F492739

General Info

Members Datasets Scaffolds Average Seq Length
1300 647 1113 202

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100517447|Ga0068858_1005174472
Length 211
Sequence MTRRRQNMRRQIAIGVLFFVAAATEGSLAADPRYPDWPCVQAKVPEISLAAVWAGPPLDDIRDKWKDDVKVSALVSKLAARRTTLDEAQKQITEFFAAPATDKATAGKLLFAGLFDSFNAQRNSVMNGLERITRKQRDAADKIRSDVAALHALQSASPPDQPRIDELSNQMVWQTRIFEDRQRVVKFVCEVPTAIDQRLFALGRMIQQEME

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
22 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
23 2791355199
24 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
25 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
26 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
27 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
28 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
29 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
30 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
31 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
32 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
33 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
34 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
35 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
36 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
37 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
42 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
43 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
44 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
45 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
46 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
47 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
48 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
49 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
50 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
51 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
52 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
53 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
54 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
55 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
56 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
57 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
58 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
59 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
60 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
61 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
62 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
63 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
64 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
65 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
66 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
67 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
68 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
69 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
70 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
71 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
72 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
73 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
74 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
75 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
76 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
77 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
78 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
79 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
80 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
81 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
82 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
83 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
84 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
85 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
86 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
87 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
88 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
89 2922368715
90 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
91 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
92 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
93 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
94 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
95 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
96 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
97 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
98 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
99 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
100 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
101 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
102 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
103 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
104 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
105 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
106 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
107 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
108 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
109 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
110 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
111 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
112 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
113 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
114 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
115 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
116 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
117 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
118 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
119 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
120 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
121 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
122 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
123 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
124 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
125 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
126 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
127 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
128 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
129 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
130 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
131 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
132 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
133 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
134 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
135 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
136 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
137 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
138 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
139 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
140 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
141 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
142 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
143 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
144 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
145 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
146 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
147 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
148 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
149 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
150 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
151 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
152 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
153 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
154 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
155 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
156 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
157 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
158 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
159 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
160 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
161 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
162 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
163 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
164 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
165 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
166 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
167 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
168 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
169 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
170 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
171 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
172 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
173 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
179 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
180 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
181 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
182 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
183 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
184 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
185 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
186 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
187 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
188 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
189 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
192 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
195 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
196 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
197 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
198 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
199 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
200 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
201 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
202 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
203 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
204 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
205 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
206 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
207 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
208 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
209 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
210 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
211 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
212 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
213 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
214 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
215 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
216 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
217 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
218 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
219 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
220 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
221 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
222 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
223 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
224 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
225 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
226 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
227 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
228 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
229 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
230 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
231 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
232 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
233 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
234 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
235 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
236 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
237 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
238 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
239 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
240 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
241 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
242 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
243 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
244 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
245 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
246 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
247 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
248 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
249 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
250 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
251 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
252 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
253 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
254 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
255 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
256 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
257 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
258 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
259 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
260 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
261 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
262 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
263 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
264 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
265 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
266 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
267 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
268 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
269 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
270 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
271 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
272 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
273 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
274 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
275 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
276 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
277 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
278 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
279 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
280 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
281 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
283 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
352 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
353 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
354 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
355 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
356 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
360 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
361 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
362 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
363 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
364 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
365 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
366 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
367 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
368 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
369 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
370 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
371 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
372 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
373 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
374 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
375 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
376 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
377 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
378 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
379 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
380 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
381 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
382 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
383 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
384 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
385 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
386 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
387 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
388 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
389 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
390 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
391 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
392 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
393 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
394 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
395 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
396 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
397 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
398 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
399 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
400 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
401 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
402 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
403 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
404 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
405 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
406 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
407 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
408 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
409 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
410 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
411 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
412 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
413 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
414 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
415 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
416 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
417 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
418 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
419 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
420 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
421 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
422 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
423 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
424 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
425 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
426 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
427 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
428 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
429 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
430 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
431 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
432 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
433 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
434 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
435 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
436 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
437 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
438 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
439 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
440 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
441 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
442 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
443 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
444 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
445 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
446 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
447 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
448 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
449 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
450 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
451 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
452 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
453 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
454 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
455 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
456 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
457 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
458 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
459 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
460 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
461 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
462 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
463 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
464 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
465 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
466 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
467 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
468 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
469 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
470 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
471 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
472 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
473 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
474 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
475 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
476 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
477 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
478 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
479 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
480 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
481 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
482 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
483 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
484 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
485 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
486 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
487 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
488 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
489 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
490 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
491 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
492 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
493 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
494 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
495 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
496 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
497 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
498 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
499 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
500 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
501 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
502 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
503 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
504 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
505 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
506 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
507 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
508 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
509 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
510 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
511 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
512 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
513 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
514 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
515 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
516 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
517 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
518 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
519 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
520 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
521 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
522 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
523 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
524 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
525 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
526 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
527 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
528 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
529 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
530 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
531 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
532 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
533 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
534 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
535 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
537 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
538 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
539 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
540 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
541 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
542 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
543 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
544 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
545 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
546 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
547 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
548 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
549 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
550 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
551 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
552 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
553 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
554 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
555 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
556 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
557 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
558 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
559 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
560 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
561 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
562 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
563 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
564 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
565 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
566 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
567 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
568 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
569 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
570 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
571 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
572 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
573 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
574 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
575 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
576 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
577 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
578 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
579 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
580 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
581 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
582 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
583 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
584 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
585 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
586 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
587 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
588 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
589 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
590 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
591 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
592 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
593 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
594 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
595 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
596 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
597 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
598 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
599 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
600 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
601 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
602 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
603 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
604 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
605 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
606 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
607 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
608 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
609 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
610 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
611 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
612 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
613 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
614 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
615 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
616 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
617 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
618 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
619 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
620 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
621 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
622 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
623 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
624 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
625 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
626 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
627 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
628 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
629 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
630 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
631 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
632 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
633 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
634 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
635 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
636 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
637 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
638 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
639 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
640 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
641 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
642 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
643 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
644 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
645 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
646 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
647 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.75
Metatranscriptomes 0
Isolates 14.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 11.46
Rhizoplane 5.85
Rhizosphere 57.62
Stem 0
Stem Tuber 0
Unclassified 10.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10044129 3300001989 Bacteria 1470
2 JGI25153J46596_10001185 3300003215 Bacteria 15756
3 JGI25153J46596_10001639 3300003215 Bacteria 13286
4 JGI25153J46596_10002188 3300003215 Bacteria 11408
5 JGI25153J46596_10007639 3300003215 Bacteria 5276
6 rootH2_10052492 3300003320 Bacteria 1047
7 rootL2_10076998 3300003322 Bacteria 1494
8 rootH1_10143147 3300003323 Bacteria 2022
9 JGI25404J52841_10009341 3300003659 Bacteria 2096
10 Ga0055529_1015691 3300003763 Bacteria 955
11 Ga0055526_1008269 3300003771 Bacteria 5221
12 Ga0055531_10003312 3300003794 Bacteria 10311
13 Ga0055531_10020075 3300003794 Bacteria 2664
14 Ga0055543_1003135 3300004625 Bacteria 5058
15 Ga0055543_1044879 3300004625 Bacteria 737
16 Ga0065165_1001540 3300005262 Bacteria 24066
17 Ga0065165_1006854 3300005262 Bacteria 5797
18 Ga0065165_1066955 3300005262 Bacteria 965
19 Ga0070676_10530967 3300005328 Bacteria 840
20 Ga0070683_100708738 3300005329 Bacteria 964
21 Ga0070670_100357754 3300005331 Bacteria 1283
22 Ga0070670_100801505 3300005331 Bacteria 851
23 Ga0068869_100349779 3300005334 Bacteria 1204
24 Ga0068869_100413498 3300005334 Bacteria 1112
25 Ga0068869_100420179 3300005334 Bacteria 1103
26 Ga0068869_100485296 3300005334 Bacteria 1029
27 Ga0070666_10318802 3300005335 Bacteria 1109
28 Ga0070680_100500992 3300005336 Bacteria 1039
29 Ga0070682_100918069 3300005337 Bacteria 721
30 Ga0068868_100444520 3300005338 Bacteria 1127
31 Ga0068868_100493240 3300005338 Bacteria 1072
32 Ga0068868_100590642 3300005338 Bacteria 983
33 Ga0068868_100702883 3300005338 Bacteria 905
34 Ga0070660_100204312 3300005339 Bacteria 1603
35 Ga0070660_100309693 3300005339 Bacteria 1295
36 Ga0070661_100546520 3300005344 Bacteria 931
37 Ga0070668_100042472 3300005347 Bacteria 3485
38 Ga0070668_100051531 3300005347 Bacteria 3171
39 Ga0070668_100198229 3300005347 Bacteria 1647
40 Ga0070668_100227425 3300005347 Bacteria 1541
41 Ga0070668_100271741 3300005347 Bacteria 1413
42 Ga0070668_100359849 3300005347 Bacteria 1234
43 Ga0070669_100971348 3300005353 Bacteria 728
44 Ga0070675_100083596 3300005354 Bacteria 2665
45 Ga0070675_100928914 3300005354 Bacteria 798
46 Ga0070671_100938564 3300005355 Bacteria 757
47 Ga0070674_100049522 3300005356 Bacteria 2888
48 Ga0070674_100051355 3300005356 Bacteria 2841
49 Ga0070673_101210468 3300005364 Bacteria 708
50 Ga0070659_100322851 3300005366 Bacteria 1291
51 Ga0070667_100117359 3300005367 Bacteria 2312
52 Ga0070667_100465284 3300005367 Bacteria 1156
53 Ga0070709_10000728 3300005434 Bacteria 18607
54 Ga0070709_10019151 3300005434 Bacteria 3951
55 Ga0070714_100017734 3300005435 Bacteria 5772
56 Ga0070714_100025169 3300005435 Bacteria 4909
57 Ga0070713_100047868 3300005436 Bacteria 3517
58 Ga0070713_100209310 3300005436 Bacteria 1765
59 Ga0070713_100670055 3300005436 Bacteria 989
60 Ga0070710_10003264 3300005437 Bacteria 7687
61 Ga0070710_10004979 3300005437 Bacteria 6290
62 Ga0070710_10036756 3300005437 Bacteria 2679
63 Ga0070710_10069856 3300005437 Bacteria 2022
64 Ga0070701_10488863 3300005438 Bacteria 797
65 Ga0070711_100003505 3300005439 Bacteria 9150
66 Ga0070711_100004294 3300005439 Bacteria 8390
67 Ga0070711_100006316 3300005439 Bacteria 7134
68 Ga0070711_100014452 3300005439 Bacteria 4974
69 Ga0070711_100617833 3300005439 Bacteria 906
70 Ga0070700_100950722 3300005441 Bacteria 703
71 Ga0070694_100300998 3300005444 Bacteria 1229
72 Ga0070708_100191892 3300005445 Bacteria 1911
73 Ga0070663_100020188 3300005455 Bacteria 4407
74 Ga0070663_100035135 3300005455 Bacteria 3475
75 Ga0070663_100036246 3300005455 Bacteria 3426
76 Ga0070663_100237043 3300005455 Bacteria 1439
77 Ga0070663_100347737 3300005455 Bacteria 1200
78 Ga0070663_100363344 3300005455 Bacteria 1175
79 Ga0070663_100490335 3300005455 Bacteria 1019
80 Ga0070663_100667663 3300005455 Bacteria 881
81 Ga0070678_100036932 3300005456 Bacteria 3425
82 Ga0070678_100094201 3300005456 Bacteria 2305
83 Ga0070678_100154818 3300005456 Bacteria 1850
84 Ga0070678_100182553 3300005456 Bacteria 1719
85 Ga0070678_100184923 3300005456 Bacteria 1709
86 Ga0070678_100244536 3300005456 Bacteria 1502
87 Ga0070678_100693896 3300005456 Bacteria 917
88 Ga0070678_101027501 3300005456 Bacteria 758
89 Ga0070662_100097337 3300005457 Bacteria 2221
90 Ga0070662_100098881 3300005457 Bacteria 2204
91 Ga0070662_100357604 3300005457 Bacteria 1197
92 Ga0068867_100238838 3300005459 Bacteria 1472
93 Ga0070685_10143345 3300005466 Bacteria 1507
94 Ga0070706_100076633 3300005467 Bacteria 3095
95 Ga0070706_100207185 3300005467 Bacteria 1831
96 Ga0070698_100136085 3300005471 Bacteria 2410
97 Ga0070698_100270290 3300005471 Bacteria 1632
98 Ga0070684_100001738 3300005535 Bacteria 15844
99 Ga0070697_100723360 3300005536 Bacteria 879
100 Ga0068853_100300036 3300005539 Bacteria 1485
101 Ga0068853_100613701 3300005539 Bacteria 1033
102 Ga0068853_100720870 3300005539 Bacteria 952
103 Ga0068853_100951177 3300005539 Bacteria 826
104 Ga0070672_100024849 3300005543 Bacteria 4435
105 Ga0070672_100193609 3300005543 Bacteria 1698
106 Ga0070672_100535309 3300005543 Bacteria 1016
107 Ga0070695_100559414 3300005545 Bacteria 893
108 Ga0070693_100274441 3300005547 Bacteria 1127
109 Ga0070665_100080196 3300005548 Bacteria 3269
110 Ga0070665_100170226 3300005548 Bacteria 2179
111 Ga0070665_100240068 3300005548 Bacteria 1813
112 Ga0070665_100265853 3300005548 Bacteria 1717
113 Ga0070665_100267780 3300005548 Bacteria 1710
114 Ga0070665_100387818 3300005548 Bacteria 1404
115 Ga0070665_100448951 3300005548 Bacteria 1299
116 Ga0070704_100503100 3300005549 Bacteria 1052
117 Ga0068855_100059927 3300005563 Bacteria 4452
118 Ga0068855_100273509 3300005563 Bacteria 1878
119 Ga0068855_101399955 3300005563 Bacteria 721
120 Ga0070664_100179406 3300005564 Bacteria 1882
121 Ga0070664_101247610 3300005564 Bacteria 702
122 Ga0068857_100124881 3300005577 Bacteria 2318
123 Ga0068857_100591784 3300005577 Bacteria 1048
124 Ga0068857_100598980 3300005577 Bacteria 1042
125 Ga0068854_100196643 3300005578 Bacteria 1583
126 Ga0068856_100128623 3300005614 Bacteria 2536
127 Ga0068856_100232200 3300005614 Bacteria 1860
128 Ga0068856_100343683 3300005614 Bacteria 1510
129 Ga0070702_100423059 3300005615 Bacteria 959
130 Ga0070702_100471666 3300005615 Bacteria 915
131 Ga0068852_100030973 3300005616 Bacteria 4409
132 Ga0068852_100066218 3300005616 Bacteria 3154
133 Ga0068852_100149369 3300005616 Bacteria 2171
134 Ga0068852_100455965 3300005616 Bacteria 1266
135 Ga0068852_100568428 3300005616 Bacteria 1135
136 Ga0068859_100165345 3300005617 Bacteria 2292
137 Ga0068859_100359614 3300005617 Bacteria 1551
138 Ga0068859_100617806 3300005617 Bacteria 1176
139 Ga0068859_100900193 3300005617 Bacteria 969
140 Ga0068864_100708859 3300005618 Bacteria 984
141 Ga0068864_101001945 3300005618 Bacteria 829
142 Ga0068866_10022148 3300005718 Bacteria 2937
143 Ga0068866_10120433 3300005718 Bacteria 1478
144 Ga0068861_100090955 3300005719 Bacteria 2408
145 Ga0068870_10351658 3300005840 Bacteria 946
146 Ga0068858_100161066 3300005842 Bacteria 2113
147 Ga0068858_100382597 3300005842 Bacteria 1350
148 Ga0068858_100480790 3300005842 Bacteria 1199
149 Ga0068858_100517447 3300005842 Bacteria 1154
150 Ga0068858_100573269 3300005842 Bacteria 1093
151 Ga0068860_100147994 3300005843 Bacteria 2260
152 Ga0068860_100352959 3300005843 Bacteria 1447
153 Ga0068860_100641071 3300005843 Bacteria 1070
154 Ga0068862_100090055 3300005844 Bacteria 2670
155 Ga0068862_100549458 3300005844 Bacteria 1103
156 Ga0068862_101045071 3300005844 Bacteria 810
157 Ga0081455_10001049 3300005937 Bacteria 34795
158 Ga0081455_10001400 3300005937 Bacteria 29809
159 Ga0081455_10010625 3300005937 Bacteria 9316
160 Ga0081455_10032582 3300005937 Bacteria 4694
161 Ga0081455_10035291 3300005937 Bacteria 4472
162 Ga0081538_10008059 3300005981 Bacteria 9003
163 Ga0081540_1000308 3300005983 Bacteria 50401
164 Ga0081540_1002600 3300005983 Bacteria 14672
165 Ga0081540_1003068 3300005983 Bacteria 13381
166 Ga0081540_1003948 3300005983 Bacteria 11521
167 Ga0081540_1010255 3300005983 Bacteria 6362
168 Ga0081540_1015571 3300005983 Bacteria 4810
169 Ga0081540_1027416 3300005983 Bacteria 3228
170 Ga0081540_1040558 3300005983 Bacteria 2425
171 Ga0081540_1155196 3300005983 Bacteria 897
172 Ga0081539_10000152 3300005985 Bacteria 160005
173 Ga0081539_10015201 3300005985 Bacteria 5617
174 Ga0070717_10255715 3300006028 Bacteria 1548
175 Ga0075365_10001666 3300006038 Bacteria 10258
176 Ga0075365_10017560 3300006038 Bacteria 4380
177 Ga0075365_10026706 3300006038 Bacteria 3668
178 Ga0075365_10033095 3300006038 Bacteria 3328
179 Ga0075365_10043102 3300006038 Bacteria 2953
180 Ga0075365_10047865 3300006038 Bacteria 2812
181 Ga0075365_10060429 3300006038 Bacteria 2528
182 Ga0075365_10068618 3300006038 Bacteria 2382
183 Ga0075365_10757890 3300006038 Bacteria 685
184 Ga0075368_10059026 3300006042 Bacteria 1534
185 Ga0075368_10153030 3300006042 Bacteria 964
186 Ga0075363_100047857 3300006048 Bacteria 2272
187 Ga0075363_100076507 3300006048 Bacteria 1825
188 Ga0075363_100168184 3300006048 Bacteria 1244
189 Ga0075363_100192631 3300006048 Bacteria 1163
190 Ga0075363_100281369 3300006048 Bacteria 962
191 Ga0075364_10037231 3300006051 Bacteria 3149
192 Ga0075364_10098009 3300006051 Bacteria 1950
193 Ga0075364_10100576 3300006051 Bacteria 1925
194 Ga0075364_10132788 3300006051 Bacteria 1671
195 Ga0075364_10510726 3300006051 Bacteria 821
196 Ga0070715_10000375 3300006163 Bacteria 11180
197 Ga0070715_10074126 3300006163 Bacteria 1528
198 Ga0070715_10261202 3300006163 Bacteria 909
199 Ga0070716_100001019 3300006173 Bacteria 12248
200 Ga0070716_100088605 3300006173 Bacteria 1867
201 Ga0070716_100152627 3300006173 Bacteria 1488
202 Ga0070712_100012939 3300006175 Bacteria 5317
203 Ga0070712_100054091 3300006175 Bacteria 2805
204 Ga0070712_100148225 3300006175 Bacteria 1798
205 Ga0070712_100340482 3300006175 Bacteria 1224
206 Ga0075367_10059669 3300006178 Bacteria 2272
207 Ga0075367_10060296 3300006178 Bacteria 2262
208 Ga0075367_10062682 3300006178 Bacteria 2221
209 Ga0075367_10081927 3300006178 Bacteria 1953
210 Ga0075367_10233446 3300006178 Bacteria 1152
211 Ga0075369_10010020 3300006186 Bacteria 3701
212 Ga0075369_10052488 3300006186 Bacteria 1767
213 Ga0075369_10117186 3300006186 Bacteria 1204
214 Ga0075366_10006876 3300006195 Bacteria 6258
215 Ga0075366_10092584 3300006195 Bacteria 1811
216 Ga0097621_100169549 3300006237 Bacteria 1881
217 Ga0075370_10137176 3300006353 Bacteria 1429
218 Ga0075370_10168312 3300006353 Bacteria 1288
219 Ga0075370_10323059 3300006353 Bacteria 919
220 Ga0068871_100351962 3300006358 Bacteria 1303
221 Ga0068871_100480077 3300006358 Bacteria 1118
222 Ga0068871_101441619 3300006358 Bacteria 650
223 Ga0075428_101294431 3300006844 Bacteria 767
224 Ga0075434_100415364 3300006871 Bacteria 1366
225 Ga0075434_100454685 3300006871 Bacteria 1302
226 Ga0097620_100165357 3300006931 Bacteria 2292
227 Ga0097620_100359636 3300006931 Bacteria 1551
228 Ga0097620_100617831 3300006931 Bacteria 1176
229 Ga0097620_100900124 3300006931 Bacteria 969
230 Ga0099825_1013172 3300006941 Bacteria 8134
231 Ga0099824_1025158 3300006942 Bacteria 3317
232 Ga0099824_1053379 3300006942 Bacteria 717
233 Ga0099794_10108827 3300007265 Bacteria 1387
234 Ga0099794_10325812 3300007265 Bacteria 797
235 Ga0099795_10008270 3300007788 Bacteria 2958
236 Ga0099795_10008800 3300007788 Bacteria 2900
237 Ga0105250_10064366 3300009092 Bacteria 1477
238 Ga0105240_10010877 3300009093 Bacteria 12744
239 Ga0105240_10169998 3300009093 Bacteria 2583
240 Ga0105240_10180736 3300009093 Bacteria 2489
241 Ga0105240_10943384 3300009093 Bacteria 926
242 Ga0111539_10169924 3300009094 Bacteria 2548
243 Ga0111539_11195894 3300009094 Bacteria 883
244 Ga0105245_10129954 3300009098 Bacteria 2361
245 Ga0105245_10210908 3300009098 Bacteria 1869
246 Ga0105247_10049713 3300009101 Bacteria 2578
247 Ga0105247_10158611 3300009101 Bacteria 1496
248 Ga0105247_10283311 3300009101 Bacteria 1144
249 Ga0105243_10035452 3300009148 Bacteria 3868
250 Ga0105243_10141567 3300009148 Bacteria 2053
251 Ga0105243_10196652 3300009148 Bacteria 1765
252 Ga0105243_10220751 3300009148 Bacteria 1675
253 Ga0105243_10447262 3300009148 Bacteria 1211
254 Ga0105243_10953269 3300009148 Bacteria 857
255 Ga0105243_11119732 3300009148 Bacteria 796
256 Ga0105243_11309294 3300009148 Bacteria 742
257 Ga0105241_10054213 3300009174 Bacteria 3068
258 Ga0105241_10105000 3300009174 Bacteria 2252
259 Ga0105241_10388083 3300009174 Bacteria 1222
260 Ga0105241_10684884 3300009174 Bacteria 934
261 Ga0105242_10179193 3300009176 Bacteria 1868
262 Ga0105242_10346065 3300009176 Bacteria 1371
263 Ga0105242_10377892 3300009176 Bacteria 1316
264 Ga0105242_10441573 3300009176 Bacteria 1224
265 Ga0105242_11593318 3300009176 Bacteria 686
266 Ga0105248_10051239 3300009177 Bacteria 4632
267 Ga0105248_10068603 3300009177 Bacteria 3981
268 Ga0105248_10193501 3300009177 Bacteria 2292
269 Ga0105248_10273822 3300009177 Bacteria 1901
270 Ga0105248_10821740 3300009177 Bacteria 1049
271 Ga0105248_10852723 3300009177 Bacteria 1028
272 Ga0105248_10995342 3300009177 Bacteria 947
273 Ga0105248_11017521 3300009177 Bacteria 936
274 Ga0105237_10005066 3300009545 Bacteria 14969
275 Ga0105237_10014113 3300009545 Bacteria 8359
276 Ga0105237_10091868 3300009545 Bacteria 3025
277 Ga0105237_10147105 3300009545 Bacteria 2351
278 Ga0105237_10318227 3300009545 Bacteria 1559
279 Ga0105237_10481348 3300009545 Bacteria 1247
280 Ga0105237_11002228 3300009545 Bacteria 842
281 Ga0105238_10344279 3300009551 Bacteria 1479
282 Ga0105238_10484587 3300009551 Bacteria 1236
283 Ga0105238_11036819 3300009551 Bacteria 842
284 Ga0105249_10328458 3300009553 Bacteria 1543
285 Ga0105249_10337489 3300009553 Bacteria 1523
286 Ga0105249_10928879 3300009553 Bacteria 937
287 Ga0099796_10008663 3300010159 Bacteria 2719
288 Ga0105239_10096270 3300010375 Bacteria 3270
289 Ga0105239_10177229 3300010375 Bacteria 2384
290 Ga0105239_10195859 3300010375 Bacteria 2263
291 Ga0105239_10278904 3300010375 Bacteria 1881
292 Ga0105239_10381015 3300010375 Bacteria 1594
293 Ga0105239_10421118 3300010375 Bacteria 1513
294 Ga0105239_10561602 3300010375 Bacteria 1300
295 Ga0105239_10819024 3300010375 Bacteria 1067
296 Ga0105239_11033299 3300010375 Bacteria 945
297 Ga0105246_10032962 3300011119 Bacteria 3439
298 Ga0105246_10045259 3300011119 Bacteria 2996
299 Ga0105246_10292029 3300011119 Bacteria 1312
300 Ga0105246_11017143 3300011119 Bacteria 751
301 Ga0157373_10137455 3300013100 Bacteria 1718
302 Ga0157370_10497404 3300013104 Bacteria 1120
303 Ga0157378_10630520 3300013297 Bacteria 1086
304 Ga0163162_10031457 3300013306 Bacteria 5264
305 Ga0163162_10058069 3300013306 Bacteria 3897
306 Ga0163162_10073750 3300013306 Bacteria 3470
307 Ga0163162_10303432 3300013306 Bacteria 1729
308 Ga0163162_10529841 3300013306 Bacteria 1307
309 Ga0163162_10747890 3300013306 Bacteria 1097
310 Ga0163162_11271134 3300013306 Bacteria 836
311 Ga0163162_11433730 3300013306 Bacteria 786
312 Ga0157372_11058527 3300013307 Bacteria 939
313 Ga0157375_10088023 3300013308 Bacteria 3159
314 Ga0157375_10386304 3300013308 Bacteria 1567
315 Ga0157375_10477603 3300013308 Bacteria 1412
316 Ga0157375_11423878 3300013308 Bacteria 817
317 Ga0157375_11830323 3300013308 Bacteria 720
318 Ga0163163_10021432 3300014325 Bacteria 6100
319 Ga0163163_10099735 3300014325 Bacteria 2926
320 Ga0163163_10214291 3300014325 Bacteria 1975
321 Ga0163163_10260966 3300014325 Bacteria 1783
322 Ga0163163_10508442 3300014325 Bacteria 1267
323 Ga0157380_10227515 3300014326 Bacteria 1672
324 Ga0157380_10386195 3300014326 Bacteria 1323
325 Ga0157380_10611034 3300014326 Bacteria 1080
326 Ga0157377_10223472 3300014745 Bacteria 1207
327 Ga0157377_10229994 3300014745 Bacteria 1192
328 Ga0157379_10133485 3300014968 Bacteria 2236
329 Ga0157379_10221728 3300014968 Bacteria 1713
330 Ga0157379_10502654 3300014968 Bacteria 1124
331 Ga0157379_10779769 3300014968 Bacteria 901
332 Ga0157376_10117436 3300014969 Bacteria 2352
333 Ga0157376_10151042 3300014969 Bacteria 2095
334 Ga0157376_10187249 3300014969 Bacteria 1896
335 Ga0157376_11443728 3300014969 Bacteria 720
336 Ga0182007_10034887 3300015262 Bacteria 1697
337 Ga0163161_10051652 3300017792 Bacteria 2979
338 Ga0163161_10054139 3300017792 Bacteria 2911
339 Ga0163161_10516453 3300017792 Bacteria 975
340 Ga0214544_1000013 3300021320 Bacteria 228947
341 Ga0214542_1000013 3300021321 Bacteria 234019
342 Ga0214545_1000012 3300021324 Bacteria 187898
343 Ga0214543_1000065 3300021327 Bacteria 126516
344 Ga0213872_10020587 3300021361 Bacteria 3041
345 Ga0213872_10081290 3300021361 Bacteria 1456
346 Ga0213876_10005504 3300021384 Bacteria 6952
347 Ga0213876_10214021 3300021384 Bacteria 1025
348 Ga0207425_1014310 3300025245 Bacteria 1804
349 Ga0209148_1000319 3300025254 Bacteria 67129
350 Ga0209233_1009436 3300025261 Bacteria 2970
351 Ga0209233_1015774 3300025261 Bacteria 2094
352 Ga0209455_1003594 3300025272 Bacteria 5408
353 Ga0209564_1001380 3300025295 Bacteria 25330
354 Ga0209564_1003835 3300025295 Bacteria 9719
355 Ga0209564_1066793 3300025295 Bacteria 770
356 Ga0209758_1000026 3300025297 Bacteria 582706
357 Ga0209758_1000097 3300025297 Bacteria 230529
358 Ga0209758_1001430 3300025297 Bacteria 28210
359 Ga0209758_1002041 3300025297 Bacteria 21649
360 Ga0209758_1003765 3300025297 Bacteria 13401
361 Ga0209758_1026690 3300025297 Bacteria 2491
362 Ga0209758_1040682 3300025297 Bacteria 1750
363 Ga0207426_1000624 3300025302 Bacteria 44994
364 Ga0207426_1001451 3300025302 Bacteria 19603
365 Ga0207426_1007728 3300025302 Bacteria 4460
366 Ga0207426_1016481 3300025302 Bacteria 2652
367 Ga0209257_1000201 3300025304 Bacteria 147272
368 Ga0209257_1016006 3300025304 Bacteria 3065
369 Ga0209257_1038057 3300025304 Bacteria 1461
370 Ga0209257_1060449 3300025304 Bacteria 1031
371 Ga0207697_10049786 3300025315 Bacteria 1730
372 Ga0207653_10178900 3300025885 Bacteria 793
373 Ga0207682_10298062 3300025893 Bacteria 755
374 Ga0207692_10010166 3300025898 Bacteria 3957
375 Ga0207692_10140044 3300025898 Bacteria 1375
376 Ga0207692_10396121 3300025898 Bacteria 860
377 Ga0207642_10004478 3300025899 Bacteria 4510
378 Ga0207642_10324907 3300025899 Bacteria 900
379 Ga0207710_10086136 3300025900 Bacteria 1464
380 Ga0207710_10103285 3300025900 Bacteria 1347
381 Ga0207710_10180397 3300025900 Bacteria 1036
382 Ga0207710_10357368 3300025900 Bacteria 745
383 Ga0207688_10042362 3300025901 Bacteria 2535
384 Ga0207688_10053597 3300025901 Bacteria 2262
385 Ga0207688_10156463 3300025901 Bacteria 1349
386 Ga0207688_10221559 3300025901 Bacteria 1140
387 Ga0207688_10279757 3300025901 Bacteria 1016
388 Ga0207688_10327720 3300025901 Bacteria 940
389 Ga0207680_10523479 3300025903 Bacteria 845
390 Ga0207647_10026721 3300025904 Bacteria 3773
391 Ga0207647_10028852 3300025904 Bacteria 3599
392 Ga0207647_10062717 3300025904 Bacteria 2263
393 Ga0207685_10032838 3300025905 Unclassified 1871
394 Ga0207685_10071488 3300025905 Bacteria 1408
395 Ga0207699_10005178 3300025906 Bacteria 6237
396 Ga0207699_10015917 3300025906 Bacteria 3921
397 Ga0207645_10165423 3300025907 Bacteria 1448
398 Ga0207643_10434930 3300025908 Bacteria 833
399 Ga0207684_10248755 3300025910 Bacteria 1534
400 Ga0207654_10024645 3300025911 Bacteria 3237
401 Ga0207654_10026168 3300025911 Bacteria 3156
402 Ga0207654_10090418 3300025911 Bacteria 1865
403 Ga0207654_10262070 3300025911 Bacteria 1163
404 Ga0207654_10527217 3300025911 Bacteria 837
405 Ga0207695_10000240 3300025913 Bacteria 143196
406 Ga0207695_10105874 3300025913 Bacteria 2799
407 Ga0207695_10211943 3300025913 Bacteria 1847
408 Ga0207671_10002558 3300025914 Bacteria 19311
409 Ga0207671_10061143 3300025914 Bacteria 2795
410 Ga0207671_10088938 3300025914 Bacteria 2324
411 Ga0207671_10244480 3300025914 Bacteria 1410
412 Ga0207671_10254132 3300025914 Bacteria 1382
413 Ga0207693_10002089 3300025915 Bacteria 17466
414 Ga0207693_10019541 3300025915 Bacteria 5387
415 Ga0207693_10087181 3300025915 Bacteria 2446
416 Ga0207693_10193679 3300025915 Bacteria 1599
417 Ga0207663_10001142 3300025916 Bacteria 12236
418 Ga0207663_10016886 3300025916 Bacteria 4059
419 Ga0207660_10121892 3300025917 Bacteria 1975
420 Ga0207660_10210454 3300025917 Bacteria 1522
421 Ga0207657_10065566 3300025919 Bacteria 3095
422 Ga0207657_10066394 3300025919 Bacteria 3071
423 Ga0207657_10199560 3300025919 Bacteria 1610
424 Ga0207657_10222298 3300025919 Bacteria 1512
425 Ga0207649_10078370 3300025920 Bacteria 2132
426 Ga0207652_10287823 3300025921 Bacteria 1483
427 Ga0207652_10974864 3300025921 Bacteria 746
428 Ga0207646_10334697 3300025922 Bacteria 1368
429 Ga0207681_10087353 3300025923 Bacteria 2219
430 Ga0207694_10175678 3300025924 Bacteria 1735
431 Ga0207694_10197881 3300025924 Bacteria 1634
432 Ga0207650_10362762 3300025925 Bacteria 1194
433 Ga0207659_10792341 3300025926 Bacteria 814
434 Ga0207687_10152740 3300025927 Bacteria 1763
435 Ga0207687_10301737 3300025927 Bacteria 1290
436 Ga0207687_10632969 3300025927 Bacteria 904
437 Ga0207700_10006146 3300025928 Bacteria 7233
438 Ga0207700_10171192 3300025928 Bacteria 1812
439 Ga0207664_10018451 3300025929 Bacteria 5137
440 Ga0207664_10208746 3300025929 Bacteria 1689
441 Ga0207664_10288492 3300025929 Unclassified 1442
442 Ga0207644_10136629 3300025931 Bacteria 1883
443 Ga0207644_10188394 3300025931 Bacteria 1621
444 Ga0207690_10652755 3300025932 Bacteria 862
445 Ga0207706_10045771 3300025933 Bacteria 3876
446 Ga0207706_10072699 3300025933 Bacteria 3024
447 Ga0207706_10171426 3300025933 Bacteria 1907
448 Ga0207706_10293970 3300025933 Bacteria 1416
449 Ga0207686_10065047 3300025934 Bacteria 2324
450 Ga0207709_10022961 3300025935 Bacteria 3545
451 Ga0207709_10048263 3300025935 Bacteria 2593
452 Ga0207709_10362493 3300025935 Bacteria 1098
453 Ga0207670_10220005 3300025936 Bacteria 1453
454 Ga0207669_10016667 3300025937 Bacteria 3741
455 Ga0207669_10190403 3300025937 Bacteria 1479
456 Ga0207704_10016698 3300025938 Bacteria 3781
457 Ga0207665_10002085 3300025939 Bacteria 13500
458 Ga0207665_10163618 3300025939 Bacteria 1602
459 Ga0207691_10023461 3300025940 Bacteria 5808
460 Ga0207691_10127129 3300025940 Bacteria 2254
461 Ga0207691_10143517 3300025940 Bacteria 2103
462 Ga0207691_10400364 3300025940 Bacteria 1171
463 Ga0207691_11001979 3300025940 Bacteria 697
464 Ga0207711_10007853 3300025941 Bacteria 8919
465 Ga0207711_10033013 3300025941 Bacteria 4378
466 Ga0207711_10496353 3300025941 Bacteria 1137
467 Ga0207711_10601433 3300025941 Bacteria 1026
468 Ga0207711_10616291 3300025941 Bacteria 1013
469 Ga0207711_10793579 3300025941 Bacteria 882
470 Ga0207689_10014948 3300025942 Bacteria 6586
471 Ga0207689_10304524 3300025942 Bacteria 1321
472 Ga0207689_10382905 3300025942 Bacteria 1171
473 Ga0207689_10436540 3300025942 Bacteria 1093
474 Ga0207689_10579743 3300025942 Bacteria 943
475 Ga0207661_10024141 3300025944 Bacteria 4603
476 Ga0207679_10095198 3300025945 Bacteria 2314
477 Ga0207679_10133218 3300025945 Bacteria 1997
478 Ga0207679_10366036 3300025945 Bacteria 1260
479 Ga0207667_10204841 3300025949 Bacteria 2023
480 Ga0207712_10145797 3300025961 Bacteria 1822
481 Ga0207712_10283488 3300025961 Bacteria 1353
482 Ga0207668_10060228 3300025972 Bacteria 2663
483 Ga0207668_10084266 3300025972 Bacteria 2315
484 Ga0207668_10244942 3300025972 Bacteria 1452
485 Ga0207640_10153939 3300025981 Bacteria 1692
486 Ga0207658_10252466 3300025986 Bacteria 1499
487 Ga0207658_10768282 3300025986 Bacteria 873
488 Ga0207677_10015943 3300026023 Bacteria 4436
489 Ga0207677_10128928 3300026023 Bacteria 1917
490 Ga0207677_10584901 3300026023 Bacteria 978
491 Ga0207703_10204566 3300026035 Bacteria 1756
492 Ga0207703_10231370 3300026035 Bacteria 1657
493 Ga0207703_10838580 3300026035 Bacteria 879
494 Ga0207703_10860828 3300026035 Bacteria 867
495 Ga0207703_10898011 3300026035 Bacteria 848
496 Ga0207639_10071039 3300026041 Bacteria 2721
497 Ga0207639_10073390 3300026041 Bacteria 2682
498 Ga0207639_10213531 3300026041 Bacteria 1662
499 Ga0207639_10328161 3300026041 Bacteria 1361
500 Ga0207639_10388585 3300026041 Bacteria 1255
501 Ga0207639_10508870 3300026041 Bacteria 1101
502 Ga0207639_10680882 3300026041 Bacteria 953
503 Ga0207639_10816530 3300026041 Bacteria 869
504 Ga0207678_10003596 3300026067 Bacteria 13930
505 Ga0207678_10011597 3300026067 Bacteria 7743
506 Ga0207678_10026386 3300026067 Bacteria 5069
507 Ga0207678_10060081 3300026067 Bacteria 3270
508 Ga0207678_10071540 3300026067 Bacteria 2974
509 Ga0207678_10081677 3300026067 Bacteria 2767
510 Ga0207678_10108380 3300026067 Bacteria 2369
511 Ga0207678_10166050 3300026067 Bacteria 1885
512 Ga0207678_10437867 3300026067 Bacteria 1135
513 Ga0207678_10993879 3300026067 Bacteria 743
514 Ga0207708_10154498 3300026075 Bacteria 1809
515 Ga0207702_10184364 3300026078 Bacteria 1924
516 Ga0207702_10393911 3300026078 Bacteria 1334
517 Ga0207641_10188351 3300026088 Bacteria 1895
518 Ga0207641_10211920 3300026088 Bacteria 1792
519 Ga0207641_11299022 3300026088 Bacteria 728
520 Ga0207648_10018263 3300026089 Bacteria 6353
521 Ga0207648_10180743 3300026089 Bacteria 1867
522 Ga0207648_10391941 3300026089 Bacteria 1257
523 Ga0207648_11054145 3300026089 Bacteria 762
524 Ga0207676_10191710 3300026095 Bacteria 1799
525 Ga0207676_10660886 3300026095 Bacteria 1009
526 Ga0207674_10065697 3300026116 Bacteria 3656
527 Ga0207674_10480234 3300026116 Bacteria 1201
528 Ga0207675_100075495 3300026118 Bacteria 3155
529 Ga0207675_100077932 3300026118 Bacteria 3105
530 Ga0207675_100242260 3300026118 Bacteria 1743
531 Ga0207675_100242955 3300026118 Bacteria 1740
532 Ga0207675_100371406 3300026118 Bacteria 1405
533 Ga0207675_100669599 3300026118 Bacteria 1045
534 Ga0207675_100748478 3300026118 Bacteria 988
535 Ga0207683_10067391 3300026121 Bacteria 3158
536 Ga0207683_10068087 3300026121 Bacteria 3142
537 Ga0207683_10225450 3300026121 Bacteria 1708
538 Ga0207683_10229165 3300026121 Bacteria 1694
539 Ga0207683_10262334 3300026121 Bacteria 1577
540 Ga0207683_10358909 3300026121 Bacteria 1338
541 Ga0207683_10751510 3300026121 Bacteria 905
542 Ga0207698_10048144 3300026142 Bacteria 3235
543 Ga0207698_10056286 3300026142 Bacteria 3036
544 Ga0207698_10140596 3300026142 Bacteria 2079
545 Ga0207698_10542858 3300026142 Bacteria 1138
546 Ga0207698_10728485 3300026142 Bacteria 989
547 Ga0209389_1000060 3300027296 Bacteria 106050
548 Ga0209389_1000188 3300027296 Bacteria 46884
549 Ga0209589_1000062 3300027357 Bacteria 106048
550 Ga0209489_101714 3300027361 Bacteria 45077
551 Ga0209489_113907 3300027361 Bacteria 6096
552 Ga0209700_100437 3300027363 Bacteria 76868
553 Ga0207428_10250158 3300027907 Bacteria 1322
554 Ga0268266_10004379 3300028379 Bacteria 13548
555 Ga0268266_10038047 3300028379 Bacteria 4097
556 Ga0268266_10048162 3300028379 Bacteria 3652
557 Ga0268266_10157317 3300028379 Bacteria 2054
558 Ga0268266_10300642 3300028379 Bacteria 1497
559 Ga0268266_10537726 3300028379 Bacteria 1118
560 Ga0268265_10210923 3300028380 Bacteria 1692
561 Ga0268265_10392349 3300028380 Bacteria 1280
562 Ga0268265_10827395 3300028380 Bacteria 904
563 Ga0268264_10000020 3300028381 Bacteria 483593
564 Ga0268264_10052221 3300028381 Bacteria 3408
565 Ga0268264_10146324 3300028381 Bacteria 2113
566 Ga0268264_10164971 3300028381 Bacteria 1999
567 Ga0265326_10002308 3300028558 Bacteria 6446
568 Ga0265319_1016741 3300028563 Bacteria 2806
569 Ga0265334_10001077 3300028573 Bacteria 13349
570 Ga0265323_10001752 3300028653 Bacteria 10296
571 Ga0265322_10004954 3300028654 Bacteria 3950
572 Ga0265336_10001643 3300028666 Bacteria 9912
573 Ga0307515_10042340 3300028794 Bacteria 7127
574 Ga0307515_10109512 3300028794 Bacteria 3243
575 Ga0307515_10411918 3300028794 Bacteria 974
576 Ga0307515_10503777 3300028794 Bacteria 821
577 Ga0265338_10000013 3300028800 Bacteria 379065
578 Ga0265324_10005453 3300029957 Bacteria 5494
579 Ga0265320_10063898 3300031240 Bacteria 1750
580 Ga0265340_10035185 3300031247 Bacteria 2488
581 Ga0265340_10118474 3300031247 Bacteria 1219
582 Ga0265339_10007191 3300031249 Bacteria 7215
583 Ga0265339_10008906 3300031249 Bacteria 6353
584 Ga0265339_10185500 3300031249 Bacteria 1034
585 Ga0307513_10161197 3300031456 Bacteria 2136
586 Ga0307509_10076466 3300031507 Bacteria 3474
587 Ga0307509_10479408 3300031507 Bacteria 932
588 Ga0307508_10016258 3300031616 Bacteria 6773
589 Ga0307508_10067251 3300031616 Bacteria 3152
590 Ga0265314_10034725 3300031711 Bacteria 3681
591 Ga0265342_10048846 3300031712 Bacteria 2534
592 Ga0307516_10273434 3300031730 Bacteria 1374
593 Ga0307516_10374215 3300031730 Bacteria 1087
594 Ga0307405_10164710 3300031731 Bacteria 1575
595 Ga0307405_10253375 3300031731 Bacteria 1311
596 Ga0307410_10095307 3300031852 Bacteria 2122
597 Ga0307406_10289470 3300031901 Bacteria 1253
598 Ga0307412_10156006 3300031911 Bacteria 1690
599 Ga0307412_10411398 3300031911 Bacteria 1104
600 Ga0307412_10429205 3300031911 Bacteria 1083
601 Ga0307412_10733133 3300031911 Bacteria 851
602 Ga0307412_10816596 3300031911 Bacteria 811
603 Ga0307416_100176674 3300032002 Bacteria 1996
604 Ga0307414_10579144 3300032004 Bacteria 1004
605 Ga0307411_10159601 3300032005 Bacteria 1687
606 Ga0307415_100393108 3300032126 Bacteria 1181
607 Ga0307510_10003003 3300033180 Bacteria 19416
608 Ga0307510_10019538 3300033180 Bacteria 7944
609 Ga0373934_0010877 3300035086 Bacteria 3421
610 Ga0373936_0010587 3300035113 Bacteria 3481
611 Ga0373954_0186590 3300035118 Bacteria 1017
612 Ga0373956_0198206 3300035119 Bacteria 951
613 Ga0373946_0183440 3300035171 Bacteria 994
614 Ga0373931_0108054 3300035691 Bacteria 1574
615 Ga0373935_0547281 3300035692 Bacteria 843
616 Ga0373927_0046821 3300035695 Bacteria 2797
617 Ga0373927_0184348 3300035695 Bacteria 1369
618 Ga0373933_0010551 3300035724 Bacteria 5065
619 Ga0373947_0008141 3300035725 Bacteria 6045
620 Ga0373947_0207416 3300035725 Bacteria 1284
621 Ga0373947_0602183 3300035725 Bacteria 749
622 Ga0373937_0795344 3300036401 Bacteria 893
623 Ga0373925_0320138 3300037068 Bacteria 1255
624 Ga0373925_0768826 3300037068 Bacteria 794
625 Ga0395900_0002185 3300037418 Bacteria 21860
626 Ga0395900_0052611 3300037418 Bacteria 4192
627 Ga0395898_0003639 3300037466 Bacteria 17131
628 Ga0395905_0013071 3300037471 Bacteria 7971
629 Ga0395905_0262755 3300037471 Bacteria 1611
630 Ga0395905_0552294 3300037471 Bacteria 1053
631 Ga0436364_0792686 3300037853 Bacteria 1066
632 Ga0395901_0004684 3300038443 Bacteria 13792
633 Ga0395901_0381792 3300038443 Bacteria 1450
634 Ga0395901_0950641 3300038443 Bacteria 838
635 Ga0436365_0163573 3300039437 Bacteria 1281
636 Ga0436365_0797309 3300039437 Bacteria 23338
637 Ga0436360_0139800 3300039438 Bacteria 4468
638 Ga0436360_0486890 3300039438 Bacteria 1855
639 Ga0436360_0751927 3300039438 Bacteria 909
640 Ga0436361_0911132 3300039447 Bacteria 752
641 Ga0436361_1122186 3300039447 Bacteria 2287
642 Ga0436363_0405860 3300039450 Bacteria 4329
643 Ga0436363_0657400 3300039450 Bacteria 1384
644 Ga0436363_1578383 3300039450 Bacteria 1091
645 Ga0436362_1242730 3300039453 Bacteria 6064
646 Ga0451787_023315 3300041441 Bacteria 988
647 Ga0451791_1294712 3300041451 Bacteria 937
648 Ga0451793_0382415 3300041452 Bacteria 698
649 Ga0451793_0590245 3300041452 Bacteria 690
650 Ga0451795_1237397 3300041456 Bacteria 1261
651 Ga0451802_0169445 3300041460 Bacteria 955
652 Ga0451802_2093298 3300041460 Bacteria 1373
653 Ga0451837_1100542 3300041494 Bacteria 941
654 Ga0451849_0759887 3300041505 Bacteria 1180
655 Ga0466972_0000576 3300044658 Bacteria 17815
656 Ga0466965_0077683 3300044683 Bacteria 1676
657 Ga0466966_0082784 3300044684 Bacteria 1997
658 Ga0466961_0190585 3300044693 Bacteria 1271
659 Ga0466963_0320087 3300044694 Bacteria 1091
660 Ga0466971_0045755 3300044719 Bacteria 1966
661 Ga0466968_0000783 3300044735 Bacteria 11080
662 Ga0466968_0192678 3300044735 Bacteria 952
663 Ga0466960_0111278 3300044901 Bacteria 1423
664 Ga0466959_0068194 3300045049 Bacteria 2578
665 Ga0466958_0521981 3300045836 Bacteria 771
666 Ga0466967_0052907 3300045976 Bacteria 3567
667 Ga0466967_0254910 3300045976 Bacteria 1677
668 Ga0466967_0308948 3300045976 Bacteria 1523
669 Ga0495627_074872 3300046453 Bacteria 986
670 Ga0495592_0077291 3300046454 Bacteria 2413
671 Ga0495603_0003185 3300046455 Bacteria 9760
672 Ga0495603_0059812 3300046455 Bacteria 2252
673 Ga0495603_0089386 3300046455 Bacteria 1802
674 Ga0495603_0118704 3300046455 Bacteria 1542
675 Ga0495603_0471309 3300046455 Bacteria 719
676 Ga0495590_0056244 3300046457 Bacteria 1375
677 Ga0495590_0090769 3300046457 Bacteria 1080
678 Ga0495590_0153420 3300046457 Bacteria 835
679 Ga0495629_0015079 3300046459 Bacteria 5555
680 Ga0495638_0002654 3300046460 Bacteria 14392
681 Ga0495638_0020245 3300046460 Bacteria 4395
682 Ga0495638_0027347 3300046460 Bacteria 3692
683 Ga0495638_0035036 3300046460 Bacteria 3200
684 Ga0495638_0112339 3300046460 Bacteria 1617
685 Ga0495651_0109977 3300046462 Bacteria 2039
686 Ga0495653_0057045 3300046463 Bacteria 2975
687 Ga0495650_0078522 3300046471 Bacteria 1278
688 Ga0495580_0210427 3300046472 Bacteria 1338
689 Ga0495582_0089972 3300046473 Bacteria 1711
690 Ga0495605_0069723 3300046474 Bacteria 1664
691 Ga0495605_0197195 3300046474 Bacteria 879
692 Ga0495662_0045488 3300046476 Bacteria 2119
693 Ga0495664_0006969 3300046477 Bacteria 6261
694 Ga0495664_0028061 3300046477 Bacteria 3286
695 Ga0495664_0394036 3300046477 Bacteria 832
696 Ga0495584_0063644 3300046491 Bacteria 1854
697 Ga0495584_0083426 3300046491 Bacteria 1609
698 Ga0495584_0304150 3300046491 Bacteria 810
699 Ga0495585_0134418 3300046492 Bacteria 1299
700 Ga0495585_0187554 3300046492 Bacteria 1060
701 Ga0495596_0234604 3300046500 Bacteria 712
702 Ga0495607_0012642 3300046501 Bacteria 5562
703 Ga0495583_0177598 3300046506 Bacteria 873
704 Ga0495583_0194374 3300046506 Bacteria 826
705 Ga0495606_0000939 3300046507 Bacteria 42966
706 Ga0495606_0033500 3300046507 Bacteria 3542
707 Ga0495606_0065635 3300046507 Bacteria 2305
708 Ga0495606_0166732 3300046507 Bacteria 1281
709 Ga0495606_0198245 3300046507 Bacteria 1146
710 Ga0495606_0264667 3300046507 Bacteria 947
711 Ga0495608_0014306 3300046511 Bacteria 5505
712 Ga0495608_0043609 3300046511 Bacteria 2997
713 Ga0495610_0078178 3300046512 Bacteria 1526
714 Ga0495610_0142738 3300046512 Bacteria 1029
715 Ga0495616_0069582 3300046513 Bacteria 1706
716 Ga0495616_0226383 3300046513 Bacteria 812
717 Ga0495618_0025347 3300046514 Bacteria 3680
718 Ga0495618_0160656 3300046514 Bacteria 1432
719 Ga0495620_0039967 3300046515 Bacteria 2069
720 Ga0495620_0047059 3300046515 Bacteria 1859
721 Ga0495628_0032399 3300046516 Bacteria 4219
722 Ga0495630_0349398 3300046517 Bacteria 1132
723 Ga0495631_0025915 3300046518 Bacteria 2696
724 Ga0495631_0311307 3300046518 Bacteria 670
725 Ga0495632_0070725 3300046519 Bacteria 1678
726 Ga0495632_0220480 3300046519 Bacteria 858
727 Ga0495632_0229103 3300046519 Bacteria 838
728 Ga0495632_0345254 3300046519 Bacteria 655
729 Ga0495637_0053267 3300046520 Bacteria 1685
730 Ga0495637_0212186 3300046520 Bacteria 708
731 Ga0495643_0024202 3300046522 Bacteria 3446
732 Ga0495648_0009119 3300046524 Bacteria 7737
733 Ga0495648_0071020 3300046524 Bacteria 2020
734 Ga0495648_0088775 3300046524 Bacteria 1737
735 Ga0495648_0130145 3300046524 Bacteria 1339
736 Ga0495648_0153359 3300046524 Bacteria 1199
737 Ga0495648_0300011 3300046524 Bacteria 753
738 Ga0495666_0073555 3300046526 Bacteria 1622
739 Ga0495652_0057963 3300046529 Bacteria 3282
740 Ga0495654_0103628 3300046530 Bacteria 1306
741 Ga0495665_0334218 3300046531 Bacteria 773
742 Ga0495640_0016226 3300046533 Bacteria 5576
743 Ga0495586_0008566 3300046535 Bacteria 5445
744 Ga0495587_0058859 3300046536 Bacteria 2256
745 Ga0495587_0115650 3300046536 Bacteria 1539
746 Ga0495598_0020585 3300046537 Bacteria 1744
747 Ga0495609_0097647 3300046538 Bacteria 1274
748 Ga0495609_0215207 3300046538 Bacteria 799
749 Ga0495597_0034811 3300046542 Bacteria 2275
750 Ga0495597_0121964 3300046542 Bacteria 1086
751 Ga0495645_0173379 3300046543 Bacteria 1483
752 Ga0495622_0023849 3300046557 Bacteria 2854
753 Ga0495622_0068065 3300046557 Bacteria 1645
754 Ga0495622_0090186 3300046557 Bacteria 1408
755 Ga0495622_0250859 3300046557 Bacteria 778
756 Ga0495667_0058053 3300046559 Bacteria 2542
757 Ga0495667_0199124 3300046559 Bacteria 1282
758 Ga0495667_0258068 3300046559 Bacteria 1109
759 Ga0495656_0126171 3300046615 Bacteria 1213
760 Ga0495656_0149067 3300046615 Bacteria 1128
761 Ga0495668_0036492 3300046616 Bacteria 2754
762 Ga0495668_0044643 3300046616 Bacteria 2463
763 Ga0495668_0085577 3300046616 Bacteria 1729
764 Ga0495668_0146911 3300046616 Bacteria 1291
765 Ga0495668_0158442 3300046616 Bacteria 1240
766 Ga0495668_0179540 3300046616 Bacteria 1160
767 Ga0495668_0355124 3300046616 Bacteria 804
768 Ga0495634_0067697 3300046642 Bacteria 2361
769 Ga0495611_0043538 3300046648 Bacteria 2007
770 Ga0495611_0053168 3300046648 Bacteria 1828
771 Ga0495611_0065363 3300046648 Bacteria 1657
772 Ga0495611_0190612 3300046648 Bacteria 957
773 Ga0495625_0110808 3300046660 Bacteria 1876
774 Ga0495625_0366273 3300046660 Bacteria 907
775 Ga0495625_0496367 3300046660 Bacteria 747
776 Ga0495659_0026904 3300046664 Bacteria 1980
777 Ga0495659_0054086 3300046664 Bacteria 1468
778 Ga0495659_0116327 3300046664 Bacteria 1049
779 Ga0495661_0008267 3300046665 Bacteria 7208
780 Ga0495588_0002645 3300046674 Bacteria 7675
781 Ga0495588_0024706 3300046674 Bacteria 2987
782 Ga0495588_0080765 3300046674 Bacteria 1697
783 Ga0495599_0046840 3300046678 Bacteria 2711
784 Ga0495599_0299733 3300046678 Bacteria 970
785 Ga0495623_0012115 3300046679 Bacteria 5584
786 Ga0495623_0431547 3300046679 Bacteria 704
787 Ga0495646_0155129 3300046680 Bacteria 1271
788 Ga0495647_0089378 3300046681 Bacteria 1261
789 Ga0495669_0014374 3300046684 Bacteria 3384
790 Ga0495669_0268495 3300046684 Bacteria 820
791 Ga0495613_0445759 3300046689 Bacteria 877
792 Ga0495670_0010493 3300046691 Bacteria 4551
793 Ga0495670_0049592 3300046691 Bacteria 2101
794 Ga0495671_0191721 3300046692 Bacteria 992
795 Ga0495649_0009963 3300046694 Bacteria 5619
796 Ga0495649_0170781 3300046694 Bacteria 1138
797 Ga0495649_0203195 3300046694 Bacteria 1028
798 Ga0495649_0301197 3300046694 Bacteria 816
799 Ga0495589_0129418 3300046794 Bacteria 1213
800 Ga0495600_0080341 3300046809 Bacteria 2128
801 Ga0495600_0224365 3300046809 Bacteria 1201
802 Ga0495581_0019778 3300047315 Bacteria 3910
803 Ga0495581_0095380 3300047315 Bacteria 1727
804 Ga0495604_0030597 3300047317 Bacteria 4274
805 Ga0495604_0064554 3300047317 Bacteria 2789
806 Ga0495636_0080871 3300047318 Bacteria 1399
807 Ga0495636_0120228 3300047318 Bacteria 1161
808 Ga0495674_0159826 3300047319 Bacteria 1885
809 Ga0495674_0335194 3300047319 Bacteria 1230
810 Ga0495674_0494710 3300047319 Bacteria 979
811 Ga0495674_0542316 3300047319 Bacteria 927
812 Ga0495672_0024971 3300047320 Bacteria 3837
813 Ga0495672_0033009 3300047320 Bacteria 3211
814 Ga0495672_0097317 3300047320 Bacteria 1603
815 Ga0495672_0100321 3300047320 Bacteria 1571
816 Ga0495672_0101470 3300047320 Bacteria 1559
817 Ga0495676_0010380 3300047321 Bacteria 8447
818 Ga0495676_0032329 3300047321 Bacteria 4418
819 Ga0495676_0132650 3300047321 Bacteria 1796
820 Ga0495676_0406389 3300047321 Bacteria 903
821 Ga0495680_0061366 3300047322 Bacteria 2892
822 Ga0495680_0549030 3300047322 Bacteria 779
823 Ga0495683_0173291 3300047323 Bacteria 990
824 Ga0495683_0213960 3300047323 Bacteria 863
825 Ga0495683_0232004 3300047323 Bacteria 818
826 Ga0495687_015682 3300047443 Bacteria 3843
827 Ga0495675_0030160 3300047444 Bacteria 3460
828 Ga0495673_0023822 3300047469 Bacteria 2969
829 Ga0495673_0168055 3300047469 Bacteria 837
830 Ga0495673_0169683 3300047469 Bacteria 832
831 Ga0495684_0050876 3300047471 Bacteria 3162
832 Ga0495686_0110629 3300047472 Bacteria 1647
833 Ga0495686_0207529 3300047472 Bacteria 1121
834 Ga0495593_0057446 3300047673 Bacteria 2043
835 Ga0495593_0108302 3300047673 Bacteria 1420
836 Ga0495593_0126027 3300047673 Bacteria 1302
837 Ga0495593_0546940 3300047673 Bacteria 581
838 Ga0495602_0110863 3300048088 Bacteria 2229
839 Ga0495614_0019409 3300048089 Bacteria 2941
840 Ga0495615_0077647 3300048090 Bacteria 906
841 Ga0496100_0016050 3300048903 Bacteria 4388
842 Ga0496100_0031098 3300048903 Bacteria 3316
843 Ga0496100_0088474 3300048903 Bacteria 2108
844 Ga0496100_0158568 3300048903 Bacteria 1620
845 Ga0496100_0820187 3300048903 Bacteria 729
846 Ga0496101_0019064 3300048904 Bacteria 4675
847 Ga0496101_0066306 3300048904 Bacteria 2633
848 Ga0496101_0097067 3300048904 Bacteria 2200
849 Ga0496101_0322655 3300048904 Bacteria 1212
850 Ga0496101_0378797 3300048904 Bacteria 1113
851 Ga0496102_0001018 3300048905 Bacteria 26153
852 Ga0496102_0022346 3300048905 Bacteria 5605
853 Ga0496102_0040983 3300048905 Bacteria 4191
854 Ga0496102_0642655 3300048905 Bacteria 984
855 Ga0496103_0003354 3300048906 Bacteria 9793
856 Ga0496103_0221293 3300048906 Bacteria 1217
857 Ga0496103_0302638 3300048906 Bacteria 1029
858 Ga0496104_0009238 3300048907 Bacteria 8766
859 Ga0496104_0161080 3300048907 Bacteria 2152
860 Ga0496104_0280093 3300048907 Bacteria 1580
861 Ga0496104_0285405 3300048907 Bacteria 1563
862 Ga0496105_0000450 3300048908 Bacteria 27125
863 Ga0496105_0101072 3300048908 Bacteria 2381
864 Ga0496105_0250713 3300048908 Bacteria 1434
865 Ga0496105_0317445 3300048908 Bacteria 1249
866 Ga0496106_0075961 3300048909 Bacteria 2574
867 Ga0496106_0396550 3300048909 Bacteria 1109
868 Ga0496106_0616578 3300048909 Bacteria 868
869 Ga0496106_0650231 3300048909 Bacteria 842
870 Ga0496107_0006468 3300048910 Bacteria 8056
871 Ga0496107_0079830 3300048910 Bacteria 2385
872 Ga0496107_0089030 3300048910 Bacteria 2254
873 Ga0496107_0145873 3300048910 Bacteria 1750
874 Ga0496107_0322267 3300048910 Bacteria 1150
875 Ga0496108_0007359 3300048911 Bacteria 8924
876 Ga0496108_0018966 3300048911 Bacteria 5641
877 Ga0496108_0115464 3300048911 Bacteria 2299
878 Ga0496108_0381211 3300048911 Bacteria 1231
879 Ga0496108_0775829 3300048911 Bacteria 828
880 Ga0496109_0036795 3300048912 Bacteria 4419
881 Ga0496109_0301361 3300048912 Bacteria 1511
882 Ga0496109_0385414 3300048912 Bacteria 1324
883 Ga0496110_0105535 3300048913 Bacteria 2528
884 Ga0496110_0201138 3300048913 Bacteria 1810
885 Ga0496110_0423716 3300048913 Bacteria 1213
886 Ga0496110_0425537 3300048913 Bacteria 1210
887 Ga0496110_0564918 3300048913 Bacteria 1033
888 Ga0496111_0170950 3300048914 Bacteria 1615
889 Ga0496111_0252927 3300048914 Bacteria 1307
890 Ga0496111_0465846 3300048914 Bacteria 932
891 Ga0496112_0000960 3300048915 Bacteria 20955
892 Ga0496112_0005812 3300048915 Bacteria 10735
893 Ga0496112_0162791 3300048915 Bacteria 2197
894 Ga0496112_0173260 3300048915 Bacteria 2123
895 Ga0496112_0337556 3300048915 Bacteria 1450
896 Ga0496112_0436146 3300048915 Bacteria 1248
897 Ga0496113_0043948 3300048916 Bacteria 3308
898 Ga0496113_0079772 3300048916 Bacteria 2506
899 Ga0496113_0427112 3300048916 Bacteria 1064
900 Ga0496114_0017392 3300048917 Bacteria 5803
901 Ga0496114_0052838 3300048917 Bacteria 3386
902 Ga0496114_0258084 3300048917 Bacteria 1534
903 Ga0496114_0466718 3300048917 Bacteria 1117
904 Ga0496114_1299885 3300048917 Bacteria 614
905 Ga0496115_0005943 3300048918 Bacteria 8910
906 Ga0496115_0209409 3300048918 Bacteria 1610
907 Ga0496115_0341316 3300048918 Bacteria 1222
908 Ga0496115_0612307 3300048918 Bacteria 865
909 Ga0496116_0001982 3300048919 Bacteria 22049
910 Ga0496116_0023198 3300048919 Bacteria 4627
911 Ga0496116_0262808 3300048919 Bacteria 850
912 Ga0496117_0057178 3300048920 Bacteria 2711
913 Ga0496117_0256798 3300048920 Bacteria 950
914 Ga0496117_0270374 3300048920 Bacteria 916
915 Ga0496117_0382086 3300048920 Bacteria 717
916 Ga0496118_0018781 3300048921 Bacteria 6211
917 Ga0496118_0043749 3300048921 Bacteria 3515
918 Ga0496118_0054475 3300048921 Bacteria 3029
919 Ga0496118_0064256 3300048921 Bacteria 2694
920 Ga0496118_0087936 3300048921 Bacteria 2152
921 Ga0496118_0175201 3300048921 Bacteria 1304
922 Ga0496118_0269744 3300048921 Bacteria 954
923 Ga0496118_0270611 3300048921 Bacteria 952
924 Ga0496118_0344600 3300048921 Bacteria 797
925 Ga0496119_0002327 3300048922 Bacteria 20938
926 Ga0496119_0150672 3300048922 Bacteria 1247
927 Ga0496120_0017844 3300048923 Bacteria 4586
928 Ga0496120_0062469 3300048923 Bacteria 2075
929 Ga0496120_0106858 3300048923 Bacteria 1469
930 Ga0496120_0142555 3300048923 Bacteria 1215
931 Ga0496121_0000428 3300048924 Bacteria 82718
932 Ga0496121_0009489 3300048924 Bacteria 11170
933 Ga0496121_0054851 3300048924 Bacteria 3326
934 Ga0496121_0058539 3300048924 Bacteria 3184
935 Ga0496121_0120053 3300048924 Bacteria 1987
936 Ga0496121_0192356 3300048924 Bacteria 1462
937 Ga0496121_0237371 3300048924 Bacteria 1273
938 Ga0496121_0253724 3300048924 Bacteria 1218
939 Ga0496121_0366020 3300048924 Bacteria 955
940 Ga0496121_0512247 3300048924 Bacteria 759
941 Ga0496122_0029420 3300048925 Bacteria 4634
942 Ga0496122_0259352 3300048925 Bacteria 966
943 Ga0496123_0024856 3300048926 Bacteria 4535
944 Ga0496124_0063549 3300048927 Bacteria 3083
945 Ga0496124_0156728 3300048927 Bacteria 1780
946 Ga0496124_0200737 3300048927 Bacteria 1517
947 Ga0496124_0251686 3300048927 Bacteria 1306
948 Ga0496124_0309732 3300048927 Bacteria 1136
949 Ga0496125_0003621 3300048928 Bacteria 18542
950 Ga0496125_0025303 3300048928 Bacteria 5438
951 Ga0496125_0043714 3300048928 Bacteria 3797
952 Ga0496125_0160002 3300048928 Bacteria 1531
953 Ga0496125_0209676 3300048928 Bacteria 1266
954 Ga0496126_0001402 3300048929 Bacteria 38138
955 Ga0496126_0008929 3300048929 Bacteria 10733
956 Ga0496126_0014924 3300048929 Bacteria 7834
957 Ga0496126_0016269 3300048929 Bacteria 7444
958 Ga0496126_0076006 3300048929 Bacteria 2980
959 Ga0496126_0078436 3300048929 Bacteria 2926
960 Ga0496126_0087451 3300048929 Bacteria 2746
961 Ga0496126_0205748 3300048929 Bacteria 1659
962 Ga0496126_0274412 3300048929 Bacteria 1398
963 Ga0496126_0282068 3300048929 Bacteria 1376
964 Ga0496126_0477938 3300048929 Bacteria 999
965 Ga0496126_0582749 3300048929 Bacteria 883
966 Ga0496126_0642176 3300048929 Bacteria 831
967 Ga0496126_0773081 3300048929 Bacteria 739
968 Ga0495682_0102948 3300049460 Bacteria 1024
969 Ga0495682_0321540 3300049460 Bacteria 545
970 Ga0501038_0399182 3300049574 Bacteria 1064
971 Ga0501039_0427018 3300049575 Bacteria 1041
972 Ga0501067_0427073 3300049583 Bacteria 740
973 Ga0501071_0602957 3300049587 Bacteria 844
974 Ga0501076_0105817 3300049592 Bacteria 2270
975 Ga0501081_0659364 3300049743 Bacteria 785
976 nmdc:mga03683_16383_c1 3300050489 Bacteria 2783
977 nmdc:mga03n38_131645_c1 3300050490 Bacteria 1240
978 nmdc:mga03n38_169119_c1 3300050490 Bacteria 1112
979 nmdc:mga00v17_33667_c1 3300050491 Bacteria 3037
980 nmdc:mga00v17_360793_c1 3300050491 Bacteria 945
981 nmdc:mga00v17_39818_c1 3300050491 Bacteria 2816
982 nmdc:mga00v17_43856_c1 3300050491 Bacteria 2695
983 nmdc:mga00v17_466857_c1 3300050491 Unclassified 819
984 nmdc:mga00v17_605066_c1 3300050491 Bacteria 706
985 nmdc:mga0yw44_104010_c1 3300050492 Bacteria 1812
986 nmdc:mga0yw44_23337_c1 3300050492 Bacteria 3484
987 nmdc:mga0yw44_26229_c1 3300050492 Bacteria 3326
988 nmdc:mga0yw44_28706_c1 3300050492 Bacteria 3204
989 nmdc:mga0yw44_531204_c1 3300050492 Bacteria 799
990 nmdc:mga0yw44_545380_c1 3300050492 Bacteria 787
991 nmdc:mga0yw44_65311_c1 3300050492 Bacteria 2242
992 nmdc:mga0k408_150776_c1 3300050493 Bacteria 1384
993 nmdc:mga06z11_143993_c1 3300050494 Bacteria 1349
994 nmdc:mga06z11_38010_c1 3300050494 Bacteria 2387
995 nmdc:mga06z11_434854_c1 3300050494 Bacteria 792
996 nmdc:mga06z11_44544_c1 3300050494 Bacteria 2238
997 nmdc:mga06z11_50473_c1 3300050494 Bacteria 2126
998 nmdc:mga06z11_74639_c1 3300050494 Bacteria 1803
999 nmdc:mga04h51_179955_c1 3300050495 Bacteria 823
1000 nmdc:mga07m45_185701_c1 3300050496 Bacteria 1209
1001 nmdc:mga07m45_22738_c1 3300050496 Bacteria 3425
1002 nmdc:mga07m45_391203_c1 3300050496 Bacteria 807
1003 nmdc:mga07m45_55827_c1 3300050496 Bacteria 2232
1004 nmdc:mga05p37_277229_c1 3300050507 Bacteria 2001
1005 nmdc:mga08y16_238984_c1 3300050511 Bacteria 1878
1006 nmdc:mga0n895_318243_c1 3300050512 Bacteria 1577
1007 nmdc:mga08x19_495723_c1 3300050514 Unclassified 862
1008 nmdc:mga0sz30_20817_c1 3300050516 Bacteria 2648
1009 nmdc:mga0sz30_25178_c1 3300050516 Bacteria 2434
1010 nmdc:mga0sz30_31912_c1 3300050516 Bacteria 2182
1011 nmdc:mga0sz30_86868_c1 3300050516 Bacteria 1358
1012 Ga0495601_0057542 3300053077 Bacteria 2462
1013 Ga0495601_0506683 3300053077 Bacteria 778
1014 Ga0495601_0529497 3300053077 Bacteria 759
1015 Ga0495612_0021008 3300053078 Bacteria 2618
1016 Ga0500610_0118029 3300053079 Bacteria 1359
1017 Ga0500610_0158740 3300053079 Bacteria 1127
1018 Ga0495655_0014047 3300053083 Bacteria 1671
1019 Ga0495655_0057159 3300053083 Bacteria 1052
1020 Ga0495595_0068422 3300053084 Bacteria 1675
1021 Ga0495619_0069535 3300053085 Bacteria 2353
1022 Ga0495619_0307464 3300053085 Bacteria 1098
1023 Ga0495619_0598229 3300053085 Bacteria 755
1024 Ga0500578_0072026 3300053086 Bacteria 2203
1025 Ga0500643_000686 3300053087 Bacteria 22575
1026 Ga0500644_0033795 3300053088 Bacteria 1645
1027 Ga0500646_0018209 3300053090 Bacteria 1848
1028 Ga0500583_0029458 3300053092 Bacteria 2393
1029 Ga0500583_0058393 3300053092 Bacteria 1814
1030 Ga0500583_0366117 3300053092 Bacteria 696
1031 Ga0500651_0005411 3300053093 Bacteria 7292
1032 Ga0500651_0308412 3300053093 Bacteria 906
1033 Ga0500566_0001250 3300053094 Bacteria 14847
1034 Ga0500566_0002250 3300053094 Bacteria 11409
1035 Ga0500566_0316862 3300053094 Bacteria 728
1036 Ga0500640_000965 3300053095 Bacteria 8147
1037 Ga0500641_0001336 3300053096 Bacteria 8771
1038 Ga0500641_0042973 3300053096 Bacteria 1833
1039 Ga0500641_0164735 3300053096 Bacteria 955
1040 Ga0500650_0003551 3300053098 Bacteria 5455
1041 Ga0500650_0096284 3300053098 Bacteria 1386
1042 Ga0500556_0000003 3300053104 Bacteria 679379
1043 Ga0500556_0092434 3300053104 Bacteria 1157
1044 Ga0500556_0232544 3300053104 Bacteria 726
1045 Ga0500557_000035 3300053105 Bacteria 71196
1046 Ga0500562_004625 3300053108 Bacteria 3475
1047 Ga0500562_014315 3300053108 Bacteria 2031
1048 Ga0500569_000936 3300053109 Bacteria 5242
1049 Ga0500569_031305 3300053109 Bacteria 1495
1050 Ga0500572_000524 3300053111 Bacteria 13090
1051 Ga0500592_018142 3300053116 Bacteria 1129
1052 Ga0500594_0030739 3300053118 Bacteria 1412
1053 Ga0500594_0044278 3300053118 Bacteria 1230
1054 Ga0500594_0085231 3300053118 Bacteria 951
1055 Ga0500595_005119 3300053119 Bacteria 5752
1056 Ga0500595_065808 3300053119 Bacteria 1084
1057 Ga0500597_141382 3300053120 Bacteria 1037
1058 Ga0500608_012410 3300053122 Bacteria 3735
1059 Ga0500608_046955 3300053122 Bacteria 2074
1060 Ga0500614_022154 3300053123 Bacteria 1480
1061 Ga0500618_041953 3300053125 Bacteria 1049
1062 Ga0500642_0000006 3300053130 Bacteria 350064
1063 Ga0500642_0000070 3300053130 Bacteria 55760
1064 Ga0500642_0253287 3300053130 Bacteria 808
1065 Ga0500652_000138 3300053131 Bacteria 27584
1066 Ga0500658_0007080 3300053134 Bacteria 4149
1067 Ga0500658_0092837 3300053134 Bacteria 1308
1068 Ga0500658_0115111 3300053134 Bacteria 1187
1069 Ga0500658_0135856 3300053134 Bacteria 1100
1070 Ga0500658_0224753 3300053134 Bacteria 861
1071 Ga0500559_0000171 3300053136 Bacteria 51385
1072 Ga0500559_0012534 3300053136 Bacteria 3600
1073 Ga0500559_0031606 3300053136 Bacteria 2271
1074 Ga0500568_0001061 3300053139 Bacteria 18696
1075 Ga0500568_0006253 3300053139 Bacteria 6010
1076 Ga0500577_0000106 3300053142 Bacteria 20227
1077 Ga0500577_0011599 3300053142 Bacteria 2635
1078 Ga0500577_0157491 3300053142 Bacteria 966
1079 Ga0500586_001231 3300053145 Bacteria 5354
1080 Ga0500588_0078416 3300053146 Bacteria 1100
1081 Ga0500589_076307 3300053147 Bacteria 1505
1082 Ga0500589_244828 3300053147 Bacteria 661
1083 Ga0500590_100185 3300053148 Bacteria 1392
1084 Ga0500603_000337 3300053150 Bacteria 12273
1085 Ga0500604_0002446 3300053151 Bacteria 5065
1086 Ga0500604_0010292 3300053151 Bacteria 2500
1087 Ga0500616_0000033 3300053153 Bacteria 398830
1088 Ga0500616_0044015 3300053153 Bacteria 2384
1089 Ga0500622_0001284 3300053156 Bacteria 20454
1090 Ga0500622_0017922 3300053156 Bacteria 3767
1091 Ga0500624_003166 3300053157 Bacteria 2170
1092 Ga0500627_0095479 3300053158 Bacteria 1332
1093 Ga0500627_0107717 3300053158 Bacteria 1253
1094 Ga0500630_001359 3300053159 Bacteria 11529
1095 Ga0500633_0130099 3300053160 Bacteria 939
1096 Ga0500634_0044689 3300053161 Bacteria 2398
1097 Ga0500634_0110719 3300053161 Bacteria 1355
1098 Ga0500634_0161638 3300053161 Bacteria 1033
1099 Ga0500638_007609 3300053162 Bacteria 4550
1100 Ga0500639_000003 3300053163 Bacteria 230428
1101 Ga0500639_164495 3300053163 Bacteria 1004
1102 Ga0500636_0172241 3300053177 Bacteria 1169
1103 Ga0500637_0067428 3300053178 Bacteria 2056
1104 Ga0500637_0094098 3300053178 Bacteria 1736
1105 Ga0500611_063934 3300053727 Bacteria 879
1106 Ga0500625_020693 3300053729 Bacteria 3097
1107 Ga0500645_006601 3300053730 Bacteria 4118
1108 Ga0500596_001079 3300053735 Bacteria 5497
1109 Ga0500601_000077 3300053737 Bacteria 20039
1110 Ga0500601_003375 3300053737 Bacteria 1731
1111 Ga0500661_034104 3300055283 Bacteria 899
1112 Ga0466962_0058611 3300061719 Bacteria 1838
1113 Ga0530510_0274821 3300061734 Bacteria 1258

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10434930 Ga0207643_104349302 167
2 3300046506 Ga0495583_0177598 Ga0495583_0177598_65_568 167
3 3300048924 Ga0496121_0512247 Ga0496121_0512247_225_728 167
4 3300049460 Ga0495682_0321540 Ga0495682_0321540_23_526 167
5 3300053147 Ga0500589_244828 Ga0500589_244828_127_630 167
6 3300047673 Ga0495593_0546940 Ga0495593_0546940_49_567 172
7 3300006178 Ga0075367_10060296 Ga0075367_100602962 174
8 3300050494 nmdc:mga06z11_38010_c1 nmdc:mga06z11_38010_c1_1647_2258 174
9 3300004625 Ga0055543_1003135 Ga0055543_10031355 175
10 3300005262 Ga0065165_1001540 Ga0065165_10015405 175
11 3300046491 Ga0495584_0063644 Ga0495584_0063644_1142_1753 175
12 3300003763 Ga0055529_1015691 Ga0055529_10156912 178
13 3300005548 Ga0070665_100080196 Ga0070665_1000801964 178
14 3300025254 Ga0209148_1000319 Ga0209148_100031936 178
15 3300025261 Ga0209233_1015774 Ga0209233_10157743 178
16 3300025272 Ga0209455_1003594 Ga0209455_10035944 178
17 3300035725 Ga0373947_0207416 Ga0373947_0207416_18_602 178
18 3300005614 Ga0068856_100128623 Ga0068856_1001286233 181
19 3300005616 Ga0068852_100455965 Ga0068852_1004559652 181
20 3300026078 Ga0207702_10393911 Ga0207702_103939112 181
21 3300048915 Ga0496112_0173260 Ga0496112_0173260_223_837 181
22 3300053077 Ga0495601_0529497 Ga0495601_0529497_13_564 183
23 3300046513 Ga0495616_0069582 Ga0495616_0069582_1065_1679 184
24 3300026075 Ga0207708_10154498 Ga0207708_101544983 185
25 3300046472 Ga0495580_0210427 Ga0495580_0210427_34_645 185
26 3300021384 Ga0213876_10214021 Ga0213876_102140212 186
27 3300039437 Ga0436365_0163573 Ga0436365_0163573_285_899 186
28 3300041494 Ga0451837_1100542 Ga0451837_1100542_15_575 186
29 3300003320 rootH2_10052492 rootH2_100524922 187
30 3300053737 Ga0500601_000077 Ga0500601_000077_18463_19074 187
31 3300041452 Ga0451793_0382415 Ga0451793_0382415_23_589 188
32 3300005539 Ga0068853_100720870 Ga0068853_1007208701 189
33 3300026041 Ga0207639_10388585 Ga0207639_103885852 189
34 3300049743 Ga0501081_0659364 Ga0501081_0659364_198_767 189
35 3300050490 nmdc:mga03n38_169119_c1 nmdc:mga03n38_169119_c1_101_670 189
36 3300050491 nmdc:mga00v17_33667_c1 nmdc:mga00v17_33667_c1_2450_3019 189
37 3300050516 nmdc:mga0sz30_31912_c1 nmdc:mga0sz30_31912_c1_1487_2056 189
38 3300006186 Ga0075369_10117186 Ga0075369_101171862 190
39 3300047472 Ga0495686_0207529 Ga0495686_0207529_17_631 190
40 3300048090 Ga0495615_0077647 Ga0495615_0077647_173_745 190
41 3300048906 Ga0496103_0302638 Ga0496103_0302638_360_932 190
42 3300048911 Ga0496108_0018966 Ga0496108_0018966_503_1075 190
43 3300048929 Ga0496126_0477938 Ga0496126_0477938_28_600 190
44 3300050516 nmdc:mga0sz30_86868_c1 nmdc:mga0sz30_86868_c1_360_974 190
45 3300053125 Ga0500618_041953 Ga0500618_041953_398_973 190
46 3300006942 Ga0099824_1025158 Ga0099824_10251582 191
47 3300013308 Ga0157375_11423878 Ga0157375_114238782 191
48 3300025919 Ga0207657_10065566 Ga0207657_100655664 191
49 3300027296 Ga0209389_1000060 Ga0209389_100006081 191
50 3300027357 Ga0209589_1000062 Ga0209589_100006226 191
51 3300027361 Ga0209489_101714 Ga0209489_10171424 191
52 3300041505 Ga0451849_0759887 Ga0451849_0759887_32_646 191
53 3300046559 Ga0495667_0199124 Ga0495667_0199124_32_607 191
54 3300048904 Ga0496101_0019064 Ga0496101_0019064_3348_3923 191
55 3300048905 Ga0496102_0001018 Ga0496102_0001018_11131_11706 191
56 3300048908 Ga0496105_0101072 Ga0496105_0101072_41_616 191
57 3300048909 Ga0496106_0650231 Ga0496106_0650231_251_826 191
58 3300048910 Ga0496107_0006468 Ga0496107_0006468_7050_7625 191
59 3300048911 Ga0496108_0007359 Ga0496108_0007359_1732_2307 191
60 3300048912 Ga0496109_0036795 Ga0496109_0036795_3200_3775 191
61 3300048913 Ga0496110_0564918 Ga0496110_0564918_128_703 191
62 3300048914 Ga0496111_0170950 Ga0496111_0170950_835_1410 191
63 3300048917 Ga0496114_0017392 Ga0496114_0017392_4237_4812 191
64 3300048917 Ga0496114_1299885 Ga0496114_1299885_22_597 191
65 3300048918 Ga0496115_0005943 Ga0496115_0005943_629_1204 191
66 3300053104 Ga0500556_0092434 Ga0500556_0092434_273_848 191
67 3300009148 Ga0105243_11119732 Ga0105243_111197321 192
68 3300041441 Ga0451787_023315 Ga0451787_023315_123_710 194
69 3300046679 Ga0495623_0431547 Ga0495623_0431547_40_627 194
70 3300048921 Ga0496118_0344600 Ga0496118_0344600_21_608 194
71 3300050491 nmdc:mga00v17_466857_c1 nmdc:mga00v17_466857_c1_116_706 194
72 3300053094 Ga0500566_0316862 Ga0500566_0316862_130_717 194
73 3300053088 Ga0500644_0033795 Ga0500644_0033795_131_751 195
74 3300053119 Ga0500595_005119 Ga0500595_005119_3621_4211 195
75 3300048903 Ga0496100_0031098 Ga0496100_0031098_151_744 196
76 3300048904 Ga0496101_0378797 Ga0496101_0378797_140_733 196
77 3300048905 Ga0496102_0642655 Ga0496102_0642655_275_868 196
78 3300048917 Ga0496114_0466718 Ga0496114_0466718_243_836 196
79 3300048921 Ga0496118_0064256 Ga0496118_0064256_226_828 196
80 iso_pu_bacteria 2602042107 2603860378 196
81 iso_pu_bacteria 2857524615 2857525325 196
82 iso_pu_bacteria 2893066018 2893066263 196
83 iso_pu_bacteria 2919073203 2919074984 196
84 3300009093 Ga0105240_10010877 Ga0105240_1001087710 197
85 3300009098 Ga0105245_10129954 Ga0105245_101299542 197
86 3300009174 Ga0105241_10105000 Ga0105241_101050002 197
87 3300009545 Ga0105237_10005066 Ga0105237_100050663 197
88 3300010375 Ga0105239_10096270 Ga0105239_100962704 197
89 3300039450 Ga0436363_0405860 Ga0436363_0405860_2425_3021 197
90 3300046474 Ga0495605_0069723 Ga0495605_0069723_959_1552 197
91 3300046507 Ga0495606_0033500 Ga0495606_0033500_794_1387 197
92 3300046524 Ga0495648_0071020 Ga0495648_0071020_902_1495 197
93 3300046529 Ga0495652_0057963 Ga0495652_0057963_296_889 197
94 3300046616 Ga0495668_0179540 Ga0495668_0179540_409_1002 197
95 3300046694 Ga0495649_0009963 Ga0495649_0009963_4923_5516 197
96 3300053130 Ga0500642_0000070 Ga0500642_0000070_35444_36037 197
97 iso_pu_bacteria 2874620515 2874625271 197
98 iso_pu_bacteria 2876808645 2876810510 197
99 iso_pu_bacteria 2879110137 2879114370 197
100 iso_pu_bacteria 2904666416 2904668825 197
101 iso_pu_bacteria 3005710791 3005712933 197
102 3300003771 Ga0055526_1008269 Ga0055526_10082693 198
103 3300005262 Ga0065165_1066955 Ga0065165_10669552 198
104 3300005548 Ga0070665_100267780 Ga0070665_1002677802 198
105 3300006038 Ga0075365_10060429 Ga0075365_100604292 198
106 3300006051 Ga0075364_10037231 Ga0075364_100372315 198
107 3300006051 Ga0075364_10098009 Ga0075364_100980093 198
108 3300006186 Ga0075369_10010020 Ga0075369_100100203 198
109 3300006353 Ga0075370_10323059 Ga0075370_103230592 198
110 3300007788 Ga0099795_10008800 Ga0099795_100088003 198
111 3300010159 Ga0099796_10008663 Ga0099796_100086634 198
112 3300025295 Ga0209564_1001380 Ga0209564_100138020 198
113 3300026067 Ga0207678_10060081 Ga0207678_100600812 198
114 3300026067 Ga0207678_10993879 Ga0207678_109938791 198
115 3300028379 Ga0268266_10157317 Ga0268266_101573172 198
116 3300028794 Ga0307515_10109512 Ga0307515_101095122 198
117 3300035725 Ga0373947_0008141 Ga0373947_0008141_2290_2889 198
118 3300039438 Ga0436360_0751927 Ga0436360_0751927_242_841 198
119 3300044684 Ga0466966_0082784 Ga0466966_0082784_267_863 198
120 3300044719 Ga0466971_0045755 Ga0466971_0045755_1340_1936 198
121 3300045836 Ga0466958_0521981 Ga0466958_0521981_114_713 198
122 3300045976 Ga0466967_0052907 Ga0466967_0052907_2324_2920 198
123 3300045976 Ga0466967_0254910 Ga0466967_0254910_662_1261 198
124 3300046460 Ga0495638_0002654 Ga0495638_0002654_6762_7370 198
125 3300046460 Ga0495638_0020245 Ga0495638_0020245_1493_2101 198
126 3300046473 Ga0495582_0089972 Ga0495582_0089972_232_831 198
127 3300046501 Ga0495607_0012642 Ga0495607_0012642_3977_4585 198
128 3300046507 Ga0495606_0166732 Ga0495606_0166732_46_654 198
129 3300046515 Ga0495620_0047059 Ga0495620_0047059_619_1227 198
130 3300046524 Ga0495648_0009119 Ga0495648_0009119_5543_6142 198
131 3300046524 Ga0495648_0130145 Ga0495648_0130145_328_936 198
132 3300046530 Ga0495654_0103628 Ga0495654_0103628_393_1001 198
133 3300046557 Ga0495622_0068065 Ga0495622_0068065_719_1327 198
134 3300046660 Ga0495625_0110808 Ga0495625_0110808_1207_1815 198
135 3300046665 Ga0495661_0008267 Ga0495661_0008267_6167_6775 198
136 3300046674 Ga0495588_0024706 Ga0495588_0024706_454_1062 198
137 3300046691 Ga0495670_0010493 Ga0495670_0010493_2945_3553 198
138 3300047315 Ga0495581_0095380 Ga0495581_0095380_681_1280 198
139 3300047320 Ga0495672_0097317 Ga0495672_0097317_724_1332 198
140 3300047321 Ga0495676_0406389 Ga0495676_0406389_192_791 198
141 3300047472 Ga0495686_0110629 Ga0495686_0110629_462_1070 198
142 3300048915 Ga0496112_0000960 Ga0496112_0000960_6427_7023 198
143 3300048919 Ga0496116_0001982 Ga0496116_0001982_1657_2265 198
144 3300048920 Ga0496117_0057178 Ga0496117_0057178_287_895 198
145 3300048921 Ga0496118_0043749 Ga0496118_0043749_1101_1709 198
146 3300048921 Ga0496118_0054475 Ga0496118_0054475_1393_2001 198
147 3300048923 Ga0496120_0062469 Ga0496120_0062469_244_852 198
148 3300048924 Ga0496121_0009489 Ga0496121_0009489_7766_8374 198
149 3300048924 Ga0496121_0192356 Ga0496121_0192356_296_892 198
150 3300048924 Ga0496121_0237371 Ga0496121_0237371_526_1134 198
151 3300048925 Ga0496122_0029420 Ga0496122_0029420_3935_4543 198
152 3300048926 Ga0496123_0024856 Ga0496123_0024856_165_773 198
153 3300048927 Ga0496124_0309732 Ga0496124_0309732_46_654 198
154 3300048928 Ga0496125_0003621 Ga0496125_0003621_11742_12350 198
155 3300048928 Ga0496125_0043714 Ga0496125_0043714_1992_2600 198
156 3300048929 Ga0496126_0282068 Ga0496126_0282068_16_615 198
157 3300048929 Ga0496126_0773081 Ga0496126_0773081_23_631 198
158 3300050491 nmdc:mga00v17_39818_c1 nmdc:mga00v17_39818_c1_1865_2473 198
159 3300050492 nmdc:mga0yw44_23337_c1 nmdc:mga0yw44_23337_c1_1954_2562 198
160 3300050496 nmdc:mga07m45_185701_c1 nmdc:mga07m45_185701_c1_408_1016 198
161 3300050516 nmdc:mga0sz30_20817_c1 nmdc:mga0sz30_20817_c1_117_725 198
162 3300053090 Ga0500646_0018209 Ga0500646_0018209_817_1425 198
163 3300053093 Ga0500651_0308412 Ga0500651_0308412_192_800 198
164 3300053094 Ga0500566_0001250 Ga0500566_0001250_10567_11175 198
165 3300053098 Ga0500650_0003551 Ga0500650_0003551_208_816 198
166 3300053104 Ga0500556_0000003 Ga0500556_0000003_70772_71380 198
167 3300053108 Ga0500562_014315 Ga0500562_014315_195_803 198
168 3300053109 Ga0500569_000936 Ga0500569_000936_4148_4756 198
169 3300053116 Ga0500592_018142 Ga0500592_018142_411_1019 198
170 3300053118 Ga0500594_0044278 Ga0500594_0044278_486_1094 198
171 3300053122 Ga0500608_046955 Ga0500608_046955_181_789 198
172 3300053130 Ga0500642_0000006 Ga0500642_0000006_333902_334510 198
173 3300053131 Ga0500652_000138 Ga0500652_000138_24816_25424 198
174 3300053134 Ga0500658_0007080 Ga0500658_0007080_1606_2214 198
175 3300053136 Ga0500559_0000171 Ga0500559_0000171_20120_20728 198
176 3300053139 Ga0500568_0001061 Ga0500568_0001061_15816_16424 198
177 3300053142 Ga0500577_0157491 Ga0500577_0157491_111_719 198
178 3300053145 Ga0500586_001231 Ga0500586_001231_4601_5206 198
179 3300053151 Ga0500604_0002446 Ga0500604_0002446_3511_4119 198
180 3300053153 Ga0500616_0000033 Ga0500616_0000033_357621_358229 198
181 3300053156 Ga0500622_0001284 Ga0500622_0001284_6394_7002 198
182 3300053157 Ga0500624_003166 Ga0500624_003166_1067_1675 198
183 3300053160 Ga0500633_0130099 Ga0500633_0130099_86_694 198
184 3300053178 Ga0500637_0067428 Ga0500637_0067428_223_831 198
185 iso_pu_bacteria 2513237092 2513626016 198
186 iso_pu_bacteria 2513237101 2513697981 198
187 iso_pu_bacteria 2513237139 2513877869 198
188 iso_pu_bacteria 2513237161 2514016243 198
189 iso_pu_bacteria 2617270735 2617353782 198
190 iso_pu_bacteria 2721755755 2723846830 198
191 iso_pu_bacteria 2791355196 2793063468 198
192 iso_pu_bacteria 2791355199 2793076416 198
193 iso_pu_bacteria 2802429603 2805917002 198
194 iso_pu_bacteria 2824600985 2824601902 198
195 iso_pu_bacteria 2824609381 2824612784 198
196 iso_pu_bacteria 2824653114 2824653203 198
197 iso_pu_bacteria 2824661429 2824662546 198
198 iso_pu_bacteria 2824671348 2824673432 198
199 iso_pu_bacteria 2824687955 2824689526 198
200 iso_pu_bacteria 2824696289 2824697341 198
201 iso_pu_bacteria 2824773399 2824776031 198
202 iso_pu_bacteria 2838122688 2838125275 198
203 iso_pu_bacteria 2841941048 2841948588 198
204 iso_pu_bacteria 2841949485 2841951484 198
205 iso_pu_bacteria 2841966195 2841968500 198
206 iso_pu_bacteria 2841974524 2841976300 198
207 iso_pu_bacteria 2841983080 2841987662 198
208 iso_pu_bacteria 2842038055 2842043163 198
209 iso_pu_bacteria 2842045827 2842051204 198
210 iso_pu_bacteria 2847930680 2847933892 198
211 iso_pu_bacteria 2847939898 2847944568 198
212 iso_pu_bacteria 2849076700 2849081191 198
213 iso_pu_bacteria 2857509624 2857516014 198
214 iso_pu_bacteria 2874604998 2874611209 198
215 iso_pu_bacteria 2874612657 2874613037 198
216 iso_pu_bacteria 2879083081 2879087422 198
217 iso_pu_bacteria 2879099564 2879109644 198
218 iso_pu_bacteria 2881364244 2881365115 198
219 iso_pu_bacteria 2885366525 2885367305 198
220 iso_pu_bacteria 2888419890 2888422507 198
221 iso_pu_bacteria 2889033259 2889038380 198
222 iso_pu_bacteria 2906643746 2906643837 198
223 iso_pu_bacteria 2922361189 2922362522 198
224 iso_pu_bacteria 2922368715 2922371836 198
225 iso_pu_bacteria 2922386360 2922387657 198
226 iso_pu_bacteria 2932784394 2932791163 198
227 iso_pu_bacteria 2932809354 2932811655 198
228 iso_pu_bacteria 2932818245 2932826428 198
229 iso_pu_bacteria 2932828146 2932834224 198
230 iso_pu_bacteria 2935616580 2935623954 198
231 iso_pu_bacteria 2935638405 2935646918 198
232 iso_pu_bacteria 2935665750 2935674102 198
233 iso_pu_bacteria 2935675223 2935684740 198
234 iso_pu_bacteria 2935684952 2935691594 198
235 iso_pu_bacteria 2935694250 2935699469 198
236 iso_pu_bacteria 2935703347 2935707697 198
237 iso_pu_bacteria 2935713505 2935719428 198
238 iso_pu_bacteria 2935722832 2935728972 198
239 iso_pu_bacteria 2935732158 2935737787 198
240 iso_pu_bacteria 2935741537 2935747163 198
241 iso_pu_bacteria 2935750917 2935758037 198
242 iso_pu_bacteria 2935760218 2935766673 198
243 iso_pu_bacteria 2935801545 2935809315 198
244 iso_pu_bacteria 2935810662 2935817794 198
245 iso_pu_bacteria 2935827899 2935836267 198
246 iso_pu_bacteria 2935837841 2935845177 198
247 iso_pu_bacteria 2935855204 2935862196 198
248 iso_pu_bacteria 2935864058 2935870877 198
249 iso_pu_bacteria 2935873716 2935881270 198
250 iso_pu_bacteria 2936002035 2936005559 198
251 iso_pu_bacteria 2936037263 2936042087 198
252 iso_pu_bacteria 2940556831 2940564052 198
253 iso_pu_bacteria 2941538514 2941545505 198
254 iso_pu_bacteria 3005506211 3005512563 198
255 iso_pu_bacteria 8006964411 8006969018 198
256 iso_pu_bacteria 8006984368 8006987543 198
257 iso_pu_bacteria 8006994254 8006995037 198
258 iso_pu_bacteria 8016511872 8016515851 198
259 iso_pu_bacteria 8017057580 8017060659 198
260 iso_pu_bacteria 8019576017 8019580172 198
261 iso_pu_bacteria 8019597564 8019603438 198
262 iso_pu_bacteria 8019608314 8019615091 198
263 iso_pu_bacteria 8056673599 8056679598 198
264 3300003323 rootH1_10143147 rootH1_101431473 199
265 3300005937 Ga0081455_10001049 Ga0081455_1000104919 199
266 3300006163 Ga0070715_10261202 Ga0070715_102612021 199
267 3300025905 Ga0207685_10032838 Ga0207685_100328382 199
268 3300025929 Ga0207664_10288492 Ga0207664_102884922 199
269 3300028379 Ga0268266_10038047 Ga0268266_100380473 199
270 3300031911 Ga0307412_10429205 Ga0307412_104292051 199
271 3300035695 Ga0373927_0184348 Ga0373927_0184348_724_1332 199
272 3300038443 Ga0395901_0381792 Ga0395901_0381792_17_625 199
273 3300045976 Ga0466967_0308948 Ga0466967_0308948_128_736 199
274 3300046660 Ga0495625_0496367 Ga0495625_0496367_53_661 199
275 3300047319 Ga0495674_0494710 Ga0495674_0494710_336_944 199
276 3300053084 Ga0495595_0068422 Ga0495595_0068422_250_858 199
277 3300053085 Ga0495619_0307464 Ga0495619_0307464_333_941 199
278 iso_pu_bacteria 2508501128 2509147745 199
279 iso_pu_bacteria 2513237098 2513672076 199
280 iso_pu_bacteria 2513237104 2513721162 199
281 iso_pu_bacteria 2513237141 2513893249 199
282 iso_pu_bacteria 2885383462 2885383631 199
283 iso_pu_bacteria 2903768456 2903776222 199
284 iso_pu_bacteria 2935992306 2935999139 199
285 iso_pu_bacteria 8056681323 8056682078 199
286 3300003215 JGI25153J46596_10007639 JGI25153J46596_100076392 200
287 3300003322 rootL2_10076998 rootL2_100769982 200
288 3300005328 Ga0070676_10530967 Ga0070676_105309671 200
289 3300005331 Ga0070670_100801505 Ga0070670_1008015051 200
290 3300005334 Ga0068869_100349779 Ga0068869_1003497792 200
291 3300005334 Ga0068869_100485296 Ga0068869_1004852962 200
292 3300005338 Ga0068868_100444520 Ga0068868_1004445201 200
293 3300005338 Ga0068868_100493240 Ga0068868_1004932401 200
294 3300005338 Ga0068868_100590642 Ga0068868_1005906422 200
295 3300005338 Ga0068868_100702883 Ga0068868_1007028831 200
296 3300005347 Ga0070668_100042472 Ga0070668_1000424723 200
297 3300005347 Ga0070668_100227425 Ga0070668_1002274252 200
298 3300005347 Ga0070668_100271741 Ga0070668_1002717412 200
299 3300005347 Ga0070668_100359849 Ga0070668_1003598492 200
300 3300005353 Ga0070669_100971348 Ga0070669_1009713481 200
301 3300005355 Ga0070671_100938564 Ga0070671_1009385641 200
302 3300005366 Ga0070659_100322851 Ga0070659_1003228512 200
303 3300005437 Ga0070710_10069856 Ga0070710_100698561 200
304 3300005438 Ga0070701_10488863 Ga0070701_104888631 200
305 3300005439 Ga0070711_100014452 Ga0070711_1000144521 200
306 3300005444 Ga0070694_100300998 Ga0070694_1003009982 200
307 3300005455 Ga0070663_100237043 Ga0070663_1002370432 200
308 3300005455 Ga0070663_100347737 Ga0070663_1003477372 200
309 3300005455 Ga0070663_100490335 Ga0070663_1004903352 200
310 3300005456 Ga0070678_100154818 Ga0070678_1001548181 200
311 3300005456 Ga0070678_100693896 Ga0070678_1006938961 200
312 3300005456 Ga0070678_101027501 Ga0070678_1010275012 200
313 3300005539 Ga0068853_100613701 Ga0068853_1006137011 200
314 3300005545 Ga0070695_100559414 Ga0070695_1005594141 200
315 3300005548 Ga0070665_100170226 Ga0070665_1001702263 200
316 3300005548 Ga0070665_100387818 Ga0070665_1003878182 200
317 3300005549 Ga0070704_100503100 Ga0070704_1005031002 200
318 3300005563 Ga0068855_101399955 Ga0068855_1013999551 200
319 3300005564 Ga0070664_101247610 Ga0070664_1012476101 200
320 3300005577 Ga0068857_100598980 Ga0068857_1005989802 200
321 3300005617 Ga0068859_100165345 Ga0068859_1001653452 200
322 3300005617 Ga0068859_100359614 Ga0068859_1003596143 200
323 3300005618 Ga0068864_101001945 Ga0068864_1010019452 200
324 3300005719 Ga0068861_100090955 Ga0068861_1000909553 200
325 3300005840 Ga0068870_10351658 Ga0068870_103516582 200
326 3300005842 Ga0068858_100161066 Ga0068858_1001610662 200
327 3300005842 Ga0068858_100382597 Ga0068858_1003825972 200
328 3300005843 Ga0068860_100147994 Ga0068860_1001479942 200
329 3300005844 Ga0068862_100090055 Ga0068862_1000900552 200
330 3300005844 Ga0068862_100549458 Ga0068862_1005494582 200
331 3300005844 Ga0068862_101045071 Ga0068862_1010450711 200
332 3300005937 Ga0081455_10032582 Ga0081455_100325823 200
333 3300005981 Ga0081538_10008059 Ga0081538_100080593 200
334 3300005983 Ga0081540_1002600 Ga0081540_100260016 200
335 3300005983 Ga0081540_1010255 Ga0081540_10102557 200
336 3300005985 Ga0081539_10015201 Ga0081539_100152017 200
337 3300006038 Ga0075365_10001666 Ga0075365_100016669 200
338 3300006038 Ga0075365_10033095 Ga0075365_100330954 200
339 3300006038 Ga0075365_10043102 Ga0075365_100431023 200
340 3300006042 Ga0075368_10153030 Ga0075368_101530302 200
341 3300006048 Ga0075363_100168184 Ga0075363_1001681842 200
342 3300006048 Ga0075363_100281369 Ga0075363_1002813692 200
343 3300006051 Ga0075364_10100576 Ga0075364_101005762 200
344 3300006173 Ga0070716_100152627 Ga0070716_1001526272 200
345 3300006175 Ga0070712_100148225 Ga0070712_1001482253 200
346 3300006178 Ga0075367_10059669 Ga0075367_100596693 200
347 3300006178 Ga0075367_10062682 Ga0075367_100626822 200
348 3300006178 Ga0075367_10081927 Ga0075367_100819273 200
349 3300006186 Ga0075369_10052488 Ga0075369_100524883 200
350 3300006195 Ga0075366_10092584 Ga0075366_100925843 200
351 3300006353 Ga0075370_10168312 Ga0075370_101683122 200
352 3300006844 Ga0075428_101294431 Ga0075428_1012944311 200
353 3300006871 Ga0075434_100454685 Ga0075434_1004546851 200
354 3300006931 Ga0097620_100165357 Ga0097620_1001653572 200
355 3300006931 Ga0097620_100359636 Ga0097620_1003596363 200
356 3300007265 Ga0099794_10325812 Ga0099794_103258122 200
357 3300009092 Ga0105250_10064366 Ga0105250_100643661 200
358 3300009093 Ga0105240_10180736 Ga0105240_101807363 200
359 3300009094 Ga0111539_11195894 Ga0111539_111958941 200
360 3300009101 Ga0105247_10158611 Ga0105247_101586112 200
361 3300009148 Ga0105243_10196652 Ga0105243_101966523 200
362 3300009148 Ga0105243_10953269 Ga0105243_109532692 200
363 3300009174 Ga0105241_10054213 Ga0105241_100542133 200
364 3300009176 Ga0105242_10377892 Ga0105242_103778923 200
365 3300009176 Ga0105242_10441573 Ga0105242_104415731 200
366 3300009177 Ga0105248_10821740 Ga0105248_108217402 200
367 3300009177 Ga0105248_10995342 Ga0105248_109953422 200
368 3300009177 Ga0105248_11017521 Ga0105248_110175211 200
369 3300009545 Ga0105237_10147105 Ga0105237_101471053 200
370 3300009545 Ga0105237_10318227 Ga0105237_103182272 200
371 3300009551 Ga0105238_11036819 Ga0105238_110368192 200
372 3300009553 Ga0105249_10337489 Ga0105249_103374891 200
373 3300009553 Ga0105249_10928879 Ga0105249_109288791 200
374 3300010375 Ga0105239_10195859 Ga0105239_101958593 200
375 3300010375 Ga0105239_10819024 Ga0105239_108190242 200
376 3300011119 Ga0105246_10032962 Ga0105246_100329624 200
377 3300011119 Ga0105246_11017143 Ga0105246_110171431 200
378 3300013306 Ga0163162_10529841 Ga0163162_105298412 200
379 3300013306 Ga0163162_10747890 Ga0163162_107478902 200
380 3300013306 Ga0163162_11271134 Ga0163162_112711342 200
381 3300013307 Ga0157372_11058527 Ga0157372_110585272 200
382 3300013308 Ga0157375_10477603 Ga0157375_104776032 200
383 3300014325 Ga0163163_10214291 Ga0163163_102142912 200
384 3300014325 Ga0163163_10260966 Ga0163163_102609661 200
385 3300014325 Ga0163163_10508442 Ga0163163_105084422 200
386 3300014326 Ga0157380_10386195 Ga0157380_103861952 200
387 3300014745 Ga0157377_10223472 Ga0157377_102234722 200
388 3300014968 Ga0157379_10221728 Ga0157379_102217282 200
389 3300014968 Ga0157379_10502654 Ga0157379_105026542 200
390 3300014969 Ga0157376_10187249 Ga0157376_101872493 200
391 3300014969 Ga0157376_11443728 Ga0157376_114437281 200
392 3300015262 Ga0182007_10034887 Ga0182007_100348872 200
393 3300017792 Ga0163161_10516453 Ga0163161_105164532 200
394 3300025297 Ga0209758_1003765 Ga0209758_100376513 200
395 3300025297 Ga0209758_1026690 Ga0209758_10266903 200
396 3300025297 Ga0209758_1040682 Ga0209758_10406822 200
397 3300025885 Ga0207653_10178900 Ga0207653_101789001 200
398 3300025898 Ga0207692_10396121 Ga0207692_103961212 200
399 3300025900 Ga0207710_10103285 Ga0207710_101032852 200
400 3300025901 Ga0207688_10042362 Ga0207688_100423624 200
401 3300025907 Ga0207645_10165423 Ga0207645_101654231 200
402 3300025911 Ga0207654_10090418 Ga0207654_100904182 200
403 3300025913 Ga0207695_10211943 Ga0207695_102119433 200
404 3300025914 Ga0207671_10244480 Ga0207671_102444802 200
405 3300025914 Ga0207671_10254132 Ga0207671_102541322 200
406 3300025915 Ga0207693_10087181 Ga0207693_100871814 200
407 3300025919 Ga0207657_10066394 Ga0207657_100663943 200
408 3300025924 Ga0207694_10197881 Ga0207694_101978813 200
409 3300025925 Ga0207650_10362762 Ga0207650_103627622 200
410 3300025933 Ga0207706_10293970 Ga0207706_102939701 200
411 3300025940 Ga0207691_10143517 Ga0207691_101435173 200
412 3300025941 Ga0207711_10033013 Ga0207711_100330134 200
413 3300025941 Ga0207711_10601433 Ga0207711_106014332 200
414 3300025941 Ga0207711_10616291 Ga0207711_106162912 200
415 3300025942 Ga0207689_10014948 Ga0207689_100149482 200
416 3300025942 Ga0207689_10304524 Ga0207689_103045242 200
417 3300025942 Ga0207689_10382905 Ga0207689_103829052 200
418 3300025945 Ga0207679_10133218 Ga0207679_101332183 200
419 3300025949 Ga0207667_10204841 Ga0207667_102048413 200
420 3300025972 Ga0207668_10084266 Ga0207668_100842663 200
421 3300026023 Ga0207677_10128928 Ga0207677_101289282 200
422 3300026023 Ga0207677_10584901 Ga0207677_105849012 200
423 3300026035 Ga0207703_10204566 Ga0207703_102045662 200
424 3300026035 Ga0207703_10231370 Ga0207703_102313702 200
425 3300026035 Ga0207703_10860828 Ga0207703_108608281 200
426 3300026041 Ga0207639_10073390 Ga0207639_100733901 200
427 3300026041 Ga0207639_10213531 Ga0207639_102135312 200
428 3300026041 Ga0207639_10328161 Ga0207639_103281612 200
429 3300026041 Ga0207639_10508870 Ga0207639_105088702 200
430 3300026067 Ga0207678_10026386 Ga0207678_100263866 200
431 3300026067 Ga0207678_10081677 Ga0207678_100816772 200
432 3300026067 Ga0207678_10108380 Ga0207678_101083802 200
433 3300026088 Ga0207641_11299022 Ga0207641_112990221 200
434 3300026089 Ga0207648_10180743 Ga0207648_101807432 200
435 3300026089 Ga0207648_11054145 Ga0207648_110541451 200
436 3300026095 Ga0207676_10191710 Ga0207676_101917103 200
437 3300026118 Ga0207675_100242260 Ga0207675_1002422602 200
438 3300026118 Ga0207675_100371406 Ga0207675_1003714062 200
439 3300026118 Ga0207675_100669599 Ga0207675_1006695992 200
440 3300026121 Ga0207683_10229165 Ga0207683_102291652 200
441 3300026121 Ga0207683_10751510 Ga0207683_107515101 200
442 3300028379 Ga0268266_10004379 Ga0268266_100043797 200
443 3300028379 Ga0268266_10048162 Ga0268266_100481624 200
444 3300028379 Ga0268266_10537726 Ga0268266_105377262 200
445 3300028380 Ga0268265_10210923 Ga0268265_102109232 200
446 3300028380 Ga0268265_10392349 Ga0268265_103923492 200
447 3300028380 Ga0268265_10827395 Ga0268265_108273952 200
448 3300028381 Ga0268264_10146324 Ga0268264_101463242 200
449 3300028381 Ga0268264_10164971 Ga0268264_101649712 200
450 3300028794 Ga0307515_10042340 Ga0307515_100423405 200
451 3300031247 Ga0265340_10118474 Ga0265340_101184742 200
452 3300031249 Ga0265339_10007191 Ga0265339_100071913 200
453 3300031249 Ga0265339_10008906 Ga0265339_100089062 200
454 3300031507 Ga0307509_10076466 Ga0307509_100764664 200
455 3300031507 Ga0307509_10479408 Ga0307509_104794082 200
456 3300031711 Ga0265314_10034725 Ga0265314_100347253 200
457 3300031712 Ga0265342_10048846 Ga0265342_100488463 200
458 3300031730 Ga0307516_10273434 Ga0307516_102734342 200
459 3300031730 Ga0307516_10374215 Ga0307516_103742152 200
460 3300031731 Ga0307405_10253375 Ga0307405_102533752 200
461 3300031852 Ga0307410_10095307 Ga0307410_100953073 200
462 3300031901 Ga0307406_10289470 Ga0307406_102894702 200
463 3300031911 Ga0307412_10156006 Ga0307412_101560063 200
464 3300031911 Ga0307412_10733133 Ga0307412_107331331 200
465 3300032002 Ga0307416_100176674 Ga0307416_1001766743 200
466 3300032004 Ga0307414_10579144 Ga0307414_105791442 200
467 3300032005 Ga0307411_10159601 Ga0307411_101596012 200
468 3300032126 Ga0307415_100393108 Ga0307415_1003931082 200
469 3300033180 Ga0307510_10003003 Ga0307510_100030033 200
470 3300035113 Ga0373936_0010587 Ga0373936_0010587_2492_3106 200
471 3300037068 Ga0373925_0320138 Ga0373925_0320138_281_892 200
472 3300037418 Ga0395900_0052611 Ga0395900_0052611_2784_3395 200
473 3300037471 Ga0395905_0262755 Ga0395905_0262755_560_1171 200
474 3300041460 Ga0451802_0169445 Ga0451802_0169445_163_774 200
475 3300041460 Ga0451802_2093298 Ga0451802_2093298_655_1266 200
476 3300046453 Ga0495627_074872 Ga0495627_074872_253_864 200
477 3300046455 Ga0495603_0003185 Ga0495603_0003185_1036_1647 200
478 3300046455 Ga0495603_0059812 Ga0495603_0059812_187_798 200
479 3300046455 Ga0495603_0471309 Ga0495603_0471309_25_636 200
480 3300046457 Ga0495590_0090769 Ga0495590_0090769_79_690 200
481 3300046457 Ga0495590_0153420 Ga0495590_0153420_40_651 200
482 3300046460 Ga0495638_0027347 Ga0495638_0027347_2300_2911 200
483 3300046460 Ga0495638_0035036 Ga0495638_0035036_728_1339 200
484 3300046460 Ga0495638_0112339 Ga0495638_0112339_257_868 200
485 3300046471 Ga0495650_0078522 Ga0495650_0078522_412_1023 200
486 3300046474 Ga0495605_0197195 Ga0495605_0197195_14_625 200
487 3300046477 Ga0495664_0028061 Ga0495664_0028061_2616_3227 200
488 3300046491 Ga0495584_0083426 Ga0495584_0083426_217_828 200
489 3300046491 Ga0495584_0304150 Ga0495584_0304150_110_721 200
490 3300046492 Ga0495585_0134418 Ga0495585_0134418_219_830 200
491 3300046506 Ga0495583_0194374 Ga0495583_0194374_110_721 200
492 3300046512 Ga0495610_0142738 Ga0495610_0142738_169_780 200
493 3300046515 Ga0495620_0039967 Ga0495620_0039967_100_711 200
494 3300046518 Ga0495631_0025915 Ga0495631_0025915_957_1568 200
495 3300046518 Ga0495631_0311307 Ga0495631_0311307_39_650 200
496 3300046519 Ga0495632_0070725 Ga0495632_0070725_525_1136 200
497 3300046519 Ga0495632_0220480 Ga0495632_0220480_93_704 200
498 3300046519 Ga0495632_0229103 Ga0495632_0229103_171_782 200
499 3300046520 Ga0495637_0053267 Ga0495637_0053267_123_734 200
500 3300046520 Ga0495637_0212186 Ga0495637_0212186_13_624 200
501 3300046524 Ga0495648_0153359 Ga0495648_0153359_290_901 200
502 3300046524 Ga0495648_0300011 Ga0495648_0300011_67_678 200
503 3300046526 Ga0495666_0073555 Ga0495666_0073555_118_729 200
504 3300046537 Ga0495598_0020585 Ga0495598_0020585_254_865 200
505 3300046557 Ga0495622_0023849 Ga0495622_0023849_1395_2006 200
506 3300046557 Ga0495622_0090186 Ga0495622_0090186_13_624 200
507 3300046615 Ga0495656_0126171 Ga0495656_0126171_280_891 200
508 3300046615 Ga0495656_0149067 Ga0495656_0149067_381_992 200
509 3300046616 Ga0495668_0044643 Ga0495668_0044643_750_1361 200
510 3300046648 Ga0495611_0043538 Ga0495611_0043538_1228_1839 200
511 3300046648 Ga0495611_0065363 Ga0495611_0065363_464_1075 200
512 3300046648 Ga0495611_0190612 Ga0495611_0190612_135_746 200
513 3300046664 Ga0495659_0026904 Ga0495659_0026904_1142_1753 200
514 3300046664 Ga0495659_0054086 Ga0495659_0054086_158_769 200
515 3300046664 Ga0495659_0116327 Ga0495659_0116327_101_712 200
516 3300046674 Ga0495588_0002645 Ga0495588_0002645_3752_4363 200
517 3300046681 Ga0495647_0089378 Ga0495647_0089378_361_972 200
518 3300046684 Ga0495669_0268495 Ga0495669_0268495_15_626 200
519 3300046691 Ga0495670_0049592 Ga0495670_0049592_1077_1688 200
520 3300046694 Ga0495649_0170781 Ga0495649_0170781_115_726 200
521 3300046694 Ga0495649_0203195 Ga0495649_0203195_125_736 200
522 3300046694 Ga0495649_0301197 Ga0495649_0301197_165_776 200
523 3300046809 Ga0495600_0224365 Ga0495600_0224365_436_1047 200
524 3300047318 Ga0495636_0080871 Ga0495636_0080871_592_1203 200
525 3300047318 Ga0495636_0120228 Ga0495636_0120228_465_1076 200
526 3300047321 Ga0495676_0032329 Ga0495676_0032329_1834_2445 200
527 3300047323 Ga0495683_0173291 Ga0495683_0173291_351_962 200
528 3300047323 Ga0495683_0213960 Ga0495683_0213960_135_746 200
529 3300047469 Ga0495673_0169683 Ga0495673_0169683_77_688 200
530 3300047673 Ga0495593_0108302 Ga0495593_0108302_775_1386 200
531 3300048903 Ga0496100_0820187 Ga0496100_0820187_82_693 200
532 3300048910 Ga0496107_0145873 Ga0496107_0145873_873_1484 200
533 3300048911 Ga0496108_0115464 Ga0496108_0115464_621_1232 200
534 3300048911 Ga0496108_0775829 Ga0496108_0775829_140_751 200
535 3300048912 Ga0496109_0385414 Ga0496109_0385414_283_894 200
536 3300048913 Ga0496110_0105535 Ga0496110_0105535_973_1584 200
537 3300048914 Ga0496111_0465846 Ga0496111_0465846_145_756 200
538 3300048917 Ga0496114_0258084 Ga0496114_0258084_870_1481 200
539 3300048918 Ga0496115_0341316 Ga0496115_0341316_503_1114 200
540 3300048921 Ga0496118_0270611 Ga0496118_0270611_88_699 200
541 3300048924 Ga0496121_0253724 Ga0496121_0253724_437_1048 200
542 3300048924 Ga0496121_0366020 Ga0496121_0366020_281_892 200
543 3300048927 Ga0496124_0156728 Ga0496124_0156728_622_1233 200
544 3300048929 Ga0496126_0001402 Ga0496126_0001402_20201_20812 200
545 3300048929 Ga0496126_0076006 Ga0496126_0076006_860_1471 200
546 3300048929 Ga0496126_0582749 Ga0496126_0582749_128_739 200
547 3300049460 Ga0495682_0102948 Ga0495682_0102948_60_671 200
548 3300049574 Ga0501038_0399182 Ga0501038_0399182_104_715 200
549 3300049575 Ga0501039_0427018 Ga0501039_0427018_324_935 200
550 3300049583 Ga0501067_0427073 Ga0501067_0427073_48_659 200
551 3300049587 Ga0501071_0602957 Ga0501071_0602957_214_825 200
552 3300049592 Ga0501076_0105817 Ga0501076_0105817_1094_1705 200
553 3300050489 nmdc:mga03683_16383_c1 nmdc:mga03683_16383_c1_987_1598 200
554 3300050491 nmdc:mga00v17_43856_c1 nmdc:mga00v17_43856_c1_1559_2170 200
555 3300050492 nmdc:mga0yw44_26229_c1 nmdc:mga0yw44_26229_c1_890_1501 200
556 3300050492 nmdc:mga0yw44_28706_c1 nmdc:mga0yw44_28706_c1_1179_1790 200
557 3300050492 nmdc:mga0yw44_545380_c1 nmdc:mga0yw44_545380_c1_24_635 200
558 3300050493 nmdc:mga0k408_150776_c1 nmdc:mga0k408_150776_c1_546_1157 200
559 3300050494 nmdc:mga06z11_143993_c1 nmdc:mga06z11_143993_c1_513_1124 200
560 3300050494 nmdc:mga06z11_44544_c1 nmdc:mga06z11_44544_c1_10_621 200
561 3300050494 nmdc:mga06z11_50473_c1 nmdc:mga06z11_50473_c1_877_1488 200
562 3300050494 nmdc:mga06z11_74639_c1 nmdc:mga06z11_74639_c1_523_1134 200
563 3300050496 nmdc:mga07m45_391203_c1 nmdc:mga07m45_391203_c1_44_655 200
564 3300050507 nmdc:mga05p37_277229_c1 nmdc:mga05p37_277229_c1_1192_1803 200
565 3300053079 Ga0500610_0118029 Ga0500610_0118029_66_698 200
566 3300053085 Ga0495619_0598229 Ga0495619_0598229_14_625 200
567 3300053092 Ga0500583_0029458 Ga0500583_0029458_175_786 200
568 3300053092 Ga0500583_0366117 Ga0500583_0366117_15_626 200
569 3300053094 Ga0500566_0002250 Ga0500566_0002250_12_626 200
570 3300053095 Ga0500640_000965 Ga0500640_000965_4304_4918 200
571 3300053096 Ga0500641_0001336 Ga0500641_0001336_5747_6358 200
572 3300053096 Ga0500641_0164735 Ga0500641_0164735_41_652 200
573 3300053111 Ga0500572_000524 Ga0500572_000524_1727_2341 200
574 3300053118 Ga0500594_0085231 Ga0500594_0085231_259_870 200
575 3300053119 Ga0500595_065808 Ga0500595_065808_120_731 200
576 3300053122 Ga0500608_012410 Ga0500608_012410_3037_3651 200
577 3300053123 Ga0500614_022154 Ga0500614_022154_17_631 200
578 3300053130 Ga0500642_0253287 Ga0500642_0253287_68_679 200
579 3300053134 Ga0500658_0115111 Ga0500658_0115111_209_820 200
580 3300053134 Ga0500658_0135856 Ga0500658_0135856_17_628 200
581 3300053134 Ga0500658_0224753 Ga0500658_0224753_166_777 200
582 3300053136 Ga0500559_0031606 Ga0500559_0031606_784_1395 200
583 3300053142 Ga0500577_0000106 Ga0500577_0000106_6682_7293 200
584 3300053142 Ga0500577_0011599 Ga0500577_0011599_1020_1631 200
585 3300053147 Ga0500589_076307 Ga0500589_076307_263_874 200
586 3300053150 Ga0500603_000337 Ga0500603_000337_10995_11609 200
587 3300053158 Ga0500627_0095479 Ga0500627_0095479_304_915 200
588 3300053159 Ga0500630_001359 Ga0500630_001359_10750_11364 200
589 3300053161 Ga0500634_0044689 Ga0500634_0044689_1628_2239 200
590 3300053161 Ga0500634_0110719 Ga0500634_0110719_239_850 200
591 3300053161 Ga0500634_0161638 Ga0500634_0161638_326_937 200
592 3300053162 Ga0500638_007609 Ga0500638_007609_3806_4420 200
593 3300053163 Ga0500639_000003 Ga0500639_000003_107065_107679 200
594 3300053177 Ga0500636_0172241 Ga0500636_0172241_410_1021 200
595 3300053178 Ga0500637_0094098 Ga0500637_0094098_200_814 200
596 3300053730 Ga0500645_006601 Ga0500645_006601_2219_2830 200
597 3300053735 Ga0500596_001079 Ga0500596_001079_690_1304 200
598 3300053737 Ga0500601_003375 Ga0500601_003375_572_1186 200
599 3300055283 Ga0500661_034104 Ga0500661_034104_271_885 200
600 3300061734 Ga0530510_0274821 Ga0530510_0274821_331_942 200
601 iso_pu_bacteria 2507262055 2507510717 200
602 iso_pu_bacteria 2508501009 2508544518 200
603 iso_pu_bacteria 2508501042 2508697337 200
604 iso_pu_bacteria 2511231028 2511398686 200
605 iso_pu_bacteria 2513237094 2513643110 200
606 iso_pu_bacteria 2513237095 2513650634 200
607 iso_pu_bacteria 2515154112 2515627970 200
608 iso_pu_bacteria 2517093001 2517105124 200
609 iso_pu_bacteria 2524023205 2524437108 200
610 iso_pu_bacteria 2744054633 2745076321 200
611 iso_pu_bacteria 2816332527 2818242597 200
612 iso_pu_bacteria 2824679649 2824680977 200
613 iso_pu_bacteria 2824704595 2824707911 200
614 iso_pu_bacteria 2824746037 2824747789 200
615 iso_pu_bacteria 2824753945 2824758997 200
616 iso_pu_bacteria 2824763712 2824763939 200
617 iso_pu_bacteria 2841957949 2841960519 200
618 iso_pu_bacteria 2844315083 2844317197 200
619 iso_pu_bacteria 2874590934 2874592328 200
620 iso_pu_bacteria 2874628541 2874634606 200
621 iso_pu_bacteria 2874645413 2874650065 200
622 iso_pu_bacteria 2876761206 2876763206 200
623 iso_pu_bacteria 2876771140 2876775406 200
624 iso_pu_bacteria 2876818435 2876826241 200
625 iso_pu_bacteria 2879074833 2879079506 200
626 iso_pu_bacteria 2879127579 2879132247 200
627 iso_pu_bacteria 2879142872 2879146896 200
628 iso_pu_bacteria 2881665667 2881668491 200
629 iso_pu_bacteria 2885409591 2885418911 200
630 iso_pu_bacteria 2888378607 2888381885 200
631 iso_pu_bacteria 2903727486 2903735181 200
632 iso_pu_bacteria 2904711408 2904720477 200
633 iso_pu_bacteria 2906602504 2906607236 200
634 iso_pu_bacteria 2906626472 2906630414 200
635 iso_pu_bacteria 2908775508 2908778139 200
636 iso_pu_bacteria 2922393267 2922399455 200
637 iso_pu_bacteria 2932794094 2932799213 200
638 iso_pu_bacteria 2935608549 2935616105 200
639 iso_pu_bacteria 2935648319 2935656364 200
640 iso_pu_bacteria 2935656913 2935665232 200
641 iso_pu_bacteria 2935769743 2935770665 200
642 iso_pu_bacteria 2935777560 2935782898 200
643 iso_pu_bacteria 2935785616 2935787049 200
644 iso_pu_bacteria 2935793552 2935795097 200
645 iso_pu_bacteria 2935819856 2935820001 200
646 iso_pu_bacteria 2935847175 2935849989 200
647 iso_pu_bacteria 2935908558 2935915143 200
648 iso_pu_bacteria 2935916978 2935923820 200
649 iso_pu_bacteria 2935926038 2935932640 200
650 iso_pu_bacteria 2935934488 2935941276 200
651 iso_pu_bacteria 2935942939 2935949310 200
652 iso_pu_bacteria 2935951376 2935958005 200
653 iso_pu_bacteria 2935959822 2935963754 200
654 iso_pu_bacteria 2935967501 2935974353 200
655 iso_pu_bacteria 2935975950 2935979542 200
656 iso_pu_bacteria 2935984226 2935991901 200
657 iso_pu_bacteria 2936011229 2936019213 200
658 iso_pu_bacteria 2936019824 2936027837 200
659 iso_pu_bacteria 2936028420 2936036620 200
660 iso_pu_bacteria 2936046547 2936054697 200
661 iso_pu_bacteria 2936055302 2936060961 200
662 iso_pu_bacteria 2941531003 2941535042 200
663 iso_pu_bacteria 3005483717 3005488660 200
664 iso_pu_bacteria 3005587118 3005594724 200
665 iso_pu_bacteria 3005594810 3005596900 200
666 iso_pu_bacteria 3005718088 3005720303 200
667 iso_pu_bacteria 8006926726 8006928738 200
668 iso_pu_bacteria 8016522445 8016523397 200
669 iso_pu_bacteria 8016530956 8016536899 200
670 iso_pu_bacteria 8016539877 8016541167 200
671 iso_pu_bacteria 8016548790 8016552085 200
672 iso_pu_bacteria 8016557553 8016560463 200
673 iso_pu_bacteria 8016566248 8016566558 200
674 iso_pu_bacteria 8016575299 8016579301 200
675 iso_pu_bacteria 8016583857 8016589898 200
676 iso_pu_bacteria 8016595262 8016598365 200
677 iso_pu_bacteria 8016603502 8016604466 200
678 iso_pu_bacteria 8016613128 8016621046 200
679 iso_pu_bacteria 8016622563 8016628956 200
680 iso_pu_bacteria 8016630954 8016633531 200
681 iso_pu_bacteria 8019530166 8019536597 200
682 iso_pu_bacteria 8019547302 8019547881 200
683 iso_pu_bacteria 8019619141 8019625643 200
684 iso_pu_bacteria 8019629233 8019636649 200
685 iso_pu_bacteria 8019638758 8019642977 200
686 iso_pu_bacteria 8019648815 8019655873 200
687 iso_pu_bacteria 8019659431 8019664448 200
688 iso_pu_bacteria 8019668869 8019674040 200
689 iso_pu_bacteria 8019678201 8019682083 200
690 iso_pu_bacteria 8019687851 8019693510 200
691 iso_pu_bacteria 8056967851 8056976261 200
692 3300003659 JGI25404J52841_10009341 JGI25404J52841_100093412 201
693 3300005329 Ga0070683_100708738 Ga0070683_1007087382 201
694 3300005331 Ga0070670_100357754 Ga0070670_1003577542 201
695 3300005334 Ga0068869_100420179 Ga0068869_1004201792 201
696 3300005335 Ga0070666_10318802 Ga0070666_103188022 201
697 3300005336 Ga0070680_100500992 Ga0070680_1005009922 201
698 3300005337 Ga0070682_100918069 Ga0070682_1009180691 201
699 3300005339 Ga0070660_100204312 Ga0070660_1002043122 201
700 3300005347 Ga0070668_100198229 Ga0070668_1001982292 201
701 3300005354 Ga0070675_100928914 Ga0070675_1009289142 201
702 3300005356 Ga0070674_100051355 Ga0070674_1000513553 201
703 3300005364 Ga0070673_101210468 Ga0070673_1012104681 201
704 3300005367 Ga0070667_100117359 Ga0070667_1001173593 201
705 3300005434 Ga0070709_10000728 Ga0070709_100007284 201
706 3300005434 Ga0070709_10019151 Ga0070709_100191512 201
707 3300005435 Ga0070714_100017734 Ga0070714_1000177346 201
708 3300005435 Ga0070714_100025169 Ga0070714_1000251693 201
709 3300005436 Ga0070713_100047868 Ga0070713_1000478684 201
710 3300005436 Ga0070713_100209310 Ga0070713_1002093102 201
711 3300005437 Ga0070710_10003264 Ga0070710_100032642 201
712 3300005437 Ga0070710_10004979 Ga0070710_100049797 201
713 3300005437 Ga0070710_10036756 Ga0070710_100367564 201
714 3300005439 Ga0070711_100003505 Ga0070711_1000035055 201
715 3300005439 Ga0070711_100004294 Ga0070711_1000042942 201
716 3300005439 Ga0070711_100006316 Ga0070711_1000063164 201
717 3300005439 Ga0070711_100617833 Ga0070711_1006178332 201
718 3300005441 Ga0070700_100950722 Ga0070700_1009507221 201
719 3300005445 Ga0070708_100191892 Ga0070708_1001918922 201
720 3300005455 Ga0070663_100020188 Ga0070663_1000201886 201
721 3300005456 Ga0070678_100036932 Ga0070678_1000369323 201
722 3300005456 Ga0070678_100184923 Ga0070678_1001849232 201
723 3300005456 Ga0070678_100244536 Ga0070678_1002445362 201
724 3300005457 Ga0070662_100098881 Ga0070662_1000988812 201
725 3300005466 Ga0070685_10143345 Ga0070685_101433452 201
726 3300005467 Ga0070706_100076633 Ga0070706_1000766331 201
727 3300005467 Ga0070706_100207185 Ga0070706_1002071853 201
728 3300005471 Ga0070698_100136085 Ga0070698_1001360853 201
729 3300005471 Ga0070698_100270290 Ga0070698_1002702901 201
730 3300005535 Ga0070684_100001738 Ga0070684_1000017388 201
731 3300005536 Ga0070697_100723360 Ga0070697_1007233601 201
732 3300005539 Ga0068853_100951177 Ga0068853_1009511771 201
733 3300005543 Ga0070672_100024849 Ga0070672_1000248492 201
734 3300005543 Ga0070672_100193609 Ga0070672_1001936092 201
735 3300005548 Ga0070665_100240068 Ga0070665_1002400683 201
736 3300005548 Ga0070665_100448951 Ga0070665_1004489512 201
737 3300005563 Ga0068855_100273509 Ga0068855_1002735093 201
738 3300005577 Ga0068857_100591784 Ga0068857_1005917842 201
739 3300005614 Ga0068856_100232200 Ga0068856_1002322002 201
740 3300005615 Ga0070702_100471666 Ga0070702_1004716662 201
741 3300005616 Ga0068852_100030973 Ga0068852_1000309734 201
742 3300005616 Ga0068852_100066218 Ga0068852_1000662182 201
743 3300005618 Ga0068864_100708859 Ga0068864_1007088592 201
744 3300005718 Ga0068866_10022148 Ga0068866_100221483 201
745 3300005842 Ga0068858_100517447 Ga0068858_1005174472 201
746 3300005842 Ga0068858_100573269 Ga0068858_1005732692 201
747 3300005937 Ga0081455_10001400 Ga0081455_100014007 201
748 3300005937 Ga0081455_10010625 Ga0081455_100106252 201
749 3300005937 Ga0081455_10035291 Ga0081455_100352914 201
750 3300005983 Ga0081540_1000308 Ga0081540_10003082 201
751 3300005983 Ga0081540_1003068 Ga0081540_100306816 201
752 3300005983 Ga0081540_1003948 Ga0081540_100394816 201
753 3300005983 Ga0081540_1015571 Ga0081540_10155716 201
754 3300005983 Ga0081540_1027416 Ga0081540_10274163 201
755 3300005983 Ga0081540_1040558 Ga0081540_10405582 201
756 3300005983 Ga0081540_1155196 Ga0081540_11551962 201
757 3300005985 Ga0081539_10000152 Ga0081539_1000015295 201
758 3300006028 Ga0070717_10255715 Ga0070717_102557152 201
759 3300006038 Ga0075365_10026706 Ga0075365_100267062 201
760 3300006038 Ga0075365_10047865 Ga0075365_100478652 201
761 3300006048 Ga0075363_100076507 Ga0075363_1000765072 201
762 3300006048 Ga0075363_100192631 Ga0075363_1001926312 201
763 3300006163 Ga0070715_10000375 Ga0070715_100003752 201
764 3300006163 Ga0070715_10074126 Ga0070715_100741262 201
765 3300006173 Ga0070716_100001019 Ga0070716_10000101910 201
766 3300006173 Ga0070716_100088605 Ga0070716_1000886052 201
767 3300006175 Ga0070712_100012939 Ga0070712_1000129395 201
768 3300006175 Ga0070712_100054091 Ga0070712_1000540912 201
769 3300006175 Ga0070712_100340482 Ga0070712_1003404821 201
770 3300006178 Ga0075367_10233446 Ga0075367_102334462 201
771 3300006237 Ga0097621_100169549 Ga0097621_1001695493 201
772 3300006358 Ga0068871_100351962 Ga0068871_1003519622 201
773 3300006358 Ga0068871_100480077 Ga0068871_1004800772 201
774 3300006871 Ga0075434_100415364 Ga0075434_1004153642 201
775 3300007265 Ga0099794_10108827 Ga0099794_101088271 201
776 3300007788 Ga0099795_10008270 Ga0099795_100082703 201
777 3300009093 Ga0105240_10943384 Ga0105240_109433841 201
778 3300009094 Ga0111539_10169924 Ga0111539_101699244 201
779 3300009098 Ga0105245_10210908 Ga0105245_102109082 201
780 3300009101 Ga0105247_10049713 Ga0105247_100497133 201
781 3300009148 Ga0105243_10035452 Ga0105243_100354523 201
782 3300009148 Ga0105243_10141567 Ga0105243_101415673 201
783 3300009148 Ga0105243_11309294 Ga0105243_113092941 201
784 3300009174 Ga0105241_10684884 Ga0105241_106848841 201
785 3300009176 Ga0105242_10179193 Ga0105242_101791932 201
786 3300009176 Ga0105242_10346065 Ga0105242_103460652 201
787 3300009177 Ga0105248_10068603 Ga0105248_100686034 201
788 3300009177 Ga0105248_10273822 Ga0105248_102738222 201
789 3300009551 Ga0105238_10344279 Ga0105238_103442792 201
790 3300009553 Ga0105249_10328458 Ga0105249_103284583 201
791 3300010375 Ga0105239_10561602 Ga0105239_105616022 201
792 3300010375 Ga0105239_11033299 Ga0105239_110332991 201
793 3300011119 Ga0105246_10045259 Ga0105246_100452593 201
794 3300011119 Ga0105246_10292029 Ga0105246_102920292 201
795 3300013297 Ga0157378_10630520 Ga0157378_106305202 201
796 3300013306 Ga0163162_10031457 Ga0163162_100314573 201
797 3300013306 Ga0163162_10073750 Ga0163162_100737504 201
798 3300013306 Ga0163162_10303432 Ga0163162_103034323 201
799 3300013306 Ga0163162_11433730 Ga0163162_114337302 201
800 3300013308 Ga0157375_10088023 Ga0157375_100880232 201
801 3300013308 Ga0157375_11830323 Ga0157375_118303231 201
802 3300014326 Ga0157380_10227515 Ga0157380_102275152 201
803 3300014326 Ga0157380_10611034 Ga0157380_106110341 201
804 3300014745 Ga0157377_10229994 Ga0157377_102299942 201
805 3300014968 Ga0157379_10133485 Ga0157379_101334853 201
806 3300014969 Ga0157376_10117436 Ga0157376_101174362 201
807 3300014969 Ga0157376_10151042 Ga0157376_101510423 201
808 3300017792 Ga0163161_10051652 Ga0163161_100516525 201
809 3300017792 Ga0163161_10054139 Ga0163161_100541393 201
810 3300021361 Ga0213872_10020587 Ga0213872_100205872 201
811 3300021361 Ga0213872_10081290 Ga0213872_100812901 201
812 3300021384 Ga0213876_10005504 Ga0213876_100055047 201
813 3300025297 Ga0209758_1002041 Ga0209758_100204119 201
814 3300025893 Ga0207682_10298062 Ga0207682_102980622 201
815 3300025898 Ga0207692_10010166 Ga0207692_100101663 201
816 3300025898 Ga0207692_10140044 Ga0207692_101400442 201
817 3300025899 Ga0207642_10004478 Ga0207642_100044781 201
818 3300025900 Ga0207710_10086136 Ga0207710_100861362 201
819 3300025901 Ga0207688_10279757 Ga0207688_102797572 201
820 3300025901 Ga0207688_10327720 Ga0207688_103277202 201
821 3300025903 Ga0207680_10523479 Ga0207680_105234791 201
822 3300025904 Ga0207647_10062717 Ga0207647_100627172 201
823 3300025905 Ga0207685_10071488 Ga0207685_100714882 201
824 3300025906 Ga0207699_10005178 Ga0207699_100051787 201
825 3300025906 Ga0207699_10015917 Ga0207699_100159174 201
826 3300025910 Ga0207684_10248755 Ga0207684_102487552 201
827 3300025913 Ga0207695_10105874 Ga0207695_101058742 201
828 3300025915 Ga0207693_10002089 Ga0207693_100020893 201
829 3300025915 Ga0207693_10019541 Ga0207693_100195413 201
830 3300025915 Ga0207693_10193679 Ga0207693_101936792 201
831 3300025916 Ga0207663_10001142 Ga0207663_100011425 201
832 3300025916 Ga0207663_10016886 Ga0207663_100168864 201
833 3300025917 Ga0207660_10210454 Ga0207660_102104542 201
834 3300025919 Ga0207657_10222298 Ga0207657_102222982 201
835 3300025920 Ga0207649_10078370 Ga0207649_100783703 201
836 3300025921 Ga0207652_10287823 Ga0207652_102878232 201
837 3300025922 Ga0207646_10334697 Ga0207646_103346972 201
838 3300025926 Ga0207659_10792341 Ga0207659_107923412 201
839 3300025927 Ga0207687_10152740 Ga0207687_101527402 201
840 3300025927 Ga0207687_10632969 Ga0207687_106329691 201
841 3300025928 Ga0207700_10006146 Ga0207700_100061463 201
842 3300025928 Ga0207700_10171192 Ga0207700_101711922 201
843 3300025929 Ga0207664_10018451 Ga0207664_100184513 201
844 3300025929 Ga0207664_10208746 Ga0207664_102087462 201
845 3300025931 Ga0207644_10188394 Ga0207644_101883942 201
846 3300025933 Ga0207706_10045771 Ga0207706_100457713 201
847 3300025934 Ga0207686_10065047 Ga0207686_100650473 201
848 3300025935 Ga0207709_10022961 Ga0207709_100229613 201
849 3300025935 Ga0207709_10048263 Ga0207709_100482631 201
850 3300025936 Ga0207670_10220005 Ga0207670_102200052 201
851 3300025937 Ga0207669_10016667 Ga0207669_100166673 201
852 3300025938 Ga0207704_10016698 Ga0207704_100166983 201
853 3300025939 Ga0207665_10002085 Ga0207665_1000208512 201
854 3300025939 Ga0207665_10163618 Ga0207665_101636183 201
855 3300025940 Ga0207691_10023461 Ga0207691_100234613 201
856 3300025940 Ga0207691_10127129 Ga0207691_101271293 201
857 3300025940 Ga0207691_11001979 Ga0207691_110019791 201
858 3300025941 Ga0207711_10007853 Ga0207711_100078534 201
859 3300025942 Ga0207689_10436540 Ga0207689_104365402 201
860 3300025942 Ga0207689_10579743 Ga0207689_105797432 201
861 3300025944 Ga0207661_10024141 Ga0207661_100241413 201
862 3300025945 Ga0207679_10095198 Ga0207679_100951982 201
863 3300025945 Ga0207679_10366036 Ga0207679_103660362 201
864 3300025961 Ga0207712_10145797 Ga0207712_101457972 201
865 3300025961 Ga0207712_10283488 Ga0207712_102834882 201
866 3300025972 Ga0207668_10060228 Ga0207668_100602283 201
867 3300025986 Ga0207658_10252466 Ga0207658_102524662 201
868 3300026023 Ga0207677_10015943 Ga0207677_100159435 201
869 3300026035 Ga0207703_10898011 Ga0207703_108980112 201
870 3300026067 Ga0207678_10003596 Ga0207678_1000359619 201
871 3300026067 Ga0207678_10011597 Ga0207678_100115973 201
872 3300026078 Ga0207702_10184364 Ga0207702_101843642 201
873 3300026088 Ga0207641_10211920 Ga0207641_102119202 201
874 3300026089 Ga0207648_10018263 Ga0207648_100182634 201
875 3300026095 Ga0207676_10660886 Ga0207676_106608862 201
876 3300026116 Ga0207674_10480234 Ga0207674_104802342 201
877 3300026118 Ga0207675_100075495 Ga0207675_1000754953 201
878 3300026118 Ga0207675_100242955 Ga0207675_1002429553 201
879 3300026121 Ga0207683_10067391 Ga0207683_100673913 201
880 3300026121 Ga0207683_10068087 Ga0207683_100680872 201
881 3300026121 Ga0207683_10225450 Ga0207683_102254503 201
882 3300026142 Ga0207698_10048144 Ga0207698_100481444 201
883 3300026142 Ga0207698_10056286 Ga0207698_100562862 201
884 3300026142 Ga0207698_10728485 Ga0207698_107284851 201
885 3300027907 Ga0207428_10250158 Ga0207428_102501582 201
886 3300028379 Ga0268266_10300642 Ga0268266_103006422 201
887 3300028381 Ga0268264_10000020 Ga0268264_10000020254 201
888 3300028794 Ga0307515_10411918 Ga0307515_104119181 201
889 3300028794 Ga0307515_10503777 Ga0307515_105037771 201
890 3300031240 Ga0265320_10063898 Ga0265320_100638982 201
891 3300031247 Ga0265340_10035185 Ga0265340_100351852 201
892 3300031249 Ga0265339_10185500 Ga0265339_101855002 201
893 3300031456 Ga0307513_10161197 Ga0307513_101611973 201
894 3300031616 Ga0307508_10016258 Ga0307508_100162583 201
895 3300031616 Ga0307508_10067251 Ga0307508_100672513 201
896 3300031731 Ga0307405_10164710 Ga0307405_101647102 201
897 3300031911 Ga0307412_10411398 Ga0307412_104113981 201
898 3300031911 Ga0307412_10816596 Ga0307412_108165962 201
899 3300035086 Ga0373934_0010877 Ga0373934_0010877_1426_2040 201
900 3300035118 Ga0373954_0186590 Ga0373954_0186590_247_861 201
901 3300035119 Ga0373956_0198206 Ga0373956_0198206_104_718 201
902 3300035171 Ga0373946_0183440 Ga0373946_0183440_310_924 201
903 3300035691 Ga0373931_0108054 Ga0373931_0108054_243_857 201
904 3300035692 Ga0373935_0547281 Ga0373935_0547281_107_721 201
905 3300035724 Ga0373933_0010551 Ga0373933_0010551_3881_4495 201
906 3300036401 Ga0373937_0795344 Ga0373937_0795344_250_864 201
907 3300037068 Ga0373925_0768826 Ga0373925_0768826_38_652 201
908 3300039437 Ga0436365_0797309 Ga0436365_0797309_717_1328 201
909 3300039438 Ga0436360_0486890 Ga0436360_0486890_787_1398 201
910 3300039447 Ga0436361_0911132 Ga0436361_0911132_105_716 201
911 3300039447 Ga0436361_1122186 Ga0436361_1122186_624_1247 201
912 3300039450 Ga0436363_1578383 Ga0436363_1578383_352_963 201
913 3300039453 Ga0436362_1242730 Ga0436362_1242730_3918_4529 201
914 3300044693 Ga0466961_0190585 Ga0466961_0190585_52_666 201
915 3300044694 Ga0466963_0320087 Ga0466963_0320087_452_1063 201
916 3300044735 Ga0466968_0192678 Ga0466968_0192678_303_908 201
917 3300045049 Ga0466959_0068194 Ga0466959_0068194_1796_2407 201
918 3300046454 Ga0495592_0077291 Ga0495592_0077291_1572_2186 201
919 3300046455 Ga0495603_0089386 Ga0495603_0089386_248_862 201
920 3300046459 Ga0495629_0015079 Ga0495629_0015079_3713_4327 201
921 3300046462 Ga0495651_0109977 Ga0495651_0109977_1190_1804 201
922 3300046463 Ga0495653_0057045 Ga0495653_0057045_1524_2138 201
923 3300046476 Ga0495662_0045488 Ga0495662_0045488_121_735 201
924 3300046477 Ga0495664_0006969 Ga0495664_0006969_177_791 201
925 3300046477 Ga0495664_0394036 Ga0495664_0394036_75_689 201
926 3300046507 Ga0495606_0000939 Ga0495606_0000939_27315_27929 201
927 3300046511 Ga0495608_0014306 Ga0495608_0014306_3426_4040 201
928 3300046514 Ga0495618_0160656 Ga0495618_0160656_593_1207 201
929 3300046516 Ga0495628_0032399 Ga0495628_0032399_374_988 201
930 3300046531 Ga0495665_0334218 Ga0495665_0334218_118_732 201
931 3300046533 Ga0495640_0016226 Ga0495640_0016226_1689_2303 201
932 3300046535 Ga0495586_0008566 Ga0495586_0008566_1074_1688 201
933 3300046536 Ga0495587_0058859 Ga0495587_0058859_30_644 201
934 3300046538 Ga0495609_0215207 Ga0495609_0215207_153_767 201
935 3300046543 Ga0495645_0173379 Ga0495645_0173379_699_1313 201
936 3300046559 Ga0495667_0058053 Ga0495667_0058053_1719_2333 201
937 3300046616 Ga0495668_0036492 Ga0495668_0036492_660_1274 201
938 3300046616 Ga0495668_0085577 Ga0495668_0085577_1096_1710 201
939 3300046616 Ga0495668_0146911 Ga0495668_0146911_494_1108 201
940 3300046642 Ga0495634_0067697 Ga0495634_0067697_1719_2333 201
941 3300046678 Ga0495599_0046840 Ga0495599_0046840_833_1447 201
942 3300046678 Ga0495599_0299733 Ga0495599_0299733_217_831 201
943 3300046679 Ga0495623_0012115 Ga0495623_0012115_1528_2142 201
944 3300046680 Ga0495646_0155129 Ga0495646_0155129_176_790 201
945 3300046684 Ga0495669_0014374 Ga0495669_0014374_2501_3115 201
946 3300046689 Ga0495613_0445759 Ga0495613_0445759_62_676 201
947 3300046809 Ga0495600_0080341 Ga0495600_0080341_1018_1632 201
948 3300047317 Ga0495604_0064554 Ga0495604_0064554_1663_2277 201
949 3300047319 Ga0495674_0335194 Ga0495674_0335194_501_1115 201
950 3300047319 Ga0495674_0542316 Ga0495674_0542316_156_770 201
951 3300047320 Ga0495672_0024971 Ga0495672_0024971_1703_2317 201
952 3300047320 Ga0495672_0033009 Ga0495672_0033009_819_1433 201
953 3300047320 Ga0495672_0100321 Ga0495672_0100321_443_1054 201
954 3300047320 Ga0495672_0101470 Ga0495672_0101470_456_1070 201
955 3300047322 Ga0495680_0061366 Ga0495680_0061366_2224_2838 201
956 3300047322 Ga0495680_0549030 Ga0495680_0549030_62_676 201
957 3300047444 Ga0495675_0030160 Ga0495675_0030160_1947_2561 201
958 3300047469 Ga0495673_0023822 Ga0495673_0023822_163_777 201
959 3300047471 Ga0495684_0050876 Ga0495684_0050876_977_1591 201
960 3300047673 Ga0495593_0057446 Ga0495593_0057446_1355_1969 201
961 3300047673 Ga0495593_0126027 Ga0495593_0126027_586_1200 201
962 3300048088 Ga0495602_0110863 Ga0495602_0110863_1031_1645 201
963 3300048903 Ga0496100_0016050 Ga0496100_0016050_3390_4004 201
964 3300048907 Ga0496104_0280093 Ga0496104_0280093_99_713 201
965 3300048909 Ga0496106_0396550 Ga0496106_0396550_231_845 201
966 3300048910 Ga0496107_0089030 Ga0496107_0089030_1292_1906 201
967 3300048913 Ga0496110_0423716 Ga0496110_0423716_20_634 201
968 3300048915 Ga0496112_0005812 Ga0496112_0005812_7029_7643 201
969 3300048915 Ga0496112_0436146 Ga0496112_0436146_37_651 201
970 3300048919 Ga0496116_0262808 Ga0496116_0262808_147_761 201
971 3300048921 Ga0496118_0018781 Ga0496118_0018781_3622_4236 201
972 3300048921 Ga0496118_0175201 Ga0496118_0175201_140_754 201
973 3300048922 Ga0496119_0150672 Ga0496119_0150672_167_781 201
974 3300048924 Ga0496121_0000428 Ga0496121_0000428_23952_24566 201
975 3300048924 Ga0496121_0054851 Ga0496121_0054851_1816_2430 201
976 3300048929 Ga0496126_0008929 Ga0496126_0008929_1111_1725 201
977 3300048929 Ga0496126_0014924 Ga0496126_0014924_236_850 201
978 3300048929 Ga0496126_0078436 Ga0496126_0078436_594_1208 201
979 3300048929 Ga0496126_0642176 Ga0496126_0642176_184_798 201
980 3300050490 nmdc:mga03n38_131645_c1 nmdc:mga03n38_131645_c1_615_1229 201
981 3300050492 nmdc:mga0yw44_65311_c1 nmdc:mga0yw44_65311_c1_252_866 201
982 3300050494 nmdc:mga06z11_434854_c1 nmdc:mga06z11_434854_c1_56_670 201
983 3300050511 nmdc:mga08y16_238984_c1 nmdc:mga08y16_238984_c1_826_1440 201
984 3300050512 nmdc:mga0n895_318243_c1 nmdc:mga0n895_318243_c1_651_1265 201
985 3300050514 nmdc:mga08x19_495723_c1 nmdc:mga08x19_495723_c1_134_748 201
986 3300053077 Ga0495601_0057542 Ga0495601_0057542_900_1514 201
987 3300053077 Ga0495601_0506683 Ga0495601_0506683_22_636 201
988 3300053078 Ga0495612_0021008 Ga0495612_0021008_285_899 201
989 3300053083 Ga0495655_0057159 Ga0495655_0057159_136_771 201
990 3300053085 Ga0495619_0069535 Ga0495619_0069535_1573_2187 201
991 3300053086 Ga0500578_0072026 Ga0500578_0072026_645_1259 201
992 3300053093 Ga0500651_0005411 Ga0500651_0005411_1411_2025 201
993 3300053098 Ga0500650_0096284 Ga0500650_0096284_703_1317 201
994 3300053727 Ga0500611_063934 Ga0500611_063934_20_634 201
995 3300061719 Ga0466962_0058611 Ga0466962_0058611_1042_1653 201
996 3300001989 JGI24739J22299_10044129 JGI24739J22299_100441292 202
997 3300003215 JGI25153J46596_10001185 JGI25153J46596_100011855 202
998 3300003215 JGI25153J46596_10001639 JGI25153J46596_100016392 202
999 3300003215 JGI25153J46596_10002188 JGI25153J46596_1000218815 202
1000 3300003794 Ga0055531_10003312 Ga0055531_100033129 202
1001 3300003794 Ga0055531_10020075 Ga0055531_100200754 202
1002 3300004625 Ga0055543_1044879 Ga0055543_10448791 202
1003 3300005262 Ga0065165_1006854 Ga0065165_10068543 202
1004 3300005334 Ga0068869_100413498 Ga0068869_1004134982 202
1005 3300005339 Ga0070660_100309693 Ga0070660_1003096932 202
1006 3300005344 Ga0070661_100546520 Ga0070661_1005465201 202
1007 3300005347 Ga0070668_100051531 Ga0070668_1000515312 202
1008 3300005354 Ga0070675_100083596 Ga0070675_1000835962 202
1009 3300005356 Ga0070674_100049522 Ga0070674_1000495224 202
1010 3300005367 Ga0070667_100465284 Ga0070667_1004652841 202
1011 3300005436 Ga0070713_100670055 Ga0070713_1006700551 202
1012 3300005455 Ga0070663_100035135 Ga0070663_1000351354 202
1013 3300005455 Ga0070663_100036246 Ga0070663_1000362463 202
1014 3300005455 Ga0070663_100363344 Ga0070663_1003633442 202
1015 3300005455 Ga0070663_100667663 Ga0070663_1006676631 202
1016 3300005456 Ga0070678_100094201 Ga0070678_1000942013 202
1017 3300005456 Ga0070678_100182553 Ga0070678_1001825533 202
1018 3300005457 Ga0070662_100097337 Ga0070662_1000973372 202
1019 3300005457 Ga0070662_100357604 Ga0070662_1003576042 202
1020 3300005459 Ga0068867_100238838 Ga0068867_1002388382 202
1021 3300005539 Ga0068853_100300036 Ga0068853_1003000362 202
1022 3300005543 Ga0070672_100535309 Ga0070672_1005353092 202
1023 3300005547 Ga0070693_100274441 Ga0070693_1002744412 202
1024 3300005548 Ga0070665_100265853 Ga0070665_1002658533 202
1025 3300005563 Ga0068855_100059927 Ga0068855_1000599276 202
1026 3300005564 Ga0070664_100179406 Ga0070664_1001794062 202
1027 3300005577 Ga0068857_100124881 Ga0068857_1001248811 202
1028 3300005578 Ga0068854_100196643 Ga0068854_1001966432 202
1029 3300005614 Ga0068856_100343683 Ga0068856_1003436832 202
1030 3300005615 Ga0070702_100423059 Ga0070702_1004230591 202
1031 3300005616 Ga0068852_100149369 Ga0068852_1001493693 202
1032 3300005616 Ga0068852_100568428 Ga0068852_1005684282 202
1033 3300005617 Ga0068859_100617806 Ga0068859_1006178062 202
1034 3300005617 Ga0068859_100900193 Ga0068859_1009001932 202
1035 3300005718 Ga0068866_10120433 Ga0068866_101204332 202
1036 3300005842 Ga0068858_100480790 Ga0068858_1004807902 202
1037 3300005843 Ga0068860_100352959 Ga0068860_1003529592 202
1038 3300005843 Ga0068860_100641071 Ga0068860_1006410712 202
1039 3300006038 Ga0075365_10017560 Ga0075365_100175603 202
1040 3300006038 Ga0075365_10068618 Ga0075365_100686183 202
1041 3300006038 Ga0075365_10757890 Ga0075365_107578901 202
1042 3300006042 Ga0075368_10059026 Ga0075368_100590262 202
1043 3300006048 Ga0075363_100047857 Ga0075363_1000478572 202
1044 3300006051 Ga0075364_10132788 Ga0075364_101327882 202
1045 3300006051 Ga0075364_10510726 Ga0075364_105107262 202
1046 3300006195 Ga0075366_10006876 Ga0075366_100068767 202
1047 3300006353 Ga0075370_10137176 Ga0075370_101371762 202
1048 3300006358 Ga0068871_101441619 Ga0068871_1014416191 202
1049 3300006931 Ga0097620_100617831 Ga0097620_1006178312 202
1050 3300006931 Ga0097620_100900124 Ga0097620_1009001242 202
1051 3300006941 Ga0099825_1013172 Ga0099825_10131724 202
1052 3300006942 Ga0099824_1053379 Ga0099824_10533791 202
1053 3300009093 Ga0105240_10169998 Ga0105240_101699982 202
1054 3300009101 Ga0105247_10283311 Ga0105247_102833112 202
1055 3300009148 Ga0105243_10220751 Ga0105243_102207512 202
1056 3300009148 Ga0105243_10447262 Ga0105243_104472622 202
1057 3300009174 Ga0105241_10388083 Ga0105241_103880831 202
1058 3300009176 Ga0105242_11593318 Ga0105242_115933181 202
1059 3300009177 Ga0105248_10051239 Ga0105248_100512397 202
1060 3300009177 Ga0105248_10193501 Ga0105248_101935013 202
1061 3300009177 Ga0105248_10852723 Ga0105248_108527232 202
1062 3300009545 Ga0105237_10014113 Ga0105237_1001411311 202
1063 3300009545 Ga0105237_10091868 Ga0105237_100918682 202
1064 3300009545 Ga0105237_10481348 Ga0105237_104813482 202
1065 3300009545 Ga0105237_11002228 Ga0105237_110022282 202
1066 3300009551 Ga0105238_10484587 Ga0105238_104845872 202
1067 3300010375 Ga0105239_10177229 Ga0105239_101772293 202
1068 3300010375 Ga0105239_10278904 Ga0105239_102789042 202
1069 3300010375 Ga0105239_10381015 Ga0105239_103810154 202
1070 3300010375 Ga0105239_10421118 Ga0105239_104211182 202
1071 3300013100 Ga0157373_10137455 Ga0157373_101374552 202
1072 3300013104 Ga0157370_10497404 Ga0157370_104974041 202
1073 3300013306 Ga0163162_10058069 Ga0163162_100580695 202
1074 3300013308 Ga0157375_10386304 Ga0157375_103863043 202
1075 3300014325 Ga0163163_10021432 Ga0163163_100214327 202
1076 3300014325 Ga0163163_10099735 Ga0163163_100997352 202
1077 3300014968 Ga0157379_10779769 Ga0157379_107797692 202
1078 3300021320 Ga0214544_1000013 Ga0214544_1000013161 202
1079 3300021321 Ga0214542_1000013 Ga0214542_100001373 202
1080 3300021324 Ga0214545_1000012 Ga0214545_1000012162 202
1081 3300021327 Ga0214543_1000065 Ga0214543_100006531 202
1082 3300025245 Ga0207425_1014310 Ga0207425_10143101 202
1083 3300025261 Ga0209233_1009436 Ga0209233_10094363 202
1084 3300025295 Ga0209564_1003835 Ga0209564_10038356 202
1085 3300025295 Ga0209564_1066793 Ga0209564_10667931 202
1086 3300025297 Ga0209758_1000026 Ga0209758_1000026318 202
1087 3300025297 Ga0209758_1000097 Ga0209758_100009719 202
1088 3300025297 Ga0209758_1001430 Ga0209758_100143015 202
1089 3300025302 Ga0207426_1000624 Ga0207426_100062427 202
1090 3300025302 Ga0207426_1001451 Ga0207426_100145123 202
1091 3300025302 Ga0207426_1007728 Ga0207426_10077285 202
1092 3300025302 Ga0207426_1016481 Ga0207426_10164814 202
1093 3300025304 Ga0209257_1000201 Ga0209257_1000201139 202
1094 3300025304 Ga0209257_1016006 Ga0209257_10160063 202
1095 3300025304 Ga0209257_1038057 Ga0209257_10380573 202
1096 3300025304 Ga0209257_1060449 Ga0209257_10604492 202
1097 3300025315 Ga0207697_10049786 Ga0207697_100497862 202
1098 3300025899 Ga0207642_10324907 Ga0207642_103249071 202
1099 3300025900 Ga0207710_10180397 Ga0207710_101803972 202
1100 3300025900 Ga0207710_10357368 Ga0207710_103573681 202
1101 3300025901 Ga0207688_10053597 Ga0207688_100535972 202
1102 3300025901 Ga0207688_10156463 Ga0207688_101564631 202
1103 3300025901 Ga0207688_10221559 Ga0207688_102215592 202
1104 3300025904 Ga0207647_10026721 Ga0207647_100267212 202
1105 3300025904 Ga0207647_10028852 Ga0207647_100288522 202
1106 3300025911 Ga0207654_10024645 Ga0207654_100246454 202
1107 3300025911 Ga0207654_10026168 Ga0207654_100261684 202
1108 3300025911 Ga0207654_10262070 Ga0207654_102620702 202
1109 3300025911 Ga0207654_10527217 Ga0207654_105272171 202
1110 3300025913 Ga0207695_10000240 Ga0207695_1000024025 202
1111 3300025914 Ga0207671_10002558 Ga0207671_100025584 202
1112 3300025914 Ga0207671_10061143 Ga0207671_100611434 202
1113 3300025914 Ga0207671_10088938 Ga0207671_100889382 202
1114 3300025917 Ga0207660_10121892 Ga0207660_101218922 202
1115 3300025919 Ga0207657_10199560 Ga0207657_101995602 202
1116 3300025921 Ga0207652_10974864 Ga0207652_109748641 202
1117 3300025923 Ga0207681_10087353 Ga0207681_100873533 202
1118 3300025924 Ga0207694_10175678 Ga0207694_101756782 202
1119 3300025927 Ga0207687_10301737 Ga0207687_103017372 202
1120 3300025931 Ga0207644_10136629 Ga0207644_101366291 202
1121 3300025932 Ga0207690_10652755 Ga0207690_106527551 202
1122 3300025933 Ga0207706_10072699 Ga0207706_100726992 202
1123 3300025933 Ga0207706_10171426 Ga0207706_101714262 202
1124 3300025935 Ga0207709_10362493 Ga0207709_103624932 202
1125 3300025937 Ga0207669_10190403 Ga0207669_101904032 202
1126 3300025940 Ga0207691_10400364 Ga0207691_104003642 202
1127 3300025941 Ga0207711_10496353 Ga0207711_104963532 202
1128 3300025941 Ga0207711_10793579 Ga0207711_107935792 202
1129 3300025972 Ga0207668_10244942 Ga0207668_102449422 202
1130 3300025981 Ga0207640_10153939 Ga0207640_101539392 202
1131 3300025986 Ga0207658_10768282 Ga0207658_107682821 202
1132 3300026035 Ga0207703_10838580 Ga0207703_108385801 202
1133 3300026041 Ga0207639_10071039 Ga0207639_100710392 202
1134 3300026041 Ga0207639_10680882 Ga0207639_106808822 202
1135 3300026041 Ga0207639_10816530 Ga0207639_108165301 202
1136 3300026067 Ga0207678_10071540 Ga0207678_100715402 202
1137 3300026067 Ga0207678_10166050 Ga0207678_101660502 202
1138 3300026067 Ga0207678_10437867 Ga0207678_104378671 202
1139 3300026088 Ga0207641_10188351 Ga0207641_101883512 202
1140 3300026089 Ga0207648_10391941 Ga0207648_103919411 202
1141 3300026116 Ga0207674_10065697 Ga0207674_100656973 202
1142 3300026118 Ga0207675_100077932 Ga0207675_1000779323 202
1143 3300026118 Ga0207675_100748478 Ga0207675_1007484782 202
1144 3300026121 Ga0207683_10262334 Ga0207683_102623342 202
1145 3300026121 Ga0207683_10358909 Ga0207683_103589092 202
1146 3300026142 Ga0207698_10140596 Ga0207698_101405962 202
1147 3300026142 Ga0207698_10542858 Ga0207698_105428582 202
1148 3300027296 Ga0209389_1000188 Ga0209389_100018829 202
1149 3300027361 Ga0209489_113907 Ga0209489_1139075 202
1150 3300027363 Ga0209700_100437 Ga0209700_10043756 202
1151 3300028381 Ga0268264_10052221 Ga0268264_100522215 202
1152 3300028558 Ga0265326_10002308 Ga0265326_100023087 202
1153 3300028563 Ga0265319_1016741 Ga0265319_10167412 202
1154 3300028573 Ga0265334_10001077 Ga0265334_100010776 202
1155 3300028653 Ga0265323_10001752 Ga0265323_100017529 202
1156 3300028654 Ga0265322_10004954 Ga0265322_100049543 202
1157 3300028666 Ga0265336_10001643 Ga0265336_100016438 202
1158 3300028800 Ga0265338_10000013 Ga0265338_10000013217 202
1159 3300029957 Ga0265324_10005453 Ga0265324_100054532 202
1160 3300033180 Ga0307510_10019538 Ga0307510_100195383 202
1161 3300035695 Ga0373927_0046821 Ga0373927_0046821_2122_2739 202
1162 3300035725 Ga0373947_0602183 Ga0373947_0602183_76_693 202
1163 3300037418 Ga0395900_0002185 Ga0395900_0002185_15341_15955 202
1164 3300037466 Ga0395898_0003639 Ga0395898_0003639_13987_14601 202
1165 3300037471 Ga0395905_0013071 Ga0395905_0013071_5536_6144 202
1166 3300037471 Ga0395905_0552294 Ga0395905_0552294_120_734 202
1167 3300037853 Ga0436364_0792686 Ga0436364_0792686_240_851 202
1168 3300038443 Ga0395901_0004684 Ga0395901_0004684_6477_7091 202
1169 3300038443 Ga0395901_0950641 Ga0395901_0950641_53_661 202
1170 3300039438 Ga0436360_0139800 Ga0436360_0139800_2660_3271 202
1171 3300039450 Ga0436363_0657400 Ga0436363_0657400_629_1243 202
1172 3300041451 Ga0451791_1294712 Ga0451791_1294712_288_902 202
1173 3300041452 Ga0451793_0590245 Ga0451793_0590245_22_636 202
1174 3300041456 Ga0451795_1237397 Ga0451795_1237397_233_847 202
1175 3300044658 Ga0466972_0000576 Ga0466972_0000576_1542_2156 202
1176 3300044683 Ga0466965_0077683 Ga0466965_0077683_567_1175 202
1177 3300044735 Ga0466968_0000783 Ga0466968_0000783_3770_4384 202
1178 3300044901 Ga0466960_0111278 Ga0466960_0111278_408_1022 202
1179 3300046455 Ga0495603_0118704 Ga0495603_0118704_708_1316 202
1180 3300046457 Ga0495590_0056244 Ga0495590_0056244_745_1353 202
1181 3300046492 Ga0495585_0187554 Ga0495585_0187554_163_777 202
1182 3300046500 Ga0495596_0234604 Ga0495596_0234604_36_644 202
1183 3300046507 Ga0495606_0065635 Ga0495606_0065635_471_1085 202
1184 3300046507 Ga0495606_0198245 Ga0495606_0198245_288_902 202
1185 3300046507 Ga0495606_0264667 Ga0495606_0264667_273_881 202
1186 3300046511 Ga0495608_0043609 Ga0495608_0043609_1151_1765 202
1187 3300046512 Ga0495610_0078178 Ga0495610_0078178_341_949 202
1188 3300046513 Ga0495616_0226383 Ga0495616_0226383_38_646 202
1189 3300046514 Ga0495618_0025347 Ga0495618_0025347_2550_3164 202
1190 3300046517 Ga0495630_0349398 Ga0495630_0349398_272_886 202
1191 3300046519 Ga0495632_0345254 Ga0495632_0345254_35_643 202
1192 3300046522 Ga0495643_0024202 Ga0495643_0024202_1858_2472 202
1193 3300046524 Ga0495648_0088775 Ga0495648_0088775_543_1157 202
1194 3300046536 Ga0495587_0115650 Ga0495587_0115650_421_1035 202
1195 3300046538 Ga0495609_0097647 Ga0495609_0097647_305_913 202
1196 3300046542 Ga0495597_0034811 Ga0495597_0034811_1587_2201 202
1197 3300046542 Ga0495597_0121964 Ga0495597_0121964_57_665 202
1198 3300046557 Ga0495622_0250859 Ga0495622_0250859_12_620 202
1199 3300046559 Ga0495667_0258068 Ga0495667_0258068_85_699 202
1200 3300046616 Ga0495668_0158442 Ga0495668_0158442_136_750 202
1201 3300046616 Ga0495668_0355124 Ga0495668_0355124_50_658 202
1202 3300046648 Ga0495611_0053168 Ga0495611_0053168_506_1114 202
1203 3300046660 Ga0495625_0366273 Ga0495625_0366273_173_781 202
1204 3300046674 Ga0495588_0080765 Ga0495588_0080765_687_1295 202
1205 3300046692 Ga0495671_0191721 Ga0495671_0191721_302_910 202
1206 3300046794 Ga0495589_0129418 Ga0495589_0129418_93_701 202
1207 3300047315 Ga0495581_0019778 Ga0495581_0019778_1392_2006 202
1208 3300047317 Ga0495604_0030597 Ga0495604_0030597_2471_3085 202
1209 3300047319 Ga0495674_0159826 Ga0495674_0159826_590_1204 202
1210 3300047321 Ga0495676_0010380 Ga0495676_0010380_6911_7525 202
1211 3300047321 Ga0495676_0132650 Ga0495676_0132650_115_723 202
1212 3300047323 Ga0495683_0232004 Ga0495683_0232004_32_646 202
1213 3300047443 Ga0495687_015682 Ga0495687_015682_518_1132 202
1214 3300047469 Ga0495673_0168055 Ga0495673_0168055_118_726 202
1215 3300048089 Ga0495614_0019409 Ga0495614_0019409_581_1195 202
1216 3300048903 Ga0496100_0088474 Ga0496100_0088474_360_974 202
1217 3300048903 Ga0496100_0158568 Ga0496100_0158568_620_1228 202
1218 3300048904 Ga0496101_0066306 Ga0496101_0066306_987_1601 202
1219 3300048904 Ga0496101_0097067 Ga0496101_0097067_974_1582 202
1220 3300048904 Ga0496101_0322655 Ga0496101_0322655_527_1141 202
1221 3300048905 Ga0496102_0022346 Ga0496102_0022346_4204_4818 202
1222 3300048905 Ga0496102_0040983 Ga0496102_0040983_2111_2719 202
1223 3300048906 Ga0496103_0003354 Ga0496103_0003354_113_727 202
1224 3300048906 Ga0496103_0221293 Ga0496103_0221293_222_830 202
1225 3300048907 Ga0496104_0009238 Ga0496104_0009238_7377_7991 202
1226 3300048907 Ga0496104_0161080 Ga0496104_0161080_1049_1657 202
1227 3300048907 Ga0496104_0285405 Ga0496104_0285405_634_1248 202
1228 3300048908 Ga0496105_0000450 Ga0496105_0000450_7019_7633 202
1229 3300048908 Ga0496105_0250713 Ga0496105_0250713_461_1075 202
1230 3300048908 Ga0496105_0317445 Ga0496105_0317445_413_1021 202
1231 3300048909 Ga0496106_0075961 Ga0496106_0075961_643_1251 202
1232 3300048909 Ga0496106_0616578 Ga0496106_0616578_129_743 202
1233 3300048910 Ga0496107_0079830 Ga0496107_0079830_1198_1806 202
1234 3300048910 Ga0496107_0322267 Ga0496107_0322267_493_1107 202
1235 3300048911 Ga0496108_0381211 Ga0496108_0381211_541_1155 202
1236 3300048912 Ga0496109_0301361 Ga0496109_0301361_870_1484 202
1237 3300048913 Ga0496110_0201138 Ga0496110_0201138_598_1206 202
1238 3300048913 Ga0496110_0425537 Ga0496110_0425537_130_744 202
1239 3300048914 Ga0496111_0252927 Ga0496111_0252927_544_1158 202
1240 3300048915 Ga0496112_0162791 Ga0496112_0162791_525_1133 202
1241 3300048915 Ga0496112_0337556 Ga0496112_0337556_473_1087 202
1242 3300048916 Ga0496113_0043948 Ga0496113_0043948_671_1285 202
1243 3300048916 Ga0496113_0079772 Ga0496113_0079772_1139_1753 202
1244 3300048916 Ga0496113_0427112 Ga0496113_0427112_406_1014 202
1245 3300048917 Ga0496114_0052838 Ga0496114_0052838_548_1156 202
1246 3300048918 Ga0496115_0209409 Ga0496115_0209409_619_1227 202
1247 3300048918 Ga0496115_0612307 Ga0496115_0612307_116_730 202
1248 3300048919 Ga0496116_0023198 Ga0496116_0023198_117_725 202
1249 3300048920 Ga0496117_0256798 Ga0496117_0256798_55_669 202
1250 3300048920 Ga0496117_0270374 Ga0496117_0270374_82_696 202
1251 3300048920 Ga0496117_0382086 Ga0496117_0382086_64_675 202
1252 3300048921 Ga0496118_0087936 Ga0496118_0087936_825_1433 202
1253 3300048921 Ga0496118_0269744 Ga0496118_0269744_323_937 202
1254 3300048922 Ga0496119_0002327 Ga0496119_0002327_6980_7594 202
1255 3300048923 Ga0496120_0017844 Ga0496120_0017844_1127_1741 202
1256 3300048923 Ga0496120_0106858 Ga0496120_0106858_59_667 202
1257 3300048923 Ga0496120_0142555 Ga0496120_0142555_103_717 202
1258 3300048924 Ga0496121_0058539 Ga0496121_0058539_400_1008 202
1259 3300048924 Ga0496121_0120053 Ga0496121_0120053_1188_1802 202
1260 3300048925 Ga0496122_0259352 Ga0496122_0259352_119_733 202
1261 3300048927 Ga0496124_0063549 Ga0496124_0063549_2393_3007 202
1262 3300048927 Ga0496124_0200737 Ga0496124_0200737_524_1132 202
1263 3300048927 Ga0496124_0251686 Ga0496124_0251686_643_1257 202
1264 3300048928 Ga0496125_0025303 Ga0496125_0025303_4310_4924 202
1265 3300048928 Ga0496125_0160002 Ga0496125_0160002_747_1361 202
1266 3300048928 Ga0496125_0209676 Ga0496125_0209676_225_839 202
1267 3300048929 Ga0496126_0016269 Ga0496126_0016269_6509_7123 202
1268 3300048929 Ga0496126_0087451 Ga0496126_0087451_151_765 202
1269 3300048929 Ga0496126_0205748 Ga0496126_0205748_762_1370 202
1270 3300048929 Ga0496126_0274412 Ga0496126_0274412_295_909 202
1271 3300050491 nmdc:mga00v17_360793_c1 nmdc:mga00v17_360793_c1_98_712 202
1272 3300050491 nmdc:mga00v17_605066_c1 nmdc:mga00v17_605066_c1_46_654 202
1273 3300050492 nmdc:mga0yw44_104010_c1 nmdc:mga0yw44_104010_c1_600_1214 202
1274 3300050492 nmdc:mga0yw44_531204_c1 nmdc:mga0yw44_531204_c1_138_752 202
1275 3300050495 nmdc:mga04h51_179955_c1 nmdc:mga04h51_179955_c1_29_643 202
1276 3300050496 nmdc:mga07m45_22738_c1 nmdc:mga07m45_22738_c1_2414_3028 202
1277 3300050496 nmdc:mga07m45_55827_c1 nmdc:mga07m45_55827_c1_1576_2184 202
1278 3300050516 nmdc:mga0sz30_25178_c1 nmdc:mga0sz30_25178_c1_1141_1755 202
1279 3300053079 Ga0500610_0158740 Ga0500610_0158740_139_753 202
1280 3300053083 Ga0495655_0014047 Ga0495655_0014047_484_1092 202
1281 3300053087 Ga0500643_000686 Ga0500643_000686_21163_21777 202
1282 3300053092 Ga0500583_0058393 Ga0500583_0058393_720_1334 202
1283 3300053096 Ga0500641_0042973 Ga0500641_0042973_720_1334 202
1284 3300053104 Ga0500556_0232544 Ga0500556_0232544_26_640 202
1285 3300053105 Ga0500557_000035 Ga0500557_000035_62701_63315 202
1286 3300053108 Ga0500562_004625 Ga0500562_004625_380_994 202
1287 3300053109 Ga0500569_031305 Ga0500569_031305_328_942 202
1288 3300053118 Ga0500594_0030739 Ga0500594_0030739_436_1050 202
1289 3300053120 Ga0500597_141382 Ga0500597_141382_249_863 202
1290 3300053134 Ga0500658_0092837 Ga0500658_0092837_310_924 202
1291 3300053136 Ga0500559_0012534 Ga0500559_0012534_717_1331 202
1292 3300053139 Ga0500568_0006253 Ga0500568_0006253_1574_2188 202
1293 3300053146 Ga0500588_0078416 Ga0500588_0078416_239_853 202
1294 3300053148 Ga0500590_100185 Ga0500590_100185_529_1143 202
1295 3300053151 Ga0500604_0010292 Ga0500604_0010292_465_1079 202
1296 3300053153 Ga0500616_0044015 Ga0500616_0044015_526_1140 202
1297 3300053156 Ga0500622_0017922 Ga0500622_0017922_589_1203 202
1298 3300053158 Ga0500627_0107717 Ga0500627_0107717_406_1020 202
1299 3300053163 Ga0500639_164495 Ga0500639_164495_200_814 202
1300 3300053729 Ga0500625_020693 Ga0500625_020693_1238_1852 202

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qsd-assembly1.cif.gz_B rbl2p, beta-tubulin binding post-chaperonin cofactor 0.812 112 199
4whe-assembly1.cif.gz_A crystal structure of e. coli phage shock protein a (pspa 1-144) 0.7651 93 201
1qsd-assembly1.cif.gz_B rbl2p, beta-tubulin binding post-chaperonin cofactor 0.7004 112 199
3tul-assembly5.cif.gz_B crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226) 0.6949 80 190
6u28-assembly2.cif.gz_D crystal structure of 1918 ns1-ed w187a in complex with the p85-beta-ish2 domain of human pi3k 0.6692 76 201
ID Description Score Start End Superfamily
1qsdA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8129 112 199 1.20.58.90
1qsdB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.812 112 199 1.20.58.90
3layE00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7649 111 176 1.20.120.1490
af_P0AAA9_39_119_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7644 109 184 1.20.120.1490
3layA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7586 108 183 1.20.120.1490
ID Description Score Start End GO Terms
AF-A0A0R3MHA7-F1-model_v4 Uncharacterized protein 0.9445 18 202
AF-A0A7Y4LV17-F1-model_v4 Uncharacterized protein 0.934 15 202
AF-A0A257PDZ7-F1-model_v4 Uncharacterized protein 0.9333 32 202
AF-A0A1L3LH52-F1-model_v4 Uncharacterized protein 0.9296 20 200
AF-A0A257PDZ7-F1-model_v4 Uncharacterized protein 0.9282 32 202

Feature Viewer

pLDDT pTM Quality
87.46 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map