Bacteria 22523
963 Ga0500557_000009 3300053105 Bacteria 125806
964 Ga0500562_009630 3300053108 Bacteria 2442
965 Ga0500569_009092 3300053109 Bacteria 2298
966 Ga0500572_000119 3300053111 Bacteria 26209
967 Ga0500593_010824 3300053117 Bacteria 3837
968 Ga0500594_0005732 3300053118 Bacteria 2762
969 Ga0500595_000111 3300053119 Bacteria 55013
970 Ga0500595_013847 3300053119 Bacteria 3078
971 Ga0500595_037477 3300053119 Bacteria 1581
972 Ga0500608_000420 3300053122 Bacteria 16146
973 Ga0500608_001840 3300053122 Bacteria 7555
974 Ga0500614_000712 3300053123 Bacteria 8500
975 Ga0500614_022418 3300053123 Bacteria 1474
976 Ga0500618_000755 3300053125 Bacteria 18296
977 Ga0500621_159539 3300053126 Bacteria 838
978 Ga0500626_044699 3300053128 Bacteria 1999
979 Ga0500642_0000154 3300053130 Bacteria 28564
980 Ga0500642_0021161 3300053130 Bacteria 2571
981 Ga0500655_000008 3300053133 Bacteria 67575
982 Ga0500655_022379 3300053133 Bacteria 1189
983 Ga0500658_0049679 3300053134 Bacteria 1710
984 Ga0500658_0230201 3300053134 Bacteria 850
985 Ga0500559_0000335 3300053136 Bacteria 35252
986 Ga0500559_0000891 3300053136 Bacteria 19105
987 Ga0500559_0003742 3300053136 Bacteria 7393
988 Ga0500559_0036328 3300053136 Bacteria 2130
989 Ga0500559_0082526 3300053136 Bacteria 1463
990 Ga0500559_0129670 3300053136 Bacteria 1177
991 Ga0500564_004667 3300053138 Bacteria 5513
992 Ga0500564_093280 3300053138 Bacteria 1338
993 Ga0500573_0028168 3300053140 Bacteria 3234
994 Ga0500573_0059303 3300053140 Bacteria 2193
995 Ga0500585_099151 3300053144 Bacteria 1050
996 Ga0500588_0032258 3300053146 Bacteria 1518
997 Ga0500590_000889 3300053148 Bacteria 11325
998 Ga0500590_042265 3300053148 Bacteria 2341
999 Ga0500603_000056 3300053150 Bacteria 27646
1000 Ga0500603_000222 3300053150 Bacteria 15001
1001 Ga0500603_021701 3300053150 Bacteria 1582
1002 Ga0500604_0009791 3300053151 Bacteria 2555
1003 Ga0500620_056124 3300053155 Bacteria 1331
1004 Ga0500624_000021 3300053157 Bacteria 117511
1005 Ga0500630_000088 3300053159 Bacteria 29175
1006 Ga0500630_123730 3300053159 Bacteria 1141
1007 Ga0500638_000096 3300053162 Bacteria 16139
1008 Ga0500638_087189 3300053162 Bacteria 1475
1009 Ga0500638_135664 3300053162 Bacteria 1111
1010 Ga0500639_000009 3300053163 Bacteria 139043
1011 Ga0500639_090584 3300053163 Bacteria 1524
1012 Ga0500636_0000228 3300053177 Bacteria 30746
1013 Ga0500636_0106617 3300053177 Bacteria 1587
1014 Ga0500636_0233003 3300053177 Bacteria 951
1015 Ga0500637_0000708 3300053178 Bacteria 13298
1016 Ga0500637_0001960 3300053178 Bacteria 8942
1017 Ga0500637_0022686 3300053178 Bacteria 3424
1018 Ga0500637_0083980 3300053178 Bacteria 1841
1019 Ga0500567_004223 3300053723 Bacteria 6519
1020 Ga0500625_000012 3300053729 Bacteria 127269
1021 Ga0500625_000053 3300053729 Bacteria 23355
1022 Ga0500645_011994 3300053730 Bacteria 2811
1023 Ga0500609_003435 3300053731 Bacteria 2223
1024 Ga0500596_000288 3300053735 Bacteria 8901
1025 Ga0500596_022511 3300053735 Bacteria 953
1026 Ga0500599_004512 3300053736 Bacteria 1725
1027 Ga0500601_000488 3300053737 Bacteria 6175
1028 Ga0500601_001930 3300053737 Bacteria 2230
1029 Ga0500661_000582 3300055283 Bacteria 6821
1030 Ga0501082_0875078 3300060353 Bacteria 786
1031 Ga0466962_0122766 3300061719 Bacteria 1254

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031649 Ga0307514_10000861 Ga0307514_1000086129 194
2 3300037471 Ga0395905_0624322 Ga0395905_0624322_77_706 194
3 3300028794 Ga0307515_10000626 Ga0307515_100006263 195
4 3300031456 Ga0307513_10011751 Ga0307513_100117518 195
5 3300026035 Ga0207703_10150352 Ga0207703_101503522 197
6 3300005439 Ga0070711_100093251 Ga0070711_1000932512 198
7 3300013100 Ga0157373_10530700 Ga0157373_105307002 198
8 3300025916 Ga0207663_10161919 Ga0207663_101619192 198
9 3300031548 Ga0307408_100007475 Ga0307408_1000074752 199
10 3300031731 Ga0307405_10008013 Ga0307405_100080137 199
11 3300031824 Ga0307413_10111485 Ga0307413_101114852 199
12 3300031901 Ga0307406_10024841 Ga0307406_100248414 199
13 3300032002 Ga0307416_100008101 Ga0307416_1000081012 199
14 3300047322 Ga0495680_0292367 Ga0495680_0292367_519_1118 199
15 3300005434 Ga0070709_10000412 Ga0070709_100004123 202
16 3300005435 Ga0070714_100002292 Ga0070714_1000022929 202
17 3300005436 Ga0070713_100000950 Ga0070713_1000009501 202
18 3300005437 Ga0070710_10012033 Ga0070710_100120333 202
19 3300005439 Ga0070711_100199402 Ga0070711_1001994021 202
20 3300006028 Ga0070717_10009339 Ga0070717_100093397 202
21 3300006163 Ga0070715_10001792 Ga0070715_100017927 202
22 3300006173 Ga0070716_100001697 Ga0070716_1000016977 202
23 3300006175 Ga0070712_100014502 Ga0070712_1000145026 202
24 3300025898 Ga0207692_10004793 Ga0207692_100047933 202
25 3300025906 Ga0207699_10005077 Ga0207699_100050778 202
26 3300025915 Ga0207693_10000217 Ga0207693_1000021712 202
27 3300025916 Ga0207663_10000151 Ga0207663_1000015118 202
28 3300025928 Ga0207700_10067405 Ga0207700_100674053 202
29 3300025929 Ga0207664_10040259 Ga0207664_100402593 202
30 3300025939 Ga0207665_10000493 Ga0207665_1000049315 202
31 3300025905 Ga0207685_10270433 Ga0207685_102704332 203
32 3300033180 Ga0307510_10235298 Ga0307510_102352982 203
33 iso_pu_bacteria 2891088606 2891089731 204
34 iso_pu_bacteria 2945945610 2945950751 204
35 iso_pu_bacteria 3005587118 3005587367 204
36 iso_pu_bacteria 2507262055 2507507979 205
37 iso_pu_bacteria 2508501009 2508542086 205
38 iso_pu_bacteria 2508501042 2508692367 205
39 iso_pu_bacteria 2508501128 2509151083 205
40 iso_pu_bacteria 2511231028 2511397997 205
41 iso_pu_bacteria 2512564014 2512642191 205
42 iso_pu_bacteria 2513237092 2513622572 205
43 iso_pu_bacteria 2513237094 2513639405 205
44 iso_pu_bacteria 2513237095 2513647192 205
45 iso_pu_bacteria 2513237096 2513653750 205
46 iso_pu_bacteria 2513237098 2513671730 205
47 iso_pu_bacteria 2513237101 2513695568 205
48 iso_pu_bacteria 2513237101 2513696594 205
49 iso_pu_bacteria 2513237102 2513700780 205
50 iso_pu_bacteria 2513237104 2513715173 205
51 iso_pu_bacteria 2513237137 2513856187 205
52 iso_pu_bacteria 2513237139 2513877606 205
53 iso_pu_bacteria 2513237141 2513887367 205
54 iso_pu_bacteria 2513237145 2513918090 205
55 iso_pu_bacteria 2513237161 2514009751 205
56 iso_pu_bacteria 2515154112 2515626866 205
57 iso_pu_bacteria 2517093001 2517103807 205
58 iso_pu_bacteria 2517572143 2517891672 205
59 iso_pu_bacteria 2524023210 2524470112 205
60 iso_pu_bacteria 2524023210 2524470177 205
61 iso_pu_bacteria 2524023228 2524536723 205
62 iso_pu_bacteria 2528768022 2528850836 205
63 iso_pu_bacteria 2574179768 2574430755 205
64 iso_pu_bacteria 2599185354 2600200273 205
65 iso_pu_bacteria 2599185359 2600226155 205
66 iso_pu_bacteria 2617270735 2617346477 205
67 iso_pu_bacteria 2617270741 2617378582 205
68 iso_pu_bacteria 2643221609 2644059157 205
69 iso_pu_bacteria 2643221611 2644075801 205
70 iso_pu_bacteria 2713897090 2715501557 205
71 iso_pu_bacteria 2721755523 2722881597 205
72 iso_pu_bacteria 2721755755 2723843971 205
73 iso_pu_bacteria 2728368998 2728751907 205
74 iso_pu_bacteria 2738541275 2738712230 205
75 iso_pu_bacteria 2738541301 2738850655 205
76 iso_pu_bacteria 2738541304 2738866384 205
77 iso_pu_bacteria 2738543012 2739245560 205
78 iso_pu_bacteria 2738543022 2739298902 205
79 iso_pu_bacteria 2738543033 2739360580 205
80 iso_pu_bacteria 2775507255 2778126384 205
81 iso_pu_bacteria 2791355197 2793067044 205
82 iso_pu_bacteria 2791355199 2793081124 205
83 iso_pu_bacteria 2802429603 2805918384 205
84 iso_pu_bacteria 2816332133 2816472282 205
85 iso_pu_bacteria 2816332527 2818236229 205
86 iso_pu_bacteria 2818991466 2819712799 205
87 iso_pu_bacteria 2824600985 2824605318 205
88 iso_pu_bacteria 2824609381 2824615568 205
89 iso_pu_bacteria 2824617872 2824626461 205
90 iso_pu_bacteria 2824626560 2824634780 205
91 iso_pu_bacteria 2824635225 2824643739 205
92 iso_pu_bacteria 2824644064 2824652896 205
93 iso_pu_bacteria 2824653114 2824656696 205
94 iso_pu_bacteria 2824661429 2824670624 205
95 iso_pu_bacteria 2824671348 2824678726 205
96 iso_pu_bacteria 2824687955 2824696147 205
97 iso_pu_bacteria 2824696289 2824703497 205
98 iso_pu_bacteria 2824704595 2824714372 205
99 iso_pu_bacteria 2824714736 2824723583 205
100 iso_pu_bacteria 2824723954 2824732587 205
101 iso_pu_bacteria 2824732956 2824740391 205
102 iso_pu_bacteria 2824746037 2824752805 205
103 iso_pu_bacteria 2824753945 2824763330 205
104 iso_pu_bacteria 2824763712 2824773089 205
105 iso_pu_bacteria 2824773399 2824774737 205
106 iso_pu_bacteria 2834578030 2834579060 205
107 iso_pu_bacteria 2838122688 2838122983 205
108 iso_pu_bacteria 2839138175 2839139750 205
109 iso_pu_bacteria 2841941048 2841944732 205
110 iso_pu_bacteria 2841949485 2841955976 205
111 iso_pu_bacteria 2841957949 2841960028 205
112 iso_pu_bacteria 2841966195 2841969887 205
113 iso_pu_bacteria 2841974524 2841978683 205
114 iso_pu_bacteria 2841983080 2841984191 205
115 iso_pu_bacteria 2842038055 2842040332 205
116 iso_pu_bacteria 2842045827 2842046724 205
117 iso_pu_bacteria 2842718218 2842719139 205
118 iso_pu_bacteria 2844315083 2844319698 205
119 iso_pu_bacteria 2847930680 2847937019 205
120 iso_pu_bacteria 2847939898 2847947419 205
121 iso_pu_bacteria 2849076700 2849078689 205
122 iso_pu_bacteria 2857509624 2857513100 205
123 iso_pu_bacteria 2874590934 2874599072 205
124 iso_pu_bacteria 2874604998 2874612044 205
125 iso_pu_bacteria 2874612657 2874617247 205
126 iso_pu_bacteria 2874620515 2874626619 205
127 iso_pu_bacteria 2874628541 2874635338 205
128 iso_pu_bacteria 2874645413 2874650483 205
129 iso_pu_bacteria 2876761206 2876764338 205
130 iso_pu_bacteria 2876771140 2876779111 205
131 iso_pu_bacteria 2876818435 2876822715 205
132 iso_pu_bacteria 2879074833 2879082904 205
133 iso_pu_bacteria 2879083081 2879083880 205
134 iso_pu_bacteria 2879099564 2879106053 205
135 iso_pu_bacteria 2879110137 2879113969 205
136 iso_pu_bacteria 2879127579 2879133031 205
137 iso_pu_bacteria 2879142872 2879149318 205
138 iso_pu_bacteria 2879163058 2879165909 205
139 iso_pu_bacteria 2881364244 2881368110 205
140 iso_pu_bacteria 2881665667 2881667806 205
141 iso_pu_bacteria 2885366525 2885369586 205
142 iso_pu_bacteria 2885383462 2885389129 205
143 iso_pu_bacteria 2885409591 2885414791 205
144 iso_pu_bacteria 2888378607 2888385119 205
145 iso_pu_bacteria 2888388044 2888393108 205
146 iso_pu_bacteria 2888419890 2888425266 205
147 iso_pu_bacteria 2889033259 2889041861 205
148 iso_pu_bacteria 2894023352 2894023995 205
149 iso_pu_bacteria 2898795034 2898798063 205
150 iso_pu_bacteria 2899259804 2899261408 205
151 iso_pu_bacteria 2903727486 2903730621 205
152 iso_pu_bacteria 2903748898 2903755796 205
153 iso_pu_bacteria 2903768456 2903776260 205
154 iso_pu_bacteria 2904666416 2904671960 205
155 iso_pu_bacteria 2904690495 2904697881 205
156 iso_pu_bacteria 2904699407 2904704588 205
157 iso_pu_bacteria 2904711408 2904712316 205
158 iso_pu_bacteria 2906602504 2906609571 205
159 iso_pu_bacteria 2906610324 2906616845 205
160 iso_pu_bacteria 2906626472 2906628884 205
161 iso_pu_bacteria 2906635258 2906642886 205
162 iso_pu_bacteria 2906643746 2906649868 205
163 iso_pu_bacteria 2906660503 2906667176 205
164 iso_pu_bacteria 2908756301 2908759704 205
165 iso_pu_bacteria 2908775508 2908780826 205
166 iso_pu_bacteria 2919138771 2919140963 205
167 iso_pu_bacteria 2922361189 2922366318 205
168 iso_pu_bacteria 2922368715 2922372765 205
169 iso_pu_bacteria 2922386360 2922386624 205
170 iso_pu_bacteria 2922425934 2922431082 205
171 iso_pu_bacteria 2928027323 2928030438 205
172 iso_pu_bacteria 2928100450 2928102718 205
173 iso_pu_bacteria 2928959182 2928959197 205
174 iso_pu_bacteria 2928968154 2928969124 205
175 iso_pu_bacteria 2929615660 2929620587 205
176 iso_pu_bacteria 2929624759 2929626481 205
177 iso_pu_bacteria 2932784394 2932784652 205
178 iso_pu_bacteria 2932794094 2932795446 205
179 iso_pu_bacteria 2932801729 2932807960 205
180 iso_pu_bacteria 2932809354 2932809632 205
181 iso_pu_bacteria 2932818245 2932818625 205
182 iso_pu_bacteria 2932828146 2932828420 205
183 iso_pu_bacteria 2933577622 2933582504 205
184 iso_pu_bacteria 2935608549 2935609525 205
185 iso_pu_bacteria 2935616580 2935617393 205
186 iso_pu_bacteria 2935638405 2935639125 205
187 iso_pu_bacteria 2935648319 2935652324 205
188 iso_pu_bacteria 2935656913 2935660906 205
189 iso_pu_bacteria 2935665750 2935666023 205
190 iso_pu_bacteria 2935675223 2935675671 205
191 iso_pu_bacteria 2935684952 2935685320 205
192 iso_pu_bacteria 2935694250 2935698569 205
193 iso_pu_bacteria 2935703347 2935704132 205
194 iso_pu_bacteria 2935713505 2935713873 205
195 iso_pu_bacteria 2935722832 2935724492 205
196 iso_pu_bacteria 2935732158 2935733150 205
197 iso_pu_bacteria 2935741537 2935742529 205
198 iso_pu_bacteria 2935750917 2935751285 205
199 iso_pu_bacteria 2935760218 2935765944 205
200 iso_pu_bacteria 2935769743 2935769925 205
201 iso_pu_bacteria 2935777560 2935782055 205
202 iso_pu_bacteria 2935785616 2935785833 205
203 iso_pu_bacteria 2935793552 2935794239 205
204 iso_pu_bacteria 2935801545 2935802215 205
205 iso_pu_bacteria 2935810662 2935811039 205
206 iso_pu_bacteria 2935819856 2935822687 205
207 iso_pu_bacteria 2935827899 2935828620 205
208 iso_pu_bacteria 2935837841 2935839996 205
209 iso_pu_bacteria 2935847175 2935848269 205
210 iso_pu_bacteria 2935855204 2935856018 205
211 iso_pu_bacteria 2935864058 2935866038 205
212 iso_pu_bacteria 2935873716 2935877637 205
213 iso_pu_bacteria 2935883170 2935883654 205
214 iso_pu_bacteria 2935908558 2935909928 205
215 iso_pu_bacteria 2935916978 2935917654 205
216 iso_pu_bacteria 2935926038 2935927408 205
217 iso_pu_bacteria 2935934488 2935936747 205
218 iso_pu_bacteria 2935942939 2935944950 205
219 iso_pu_bacteria 2935951376 2935953387 205
220 iso_pu_bacteria 2935959822 2935961120 205
221 iso_pu_bacteria 2935967501 2935970227 205
222 iso_pu_bacteria 2935975950 2935981048 205
223 iso_pu_bacteria 2935984226 2935986795 205
224 iso_pu_bacteria 2935992306 2935992581 205
225 iso_pu_bacteria 2936002035 2936002453 205
226 iso_pu_bacteria 2936011229 2936014962 205
227 iso_pu_bacteria 2936019824 2936022057 205
228 iso_pu_bacteria 2936028420 2936032745 205
229 iso_pu_bacteria 2936037263 2936037542 205
230 iso_pu_bacteria 2936046547 2936050703 205
231 iso_pu_bacteria 2936055302 2936059520 205
232 iso_pu_bacteria 2940556831 2940557913 205
233 iso_pu_bacteria 2941531003 2941536756 205
234 iso_pu_bacteria 2941538514 2941540664 205
235 iso_pu_bacteria 2946787523 2946788598 205
236 iso_pu_bacteria 2974320154 2974324223 205
237 iso_pu_bacteria 2984555340 2984557365 205
238 iso_pu_bacteria 2984564862 2984568238 205
239 iso_pu_bacteria 2990265787 2990267977 205
240 iso_pu_bacteria 2993356040 2993359318 205
241 iso_pu_bacteria 2993693658 2993697004 205
242 iso_pu_bacteria 3000017691 3000018470 205
243 iso_pu_bacteria 3005474847 3005480904 205
244 iso_pu_bacteria 3005483717 3005485070 205
245 iso_pu_bacteria 3005506211 3005507409 205
246 iso_pu_bacteria 3005594810 3005599926 205
247 iso_pu_bacteria 3005710791 3005715520 205
248 iso_pu_bacteria 3005718088 3005722856 205
249 iso_pu_bacteria 8006926726 8006930662 205
250 iso_pu_bacteria 8006933436 8006939806 205
251 iso_pu_bacteria 8006964411 8006970930 205
252 iso_pu_bacteria 8006973647 8006979575 205
253 iso_pu_bacteria 8006984368 8006990313 205
254 iso_pu_bacteria 8006994254 8006999337 205
255 iso_pu_bacteria 8016511872 8016521097 205
256 iso_pu_bacteria 8016522445 8016528993 205
257 iso_pu_bacteria 8016530956 8016534194 205
258 iso_pu_bacteria 8016548790 8016554717 205
259 iso_pu_bacteria 8016557553 8016563089 205
260 iso_pu_bacteria 8016566248 8016572536 205
261 iso_pu_bacteria 8016575299 8016576704 205
262 iso_pu_bacteria 8016583857 8016593790 205
263 iso_pu_bacteria 8016595262 8016600846 205
264 iso_pu_bacteria 8016603502 8016609647 205
265 iso_pu_bacteria 8016613128 8016615281 205
266 iso_pu_bacteria 8016622563 8016625927 205
267 iso_pu_bacteria 8016630954 8016639509 205
268 iso_pu_bacteria 8017057580 8017064510 205
269 iso_pu_bacteria 8019530166 8019533966 205
270 iso_pu_bacteria 8019538911 8019545705 205
271 iso_pu_bacteria 8019547302 8019553008 205
272 iso_pu_bacteria 8019576017 8019583875 205
273 iso_pu_bacteria 8019586578 8019591686 205
274 iso_pu_bacteria 8019597564 8019599650 205
275 iso_pu_bacteria 8019608314 8019618899 205
276 iso_pu_bacteria 8019619141 8019619486 205
277 iso_pu_bacteria 8019638758 8019646270 205
278 iso_pu_bacteria 8019648815 8019649022 205
279 iso_pu_bacteria 8019659431 8019661513 205
280 iso_pu_bacteria 8019668869 8019671046 205
281 iso_pu_bacteria 8019687851 8019690736 205
282 iso_pu_bacteria 8055742211 8055745449 205
283 iso_pu_bacteria 8056673599 8056680042 205
284 iso_pu_bacteria 8056681323 8056687865 205
285 iso_pu_bacteria 8056967851 8056968713 205
286 iso_pu_bacteria 2739367898 2740165810 206
287 3300005719 Ga0068861_100919204 Ga0068861_1009192041 207
288 3300003578 Ga0006562J51391_1080078 Ga0006562J51391_10800782 208
289 3300003790 Ga0055528_1042532 Ga0055528_10425321 208
290 3300005288 Ga0065714_10004054 Ga0065714_100040545 208
291 3300005329 Ga0070683_100214615 Ga0070683_1002146152 208
292 3300005367 Ga0070667_100028009 Ga0070667_1000280093 208
293 3300005434 Ga0070709_10124190 Ga0070709_101241902 208
294 3300005435 Ga0070714_100011447 Ga0070714_1000114472 208
295 3300005435 Ga0070714_100036225 Ga0070714_1000362252 208
296 3300005436 Ga0070713_100386640 Ga0070713_1003866402 208
297 3300005459 Ga0068867_100119352 Ga0068867_1001193523 208
298 3300005614 Ga0068856_100189219 Ga0068856_1001892192 208
299 3300005616 Ga0068852_100147625 Ga0068852_1001476253 208
300 3300005840 Ga0068870_10070566 Ga0068870_100705662 208
301 3300005843 Ga0068860_100003099 Ga0068860_10000309915 208
302 3300006038 Ga0075365_10051078 Ga0075365_100510782 208
303 3300006038 Ga0075365_10100633 Ga0075365_101006332 208
304 3300006038 Ga0075365_10118731 Ga0075365_101187312 208
305 3300006038 Ga0075365_10218650 Ga0075365_102186502 208
306 3300006042 Ga0075368_10002064 Ga0075368_100020644 208
307 3300006048 Ga0075363_100002734 Ga0075363_1000027345 208
308 3300006048 Ga0075363_100190554 Ga0075363_1001905542 208
309 3300006051 Ga0075364_10009420 Ga0075364_100094205 208
310 3300006051 Ga0075364_10089644 Ga0075364_100896442 208
311 3300006051 Ga0075364_10122661 Ga0075364_101226612 208
312 3300006051 Ga0075364_10129192 Ga0075364_101291923 208
313 3300006058 Ga0075432_10000947 Ga0075432_100009476 208
314 3300006178 Ga0075367_10008575 Ga0075367_100085753 208
315 3300006178 Ga0075367_10206064 Ga0075367_102060642 208
316 3300006353 Ga0075370_10193655 Ga0075370_101936552 208
317 3300009098 Ga0105245_10843520 Ga0105245_108435202 208
318 3300014497 Ga0182008_10068896 Ga0182008_100688962 208
319 3300020081 Ga0206354_11418476 Ga0206354_114184762 208
320 3300020082 Ga0206353_12023448 Ga0206353_120234484 208
321 3300020610 Ga0154015_1264598 Ga0154015_12645982 208
322 3300021388 Ga0213875_10079341 Ga0213875_100793412 208
323 3300025273 Ga0209673_1001167 Ga0209673_100116727 208
324 3300025906 Ga0207699_10053444 Ga0207699_100534442 208
325 3300025915 Ga0207693_10741960 Ga0207693_107419601 208
326 3300025928 Ga0207700_10005260 Ga0207700_100052605 208
327 3300025928 Ga0207700_10433784 Ga0207700_104337842 208
328 3300025929 Ga0207664_10013911 Ga0207664_100139114 208
329 3300025929 Ga0207664_10015966 Ga0207664_100159661 208
330 3300025935 Ga0207709_10639423 Ga0207709_106394231 208
331 3300025942 Ga0207689_10113725 Ga0207689_101137252 208
332 3300025986 Ga0207658_10057561 Ga0207658_100575614 208
333 3300026078 Ga0207702_10156921 Ga0207702_101569212 208
334 3300026142 Ga0207698_10067408 Ga0207698_100674083 208
335 3300026142 Ga0207698_11307182 Ga0207698_113071821 208
336 3300027866 Ga0209813_10186011 Ga0209813_101860111 208
337 3300027907 Ga0207428_10113849 Ga0207428_101138493 208
338 3300028381 Ga0268264_10000980 Ga0268264_100009804 208
339 3300037312 Ga0395899_0039807 Ga0395899_0039807_1970_2635 208
340 3300037418 Ga0395900_0055181 Ga0395900_0055181_2016_2681 208
341 3300037418 Ga0395900_0062858 Ga0395900_0062858_678_1349 208
342 3300037418 Ga0395900_0064716 Ga0395900_0064716_1750_2415 208
343 3300037418 Ga0395900_0221809 Ga0395900_0221809_466_1131 208
344 3300037466 Ga0395898_0050420 Ga0395898_0050420_756_1421 208
345 3300037466 Ga0395898_0144970 Ga0395898_0144970_862_1527 208
346 3300037471 Ga0395905_0010197 Ga0395905_0010197_5967_6632 208
347 3300037853 Ga0436364_0341967 Ga0436364_0341967_1276_1947 208
348 3300037853 Ga0436364_0476301 Ga0436364_0476301_223_858 208
349 3300037853 Ga0436364_0752290 Ga0436364_0752290_205_831 208
350 3300038443 Ga0395901_0091636 Ga0395901_0091636_389_1054 208
351 3300038443 Ga0395901_0343297 Ga0395901_0343297_735_1400 208
352 3300041404 Ga0439436_0024372 Ga0439436_0024372_1047_1712 208
353 3300041452 Ga0451793_1165256 Ga0451793_1165256_1433_2089 208
354 3300041453 Ga0451797_1163837 Ga0451797_1163837_342_995 208
355 3300041491 Ga0451833_0257326 Ga0451833_0257326_291_968 208
356 3300041491 Ga0451833_0290422 Ga0451833_0290422_455_1111 208
357 3300041491 Ga0451833_0896395 Ga0451833_0896395_2179_2835 208
358 3300041494 Ga0451837_1397189 Ga0451837_1397189_3503_4159 208
359 3300041496 Ga0451839_0842413 Ga0451839_0842413_1223_1879 208
360 3300041512 Ga0451853_0261175 Ga0451853_0261175_54_719 208
361 3300042004 Ga0439445_0007938 Ga0439445_0007938_801_1484 208
362 3300042146 Ga0450907_007576 Ga0450907_007576_332_997 208
363 3300044658 Ga0466972_0017113 Ga0466972_0017113_2423_3088 208
364 3300044658 Ga0466972_0169946 Ga0466972_0169946_40_735 208
365 3300044684 Ga0466966_0292965 Ga0466966_0292965_212_880 208
366 3300044765 Ga0466970_0054266 Ga0466970_0054266_303_998 208
367 3300044765 Ga0466970_0058552 Ga0466970_0058552_764_1432 208
368 3300044765 Ga0466970_0077125 Ga0466970_0077125_123_791 208
369 3300044842 Ga0466957_0309867 Ga0466957_0309867_128_796 208
370 3300044901 Ga0466960_0090662 Ga0466960_0090662_75_770 208
371 3300044901 Ga0466960_0117920 Ga0466960_0117920_32_697 208
372 3300045976 Ga0466967_0057572 Ga0466967_0057572_1861_2529 208
373 3300046477 Ga0495664_0161810 Ga0495664_0161810_236_901 208
374 3300046660 Ga0495625_0000238 Ga0495625_0000238_10362_10988 208
375 3300046663 Ga0495635_0089364 Ga0495635_0089364_1023_1688 208
376 3300048903 Ga0496100_0158966 Ga0496100_0158966_511_1137 208
377 3300048905 Ga0496102_0098004 Ga0496102_0098004_1680_2348 208
378 3300048907 Ga0496104_0575930 Ga0496104_0575930_364_990 208
379 3300048908 Ga0496105_0074881 Ga0496105_0074881_662_1348 208
380 3300048911 Ga0496108_0845861 Ga0496108_0845861_21_689 208
381 3300048912 Ga0496109_0465790 Ga0496109_0465790_40_708 208
382 3300048913 Ga0496110_0149483 Ga0496110_0149483_972_1640 208
383 3300048913 Ga0496110_0296096 Ga0496110_0296096_570_1235 208
384 3300048914 Ga0496111_0042941 Ga0496111_0042941_915_1580 208
385 3300048915 Ga0496112_0033125 Ga0496112_0033125_3127_3753 208
386 3300048916 Ga0496113_0226339 Ga0496113_0226339_219_887 208
387 3300048927 Ga0496124_0056740 Ga0496124_0056740_713_1378 208
388 3300048929 Ga0496126_0039311 Ga0496126_0039311_2217_2909 208
389 3300049569 Ga0501032_0006654 Ga0501032_0006654_1087_1752 208
390 3300049569 Ga0501032_0072599 Ga0501032_0072599_917_1585 208
391 3300049570 Ga0501033_0000471 Ga0501033_0000471_30640_31305 208
392 3300049570 Ga0501033_0018472 Ga0501033_0018472_340_1008 208
393 3300049570 Ga0501033_0110068 Ga0501033_0110068_436_1101 208
394 3300049571 Ga0501034_0040304 Ga0501034_0040304_1404_2072 208
395 3300049571 Ga0501034_0283137 Ga0501034_0283137_789_1454 208
396 3300049572 Ga0501036_0371046 Ga0501036_0371046_428_1093 208
397 3300049573 Ga0501037_0008873 Ga0501037_0008873_3770_4435 208
398 3300049574 Ga0501038_0011583 Ga0501038_0011583_7258_7923 208
399 3300049575 Ga0501039_0004382 Ga0501039_0004382_4639_5304 208
400 3300049577 Ga0501041_0171979 Ga0501041_0171979_82_747 208
401 3300049578 Ga0501042_0001444 Ga0501042_0001444_8545_9210 208
402 3300049578 Ga0501042_0365522 Ga0501042_0365522_112_777 208
403 3300049579 Ga0501043_0001496 Ga0501043_0001496_4456_5121 208
404 3300049579 Ga0501043_0121079 Ga0501043_0121079_551_1216 208
405 3300049579 Ga0501043_0157870 Ga0501043_0157870_852_1517 208
406 3300049579 Ga0501043_0521033 Ga0501043_0521033_52_720 208
407 3300049580 Ga0501046_0002161 Ga0501046_0002161_981_1646 208
408 3300049580 Ga0501046_0033631 Ga0501046_0033631_1099_1764 208
409 3300049580 Ga0501046_0339381 Ga0501046_0339381_276_944 208
410 3300049581 Ga0501047_0013306 Ga0501047_0013306_868_1533 208
411 3300049581 Ga0501047_0026404 Ga0501047_0026404_2694_3362 208
412 3300049582 Ga0501048_0003202 Ga0501048_0003202_4984_5649 208
413 3300049584 Ga0501068_0069665 Ga0501068_0069665_233_901 208
414 3300049584 Ga0501068_0081139 Ga0501068_0081139_235_891 208
415 3300049585 Ga0501069_0039315 Ga0501069_0039315_840_1505 208
416 3300049585 Ga0501069_0295419 Ga0501069_0295419_209_874 208
417 3300049586 Ga0501070_0132879 Ga0501070_0132879_1207_1872 208
418 3300049586 Ga0501070_0359142 Ga0501070_0359142_160_825 208
419 3300049590 Ga0501074_0051742 Ga0501074_0051742_473_1138 208
420 3300049590 Ga0501074_0300397 Ga0501074_0300397_449_1114 208
421 3300049742 Ga0501080_0003940 Ga0501080_0003940_8747_9412 208
422 3300049742 Ga0501080_0021921 Ga0501080_0021921_5135_5800 208
423 3300049822 Ga0501035_0000184 Ga0501035_0000184_72655_73323 208
424 3300049822 Ga0501035_0086193 Ga0501035_0086193_895_1560 208
425 3300049822 Ga0501035_0438108 Ga0501035_0438108_123_785 208
426 3300049823 Ga0501044_0009899 Ga0501044_0009899_8307_8975 208
427 3300049823 Ga0501044_0031820 Ga0501044_0031820_3398_4063 208
428 3300049824 Ga0501045_0543177 Ga0501045_0543177_65_730 208
429 3300050489 nmdc:mga03683_18922_c1 nmdc:mga03683_18922_c1_853_1479 208
430 3300050490 nmdc:mga03n38_106837_c1 nmdc:mga03n38_106837_c1_585_1211 208
431 3300050490 nmdc:mga03n38_19312_c1 nmdc:mga03n38_19312_c1_970_1635 208
432 3300050491 nmdc:mga00v17_45380_c1 nmdc:mga00v17_45380_c1_1317_1982 208
433 3300050491 nmdc:mga00v17_95707_c1 nmdc:mga00v17_95707_c1_472_1098 208
434 3300050492 nmdc:mga0yw44_19812_c1 nmdc:mga0yw44_19812_c1_439_1104 208
435 3300050492 nmdc:mga0yw44_198383_c1 nmdc:mga0yw44_198383_c1_185_850 208
436 3300050492 nmdc:mga0yw44_7980_c1 nmdc:mga0yw44_7980_c1_40_666 208
437 3300050492 nmdc:mga0yw44_83120_c1 nmdc:mga0yw44_83120_c1_245_910 208
438 3300050493 nmdc:mga0k408_43269_c1 nmdc:mga0k408_43269_c1_823_1449 208
439 3300050494 nmdc:mga06z11_453005_c1 nmdc:mga06z11_453005_c1_65_730 208
440 3300050494 nmdc:mga06z11_58537_c1 nmdc:mga06z11_58537_c1_23_688 208
441 3300050494 nmdc:mga06z11_67065_c1 nmdc:mga06z11_67065_c1_25_651 208
442 3300050495 nmdc:mga04h51_10764_c1 nmdc:mga04h51_10764_c1_23_688 208
443 3300053104 Ga0500556_0000621 Ga0500556_0000621_14910_15587 208
444 3300053117 Ga0500593_010824 Ga0500593_010824_2355_3020 208
445 3300060353 Ga0501082_0875078 Ga0501082_0875078_52_717 208
446 iso_pu_bacteria 2501939600 2501943015 208
447 iso_pu_bacteria 2643221561 2643823970 208
448 iso_pu_bacteria 2643221576 2643891255 208
449 iso_pu_bacteria 2643221590 2643960303 208
450 iso_pu_bacteria 2643221604 2644036263 208
451 iso_pu_bacteria 2643221615 2644088953 208
452 iso_pu_bacteria 2643221617 2644101967 208
453 iso_pu_bacteria 2643221620 2644115190 208
454 iso_pu_bacteria 2643221657 2644318798 208
455 iso_pu_bacteria 2643221697 2644538945 208
456 iso_pu_bacteria 2738541305 2738870159 208
457 iso_pu_bacteria 2811994874 2812333478 208
458 iso_pu_bacteria 2856858025 2856863807 208
459 iso_pu_bacteria 2857481737 2857481992 208
460 iso_pu_bacteria 2984592036 2984592600 208
461 iso_pu_bacteria 649633069 649814464 208
462 2162886007 SwRhRL2b_contig_891765 SwRhRL2b_0885.00003280 209
463 3300001915 JGI24741J21665_1001372 JGI24741J21665_10013728 209
464 3300001979 JGI24740J21852_10001088 JGI24740J21852_100010887 209
465 3300001989 JGI24739J22299_10004944 JGI24739J22299_100049442 209
466 3300001990 JGI24737J22298_10001478 JGI24737J22298_100014785 209
467 3300002067 JGI24735J21928_10003371 JGI24735J21928_100033715 209
468 3300002075 JGI24738J21930_10002858 JGI24738J21930_100028585 209
469 3300003215 JGI25153J46596_10015897 JGI25153J46596_100158973 209
470 3300003354 JGI25160J50197_1000991 JGI25160J50197_10009914 209
471 3300003775 Ga0055524_1031628 Ga0055524_10316282 209
472 3300003794 Ga0055531_10007448 Ga0055531_100074483 209
473 3300004625 Ga0055543_1010842 Ga0055543_10108422 209
474 3300005262 Ga0065165_1000420 Ga0065165_100042052 209
475 3300005262 Ga0065165_1000556 Ga0065165_100055643 209
476 3300005262 Ga0065165_1002861 Ga0065165_10028615 209
477 3300005262 Ga0065165_1018469 Ga0065165_10184692 209
478 3300005262 Ga0065165_1022530 Ga0065165_10225301 209
479 3300005289 Ga0065704_10073969 Ga0065704_100739694 209
480 3300005289 Ga0065704_10098518 Ga0065704_100985183 209
481 3300005327 Ga0070658_10011650 Ga0070658_100116504 209
482 3300005331 Ga0070670_100158239 Ga0070670_1001582393 209
483 3300005334 Ga0068869_100011273 Ga0068869_1000112738 209
484 3300005334 Ga0068869_100505077 Ga0068869_1005050772 209
485 3300005335 Ga0070666_10630426 Ga0070666_106304261 209
486 3300005336 Ga0070680_100127183 Ga0070680_1001271832 209
487 3300005336 Ga0070680_100144897 Ga0070680_1001448973 209
488 3300005339 Ga0070660_100108655 Ga0070660_1001086553 209
489 3300005343 Ga0070687_100771303 Ga0070687_1007713031 209
490 3300005347 Ga0070668_100000159 Ga0070668_10000015918 209
491 3300005347 Ga0070668_100012970 Ga0070668_1000129703 209
492 3300005347 Ga0070668_100042914 Ga0070668_1000429143 209
493 3300005347 Ga0070668_100060893 Ga0070668_1000608931 209
494 3300005347 Ga0070668_100070156 Ga0070668_1000701563 209
495 3300005353 Ga0070669_100000502 Ga0070669_10000050212 209
496 3300005353 Ga0070669_100008694 Ga0070669_1000086944 209
497 3300005353 Ga0070669_100047738 Ga0070669_1000477383 209
498 3300005353 Ga0070669_100431815 Ga0070669_1004318151 209
499 3300005355 Ga0070671_100072841 Ga0070671_1000728414 209
500 3300005355 Ga0070671_100093311 Ga0070671_1000933113 209
501 3300005366 Ga0070659_100101177 Ga0070659_1001011772 209
502 3300005366 Ga0070659_100225312 Ga0070659_1002253122 209
503 3300005367 Ga0070667_100000120 Ga0070667_10000012034 209
504 3300005367 Ga0070667_100185115 Ga0070667_1001851152 209
505 3300005367 Ga0070667_100272476 Ga0070667_1002724762 209
506 3300005434 Ga0070709_10024335 Ga0070709_100243352 209
507 3300005434 Ga0070709_10048056 Ga0070709_100480563 209
508 3300005435 Ga0070714_100034015 Ga0070714_1000340152 209
509 3300005435 Ga0070714_100362590 Ga0070714_1003625902 209
510 3300005436 Ga0070713_100064714 Ga0070713_1000647142 209
511 3300005436 Ga0070713_100230108 Ga0070713_1002301082 209
512 3300005436 Ga0070713_100506776 Ga0070713_1005067762 209
513 3300005437 Ga0070710_10016226 Ga0070710_100162263 209
514 3300005437 Ga0070710_10068077 Ga0070710_100680772 209
515 3300005437 Ga0070710_10181543 Ga0070710_101815432 209
516 3300005437 Ga0070710_10285744 Ga0070710_102857442 209
517 3300005439 Ga0070711_100035424 Ga0070711_1000354242 209
518 3300005439 Ga0070711_100068759 Ga0070711_1000687592 209
519 3300005440 Ga0070705_100130127 Ga0070705_1001301272 209
520 3300005455 Ga0070663_100003672 Ga0070663_1000036725 209
521 3300005456 Ga0070678_100015171 Ga0070678_1000151712 209
522 3300005457 Ga0070662_100021506 Ga0070662_1000215063 209
523 3300005457 Ga0070662_100210093 Ga0070662_1002100931 209
524 3300005458 Ga0070681_10351005 Ga0070681_103510052 209
525 3300005467 Ga0070706_100111923 Ga0070706_1001119232 209
526 3300005530 Ga0070679_100005105 Ga0070679_1000051052 209
527 3300005535 Ga0070684_100012778 Ga0070684_1000127782 209
528 3300005535 Ga0070684_100119046 Ga0070684_1001190463 209
529 3300005536 Ga0070697_100259244 Ga0070697_1002592442 209
530 3300005539 Ga0068853_100001299 Ga0068853_10000129920 209
531 3300005539 Ga0068853_100117771 Ga0068853_1001177713 209
532 3300005539 Ga0068853_100312689 Ga0068853_1003126892 209
533 3300005539 Ga0068853_100545458 Ga0068853_1005454582 209
534 3300005548 Ga0070665_100018399 Ga0070665_1000183993 209
535 3300005549 Ga0070704_100877963 Ga0070704_1008779632 209
536 3300005563 Ga0068855_100093490 Ga0068855_1000934903 209
537 3300005563 Ga0068855_100514454 Ga0068855_1005144542 209
538 3300005564 Ga0070664_100100367 Ga0070664_1001003672 209
539 3300005577 Ga0068857_100068885 Ga0068857_1000688853 209
540 3300005577 Ga0068857_100074848 Ga0068857_1000748482 209
541 3300005577 Ga0068857_100148499 Ga0068857_1001484993 209
542 3300005577 Ga0068857_100622773 Ga0068857_1006227732 209
543 3300005614 Ga0068856_100004372 Ga0068856_1000043728 209
544 3300005614 Ga0068856_100085631 Ga0068856_1000856312 209
545 3300005614 Ga0068856_100770256 Ga0068856_1007702562 209
546 3300005616 Ga0068852_100260037 Ga0068852_1002600372 209
547 3300005617 Ga0068859_100422237 Ga0068859_1004222371 209
548 3300005617 Ga0068859_100436313 Ga0068859_1004363131 209
549 3300005617 Ga0068859_100855479 Ga0068859_1008554791 209
550 3300005618 Ga0068864_100287620 Ga0068864_1002876202 209
551 3300005834 Ga0068851_10454633 Ga0068851_104546331 209
552 3300005841 Ga0068863_100000053 Ga0068863_10000005335 209
553 3300005841 Ga0068863_100042120 Ga0068863_1000421206 209
554 3300005841 Ga0068863_100043176 Ga0068863_1000431762 209
555 3300005842 Ga0068858_100066232 Ga0068858_1000662323 209
556 3300005842 Ga0068858_100273482 Ga0068858_1002734822 209
557 3300005843 Ga0068860_100000312 Ga0068860_10000031216 209
558 3300005843 Ga0068860_100013340 Ga0068860_1000133405 209
559 3300005843 Ga0068860_100081169 Ga0068860_1000811692 209
560 3300005844 Ga0068862_100000778 Ga0068862_10000077823 209
561 3300005844 Ga0068862_100084813 Ga0068862_1000848132 209
562 3300005844 Ga0068862_100235116 Ga0068862_1002351162 209
563 3300005844 Ga0068862_100444166 Ga0068862_1004441662 209
564 3300005844 Ga0068862_100722151 Ga0068862_1007221512 209
565 3300005844 Ga0068862_100745364 Ga0068862_1007453641 209
566 3300005981 Ga0081538_10022343 Ga0081538_100223432 209
567 3300005983 Ga0081540_1006288 Ga0081540_10062883 209
568 3300005983 Ga0081540_1011114 Ga0081540_10111147 209
569 3300005983 Ga0081540_1052167 Ga0081540_10521673 209
570 3300005983 Ga0081540_1062715 Ga0081540_10627152 209
571 3300006028 Ga0070717_10007581 Ga0070717_100075815 209
572 3300006028 Ga0070717_10240356 Ga0070717_102403563 209
573 3300006038 Ga0075365_10043348 Ga0075365_100433483 209
574 3300006038 Ga0075365_10082334 Ga0075365_100823342 209
575 3300006042 Ga0075368_10000747 Ga0075368_100007476 209
576 3300006048 Ga0075363_100019180 Ga0075363_1000191804 209
577 3300006048 Ga0075363_100134951 Ga0075363_1001349512 209
578 3300006051 Ga0075364_10014814 Ga0075364_100148142 209
579 3300006051 Ga0075364_10015455 Ga0075364_100154553 209
580 3300006051 Ga0075364_10049523 Ga0075364_100495233 209
581 3300006051 Ga0075364_10119747 Ga0075364_101197472 209
582 3300006173 Ga0070716_100065483 Ga0070716_1000654833 209
583 3300006173 Ga0070716_100192081 Ga0070716_1001920812 209
584 3300006173 Ga0070716_100526128 Ga0070716_1005261281 209
585 3300006175 Ga0070712_100105643 Ga0070712_1001056433 209
586 3300006175 Ga0070712_100147941 Ga0070712_1001479412 209
587 3300006178 Ga0075367_10001262 Ga0075367_100012622 209
588 3300006178 Ga0075367_10402848 Ga0075367_104028482 209
589 3300006178 Ga0075367_10549079 Ga0075367_105490791 209
590 3300006186 Ga0075369_10210616 Ga0075369_102106162 209
591 3300006195 Ga0075366_10004909 Ga0075366_100049098 209
592 3300006195 Ga0075366_10005300 Ga0075366_100053003 209
593 3300006195 Ga0075366_10148824 Ga0075366_101488242 209
594 3300006237 Ga0097621_100089721 Ga0097621_1000897212 209
595 3300006353 Ga0075370_10001829 Ga0075370_100018298 209
596 3300006353 Ga0075370_10143708 Ga0075370_101437082 209
597 3300006353 Ga0075370_10258972 Ga0075370_102589722 209
598 3300006358 Ga0068871_100255625 Ga0068871_1002556252 209
599 3300006871 Ga0075434_100065071 Ga0075434_1000650713 209
600 3300006871 Ga0075434_100120336 Ga0075434_1001203364 209
601 3300006914 Ga0075436_100060838 Ga0075436_1000608383 209
602 3300006931 Ga0097620_100422246 Ga0097620_1004222462 209
603 3300006931 Ga0097620_100436292 Ga0097620_1004362921 209
604 3300006931 Ga0097620_100855369 Ga0097620_1008553692 209
605 3300006941 Ga0099825_1025128 Ga0099825_10251285 209
606 3300006942 Ga0099824_1004605 Ga0099824_100460510 209
607 3300006942 Ga0099824_1005450 Ga0099824_100545017 209
608 3300006943 Ga0099822_1000031 Ga0099822_100003112 209
609 3300006944 Ga0099823_1045510 Ga0099823_10455102 209
610 3300006946 Ga0079104_1000167 Ga0079104_100016718 209
611 3300006946 Ga0079104_1003511 Ga0079104_10035112 209
612 3300007788 Ga0099795_10002064 Ga0099795_100020645 209
613 3300007788 Ga0099795_10266265 Ga0099795_102662651 209
614 3300009092 Ga0105250_10000496 Ga0105250_100004964 209
615 3300009092 Ga0105250_10070463 Ga0105250_100704631 209
616 3300009092 Ga0105250_10269204 Ga0105250_102692041 209
617 3300009093 Ga0105240_10224017 Ga0105240_102240172 209
618 3300009093 Ga0105240_10236670 Ga0105240_102366702 209
619 3300009093 Ga0105240_10597280 Ga0105240_105972802 209
620 3300009093 Ga0105240_10705407 Ga0105240_107054072 209
621 3300009098 Ga0105245_10029674 Ga0105245_100296743 209
622 3300009098 Ga0105245_11126191 Ga0105245_111261912 209
623 3300009101 Ga0105247_10005744 Ga0105247_100057447 209
624 3300009101 Ga0105247_10016235 Ga0105247_100162352 209
625 3300009101 Ga0105247_10132234 Ga0105247_101322341 209
626 3300009101 Ga0105247_10542970 Ga0105247_105429701 209
627 3300009148 Ga0105243_10099559 Ga0105243_100995592 209
628 3300009148 Ga0105243_10124058 Ga0105243_101240582 209
629 3300009148 Ga0105243_11522682 Ga0105243_115226821 209
630 3300009174 Ga0105241_10018413 Ga0105241_100184134 209
631 3300009174 Ga0105241_10037419 Ga0105241_100374194 209
632 3300009174 Ga0105241_10060960 Ga0105241_100609602 209
633 3300009174 Ga0105241_10073639 Ga0105241_100736394 209
634 3300009174 Ga0105241_10111980 Ga0105241_101119803 209
635 3300009174 Ga0105241_10112845 Ga0105241_101128453 209
636 3300009177 Ga0105248_10010634 Ga0105248_1001063413 209
637 3300009177 Ga0105248_10050368 Ga0105248_100503682 209
638 3300009177 Ga0105248_10050394 Ga0105248_100503942 209
639 3300009177 Ga0105248_10097135 Ga0105248_100971353 209
640 3300009177 Ga0105248_10936489 Ga0105248_109364892 209
641 3300009545 Ga0105237_10010021 Ga0105237_1001002112 209
642 3300009545 Ga0105237_10030642 Ga0105237_100306423 209
643 3300009545 Ga0105237_10038406 Ga0105237_100384063 209
644 3300009545 Ga0105237_10049974 Ga0105237_100499743 209
645 3300009545 Ga0105237_10091668 Ga0105237_100916682 209
646 3300009545 Ga0105237_10126417 Ga0105237_101264172 209
647 3300009545 Ga0105237_11196456 Ga0105237_111964561 209
648 3300009551 Ga0105238_10051030 Ga0105238_100510302 209
649 3300009551 Ga0105238_10097805 Ga0105238_100978052 209
650 3300009551 Ga0105238_10284461 Ga0105238_102844612 209
651 3300009553 Ga0105249_10000479 Ga0105249_1000047926 209
652 3300009978 Ga0105148_100042 Ga0105148_10004218 209
653 3300010159 Ga0099796_10011546 Ga0099796_100115462 209
654 3300010375 Ga0105239_10022158 Ga0105239_100221582 209
655 3300010375 Ga0105239_10608547 Ga0105239_106085472 209
656 3300010375 Ga0105239_10623366 Ga0105239_106233662 209
657 3300010375 Ga0105239_10668126 Ga0105239_106681261 209
658 3300010375 Ga0105239_10907631 Ga0105239_109076312 209
659 3300011119 Ga0105246_10061565 Ga0105246_100615653 209
660 3300013102 Ga0157371_10085823 Ga0157371_100858232 209
661 3300013104 Ga0157370_10110273 Ga0157370_101102731 209
662 3300013104 Ga0157370_10299109 Ga0157370_102991092 209
663 3300013105 Ga0157369_10114195 Ga0157369_101141953 209
664 3300013105 Ga0157369_10179697 Ga0157369_101796973 209
665 3300013105 Ga0157369_10180113 Ga0157369_101801133 209
666 3300013105 Ga0157369_10364629 Ga0157369_103646292 209
667 3300013296 Ga0157374_10057825 Ga0157374_100578254 209
668 3300013296 Ga0157374_10128458 Ga0157374_101284582 209
669 3300013296 Ga0157374_10217974 Ga0157374_102179742 209
670 3300013297 Ga0157378_10042553 Ga0157378_100425534 209
671 3300013306 Ga0163162_10109119 Ga0163162_101091192 209
672 3300013306 Ga0163162_10444626 Ga0163162_104446261 209
673 3300013306 Ga0163162_10601242 Ga0163162_106012421 209
674 3300013308 Ga0157375_10238752 Ga0157375_102387522 209
675 3300014325 Ga0163163_10007677 Ga0163163_100076773 209
676 3300014325 Ga0163163_10117815 Ga0163163_101178154 209
677 3300014968 Ga0157379_10007477 Ga0157379_100074778 209
678 3300014968 Ga0157379_10098603 Ga0157379_100986032 209
679 3300014969 Ga0157376_10021572 Ga0157376_100215723 209
680 3300014969 Ga0157376_10638139 Ga0157376_106381391 209
681 3300017792 Ga0163161_10005250 Ga0163161_100052509 209
682 3300020070 Ga0206356_11766087 Ga0206356_117660871 209
683 3300020082 Ga0206353_11597628 Ga0206353_115976282 209
684 3300021320 Ga0214544_1000004 Ga0214544_1000004210 209
685 3300021321 Ga0214542_1000001 Ga0214542_1000001143 209
686 3300021324 Ga0214545_1000001 Ga0214545_1000001210 209
687 3300021327 Ga0214543_1000006 Ga0214543_1000006207 209
688 3300021441 Ga0213871_10007850 Ga0213871_100078502 209
689 3300021441 Ga0213871_10021068 Ga0213871_100210682 209
690 3300025230 Ga0209563_104631 Ga0209563_1046312 209
691 3300025245 Ga0207425_1016340 Ga0207425_10163402 209
692 3300025253 Ga0209677_101151 Ga0209677_10115110 209
693 3300025254 Ga0209148_1000566 Ga0209148_100056625 209
694 3300025261 Ga0209233_1001516 Ga0209233_10015162 209
695 3300025261 Ga0209233_1002707 Ga0209233_10027076 209
696 3300025261 Ga0209233_1026960 Ga0209233_10269602 209
697 3300025272 Ga0209455_1001114 Ga0209455_10011145 209
698 3300025295 Ga0209564_1039126 Ga0209564_10391262 209
699 3300025297 Ga0209758_1000024 Ga0209758_1000024538 209
700 3300025297 Ga0209758_1000068 Ga0209758_1000068310 209
701 3300025297 Ga0209758_1002049 Ga0209758_100204912 209
702 3300025297 Ga0209758_1005922 Ga0209758_10059229 209
703 3300025297 Ga0209758_1032747 Ga0209758_10327473 209
704 3300025299 Ga0209256_1008038 Ga0209256_10080385 209
705 3300025302 Ga0207426_1000120 Ga0207426_100012042 209
706 3300025302 Ga0207426_1000673 Ga0207426_100067314 209
707 3300025302 Ga0207426_1004196 Ga0207426_10041962 209
708 3300025304 Ga0209257_1001327 Ga0209257_100132719 209
709 3300025321 Ga0207656_10077493 Ga0207656_100774933 209
710 3300025711 Ga0207696_1005868 Ga0207696_10058683 209
711 3300025711 Ga0207696_1015915 Ga0207696_10159152 209
712 3300025899 Ga0207642_10483461 Ga0207642_104834611 209
713 3300025900 Ga0207710_10072977 Ga0207710_100729773 209
714 3300025900 Ga0207710_10074572 Ga0207710_100745721 209
715 3300025903 Ga0207680_10001161 Ga0207680_1000116110 209
716 3300025903 Ga0207680_10143421 Ga0207680_101434212 209
717 3300025904 Ga0207647_10035303 Ga0207647_100353034 209
718 3300025906 Ga0207699_10046323 Ga0207699_100463232 209
719 3300025906 Ga0207699_10275526 Ga0207699_102755262 209
720 3300025909 Ga0207705_10015903 Ga0207705_100159035 209
721 3300025910 Ga0207684_10122127 Ga0207684_101221273 209
722 3300025911 Ga0207654_10080134 Ga0207654_100801342 209
723 3300025911 Ga0207654_10092881 Ga0207654_100928812 209
724 3300025911 Ga0207654_10247339 Ga0207654_102473392 209
725 3300025911 Ga0207654_10283197 Ga0207654_102831972 209
726 3300025912 Ga0207707_10184089 Ga0207707_101840892 209
727 3300025912 Ga0207707_10195323 Ga0207707_101953232 209
728 3300025913 Ga0207695_10000008 Ga0207695_10000008492 209
729 3300025913 Ga0207695_10022582 Ga0207695_100225825 209
730 3300025913 Ga0207695_10186796 Ga0207695_101867963 209
731 3300025914 Ga0207671_10049564 Ga0207671_100495642 209
732 3300025914 Ga0207671_10070742 Ga0207671_100707424 209
733 3300025914 Ga0207671_10101602 Ga0207671_101016022 209
734 3300025914 Ga0207671_10156010 Ga0207671_101560102 209
735 3300025914 Ga0207671_10164936 Ga0207671_101649362 209
736 3300025914 Ga0207671_10691826 Ga0207671_106918261 209
737 3300025915 Ga0207693_10267676 Ga0207693_102676762 209
738 3300025916 Ga0207663_10059235 Ga0207663_100592352 209
739 3300025917 Ga0207660_10038888 Ga0207660_100388882 209
740 3300025917 Ga0207660_10305166 Ga0207660_103051662 209
741 3300025919 Ga0207657_10013873 Ga0207657_100138734 209
742 3300025919 Ga0207657_10395794 Ga0207657_103957942 209
743 3300025921 Ga0207652_10182875 Ga0207652_101828752 209
744 3300025921 Ga0207652_10440571 Ga0207652_104405712 209
745 3300025923 Ga0207681_10000358 Ga0207681_1000035820 209
746 3300025923 Ga0207681_10006344 Ga0207681_100063445 209
747 3300025923 Ga0207681_10133722 Ga0207681_101337222 209
748 3300025923 Ga0207681_10497069 Ga0207681_104970691 209
749 3300025924 Ga0207694_10170272 Ga0207694_101702723 209
750 3300025925 Ga0207650_10269207 Ga0207650_102692072 209
751 3300025926 Ga0207659_10141181 Ga0207659_101411812 209
752 3300025927 Ga0207687_10068316 Ga0207687_100683162 209
753 3300025927 Ga0207687_10748539 Ga0207687_107485391 209
754 3300025928 Ga0207700_10034019 Ga0207700_100340192 209
755 3300025928 Ga0207700_10449174 Ga0207700_104491741 209
756 3300025929 Ga0207664_10015026 Ga0207664_100150264 209
757 3300025929 Ga0207664_10414343 Ga0207664_104143432 209
758 3300025931 Ga0207644_10003443 Ga0207644_1000344312 209
759 3300025931 Ga0207644_10015682 Ga0207644_100156822 209
760 3300025931 Ga0207644_10017154 Ga0207644_100171546 209
761 3300025932 Ga0207690_10761991 Ga0207690_107619912 209
762 3300025933 Ga0207706_10022693 Ga0207706_100226932 209
763 3300025933 Ga0207706_10054128 Ga0207706_100541285 209
764 3300025933 Ga0207706_10077856 Ga0207706_100778562 209
765 3300025933 Ga0207706_10194661 Ga0207706_101946612 209
766 3300025933 Ga0207706_10614595 Ga0207706_106145952 209
767 3300025935 Ga0207709_10000143 Ga0207709_1000014356 209
768 3300025939 Ga0207665_10272241 Ga0207665_102722412 209
769 3300025941 Ga0207711_10063926 Ga0207711_100639264 209
770 3300025941 Ga0207711_10065464 Ga0207711_100654642 209
771 3300025942 Ga0207689_10001713 Ga0207689_100017138 209
772 3300025944 Ga0207661_10024510 Ga0207661_100245102 209
773 3300025944 Ga0207661_10069955 Ga0207661_100699552 209
774 3300025945 Ga0207679_10564102 Ga0207679_105641022 209
775 3300025945 Ga0207679_10655042 Ga0207679_106550422 209
776 3300025949 Ga0207667_10044360 Ga0207667_100443603 209
777 3300025949 Ga0207667_10054301 Ga0207667_100543012 209
778 3300025949 Ga0207667_10799326 Ga0207667_107993262 209
779 3300025961 Ga0207712_10000405 Ga0207712_1000040526 209
780 3300025961 Ga0207712_10200412 Ga0207712_102004122 209
781 3300025972 Ga0207668_10000027 Ga0207668_1000002735 209
782 3300025972 Ga0207668_10000119 Ga0207668_100001198 209
783 3300025972 Ga0207668_10015543 Ga0207668_100155432 209
784 3300025972 Ga0207668_10020385 Ga0207668_100203855 209
785 3300025972 Ga0207668_10106114 Ga0207668_101061142 209
786 3300025972 Ga0207668_10351107 Ga0207668_103511072 209
787 3300025981 Ga0207640_10002550 Ga0207640_100025505 209
788 3300025981 Ga0207640_10073577 Ga0207640_100735772 209
789 3300025986 Ga0207658_10000091 Ga0207658_1000009134 209
790 3300025986 Ga0207658_10068456 Ga0207658_100684562 209
791 3300025986 Ga0207658_10293074 Ga0207658_102930742 209
792 3300026023 Ga0207677_10024255 Ga0207677_100242553 209
793 3300026035 Ga0207703_10060972 Ga0207703_100609722 209
794 3300026035 Ga0207703_10106018 Ga0207703_101060182 209
795 3300026035 Ga0207703_10224120 Ga0207703_102241202 209
796 3300026041 Ga0207639_10003038 Ga0207639_100030389 209
797 3300026041 Ga0207639_10046719 Ga0207639_100467193 209
798 3300026041 Ga0207639_10049046 Ga0207639_100490464 209
799 3300026041 Ga0207639_10176128 Ga0207639_101761282 209
800 3300026041 Ga0207639_11100196 Ga0207639_111001961 209
801 3300026067 Ga0207678_10000053 Ga0207678_1000005380 209
802 3300026067 Ga0207678_10094685 Ga0207678_100946853 209
803 3300026078 Ga0207702_10007174 Ga0207702_100071744 209
804 3300026078 Ga0207702_10146400 Ga0207702_101464002 209
805 3300026078 Ga0207702_10222708 Ga0207702_102227082 209
806 3300026078 Ga0207702_10714325 Ga0207702_107143252 209
807 3300026088 Ga0207641_10000093 Ga0207641_1000009387 209
808 3300026088 Ga0207641_10027610 Ga0207641_100276106 209
809 3300026088 Ga0207641_10068221 Ga0207641_100682212 209
810 3300026088 Ga0207641_10819375 Ga0207641_108193752 209
811 3300026095 Ga0207676_10063189 Ga0207676_100631892 209
812 3300026095 Ga0207676_10117273 Ga0207676_101172732 209
813 3300026116 Ga0207674_10018107 Ga0207674_100181073 209
814 3300026116 Ga0207674_10075668 Ga0207674_100756682 209
815 3300026116 Ga0207674_10306908 Ga0207674_103069082 209
816 3300026118 Ga0207675_100003788 Ga0207675_1000037884 209
817 3300026118 Ga0207675_100288328 Ga0207675_1002883282 209
818 3300026121 Ga0207683_10026771 Ga0207683_100267715 209
819 3300026142 Ga0207698_10024978 Ga0207698_100249781 209
820 3300026142 Ga0207698_10027523 Ga0207698_100275232 209
821 3300026142 Ga0207698_10055947 Ga0207698_100559474 209
822 3300027111 Ga0209281_1000017 Ga0209281_1000017362 209
823 3300027296 Ga0209389_1000010 Ga0209389_1000010117 209
824 3300027296 Ga0209389_1000149 Ga0209389_100014937 209
825 3300027357 Ga0209589_1000016 Ga0209589_100001697 209
826 3300027357 Ga0209589_1000025 Ga0209589_100002581 209
827 3300027361 Ga0209489_100016 Ga0209489_100016117 209
828 3300027361 Ga0209489_100039 Ga0209489_10003981 209
829 3300027363 Ga0209700_100030 Ga0209700_100030181 209
830 3300027363 Ga0209700_100043 Ga0209700_10004384 209
831 3300027866 Ga0209813_10000012 Ga0209813_1000001211 209
832 3300028379 Ga0268266_10006810 Ga0268266_100068106 209
833 3300028379 Ga0268266_10016057 Ga0268266_100160576 209
834 3300028379 Ga0268266_10387098 Ga0268266_103870982 209
835 3300028379 Ga0268266_10794120 Ga0268266_107941201 209
836 3300028380 Ga0268265_10000633 Ga0268265_1000063312 209
837 3300028380 Ga0268265_10067570 Ga0268265_100675702 209
838 3300028380 Ga0268265_10296466 Ga0268265_102964662 209
839 3300028381 Ga0268264_10000030 Ga0268264_1000003046 209
840 3300028381 Ga0268264_10008606 Ga0268264_100086067 209
841 3300028381 Ga0268264_10058148 Ga0268264_100581482 209
842 3300030521 Ga0307511_10068998 Ga0307511_100689982 209
843 3300031247 Ga0265340_10011093 Ga0265340_100110933 209
844 3300031249 Ga0265339_10002090 Ga0265339_100020909 209
845 3300031456 Ga0307513_10114409 Ga0307513_101144093 209
846 3300031507 Ga0307509_10012996 Ga0307509_100129964 209
847 3300031616 Ga0307508_10330955 Ga0307508_103309552 209
848 3300031730 Ga0307516_10004326 Ga0307516_1000432614 209
849 3300031730 Ga0307516_10059170 Ga0307516_100591704 209
850 3300031730 Ga0307516_10204047 Ga0307516_102040471 209
851 3300031731 Ga0307405_10064861 Ga0307405_100648613 209
852 3300031901 Ga0307406_10350463 Ga0307406_103504632 209
853 3300031901 Ga0307406_10506305 Ga0307406_105063052 209
854 3300031911 Ga0307412_10002798 Ga0307412_100027985 209
855 3300031911 Ga0307412_10067707 Ga0307412_100677074 209
856 3300033180 Ga0307510_10032342 Ga0307510_100323424 209
857 3300033180 Ga0307510_10069078 Ga0307510_100690785 209
858 3300033442 Ga0315911_1000002 Ga0315911_1000002476 209
859 3300035086 Ga0373934_0023398 Ga0373934_0023398_757_1389 209
860 3300035089 Ga0373944_0069693 Ga0373944_0069693_310_939 209
861 3300035111 Ga0373923_0033070 Ga0373923_0033070_592_1224 209
862 3300035113 Ga0373936_0018408 Ga0373936_0018408_947_1579 209
863 3300035113 Ga0373936_0078370 Ga0373936_0078370_217_846 209
864 3300035117 Ga0373953_0042756 Ga0373953_0042756_594_1226 209
865 3300035118 Ga0373954_0022313 Ga0373954_0022313_1115_1747 209
866 3300035119 Ga0373956_0126661 Ga0373956_0126661_447_1079 209
867 3300035170 Ga0373943_0046835 Ga0373943_0046835_590_1219 209
868 3300035172 Ga0373955_0531326 Ga0373955_0531326_69_701 209
869 3300035410 Ga0373924_0013501 Ga0373924_0013501_132_764 209
870 3300035691 Ga0373931_0149272 Ga0373931_0149272_566_1195 209
871 3300035692 Ga0373935_0100224 Ga0373935_0100224_795_1424 209
872 3300035695 Ga0373927_0003407 Ga0373927_0003407_9248_9877 209
873 3300035724 Ga0373933_0454989 Ga0373933_0454989_180_809 209
874 3300035725 Ga0373947_0146864 Ga0373947_0146864_494_1123 209
875 3300036401 Ga0373937_0194238 Ga0373937_0194238_1244_1876 209
876 3300037068 Ga0373925_0052030 Ga0373925_0052030_1543_2175 209
877 3300037068 Ga0373925_0070598 Ga0373925_0070598_203_835 209
878 3300037068 Ga0373925_0490920 Ga0373925_0490920_83_712 209
879 3300037471 Ga0395905_0009332 Ga0395905_0009332_4050_4679 209
880 3300037471 Ga0395905_0228767 Ga0395905_0228767_1089_1721 209
881 3300037853 Ga0436364_0926030 Ga0436364_0926030_4344_4973 209
882 3300038443 Ga0395901_0058273 Ga0395901_0058273_3288_3917 209
883 3300039062 Ga0400483_126259 Ga0400483_126259_381_1010 209
884 3300039438 Ga0436360_0460772 Ga0436360_0460772_282_911 209
885 3300039438 Ga0436360_0732042 Ga0436360_0732042_2084_2713 209
886 3300039438 Ga0436360_1138676 Ga0436360_1138676_2488_3117 209
887 3300039447 Ga0436361_0149759 Ga0436361_0149759_951_1580 209
888 3300039447 Ga0436361_0263958 Ga0436361_0263958_836_1465 209
889 3300039447 Ga0436361_0319705 Ga0436361_0319705_94_726 209
890 3300042004 Ga0439445_0003192 Ga0439445_0003192_499_1143 209
891 3300042115 Ga0450911_000342 Ga0450911_000342_3943_4587 209
892 3300044656 Ga0466969_0004164 Ga0466969_0004164_6490_7119 209
893 3300044656 Ga0466969_0114560 Ga0466969_0114560_394_1023 209
894 3300044658 Ga0466972_0000148 Ga0466972_0000148_12817_13446 209
895 3300044658 Ga0466972_0003448 Ga0466972_0003448_1631_2260 209
896 3300044683 Ga0466965_0369115 Ga0466965_0369115_88_717 209
897 3300044684 Ga0466966_0012261 Ga0466966_0012261_1177_1806 209
898 3300044684 Ga0466966_0249042 Ga0466966_0249042_417_1046 209
899 3300044684 Ga0466966_0255610 Ga0466966_0255610_157_786 209
900 3300044693 Ga0466961_0000008 Ga0466961_0000008_67743_68372 209
901 3300044693 Ga0466961_0227358 Ga0466961_0227358_50_679 209
902 3300044694 Ga0466963_0483240 Ga0466963_0483240_232_861 209
903 3300044706 Ga0466964_0042755 Ga0466964_0042755_1037_1666 209
904 3300044719 Ga0466971_0139384 Ga0466971_0139384_486_1115 209
905 3300044735 Ga0466968_0038023 Ga0466968_0038023_787_1416 209
906 3300044735 Ga0466968_0155839 Ga0466968_0155839_119_748 209
907 3300044735 Ga0466968_0292198 Ga0466968_0292198_106_735 209
908 3300044765 Ga0466970_0053407 Ga0466970_0053407_360_989 209
909 3300044765 Ga0466970_0370827 Ga0466970_0370827_146_775 209
910 3300044842 Ga0466957_0089469 Ga0466957_0089469_899_1528 209
911 3300044901 Ga0466960_0016548 Ga0466960_0016548_1964_2593 209
912 3300044901 Ga0466960_0051615 Ga0466960_0051615_1138_1767 209
913 3300045049 Ga0466959_0009565 Ga0466959_0009565_3472_4101 209
914 3300045049 Ga0466959_0012592 Ga0466959_0012592_5443_6072 209
915 3300045049 Ga0466959_0016679 Ga0466959_0016679_857_1486 209
916 3300045049 Ga0466959_0473556 Ga0466959_0473556_164_793 209
917 3300045836 Ga0466958_0290849 Ga0466958_0290849_390_1019 209
918 3300045976 Ga0466967_0127399 Ga0466967_0127399_712_1341 209
919 3300045976 Ga0466967_0325825 Ga0466967_0325825_212_844 209
920 3300046452 Ga0495617_004580 Ga0495617_004580_3281_3910 209
921 3300046452 Ga0495617_092613 Ga0495617_092613_259_888 209
922 3300046453 Ga0495627_013822 Ga0495627_013822_1004_1633 209
923 3300046454 Ga0495592_0010915 Ga0495592_0010915_2943_3575 209
924 3300046455 Ga0495603_0223516 Ga0495603_0223516_216_845 209
925 3300046457 Ga0495590_0080137 Ga0495590_0080137_241_870 209
926 3300046459 Ga0495629_0059289 Ga0495629_0059289_679_1308 209
927 3300046459 Ga0495629_0130940 Ga0495629_0130940_1076_1708 209
928 3300046460 Ga0495638_0000073 Ga0495638_0000073_97404_98033 209
929 3300046460 Ga0495638_0002880 Ga0495638_0002880_10301_10930 209
930 3300046461 Ga0495641_0332186 Ga0495641_0332186_24_653 209
931 3300046462 Ga0495651_0001984 Ga0495651_0001984_3849_4478 209
932 3300046462 Ga0495651_0029080 Ga0495651_0029080_2027_2656 209
933 3300046462 Ga0495651_0085311 Ga0495651_0085311_1391_2020 209
934 3300046463 Ga0495653_0019076 Ga0495653_0019076_1199_1828 209
935 3300046463 Ga0495653_0200081 Ga0495653_0200081_235_864 209
936 3300046471 Ga0495650_0001348 Ga0495650_0001348_19741_20370 209
937 3300046473 Ga0495582_0020660 Ga0495582_0020660_1169_1801 209
938 3300046474 Ga0495605_0092373 Ga0495605_0092373_731_1360 209
939 3300046475 Ga0495639_0004491 Ga0495639_0004491_1004_1636 209
940 3300046475 Ga0495639_0295463 Ga0495639_0295463_43_672 209
941 3300046477 Ga0495664_0028535 Ga0495664_0028535_403_1035 209
942 3300046491 Ga0495584_0126854 Ga0495584_0126854_115_744 209
943 3300046499 Ga0495594_0109427 Ga0495594_0109427_759_1391 209
944 3300046500 Ga0495596_0003376 Ga0495596_0003376_6698_7327 209
945 3300046506 Ga0495583_0000087 Ga0495583_0000087_97364_97993 209
946 3300046507 Ga0495606_0061205 Ga0495606_0061205_521_1150 209
947 3300046507 Ga0495606_0284202 Ga0495606_0284202_214_843 209
948 3300046512 Ga0495610_0005333 Ga0495610_0005333_4477_5106 209
949 3300046512 Ga0495610_0027469 Ga0495610_0027469_1863_2492 209
950 3300046513 Ga0495616_0012946 Ga0495616_0012946_1096_1725 209
951 3300046514 Ga0495618_0034740 Ga0495618_0034740_2088_2717 209
952 3300046514 Ga0495618_0076428 Ga0495618_0076428_1093_1722 209
953 3300046514 Ga0495618_0141470 Ga0495618_0141470_342_971 209
954 3300046516 Ga0495628_0011313 Ga0495628_0011313_3308_3937 209
955 3300046516 Ga0495628_0110653 Ga0495628_0110653_1016_1648 209
956 3300046517 Ga0495630_0058231 Ga0495630_0058231_1115_1747 209
957 3300046517 Ga0495630_0159930 Ga0495630_0159930_59_688 209
958 3300046517 Ga0495630_0220274 Ga0495630_0220274_543_1172 209
959 3300046519 Ga0495632_0000049 Ga0495632_0000049_86905_87534 209
960 3300046519 Ga0495632_0002653 Ga0495632_0002653_7282_7911 209
961 3300046519 Ga0495632_0235837 Ga0495632_0235837_127_756 209
962 3300046520 Ga0495637_0014164 Ga0495637_0014164_991_1620 209
963 3300046522 Ga0495643_0000047 Ga0495643_0000047_65170_65799 209
964 3300046522 Ga0495643_0020094 Ga0495643_0020094_922_1551 209
965 3300046524 Ga0495648_0000049 Ga0495648_0000049_97404_98033 209
966 3300046524 Ga0495648_0032189 Ga0495648_0032189_1285_1914 209
967 3300046524 Ga0495648_0135824 Ga0495648_0135824_421_1050 209
968 3300046525 Ga0495663_0000009 Ga0495663_0000009_142545_143174 209
969 3300046526 Ga0495666_0029362 Ga0495666_0029362_1695_2327 209
970 3300046529 Ga0495652_0010482 Ga0495652_0010482_1536_2165 209
971 3300046529 Ga0495652_0035658 Ga0495652_0035658_3144_3773 209
972 3300046530 Ga0495654_0002730 Ga0495654_0002730_267_941 209
973 3300046531 Ga0495665_0013511 Ga0495665_0013511_3214_3846 209
974 3300046533 Ga0495640_0016765 Ga0495640_0016765_2333_2962 209
975 3300046533 Ga0495640_0031232 Ga0495640_0031232_2731_3363 209
976 3300046533 Ga0495640_0049025 Ga0495640_0049025_770_1399 209
977 3300046536 Ga0495587_0004347 Ga0495587_0004347_325_954 209
978 3300046542 Ga0495597_0000024 Ga0495597_0000024_45452_46081 209
979 3300046542 Ga0495597_0004357 Ga0495597_0004357_3458_4087 209
980 3300046542 Ga0495597_0104029 Ga0495597_0104029_199_828 209
981 3300046543 Ga0495645_0001873 Ga0495645_0001873_5911_6540 209
982 3300046543 Ga0495645_0113493 Ga0495645_0113493_836_1465 209
983 3300046557 Ga0495622_0039624 Ga0495622_0039624_976_1605 209
984 3300046557 Ga0495622_0206056 Ga0495622_0206056_193_822 209
985 3300046558 Ga0495633_0000290 Ga0495633_0000290_9189_9818 209
986 3300046558 Ga0495633_0000319 Ga0495633_0000319_31908_32537 209
987 3300046558 Ga0495633_0043026 Ga0495633_0043026_1443_2072 209
988 3300046558 Ga0495633_0111654 Ga0495633_0111654_390_1019 209
989 3300046559 Ga0495667_0003300 Ga0495667_0003300_6181_6810 209
990 3300046559 Ga0495667_0039255 Ga0495667_0039255_1491_2123 209
991 3300046616 Ga0495668_0025664 Ga0495668_0025664_2228_2857 209
992 3300046616 Ga0495668_0124753 Ga0495668_0124753_571_1200 209
993 3300046616 Ga0495668_0144762 Ga0495668_0144762_14_643 209
994 3300046642 Ga0495634_0024720 Ga0495634_0024720_2235_2864 209
995 3300046642 Ga0495634_0401407 Ga0495634_0401407_124_756 209
996 3300046648 Ga0495611_0133439 Ga0495611_0133439_373_1002 209
997 3300046660 Ga0495625_0004416 Ga0495625_0004416_5671_6300 209
998 3300046663 Ga0495635_0001999 Ga0495635_0001999_10813_11442 209
999 3300046663 Ga0495635_0009596 Ga0495635_0009596_4517_5146 209
1000 3300046665 Ga0495661_0167203 Ga0495661_0167203_80_709 209
1001 3300046674 Ga0495588_0007284 Ga0495588_0007284_1061_1690 209
1002 3300046675 Ga0495657_0001200 Ga0495657_0001200_15308_15937 209
1003 3300046675 Ga0495657_0079975 Ga0495657_0079975_433_1062 209
1004 3300046678 Ga0495599_0004074 Ga0495599_0004074_675_1304 209
1005 3300046678 Ga0495599_0103104 Ga0495599_0103104_808_1437 209
1006 3300046679 Ga0495623_0012871 Ga0495623_0012871_4731_5360 209
1007 3300046680 Ga0495646_0040750 Ga0495646_0040750_460_1089 209
1008 3300046680 Ga0495646_0042675 Ga0495646_0042675_928_1557 209
1009 3300046680 Ga0495646_0307381 Ga0495646_0307381_62_691 209
1010 3300046681 Ga0495647_0010474 Ga0495647_0010474_2088_2720 209
1011 3300046689 Ga0495613_0028267 Ga0495613_0028267_2734_3363 209
1012 3300046690 Ga0495624_0014716 Ga0495624_0014716_4142_4771 209
1013 3300046690 Ga0495624_0024527 Ga0495624_0024527_2716_3348 209
1014 3300046692 Ga0495671_0000038 Ga0495671_0000038_107895_108524 209
1015 3300046692 Ga0495671_0000042 Ga0495671_0000042_97591_98220 209
1016 3300046694 Ga0495649_0038769 Ga0495649_0038769_520_1149 209
1017 3300046694 Ga0495649_0189318 Ga0495649_0189318_361_990 209
1018 3300046809 Ga0495600_0002291 Ga0495600_0002291_6401_7030 209
1019 3300046809 Ga0495600_0110545 Ga0495600_0110545_222_851 209
1020 3300046809 Ga0495600_0157089 Ga0495600_0157089_178_810 209
1021 3300047317 Ga0495604_0009383 Ga0495604_0009383_3272_3901 209
1022 3300047317 Ga0495604_0111017 Ga0495604_0111017_820_1449 209
1023 3300047319 Ga0495674_0009389 Ga0495674_0009389_3966_4595 209
1024 3300047319 Ga0495674_0023697 Ga0495674_0023697_462_1091 209
1025 3300047321 Ga0495676_0041792 Ga0495676_0041792_586_1215 209
1026 3300047322 Ga0495680_0007048 Ga0495680_0007048_6422_7051 209
1027 3300047443 Ga0495687_016477 Ga0495687_016477_2898_3527 209
1028 3300047444 Ga0495675_0001461 Ga0495675_0001461_3037_3666 209
1029 3300047469 Ga0495673_0000111 Ga0495673_0000111_66982_67611 209
1030 3300047469 Ga0495673_0032421 Ga0495673_0032421_994_1623 209
1031 3300047469 Ga0495673_0106846 Ga0495673_0106846_51_680 209
1032 3300047470 Ga0495681_0000050 Ga0495681_0000050_94158_94787 209
1033 3300047470 Ga0495681_0000953 Ga0495681_0000953_5611_6240 209
1034 3300047471 Ga0495684_0004997 Ga0495684_0004997_8253_8885 209
1035 3300047471 Ga0495684_0076471 Ga0495684_0076471_1582_2211 209
1036 3300047472 Ga0495686_0000131 Ga0495686_0000131_62703_63332 209
1037 3300047472 Ga0495686_0044217 Ga0495686_0044217_1839_2468 209
1038 3300047472 Ga0495686_0078545 Ga0495686_0078545_1036_1665 209
1039 3300047673 Ga0495593_0031083 Ga0495593_0031083_2152_2781 209
1040 3300047673 Ga0495593_0066345 Ga0495593_0066345_130_759 209
1041 3300047673 Ga0495593_0067395 Ga0495593_0067395_1219_1851 209
1042 3300048088 Ga0495602_0016196 Ga0495602_0016196_3192_3821 209
1043 3300048088 Ga0495602_0110878 Ga0495602_0110878_551_1180 209
1044 3300048088 Ga0495602_0249852 Ga0495602_0249852_119_748 209
1045 3300048090 Ga0495615_0000002 Ga0495615_0000002_95640_96269 209
1046 3300048091 Ga0495626_0001710 Ga0495626_0001710_6711_7340 209
1047 3300048903 Ga0496100_0254925 Ga0496100_0254925_355_984 209
1048 3300048903 Ga0496100_0324336 Ga0496100_0324336_157_786 209
1049 3300048903 Ga0496100_0491266 Ga0496100_0491266_168_797 209
1050 3300048904 Ga0496101_0063166 Ga0496101_0063166_1193_1822 209
1051 3300048904 Ga0496101_0193098 Ga0496101_0193098_467_1096 209
1052 3300048904 Ga0496101_0749993 Ga0496101_0749993_43_672 209
1053 3300048905 Ga0496102_0001289 Ga0496102_0001289_13867_14496 209
1054 3300048905 Ga0496102_0014553 Ga0496102_0014553_2098_2727 209
1055 3300048905 Ga0496102_0022385 Ga0496102_0022385_2677_3306 209
1056 3300048905 Ga0496102_0056751 Ga0496102_0056751_795_1424 209
1057 3300048906 Ga0496103_0000163 Ga0496103_0000163_69705_70334 209
1058 3300048906 Ga0496103_0011719 Ga0496103_0011719_2670_3299 209
1059 3300048906 Ga0496103_0049786 Ga0496103_0049786_1511_2140 209
1060 3300048907 Ga0496104_0003456 Ga0496104_0003456_12419_13048 209
1061 3300048907 Ga0496104_0003849 Ga0496104_0003849_6962_7591 209
1062 3300048907 Ga0496104_0021120 Ga0496104_0021120_430_1059 209
1063 3300048907 Ga0496104_0839004 Ga0496104_0839004_23_652 209
1064 3300048908 Ga0496105_0001070 Ga0496105_0001070_12269_12898 209
1065 3300048908 Ga0496105_0007451 Ga0496105_0007451_5594_6223 209
1066 3300048908 Ga0496105_0205474 Ga0496105_0205474_210_839 209
1067 3300048908 Ga0496105_0417999 Ga0496105_0417999_157_786 209
1068 3300048909 Ga0496106_0000358 Ga0496106_0000358_15219_15848 209
1069 3300048909 Ga0496106_0010950 Ga0496106_0010950_5395_6024 209
1070 3300048910 Ga0496107_0085414 Ga0496107_0085414_1168_1797 209
1071 3300048910 Ga0496107_0103996 Ga0496107_0103996_345_974 209
1072 3300048910 Ga0496107_0184332 Ga0496107_0184332_184_813 209
1073 3300048911 Ga0496108_0069872 Ga0496108_0069872_1864_2493 209
1074 3300048911 Ga0496108_0078137 Ga0496108_0078137_1461_2090 209
1075 3300048911 Ga0496108_0249567 Ga0496108_0249567_595_1224 209
1076 3300048912 Ga0496109_0024779 Ga0496109_0024779_1202_1831 209
1077 3300048912 Ga0496109_0080914 Ga0496109_0080914_1300_1929 209
1078 3300048912 Ga0496109_0371301 Ga0496109_0371301_547_1179 209
1079 3300048912 Ga0496109_0680925 Ga0496109_0680925_145_774 209
1080 3300048913 Ga0496110_0010631 Ga0496110_0010631_4733_5362 209
1081 3300048913 Ga0496110_0079158 Ga0496110_0079158_763_1392 209
1082 3300048913 Ga0496110_0098432 Ga0496110_0098432_621_1250 209
1083 3300048913 Ga0496110_0241914 Ga0496110_0241914_205_834 209
1084 3300048914 Ga0496111_0110967 Ga0496111_0110967_56_685 209
1085 3300048914 Ga0496111_0206713 Ga0496111_0206713_499_1128 209
1086 3300048915 Ga0496112_0004169 Ga0496112_0004169_5411_6040 209
1087 3300048915 Ga0496112_0005313 Ga0496112_0005313_5126_5755 209
1088 3300048915 Ga0496112_0048480 Ga0496112_0048480_2192_2821 209
1089 3300048915 Ga0496112_0199250 Ga0496112_0199250_644_1273 209
1090 3300048915 Ga0496112_0299729 Ga0496112_0299729_345_974 209
1091 3300048915 Ga0496112_0629522 Ga0496112_0629522_40_669 209
1092 3300048915 Ga0496112_0730787 Ga0496112_0730787_59_688 209
1093 3300048916 Ga0496113_0000519 Ga0496113_0000519_6926_7555 209
1094 3300048916 Ga0496113_0009379 Ga0496113_0009379_198_827 209
1095 3300048916 Ga0496113_0015207 Ga0496113_0015207_1536_2168 209
1096 3300048916 Ga0496113_0043989 Ga0496113_0043989_2172_2801 209
1097 3300048916 Ga0496113_0061925 Ga0496113_0061925_325_954 209
1098 3300048916 Ga0496113_0131023 Ga0496113_0131023_632_1261 209
1099 3300048916 Ga0496113_0727822 Ga0496113_0727822_104_733 209
1100 3300048917 Ga0496114_0101393 Ga0496114_0101393_1653_2282 209
1101 3300048917 Ga0496114_0705007 Ga0496114_0705007_70_699 209
1102 3300048918 Ga0496115_0031252 Ga0496115_0031252_1270_1899 209
1103 3300048918 Ga0496115_0186263 Ga0496115_0186263_629_1258 209
1104 3300048918 Ga0496115_0208849 Ga0496115_0208849_615_1244 209
1105 3300048918 Ga0496115_0371747 Ga0496115_0371747_276_905 209
1106 3300048919 Ga0496116_0042437 Ga0496116_0042437_465_1094 209
1107 3300048920 Ga0496117_0001164 Ga0496117_0001164_14588_15217 209
1108 3300048920 Ga0496117_0072211 Ga0496117_0072211_1485_2114 209
1109 3300048920 Ga0496117_0074790 Ga0496117_0074790_562_1191 209
1110 3300048920 Ga0496117_0184712 Ga0496117_0184712_507_1136 209
1111 3300048921 Ga0496118_0000618 Ga0496118_0000618_19461_20090 209
1112 3300048921 Ga0496118_0019810 Ga0496118_0019810_4485_5114 209
1113 3300048921 Ga0496118_0023183 Ga0496118_0023183_3564_4193 209
1114 3300048921 Ga0496118_0070937 Ga0496118_0070937_751_1380 209
1115 3300048921 Ga0496118_0070938 Ga0496118_0070938_1132_1761 209
1116 3300048922 Ga0496119_0003597 Ga0496119_0003597_9295_9924 209
1117 3300048922 Ga0496119_0011321 Ga0496119_0011321_5553_6182 209
1118 3300048922 Ga0496119_0022385 Ga0496119_0022385_734_1363 209
1119 3300048922 Ga0496119_0031381 Ga0496119_0031381_2723_3352 209
1120 3300048923 Ga0496120_0022344 Ga0496120_0022344_2370_2999 209
1121 3300048923 Ga0496120_0055355 Ga0496120_0055355_87_716 209
1122 3300048923 Ga0496120_0061066 Ga0496120_0061066_416_1045 209
1123 3300048924 Ga0496121_0000017 Ga0496121_0000017_313483_314112 209
1124 3300048924 Ga0496121_0000212 Ga0496121_0000212_37485_38114 209
1125 3300048924 Ga0496121_0011514 Ga0496121_0011514_8205_8837 209
1126 3300048924 Ga0496121_0014846 Ga0496121_0014846_3501_4130 209
1127 3300048924 Ga0496121_0035076 Ga0496121_0035076_857_1486 209
1128 3300048924 Ga0496121_0043707 Ga0496121_0043707_2115_2744 209
1129 3300048924 Ga0496121_0057029 Ga0496121_0057029_328_957 209
1130 3300048924 Ga0496121_0059460 Ga0496121_0059460_963_1592 209
1131 3300048924 Ga0496121_0061598 Ga0496121_0061598_153_782 209
1132 3300048924 Ga0496121_0063034 Ga0496121_0063034_2210_2839 209
1133 3300048924 Ga0496121_0093883 Ga0496121_0093883_598_1227 209
1134 3300048924 Ga0496121_0166887 Ga0496121_0166887_23_652 209
1135 3300048924 Ga0496121_0194799 Ga0496121_0194799_579_1211 209
1136 3300048924 Ga0496121_0216279 Ga0496121_0216279_646_1275 209
1137 3300048924 Ga0496121_0413651 Ga0496121_0413651_23_652 209
1138 3300048925 Ga0496122_0001302 Ga0496122_0001302_35686_36315 209
1139 3300048925 Ga0496122_0001656 Ga0496122_0001656_19425_20054 209
1140 3300048925 Ga0496122_0015581 Ga0496122_0015581_6616_7245 209
1141 3300048925 Ga0496122_0070871 Ga0496122_0070871_1194_1823 209
1142 3300048925 Ga0496122_0078710 Ga0496122_0078710_1214_1843 209
1143 3300048925 Ga0496122_0131977 Ga0496122_0131977_472_1101 209
1144 3300048926 Ga0496123_0001454 Ga0496123_0001454_27479_28108 209
1145 3300048926 Ga0496123_0003614 Ga0496123_0003614_2898_3527 209
1146 3300048926 Ga0496123_0005223 Ga0496123_0005223_3799_4428 209
1147 3300048926 Ga0496123_0048070 Ga0496123_0048070_2184_2813 209
1148 3300048926 Ga0496123_0123319 Ga0496123_0123319_348_977 209
1149 3300048926 Ga0496123_0153197 Ga0496123_0153197_258_980 209
1150 3300048927 Ga0496124_0000204 Ga0496124_0000204_31212_31841 209
1151 3300048927 Ga0496124_0000861 Ga0496124_0000861_34298_34927 209
1152 3300048927 Ga0496124_0000988 Ga0496124_0000988_38617_39246 209
1153 3300048927 Ga0496124_0002175 Ga0496124_0002175_11135_11764 209
1154 3300048927 Ga0496124_0062229 Ga0496124_0062229_1697_2326 209
1155 3300048927 Ga0496124_0097847 Ga0496124_0097847_1454_2083 209
1156 3300048927 Ga0496124_0233617 Ga0496124_0233617_226_855 209
1157 3300048927 Ga0496124_0258241 Ga0496124_0258241_200_829 209
1158 3300048928 Ga0496125_0000841 Ga0496125_0000841_8154_8783 209
1159 3300048928 Ga0496125_0003958 Ga0496125_0003958_6067_6696 209
1160 3300048928 Ga0496125_0004293 Ga0496125_0004293_2052_2684 209
1161 3300048928 Ga0496125_0071000 Ga0496125_0071000_1655_2284 209
1162 3300048928 Ga0496125_0076091 Ga0496125_0076091_1405_2034 209
1163 3300048928 Ga0496125_0090717 Ga0496125_0090717_1428_2072 209
1164 3300048928 Ga0496125_0101131 Ga0496125_0101131_391_1020 209
1165 3300048928 Ga0496125_0200646 Ga0496125_0200646_265_894 209
1166 3300048929 Ga0496126_0000066 Ga0496126_0000066_17713_18342 209
1167 3300048929 Ga0496126_0005496 Ga0496126_0005496_696_1325 209
1168 3300048929 Ga0496126_0017234 Ga0496126_0017234_2057_2686 209
1169 3300048929 Ga0496126_0032656 Ga0496126_0032656_674_1303 209
1170 3300048929 Ga0496126_0034196 Ga0496126_0034196_1206_1835 209
1171 3300048929 Ga0496126_0080413 Ga0496126_0080413_1812_2441 209
1172 3300048929 Ga0496126_0116161 Ga0496126_0116161_1259_1888 209
1173 3300048929 Ga0496126_0132632 Ga0496126_0132632_1031_1660 209
1174 3300048929 Ga0496126_0134066 Ga0496126_0134066_1133_1762 209
1175 3300048929 Ga0496126_0216201 Ga0496126_0216201_938_1567 209
1176 3300048929 Ga0496126_0439538 Ga0496126_0439538_262_891 209
1177 3300048929 Ga0496126_0449882 Ga0496126_0449882_383_1012 209
1178 3300049570 Ga0501033_0247601 Ga0501033_0247601_189_818 209
1179 3300049581 Ga0501047_0132914 Ga0501047_0132914_707_1336 209
1180 3300049586 Ga0501070_0072795 Ga0501070_0072795_738_1367 209
1181 3300049590 Ga0501074_0113300 Ga0501074_0113300_189_818 209
1182 3300049663 Ga0501223_000031 Ga0501223_000031_42017_42649 209
1183 3300049668 Ga0501233_000027 Ga0501233_000027_14796_15425 209
1184 3300049705 Ga0501225_0006588 Ga0501225_0006588_639_1271 209
1185 3300049705 Ga0501225_0014677 Ga0501225_0014677_1248_1877 209
1186 3300049742 Ga0501080_0132729 Ga0501080_0132729_771_1400 209
1187 3300049823 Ga0501044_0056476 Ga0501044_0056476_1916_2545 209
1188 3300050490 nmdc:mga03n38_46090_c1 nmdc:mga03n38_46090_c1_1038_1667 209
1189 3300050492 nmdc:mga0yw44_171177_c1 nmdc:mga0yw44_171177_c1_138_767 209
1190 3300050492 nmdc:mga0yw44_239601_c1 nmdc:mga0yw44_239601_c1_552_1181 209
1191 3300050492 nmdc:mga0yw44_30835_c1 nmdc:mga0yw44_30835_c1_55_684 209
1192 3300050492 nmdc:mga0yw44_35076_c1 nmdc:mga0yw44_35076_c1_843_1472 209
1193 3300050492 nmdc:mga0yw44_46356_c1 nmdc:mga0yw44_46356_c1_1490_2119 209
1194 3300050493 nmdc:mga0k408_168650_c1 nmdc:mga0k408_168650_c1_601_1230 209
1195 3300050493 nmdc:mga0k408_4184_c1 nmdc:mga0k408_4184_c1_1767_2399 209
1196 3300050494 nmdc:mga06z11_108_c1 nmdc:mga06z11_108_c1_13176_13805 209
1197 3300050494 nmdc:mga06z11_162081_c1 nmdc:mga06z11_162081_c1_303_932 209
1198 3300050494 nmdc:mga06z11_18525_c1 nmdc:mga06z11_18525_c1_2506_3135 209
1199 3300050494 nmdc:mga06z11_318564_c1 nmdc:mga06z11_318564_c1_113_742 209
1200 3300050495 nmdc:mga04h51_11_c1 nmdc:mga04h51_11_c1_18079_18708 209
1201 3300050496 nmdc:mga07m45_118389_c1 nmdc:mga07m45_118389_c1_387_1016 209
1202 3300050496 nmdc:mga07m45_323868_c1 nmdc:mga07m45_323868_c1_107_736 209
1203 3300050496 nmdc:mga07m45_3791_c1 nmdc:mga07m45_3791_c1_3609_4238 209
1204 3300050496 nmdc:mga07m45_41409_c1 nmdc:mga07m45_41409_c1_1844_2473 209
1205 3300050512 nmdc:mga0n895_202296_c1 nmdc:mga0n895_202296_c1_264_893 209
1206 3300050512 nmdc:mga0n895_62695_c1 nmdc:mga0n895_62695_c1_1329_1958 209
1207 3300050514 nmdc:mga08x19_48563_c1 nmdc:mga08x19_48563_c1_862_1491 209
1208 3300050516 nmdc:mga0sz30_106040_c1 nmdc:mga0sz30_106040_c1_40_669 209
1209 3300050516 nmdc:mga0sz30_17191_c1 nmdc:mga0sz30_17191_c1_202_831 209
1210 3300053077 Ga0495601_0135539 Ga0495601_0135539_636_1265 209
1211 3300053077 Ga0495601_0144005 Ga0495601_0144005_202_834 209
1212 3300053078 Ga0495612_0015011 Ga0495612_0015011_59_691 209
1213 3300053079 Ga0500610_0030564 Ga0500610_0030564_1849_2478 209
1214 3300053080 Ga0500635_0000497 Ga0500635_0000497_1830_2459 209
1215 3300053080 Ga0500635_0002088 Ga0500635_0002088_1620_2249 209
1216 3300053080 Ga0500635_0052409 Ga0500635_0052409_306_935 209
1217 3300053083 Ga0495655_0057445 Ga0495655_0057445_144_773 209
1218 3300053084 Ga0495595_0128276 Ga0495595_0128276_557_1186 209
1219 3300053086 Ga0500578_0201782 Ga0500578_0201782_574_1203 209
1220 3300053086 Ga0500578_0292072 Ga0500578_0292072_98_727 209
1221 3300053087 Ga0500643_000007 Ga0500643_000007_450696_451325 209
1222 3300053087 Ga0500643_126723 Ga0500643_126723_34_663 209
1223 3300053091 Ga0500647_0004594 Ga0500647_0004594_425_1054 209
1224 3300053091 Ga0500647_0023075 Ga0500647_0023075_1039_1668 209
1225 3300053092 Ga0500583_0024081 Ga0500583_0024081_623_1252 209
1226 3300053093 Ga0500651_0054309 Ga0500651_0054309_84_713 209
1227 3300053093 Ga0500651_0097056 Ga0500651_0097056_496_1125 209
1228 3300053094 Ga0500566_0000011 Ga0500566_0000011_17689_18318 209
1229 3300053094 Ga0500566_0000613 Ga0500566_0000613_6178_6807 209
1230 3300053094 Ga0500566_0049910 Ga0500566_0049910_55_684 209
1231 3300053094 Ga0500566_0198287 Ga0500566_0198287_126_755 209
1232 3300053095 Ga0500640_002917 Ga0500640_002917_3712_4341 209
1233 3300053098 Ga0500650_0070352 Ga0500650_0070352_658_1287 209
1234 3300053103 Ga0500555_003600 Ga0500555_003600_922_1551 209
1235 3300053105 Ga0500557_000009 Ga0500557_000009_77431_78060 209
1236 3300053108 Ga0500562_009630 Ga0500562_009630_1193_1822 209
1237 3300053109 Ga0500569_009092 Ga0500569_009092_429_1058 209
1238 3300053111 Ga0500572_000119 Ga0500572_000119_19306_19935 209
1239 3300053118 Ga0500594_0005732 Ga0500594_0005732_1659_2288 209
1240 3300053119 Ga0500595_000111 Ga0500595_000111_15380_16009 209
1241 3300053119 Ga0500595_013847 Ga0500595_013847_690_1319 209
1242 3300053119 Ga0500595_037477 Ga0500595_037477_83_712 209
1243 3300053122 Ga0500608_000420 Ga0500608_000420_3614_4243 209
1244 3300053122 Ga0500608_001840 Ga0500608_001840_4028_4657 209
1245 3300053123 Ga0500614_000712 Ga0500614_000712_3367_3996 209
1246 3300053123 Ga0500614_022418 Ga0500614_022418_475_1104 209
1247 3300053125 Ga0500618_000755 Ga0500618_000755_4020_4649 209
1248 3300053126 Ga0500621_159539 Ga0500621_159539_144_773 209
1249 3300053128 Ga0500626_044699 Ga0500626_044699_387_1016 209
1250 3300053130 Ga0500642_0000154 Ga0500642_0000154_2831_3460 209
1251 3300053130 Ga0500642_0021161 Ga0500642_0021161_786_1415 209
1252 3300053133 Ga0500655_000008 Ga0500655_000008_38342_38971 209
1253 3300053133 Ga0500655_022379 Ga0500655_022379_103_732 209
1254 3300053134 Ga0500658_0049679 Ga0500658_0049679_273_902 209
1255 3300053134 Ga0500658_0230201 Ga0500658_0230201_156_785 209
1256 3300053136 Ga0500559_0000335 Ga0500559_0000335_24121_24750 209
1257 3300053136 Ga0500559_0000891 Ga0500559_0000891_6829_7458 209
1258 3300053136 Ga0500559_0003742 Ga0500559_0003742_3618_4247 209
1259 3300053136 Ga0500559_0036328 Ga0500559_0036328_1047_1676 209
1260 3300053136 Ga0500559_0082526 Ga0500559_0082526_690_1319 209
1261 3300053136 Ga0500559_0129670 Ga0500559_0129670_101_730 209
1262 3300053138 Ga0500564_004667 Ga0500564_004667_1658_2287 209
1263 3300053138 Ga0500564_093280 Ga0500564_093280_89_718 209
1264 3300053140 Ga0500573_0028168 Ga0500573_0028168_368_997 209
1265 3300053140 Ga0500573_0059303 Ga0500573_0059303_246_875 209
1266 3300053144 Ga0500585_099151 Ga0500585_099151_342_971 209
1267 3300053146 Ga0500588_0032258 Ga0500588_0032258_830_1459 209
1268 3300053148 Ga0500590_000889 Ga0500590_000889_9935_10564 209
1269 3300053148 Ga0500590_042265 Ga0500590_042265_851_1480 209
1270 3300053150 Ga0500603_000056 Ga0500603_000056_13486_14115 209
1271 3300053150 Ga0500603_000222 Ga0500603_000222_8293_8922 209
1272 3300053150 Ga0500603_021701 Ga0500603_021701_526_1155 209
1273 3300053151 Ga0500604_0009791 Ga0500604_0009791_207_836 209
1274 3300053155 Ga0500620_056124 Ga0500620_056124_177_806 209
1275 3300053157 Ga0500624_000021 Ga0500624_000021_82433_83062 209
1276 3300053159 Ga0500630_000088 Ga0500630_000088_9159_9788 209
1277 3300053159 Ga0500630_123730 Ga0500630_123730_326_955 209
1278 3300053162 Ga0500638_000096 Ga0500638_000096_6536_7165 209
1279 3300053162 Ga0500638_087189 Ga0500638_087189_522_1151 209
1280 3300053162 Ga0500638_135664 Ga0500638_135664_461_1090 209
1281 3300053163 Ga0500639_000009 Ga0500639_000009_21032_21661 209
1282 3300053163 Ga0500639_090584 Ga0500639_090584_206_835 209
1283 3300053177 Ga0500636_0000228 Ga0500636_0000228_15603_16232 209
1284 3300053177 Ga0500636_0106617 Ga0500636_0106617_135_764 209
1285 3300053177 Ga0500636_0233003 Ga0500636_0233003_55_684 209
1286 3300053178 Ga0500637_0000708 Ga0500637_0000708_1107_1736 209
1287 3300053178 Ga0500637_0001960 Ga0500637_0001960_606_1235 209
1288 3300053178 Ga0500637_0022686 Ga0500637_0022686_300_929 209
1289 3300053178 Ga0500637_0083980 Ga0500637_0083980_70_699 209
1290 3300053723 Ga0500567_004223 Ga0500567_004223_3828_4457 209
1291 3300053729 Ga0500625_000012 Ga0500625_000012_68286_68915 209
1292 3300053729 Ga0500625_000053 Ga0500625_000053_20354_20983 209
1293 3300053730 Ga0500645_011994 Ga0500645_011994_1460_2089 209
1294 3300053731 Ga0500609_003435 Ga0500609_003435_497_1126 209
1295 3300053735 Ga0500596_000288 Ga0500596_000288_8258_8887 209
1296 3300053735 Ga0500596_022511 Ga0500596_022511_133_762 209
1297 3300053736 Ga0500599_004512 Ga0500599_004512_334_963 209
1298 3300053737 Ga0500601_000488 Ga0500601_000488_1107_1736 209
1299 3300053737 Ga0500601_001930 Ga0500601_001930_22_651 209
1300 3300055283 Ga0500661_000582 Ga0500661_000582_4894_5523 209
1301 3300061719 Ga0466962_0122766 Ga0466962_0122766_477_1106 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02570

CbiC

Precorrin-8X methylmutase

42

238

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.9998 2 209
5n0g-assembly1.cif.gz_A-2 crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba 0.9982 2 209
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.995 2 209
5n0g-assembly1.cif.gz_A-2 crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba 0.9934 2 209
3e7d-assembly1.cif.gz_A crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis 0.9792 5 206
ID Description Score Start End Superfamily
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9815 5 207 3.40.50.10230
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9721 5 207 3.40.50.10230
2afvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9258 3 204 3.40.50.10230
1v9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9176 11 204 3.40.50.10230
af_Q58340_4_210_3.40.50.10230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.911 5 204 3.40.50.10230
ID Description Score Start End GO Terms
AF-A0A6L9G7R4-F1-model_v4 Precorrin-8X methylmutase (EC 5.4.99.61) 1.004 71 176 GO:0009236
GO:0016993
AF-A0A0C9M4D2-F1-model_v4 CobH protein 1.002 39 209 GO:0009236
GO:0016993
AF-A0A519QW32-F1-model_v4 Precorrin-8X methylmutase (EC 5.4.99.61) 1.002 71 209 GO:0009236
GO:0016993
AF-A0A2N8FP27-F1-model_v4 deleted 1.002 97 209
AF-A0A7Y5QQ20-F1-model_v4 Precorrin-8X methylmutase 1.001 123 203 GO:0009236
GO:0016993

Feature Viewer

pLDDT pTM Quality
96.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map