F492739
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1300 | 647 | 1113 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100517447|Ga0068858_1005174472 |
| Length | 211 |
| Sequence | MTRRRQNMRRQIAIGVLFFVAAATEGSLAADPRYPDWPCVQAKVPEISLAAVWAGPPLDDIRDKWKDDVKVSALVSKLAARRTTLDEAQKQITEFFAAPATDKATAGKLLFAGLFDSFNAQRNSVMNGLERITRKQRDAADKIRSDVAALHALQSASPPDQPRIDELSNQMVWQTRIFEDRQRVVKFVCEVPTAIDQRLFALGRMIQQEME |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 18 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 21 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 22 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 23 | 2791355199 | |||
| 24 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 25 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 26 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 27 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 28 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 29 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 30 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 31 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 32 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 33 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 34 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 35 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 36 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 37 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 38 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 39 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 40 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 41 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 42 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 43 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 44 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 45 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 46 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 47 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 48 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 49 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 50 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 51 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 52 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 53 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 54 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 55 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 56 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 57 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 58 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 59 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 60 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 61 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 62 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 63 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 64 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 65 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 66 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 67 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 68 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 69 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 70 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 71 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 72 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 73 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 74 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 75 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 76 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 77 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 78 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 79 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 80 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 81 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 82 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 83 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 84 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 85 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 86 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 87 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 88 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 89 | 2922368715 | |||
| 90 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 91 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 92 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 93 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 94 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 95 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 96 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 97 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 98 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 99 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 100 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 101 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 102 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 103 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 104 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 105 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 106 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 107 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 108 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 109 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 110 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 111 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 112 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 113 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 114 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 115 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 116 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 117 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 118 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 119 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 120 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 121 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 122 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 123 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 124 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 125 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 126 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 127 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 128 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 129 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 130 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 131 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 132 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 133 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 134 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 135 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 136 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 137 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 138 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 139 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 140 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 141 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 142 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 143 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 144 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 145 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 146 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 147 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 148 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 149 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 150 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 151 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 152 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 153 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 154 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 155 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 156 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 157 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 158 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 159 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 160 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 161 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 162 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 163 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 164 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 166 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 168 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 172 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 183 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 189 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 195 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 196 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 197 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 199 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 201 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 207 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 209 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 210 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 211 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 213 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 214 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 215 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 216 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 217 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 218 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 219 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 220 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 221 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 222 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 223 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 224 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 225 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 227 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 228 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 229 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 230 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 231 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 232 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 233 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 234 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 235 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 236 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 238 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 239 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 240 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 241 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 243 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 244 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 245 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 246 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 259 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 273 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 275 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 276 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 277 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 278 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 279 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 280 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 281 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 285 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 352 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 353 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 354 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 355 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 356 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 360 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 361 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 362 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 363 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 364 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 365 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 366 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 367 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 368 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 369 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 370 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 371 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 372 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 373 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 374 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 375 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 376 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 377 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 378 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 379 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 380 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 381 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 382 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 383 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 384 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 385 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 386 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 387 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 388 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 389 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 390 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 391 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 392 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 393 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 394 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 395 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 396 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 397 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 398 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 399 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 400 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 401 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 402 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 403 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 404 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 405 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 406 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 407 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 408 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 409 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 410 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 411 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 412 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 413 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 414 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 415 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 416 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 417 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 418 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 419 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 420 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 421 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 422 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 423 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 424 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 425 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 426 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 508 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 509 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 510 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 511 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 512 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 513 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 514 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 515 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 516 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 517 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 518 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 519 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 520 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 521 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 522 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 523 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 524 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 525 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 526 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 527 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 528 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 529 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 530 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 531 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 532 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 533 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 534 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 542 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 543 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 544 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 545 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 546 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 547 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 548 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 549 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 554 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 557 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 562 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 563 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 564 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 565 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 566 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 567 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 568 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 569 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 570 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 571 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 572 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 573 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 574 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 575 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 576 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 577 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 578 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 579 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 580 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 581 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 582 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 583 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 584 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 585 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 586 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 587 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 588 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 589 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 590 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 591 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 592 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 593 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 594 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 595 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 596 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 597 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 598 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 599 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 600 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 601 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 602 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 603 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 604 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 605 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 606 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 607 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 608 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 609 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 610 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 611 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 612 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 613 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 614 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 615 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 616 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 617 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 618 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 619 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 620 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 621 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 622 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 623 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 624 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 625 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 626 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 627 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 628 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 629 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 630 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 631 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 632 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 633 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 634 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 635 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 636 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 637 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 638 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 639 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 640 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 641 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 642 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 643 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 644 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 645 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 646 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 647 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.75 |
| Metatranscriptomes | 0 |
| Isolates | 14.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.77 |
| Nodule | 11.46 |
| Rhizoplane | 5.85 |
| Rhizosphere | 57.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10044129 | 3300001989 | Bacteria | 1470 |
| 2 | JGI25153J46596_10001185 | 3300003215 | Bacteria | 15756 |
| 3 | JGI25153J46596_10001639 | 3300003215 | Bacteria | 13286 |
| 4 | JGI25153J46596_10002188 | 3300003215 | Bacteria | 11408 |
| 5 | JGI25153J46596_10007639 | 3300003215 | Bacteria | 5276 |
| 6 | rootH2_10052492 | 3300003320 | Bacteria | 1047 |
| 7 | rootL2_10076998 | 3300003322 | Bacteria | 1494 |
| 8 | rootH1_10143147 | 3300003323 | Bacteria | 2022 |
| 9 | JGI25404J52841_10009341 | 3300003659 | Bacteria | 2096 |
| 10 | Ga0055529_1015691 | 3300003763 | Bacteria | 955 |
| 11 | Ga0055526_1008269 | 3300003771 | Bacteria | 5221 |
| 12 | Ga0055531_10003312 | 3300003794 | Bacteria | 10311 |
| 13 | Ga0055531_10020075 | 3300003794 | Bacteria | 2664 |
| 14 | Ga0055543_1003135 | 3300004625 | Bacteria | 5058 |
| 15 | Ga0055543_1044879 | 3300004625 | Bacteria | 737 |
| 16 | Ga0065165_1001540 | 3300005262 | Bacteria | 24066 |
| 17 | Ga0065165_1006854 | 3300005262 | Bacteria | 5797 |
| 18 | Ga0065165_1066955 | 3300005262 | Bacteria | 965 |
| 19 | Ga0070676_10530967 | 3300005328 | Bacteria | 840 |
| 20 | Ga0070683_100708738 | 3300005329 | Bacteria | 964 |
| 21 | Ga0070670_100357754 | 3300005331 | Bacteria | 1283 |
| 22 | Ga0070670_100801505 | 3300005331 | Bacteria | 851 |
| 23 | Ga0068869_100349779 | 3300005334 | Bacteria | 1204 |
| 24 | Ga0068869_100413498 | 3300005334 | Bacteria | 1112 |
| 25 | Ga0068869_100420179 | 3300005334 | Bacteria | 1103 |
| 26 | Ga0068869_100485296 | 3300005334 | Bacteria | 1029 |
| 27 | Ga0070666_10318802 | 3300005335 | Bacteria | 1109 |
| 28 | Ga0070680_100500992 | 3300005336 | Bacteria | 1039 |
| 29 | Ga0070682_100918069 | 3300005337 | Bacteria | 721 |
| 30 | Ga0068868_100444520 | 3300005338 | Bacteria | 1127 |
| 31 | Ga0068868_100493240 | 3300005338 | Bacteria | 1072 |
| 32 | Ga0068868_100590642 | 3300005338 | Bacteria | 983 |
| 33 | Ga0068868_100702883 | 3300005338 | Bacteria | 905 |
| 34 | Ga0070660_100204312 | 3300005339 | Bacteria | 1603 |
| 35 | Ga0070660_100309693 | 3300005339 | Bacteria | 1295 |
| 36 | Ga0070661_100546520 | 3300005344 | Bacteria | 931 |
| 37 | Ga0070668_100042472 | 3300005347 | Bacteria | 3485 |
| 38 | Ga0070668_100051531 | 3300005347 | Bacteria | 3171 |
| 39 | Ga0070668_100198229 | 3300005347 | Bacteria | 1647 |
| 40 | Ga0070668_100227425 | 3300005347 | Bacteria | 1541 |
| 41 | Ga0070668_100271741 | 3300005347 | Bacteria | 1413 |
| 42 | Ga0070668_100359849 | 3300005347 | Bacteria | 1234 |
| 43 | Ga0070669_100971348 | 3300005353 | Bacteria | 728 |
| 44 | Ga0070675_100083596 | 3300005354 | Bacteria | 2665 |
| 45 | Ga0070675_100928914 | 3300005354 | Bacteria | 798 |
| 46 | Ga0070671_100938564 | 3300005355 | Bacteria | 757 |
| 47 | Ga0070674_100049522 | 3300005356 | Bacteria | 2888 |
| 48 | Ga0070674_100051355 | 3300005356 | Bacteria | 2841 |
| 49 | Ga0070673_101210468 | 3300005364 | Bacteria | 708 |
| 50 | Ga0070659_100322851 | 3300005366 | Bacteria | 1291 |
| 51 | Ga0070667_100117359 | 3300005367 | Bacteria | 2312 |
| 52 | Ga0070667_100465284 | 3300005367 | Bacteria | 1156 |
| 53 | Ga0070709_10000728 | 3300005434 | Bacteria | 18607 |
| 54 | Ga0070709_10019151 | 3300005434 | Bacteria | 3951 |
| 55 | Ga0070714_100017734 | 3300005435 | Bacteria | 5772 |
| 56 | Ga0070714_100025169 | 3300005435 | Bacteria | 4909 |
| 57 | Ga0070713_100047868 | 3300005436 | Bacteria | 3517 |
| 58 | Ga0070713_100209310 | 3300005436 | Bacteria | 1765 |
| 59 | Ga0070713_100670055 | 3300005436 | Bacteria | 989 |
| 60 | Ga0070710_10003264 | 3300005437 | Bacteria | 7687 |
| 61 | Ga0070710_10004979 | 3300005437 | Bacteria | 6290 |
| 62 | Ga0070710_10036756 | 3300005437 | Bacteria | 2679 |
| 63 | Ga0070710_10069856 | 3300005437 | Bacteria | 2022 |
| 64 | Ga0070701_10488863 | 3300005438 | Bacteria | 797 |
| 65 | Ga0070711_100003505 | 3300005439 | Bacteria | 9150 |
| 66 | Ga0070711_100004294 | 3300005439 | Bacteria | 8390 |
| 67 | Ga0070711_100006316 | 3300005439 | Bacteria | 7134 |
| 68 | Ga0070711_100014452 | 3300005439 | Bacteria | 4974 |
| 69 | Ga0070711_100617833 | 3300005439 | Bacteria | 906 |
| 70 | Ga0070700_100950722 | 3300005441 | Bacteria | 703 |
| 71 | Ga0070694_100300998 | 3300005444 | Bacteria | 1229 |
| 72 | Ga0070708_100191892 | 3300005445 | Bacteria | 1911 |
| 73 | Ga0070663_100020188 | 3300005455 | Bacteria | 4407 |
| 74 | Ga0070663_100035135 | 3300005455 | Bacteria | 3475 |
| 75 | Ga0070663_100036246 | 3300005455 | Bacteria | 3426 |
| 76 | Ga0070663_100237043 | 3300005455 | Bacteria | 1439 |
| 77 | Ga0070663_100347737 | 3300005455 | Bacteria | 1200 |
| 78 | Ga0070663_100363344 | 3300005455 | Bacteria | 1175 |
| 79 | Ga0070663_100490335 | 3300005455 | Bacteria | 1019 |
| 80 | Ga0070663_100667663 | 3300005455 | Bacteria | 881 |
| 81 | Ga0070678_100036932 | 3300005456 | Bacteria | 3425 |
| 82 | Ga0070678_100094201 | 3300005456 | Bacteria | 2305 |
| 83 | Ga0070678_100154818 | 3300005456 | Bacteria | 1850 |
| 84 | Ga0070678_100182553 | 3300005456 | Bacteria | 1719 |
| 85 | Ga0070678_100184923 | 3300005456 | Bacteria | 1709 |
| 86 | Ga0070678_100244536 | 3300005456 | Bacteria | 1502 |
| 87 | Ga0070678_100693896 | 3300005456 | Bacteria | 917 |
| 88 | Ga0070678_101027501 | 3300005456 | Bacteria | 758 |
| 89 | Ga0070662_100097337 | 3300005457 | Bacteria | 2221 |
| 90 | Ga0070662_100098881 | 3300005457 | Bacteria | 2204 |
| 91 | Ga0070662_100357604 | 3300005457 | Bacteria | 1197 |
| 92 | Ga0068867_100238838 | 3300005459 | Bacteria | 1472 |
| 93 | Ga0070685_10143345 | 3300005466 | Bacteria | 1507 |
| 94 | Ga0070706_100076633 | 3300005467 | Bacteria | 3095 |
| 95 | Ga0070706_100207185 | 3300005467 | Bacteria | 1831 |
| 96 | Ga0070698_100136085 | 3300005471 | Bacteria | 2410 |
| 97 | Ga0070698_100270290 | 3300005471 | Bacteria | 1632 |
| 98 | Ga0070684_100001738 | 3300005535 | Bacteria | 15844 |
| 99 | Ga0070697_100723360 | 3300005536 | Bacteria | 879 |
| 100 | Ga0068853_100300036 | 3300005539 | Bacteria | 1485 |
| 101 | Ga0068853_100613701 | 3300005539 | Bacteria | 1033 |
| 102 | Ga0068853_100720870 | 3300005539 | Bacteria | 952 |
| 103 | Ga0068853_100951177 | 3300005539 | Bacteria | 826 |
| 104 | Ga0070672_100024849 | 3300005543 | Bacteria | 4435 |
| 105 | Ga0070672_100193609 | 3300005543 | Bacteria | 1698 |
| 106 | Ga0070672_100535309 | 3300005543 | Bacteria | 1016 |
| 107 | Ga0070695_100559414 | 3300005545 | Bacteria | 893 |
| 108 | Ga0070693_100274441 | 3300005547 | Bacteria | 1127 |
| 109 | Ga0070665_100080196 | 3300005548 | Bacteria | 3269 |
| 110 | Ga0070665_100170226 | 3300005548 | Bacteria | 2179 |
| 111 | Ga0070665_100240068 | 3300005548 | Bacteria | 1813 |
| 112 | Ga0070665_100265853 | 3300005548 | Bacteria | 1717 |
| 113 | Ga0070665_100267780 | 3300005548 | Bacteria | 1710 |
| 114 | Ga0070665_100387818 | 3300005548 | Bacteria | 1404 |
| 115 | Ga0070665_100448951 | 3300005548 | Bacteria | 1299 |
| 116 | Ga0070704_100503100 | 3300005549 | Bacteria | 1052 |
| 117 | Ga0068855_100059927 | 3300005563 | Bacteria | 4452 |
| 118 | Ga0068855_100273509 | 3300005563 | Bacteria | 1878 |
| 119 | Ga0068855_101399955 | 3300005563 | Bacteria | 721 |
| 120 | Ga0070664_100179406 | 3300005564 | Bacteria | 1882 |
| 121 | Ga0070664_101247610 | 3300005564 | Bacteria | 702 |
| 122 | Ga0068857_100124881 | 3300005577 | Bacteria | 2318 |
| 123 | Ga0068857_100591784 | 3300005577 | Bacteria | 1048 |
| 124 | Ga0068857_100598980 | 3300005577 | Bacteria | 1042 |
| 125 | Ga0068854_100196643 | 3300005578 | Bacteria | 1583 |
| 126 | Ga0068856_100128623 | 3300005614 | Bacteria | 2536 |
| 127 | Ga0068856_100232200 | 3300005614 | Bacteria | 1860 |
| 128 | Ga0068856_100343683 | 3300005614 | Bacteria | 1510 |
| 129 | Ga0070702_100423059 | 3300005615 | Bacteria | 959 |
| 130 | Ga0070702_100471666 | 3300005615 | Bacteria | 915 |
| 131 | Ga0068852_100030973 | 3300005616 | Bacteria | 4409 |
| 132 | Ga0068852_100066218 | 3300005616 | Bacteria | 3154 |
| 133 | Ga0068852_100149369 | 3300005616 | Bacteria | 2171 |
| 134 | Ga0068852_100455965 | 3300005616 | Bacteria | 1266 |
| 135 | Ga0068852_100568428 | 3300005616 | Bacteria | 1135 |
| 136 | Ga0068859_100165345 | 3300005617 | Bacteria | 2292 |
| 137 | Ga0068859_100359614 | 3300005617 | Bacteria | 1551 |
| 138 | Ga0068859_100617806 | 3300005617 | Bacteria | 1176 |
| 139 | Ga0068859_100900193 | 3300005617 | Bacteria | 969 |
| 140 | Ga0068864_100708859 | 3300005618 | Bacteria | 984 |
| 141 | Ga0068864_101001945 | 3300005618 | Bacteria | 829 |
| 142 | Ga0068866_10022148 | 3300005718 | Bacteria | 2937 |
| 143 | Ga0068866_10120433 | 3300005718 | Bacteria | 1478 |
| 144 | Ga0068861_100090955 | 3300005719 | Bacteria | 2408 |
| 145 | Ga0068870_10351658 | 3300005840 | Bacteria | 946 |
| 146 | Ga0068858_100161066 | 3300005842 | Bacteria | 2113 |
| 147 | Ga0068858_100382597 | 3300005842 | Bacteria | 1350 |
| 148 | Ga0068858_100480790 | 3300005842 | Bacteria | 1199 |
| 149 | Ga0068858_100517447 | 3300005842 | Bacteria | 1154 |
| 150 | Ga0068858_100573269 | 3300005842 | Bacteria | 1093 |
| 151 | Ga0068860_100147994 | 3300005843 | Bacteria | 2260 |
| 152 | Ga0068860_100352959 | 3300005843 | Bacteria | 1447 |
| 153 | Ga0068860_100641071 | 3300005843 | Bacteria | 1070 |
| 154 | Ga0068862_100090055 | 3300005844 | Bacteria | 2670 |
| 155 | Ga0068862_100549458 | 3300005844 | Bacteria | 1103 |
| 156 | Ga0068862_101045071 | 3300005844 | Bacteria | 810 |
| 157 | Ga0081455_10001049 | 3300005937 | Bacteria | 34795 |
| 158 | Ga0081455_10001400 | 3300005937 | Bacteria | 29809 |
| 159 | Ga0081455_10010625 | 3300005937 | Bacteria | 9316 |
| 160 | Ga0081455_10032582 | 3300005937 | Bacteria | 4694 |
| 161 | Ga0081455_10035291 | 3300005937 | Bacteria | 4472 |
| 162 | Ga0081538_10008059 | 3300005981 | Bacteria | 9003 |
| 163 | Ga0081540_1000308 | 3300005983 | Bacteria | 50401 |
| 164 | Ga0081540_1002600 | 3300005983 | Bacteria | 14672 |
| 165 | Ga0081540_1003068 | 3300005983 | Bacteria | 13381 |
| 166 | Ga0081540_1003948 | 3300005983 | Bacteria | 11521 |
| 167 | Ga0081540_1010255 | 3300005983 | Bacteria | 6362 |
| 168 | Ga0081540_1015571 | 3300005983 | Bacteria | 4810 |
| 169 | Ga0081540_1027416 | 3300005983 | Bacteria | 3228 |
| 170 | Ga0081540_1040558 | 3300005983 | Bacteria | 2425 |
| 171 | Ga0081540_1155196 | 3300005983 | Bacteria | 897 |
| 172 | Ga0081539_10000152 | 3300005985 | Bacteria | 160005 |
| 173 | Ga0081539_10015201 | 3300005985 | Bacteria | 5617 |
| 174 | Ga0070717_10255715 | 3300006028 | Bacteria | 1548 |
| 175 | Ga0075365_10001666 | 3300006038 | Bacteria | 10258 |
| 176 | Ga0075365_10017560 | 3300006038 | Bacteria | 4380 |
| 177 | Ga0075365_10026706 | 3300006038 | Bacteria | 3668 |
| 178 | Ga0075365_10033095 | 3300006038 | Bacteria | 3328 |
| 179 | Ga0075365_10043102 | 3300006038 | Bacteria | 2953 |
| 180 | Ga0075365_10047865 | 3300006038 | Bacteria | 2812 |
| 181 | Ga0075365_10060429 | 3300006038 | Bacteria | 2528 |
| 182 | Ga0075365_10068618 | 3300006038 | Bacteria | 2382 |
| 183 | Ga0075365_10757890 | 3300006038 | Bacteria | 685 |
| 184 | Ga0075368_10059026 | 3300006042 | Bacteria | 1534 |
| 185 | Ga0075368_10153030 | 3300006042 | Bacteria | 964 |
| 186 | Ga0075363_100047857 | 3300006048 | Bacteria | 2272 |
| 187 | Ga0075363_100076507 | 3300006048 | Bacteria | 1825 |
| 188 | Ga0075363_100168184 | 3300006048 | Bacteria | 1244 |
| 189 | Ga0075363_100192631 | 3300006048 | Bacteria | 1163 |
| 190 | Ga0075363_100281369 | 3300006048 | Bacteria | 962 |
| 191 | Ga0075364_10037231 | 3300006051 | Bacteria | 3149 |
| 192 | Ga0075364_10098009 | 3300006051 | Bacteria | 1950 |
| 193 | Ga0075364_10100576 | 3300006051 | Bacteria | 1925 |
| 194 | Ga0075364_10132788 | 3300006051 | Bacteria | 1671 |
| 195 | Ga0075364_10510726 | 3300006051 | Bacteria | 821 |
| 196 | Ga0070715_10000375 | 3300006163 | Bacteria | 11180 |
| 197 | Ga0070715_10074126 | 3300006163 | Bacteria | 1528 |
| 198 | Ga0070715_10261202 | 3300006163 | Bacteria | 909 |
| 199 | Ga0070716_100001019 | 3300006173 | Bacteria | 12248 |
| 200 | Ga0070716_100088605 | 3300006173 | Bacteria | 1867 |
| 201 | Ga0070716_100152627 | 3300006173 | Bacteria | 1488 |
| 202 | Ga0070712_100012939 | 3300006175 | Bacteria | 5317 |
| 203 | Ga0070712_100054091 | 3300006175 | Bacteria | 2805 |
| 204 | Ga0070712_100148225 | 3300006175 | Bacteria | 1798 |
| 205 | Ga0070712_100340482 | 3300006175 | Bacteria | 1224 |
| 206 | Ga0075367_10059669 | 3300006178 | Bacteria | 2272 |
| 207 | Ga0075367_10060296 | 3300006178 | Bacteria | 2262 |
| 208 | Ga0075367_10062682 | 3300006178 | Bacteria | 2221 |
| 209 | Ga0075367_10081927 | 3300006178 | Bacteria | 1953 |
| 210 | Ga0075367_10233446 | 3300006178 | Bacteria | 1152 |
| 211 | Ga0075369_10010020 | 3300006186 | Bacteria | 3701 |
| 212 | Ga0075369_10052488 | 3300006186 | Bacteria | 1767 |
| 213 | Ga0075369_10117186 | 3300006186 | Bacteria | 1204 |
| 214 | Ga0075366_10006876 | 3300006195 | Bacteria | 6258 |
| 215 | Ga0075366_10092584 | 3300006195 | Bacteria | 1811 |
| 216 | Ga0097621_100169549 | 3300006237 | Bacteria | 1881 |
| 217 | Ga0075370_10137176 | 3300006353 | Bacteria | 1429 |
| 218 | Ga0075370_10168312 | 3300006353 | Bacteria | 1288 |
| 219 | Ga0075370_10323059 | 3300006353 | Bacteria | 919 |
| 220 | Ga0068871_100351962 | 3300006358 | Bacteria | 1303 |
| 221 | Ga0068871_100480077 | 3300006358 | Bacteria | 1118 |
| 222 | Ga0068871_101441619 | 3300006358 | Bacteria | 650 |
| 223 | Ga0075428_101294431 | 3300006844 | Bacteria | 767 |
| 224 | Ga0075434_100415364 | 3300006871 | Bacteria | 1366 |
| 225 | Ga0075434_100454685 | 3300006871 | Bacteria | 1302 |
| 226 | Ga0097620_100165357 | 3300006931 | Bacteria | 2292 |
| 227 | Ga0097620_100359636 | 3300006931 | Bacteria | 1551 |
| 228 | Ga0097620_100617831 | 3300006931 | Bacteria | 1176 |
| 229 | Ga0097620_100900124 | 3300006931 | Bacteria | 969 |
| 230 | Ga0099825_1013172 | 3300006941 | Bacteria | 8134 |
| 231 | Ga0099824_1025158 | 3300006942 | Bacteria | 3317 |
| 232 | Ga0099824_1053379 | 3300006942 | Bacteria | 717 |
| 233 | Ga0099794_10108827 | 3300007265 | Bacteria | 1387 |
| 234 | Ga0099794_10325812 | 3300007265 | Bacteria | 797 |
| 235 | Ga0099795_10008270 | 3300007788 | Bacteria | 2958 |
| 236 | Ga0099795_10008800 | 3300007788 | Bacteria | 2900 |
| 237 | Ga0105250_10064366 | 3300009092 | Bacteria | 1477 |
| 238 | Ga0105240_10010877 | 3300009093 | Bacteria | 12744 |
| 239 | Ga0105240_10169998 | 3300009093 | Bacteria | 2583 |
| 240 | Ga0105240_10180736 | 3300009093 | Bacteria | 2489 |
| 241 | Ga0105240_10943384 | 3300009093 | Bacteria | 926 |
| 242 | Ga0111539_10169924 | 3300009094 | Bacteria | 2548 |
| 243 | Ga0111539_11195894 | 3300009094 | Bacteria | 883 |
| 244 | Ga0105245_10129954 | 3300009098 | Bacteria | 2361 |
| 245 | Ga0105245_10210908 | 3300009098 | Bacteria | 1869 |
| 246 | Ga0105247_10049713 | 3300009101 | Bacteria | 2578 |
| 247 | Ga0105247_10158611 | 3300009101 | Bacteria | 1496 |
| 248 | Ga0105247_10283311 | 3300009101 | Bacteria | 1144 |
| 249 | Ga0105243_10035452 | 3300009148 | Bacteria | 3868 |
| 250 | Ga0105243_10141567 | 3300009148 | Bacteria | 2053 |
| 251 | Ga0105243_10196652 | 3300009148 | Bacteria | 1765 |
| 252 | Ga0105243_10220751 | 3300009148 | Bacteria | 1675 |
| 253 | Ga0105243_10447262 | 3300009148 | Bacteria | 1211 |
| 254 | Ga0105243_10953269 | 3300009148 | Bacteria | 857 |
| 255 | Ga0105243_11119732 | 3300009148 | Bacteria | 796 |
| 256 | Ga0105243_11309294 | 3300009148 | Bacteria | 742 |
| 257 | Ga0105241_10054213 | 3300009174 | Bacteria | 3068 |
| 258 | Ga0105241_10105000 | 3300009174 | Bacteria | 2252 |
| 259 | Ga0105241_10388083 | 3300009174 | Bacteria | 1222 |
| 260 | Ga0105241_10684884 | 3300009174 | Bacteria | 934 |
| 261 | Ga0105242_10179193 | 3300009176 | Bacteria | 1868 |
| 262 | Ga0105242_10346065 | 3300009176 | Bacteria | 1371 |
| 263 | Ga0105242_10377892 | 3300009176 | Bacteria | 1316 |
| 264 | Ga0105242_10441573 | 3300009176 | Bacteria | 1224 |
| 265 | Ga0105242_11593318 | 3300009176 | Bacteria | 686 |
| 266 | Ga0105248_10051239 | 3300009177 | Bacteria | 4632 |
| 267 | Ga0105248_10068603 | 3300009177 | Bacteria | 3981 |
| 268 | Ga0105248_10193501 | 3300009177 | Bacteria | 2292 |
| 269 | Ga0105248_10273822 | 3300009177 | Bacteria | 1901 |
| 270 | Ga0105248_10821740 | 3300009177 | Bacteria | 1049 |
| 271 | Ga0105248_10852723 | 3300009177 | Bacteria | 1028 |
| 272 | Ga0105248_10995342 | 3300009177 | Bacteria | 947 |
| 273 | Ga0105248_11017521 | 3300009177 | Bacteria | 936 |
| 274 | Ga0105237_10005066 | 3300009545 | Bacteria | 14969 |
| 275 | Ga0105237_10014113 | 3300009545 | Bacteria | 8359 |
| 276 | Ga0105237_10091868 | 3300009545 | Bacteria | 3025 |
| 277 | Ga0105237_10147105 | 3300009545 | Bacteria | 2351 |
| 278 | Ga0105237_10318227 | 3300009545 | Bacteria | 1559 |
| 279 | Ga0105237_10481348 | 3300009545 | Bacteria | 1247 |
| 280 | Ga0105237_11002228 | 3300009545 | Bacteria | 842 |
| 281 | Ga0105238_10344279 | 3300009551 | Bacteria | 1479 |
| 282 | Ga0105238_10484587 | 3300009551 | Bacteria | 1236 |
| 283 | Ga0105238_11036819 | 3300009551 | Bacteria | 842 |
| 284 | Ga0105249_10328458 | 3300009553 | Bacteria | 1543 |
| 285 | Ga0105249_10337489 | 3300009553 | Bacteria | 1523 |
| 286 | Ga0105249_10928879 | 3300009553 | Bacteria | 937 |
| 287 | Ga0099796_10008663 | 3300010159 | Bacteria | 2719 |
| 288 | Ga0105239_10096270 | 3300010375 | Bacteria | 3270 |
| 289 | Ga0105239_10177229 | 3300010375 | Bacteria | 2384 |
| 290 | Ga0105239_10195859 | 3300010375 | Bacteria | 2263 |
| 291 | Ga0105239_10278904 | 3300010375 | Bacteria | 1881 |
| 292 | Ga0105239_10381015 | 3300010375 | Bacteria | 1594 |
| 293 | Ga0105239_10421118 | 3300010375 | Bacteria | 1513 |
| 294 | Ga0105239_10561602 | 3300010375 | Bacteria | 1300 |
| 295 | Ga0105239_10819024 | 3300010375 | Bacteria | 1067 |
| 296 | Ga0105239_11033299 | 3300010375 | Bacteria | 945 |
| 297 | Ga0105246_10032962 | 3300011119 | Bacteria | 3439 |
| 298 | Ga0105246_10045259 | 3300011119 | Bacteria | 2996 |
| 299 | Ga0105246_10292029 | 3300011119 | Bacteria | 1312 |
| 300 | Ga0105246_11017143 | 3300011119 | Bacteria | 751 |
| 301 | Ga0157373_10137455 | 3300013100 | Bacteria | 1718 |
| 302 | Ga0157370_10497404 | 3300013104 | Bacteria | 1120 |
| 303 | Ga0157378_10630520 | 3300013297 | Bacteria | 1086 |
| 304 | Ga0163162_10031457 | 3300013306 | Bacteria | 5264 |
| 305 | Ga0163162_10058069 | 3300013306 | Bacteria | 3897 |
| 306 | Ga0163162_10073750 | 3300013306 | Bacteria | 3470 |
| 307 | Ga0163162_10303432 | 3300013306 | Bacteria | 1729 |
| 308 | Ga0163162_10529841 | 3300013306 | Bacteria | 1307 |
| 309 | Ga0163162_10747890 | 3300013306 | Bacteria | 1097 |
| 310 | Ga0163162_11271134 | 3300013306 | Bacteria | 836 |
| 311 | Ga0163162_11433730 | 3300013306 | Bacteria | 786 |
| 312 | Ga0157372_11058527 | 3300013307 | Bacteria | 939 |
| 313 | Ga0157375_10088023 | 3300013308 | Bacteria | 3159 |
| 314 | Ga0157375_10386304 | 3300013308 | Bacteria | 1567 |
| 315 | Ga0157375_10477603 | 3300013308 | Bacteria | 1412 |
| 316 | Ga0157375_11423878 | 3300013308 | Bacteria | 817 |
| 317 | Ga0157375_11830323 | 3300013308 | Bacteria | 720 |
| 318 | Ga0163163_10021432 | 3300014325 | Bacteria | 6100 |
| 319 | Ga0163163_10099735 | 3300014325 | Bacteria | 2926 |
| 320 | Ga0163163_10214291 | 3300014325 | Bacteria | 1975 |
| 321 | Ga0163163_10260966 | 3300014325 | Bacteria | 1783 |
| 322 | Ga0163163_10508442 | 3300014325 | Bacteria | 1267 |
| 323 | Ga0157380_10227515 | 3300014326 | Bacteria | 1672 |
| 324 | Ga0157380_10386195 | 3300014326 | Bacteria | 1323 |
| 325 | Ga0157380_10611034 | 3300014326 | Bacteria | 1080 |
| 326 | Ga0157377_10223472 | 3300014745 | Bacteria | 1207 |
| 327 | Ga0157377_10229994 | 3300014745 | Bacteria | 1192 |
| 328 | Ga0157379_10133485 | 3300014968 | Bacteria | 2236 |
| 329 | Ga0157379_10221728 | 3300014968 | Bacteria | 1713 |
| 330 | Ga0157379_10502654 | 3300014968 | Bacteria | 1124 |
| 331 | Ga0157379_10779769 | 3300014968 | Bacteria | 901 |
| 332 | Ga0157376_10117436 | 3300014969 | Bacteria | 2352 |
| 333 | Ga0157376_10151042 | 3300014969 | Bacteria | 2095 |
| 334 | Ga0157376_10187249 | 3300014969 | Bacteria | 1896 |
| 335 | Ga0157376_11443728 | 3300014969 | Bacteria | 720 |
| 336 | Ga0182007_10034887 | 3300015262 | Bacteria | 1697 |
| 337 | Ga0163161_10051652 | 3300017792 | Bacteria | 2979 |
| 338 | Ga0163161_10054139 | 3300017792 | Bacteria | 2911 |
| 339 | Ga0163161_10516453 | 3300017792 | Bacteria | 975 |
| 340 | Ga0214544_1000013 | 3300021320 | Bacteria | 228947 |
| 341 | Ga0214542_1000013 | 3300021321 | Bacteria | 234019 |
| 342 | Ga0214545_1000012 | 3300021324 | Bacteria | 187898 |
| 343 | Ga0214543_1000065 | 3300021327 | Bacteria | 126516 |
| 344 | Ga0213872_10020587 | 3300021361 | Bacteria | 3041 |
| 345 | Ga0213872_10081290 | 3300021361 | Bacteria | 1456 |
| 346 | Ga0213876_10005504 | 3300021384 | Bacteria | 6952 |
| 347 | Ga0213876_10214021 | 3300021384 | Bacteria | 1025 |
| 348 | Ga0207425_1014310 | 3300025245 | Bacteria | 1804 |
| 349 | Ga0209148_1000319 | 3300025254 | Bacteria | 67129 |
| 350 | Ga0209233_1009436 | 3300025261 | Bacteria | 2970 |
| 351 | Ga0209233_1015774 | 3300025261 | Bacteria | 2094 |
| 352 | Ga0209455_1003594 | 3300025272 | Bacteria | 5408 |
| 353 | Ga0209564_1001380 | 3300025295 | Bacteria | 25330 |
| 354 | Ga0209564_1003835 | 3300025295 | Bacteria | 9719 |
| 355 | Ga0209564_1066793 | 3300025295 | Bacteria | 770 |
| 356 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 357 | Ga0209758_1000097 | 3300025297 | Bacteria | 230529 |
| 358 | Ga0209758_1001430 | 3300025297 | Bacteria | 28210 |
| 359 | Ga0209758_1002041 | 3300025297 | Bacteria | 21649 |
| 360 | Ga0209758_1003765 | 3300025297 | Bacteria | 13401 |
| 361 | Ga0209758_1026690 | 3300025297 | Bacteria | 2491 |
| 362 | Ga0209758_1040682 | 3300025297 | Bacteria | 1750 |
| 363 | Ga0207426_1000624 | 3300025302 | Bacteria | 44994 |
| 364 | Ga0207426_1001451 | 3300025302 | Bacteria | 19603 |
| 365 | Ga0207426_1007728 | 3300025302 | Bacteria | 4460 |
| 366 | Ga0207426_1016481 | 3300025302 | Bacteria | 2652 |
| 367 | Ga0209257_1000201 | 3300025304 | Bacteria | 147272 |
| 368 | Ga0209257_1016006 | 3300025304 | Bacteria | 3065 |
| 369 | Ga0209257_1038057 | 3300025304 | Bacteria | 1461 |
| 370 | Ga0209257_1060449 | 3300025304 | Bacteria | 1031 |
| 371 | Ga0207697_10049786 | 3300025315 | Bacteria | 1730 |
| 372 | Ga0207653_10178900 | 3300025885 | Bacteria | 793 |
| 373 | Ga0207682_10298062 | 3300025893 | Bacteria | 755 |
| 374 | Ga0207692_10010166 | 3300025898 | Bacteria | 3957 |
| 375 | Ga0207692_10140044 | 3300025898 | Bacteria | 1375 |
| 376 | Ga0207692_10396121 | 3300025898 | Bacteria | 860 |
| 377 | Ga0207642_10004478 | 3300025899 | Bacteria | 4510 |
| 378 | Ga0207642_10324907 | 3300025899 | Bacteria | 900 |
| 379 | Ga0207710_10086136 | 3300025900 | Bacteria | 1464 |
| 380 | Ga0207710_10103285 | 3300025900 | Bacteria | 1347 |
| 381 | Ga0207710_10180397 | 3300025900 | Bacteria | 1036 |
| 382 | Ga0207710_10357368 | 3300025900 | Bacteria | 745 |
| 383 | Ga0207688_10042362 | 3300025901 | Bacteria | 2535 |
| 384 | Ga0207688_10053597 | 3300025901 | Bacteria | 2262 |
| 385 | Ga0207688_10156463 | 3300025901 | Bacteria | 1349 |
| 386 | Ga0207688_10221559 | 3300025901 | Bacteria | 1140 |
| 387 | Ga0207688_10279757 | 3300025901 | Bacteria | 1016 |
| 388 | Ga0207688_10327720 | 3300025901 | Bacteria | 940 |
| 389 | Ga0207680_10523479 | 3300025903 | Bacteria | 845 |
| 390 | Ga0207647_10026721 | 3300025904 | Bacteria | 3773 |
| 391 | Ga0207647_10028852 | 3300025904 | Bacteria | 3599 |
| 392 | Ga0207647_10062717 | 3300025904 | Bacteria | 2263 |
| 393 | Ga0207685_10032838 | 3300025905 | Unclassified | 1871 |
| 394 | Ga0207685_10071488 | 3300025905 | Bacteria | 1408 |
| 395 | Ga0207699_10005178 | 3300025906 | Bacteria | 6237 |
| 396 | Ga0207699_10015917 | 3300025906 | Bacteria | 3921 |
| 397 | Ga0207645_10165423 | 3300025907 | Bacteria | 1448 |
| 398 | Ga0207643_10434930 | 3300025908 | Bacteria | 833 |
| 399 | Ga0207684_10248755 | 3300025910 | Bacteria | 1534 |
| 400 | Ga0207654_10024645 | 3300025911 | Bacteria | 3237 |
| 401 | Ga0207654_10026168 | 3300025911 | Bacteria | 3156 |
| 402 | Ga0207654_10090418 | 3300025911 | Bacteria | 1865 |
| 403 | Ga0207654_10262070 | 3300025911 | Bacteria | 1163 |
| 404 | Ga0207654_10527217 | 3300025911 | Bacteria | 837 |
| 405 | Ga0207695_10000240 | 3300025913 | Bacteria | 143196 |
| 406 | Ga0207695_10105874 | 3300025913 | Bacteria | 2799 |
| 407 | Ga0207695_10211943 | 3300025913 | Bacteria | 1847 |
| 408 | Ga0207671_10002558 | 3300025914 | Bacteria | 19311 |
| 409 | Ga0207671_10061143 | 3300025914 | Bacteria | 2795 |
| 410 | Ga0207671_10088938 | 3300025914 | Bacteria | 2324 |
| 411 | Ga0207671_10244480 | 3300025914 | Bacteria | 1410 |
| 412 | Ga0207671_10254132 | 3300025914 | Bacteria | 1382 |
| 413 | Ga0207693_10002089 | 3300025915 | Bacteria | 17466 |
| 414 | Ga0207693_10019541 | 3300025915 | Bacteria | 5387 |
| 415 | Ga0207693_10087181 | 3300025915 | Bacteria | 2446 |
| 416 | Ga0207693_10193679 | 3300025915 | Bacteria | 1599 |
| 417 | Ga0207663_10001142 | 3300025916 | Bacteria | 12236 |
| 418 | Ga0207663_10016886 | 3300025916 | Bacteria | 4059 |
| 419 | Ga0207660_10121892 | 3300025917 | Bacteria | 1975 |
| 420 | Ga0207660_10210454 | 3300025917 | Bacteria | 1522 |
| 421 | Ga0207657_10065566 | 3300025919 | Bacteria | 3095 |
| 422 | Ga0207657_10066394 | 3300025919 | Bacteria | 3071 |
| 423 | Ga0207657_10199560 | 3300025919 | Bacteria | 1610 |
| 424 | Ga0207657_10222298 | 3300025919 | Bacteria | 1512 |
| 425 | Ga0207649_10078370 | 3300025920 | Bacteria | 2132 |
| 426 | Ga0207652_10287823 | 3300025921 | Bacteria | 1483 |
| 427 | Ga0207652_10974864 | 3300025921 | Bacteria | 746 |
| 428 | Ga0207646_10334697 | 3300025922 | Bacteria | 1368 |
| 429 | Ga0207681_10087353 | 3300025923 | Bacteria | 2219 |
| 430 | Ga0207694_10175678 | 3300025924 | Bacteria | 1735 |
| 431 | Ga0207694_10197881 | 3300025924 | Bacteria | 1634 |
| 432 | Ga0207650_10362762 | 3300025925 | Bacteria | 1194 |
| 433 | Ga0207659_10792341 | 3300025926 | Bacteria | 814 |
| 434 | Ga0207687_10152740 | 3300025927 | Bacteria | 1763 |
| 435 | Ga0207687_10301737 | 3300025927 | Bacteria | 1290 |
| 436 | Ga0207687_10632969 | 3300025927 | Bacteria | 904 |
| 437 | Ga0207700_10006146 | 3300025928 | Bacteria | 7233 |
| 438 | Ga0207700_10171192 | 3300025928 | Bacteria | 1812 |
| 439 | Ga0207664_10018451 | 3300025929 | Bacteria | 5137 |
| 440 | Ga0207664_10208746 | 3300025929 | Bacteria | 1689 |
| 441 | Ga0207664_10288492 | 3300025929 | Unclassified | 1442 |
| 442 | Ga0207644_10136629 | 3300025931 | Bacteria | 1883 |
| 443 | Ga0207644_10188394 | 3300025931 | Bacteria | 1621 |
| 444 | Ga0207690_10652755 | 3300025932 | Bacteria | 862 |
| 445 | Ga0207706_10045771 | 3300025933 | Bacteria | 3876 |
| 446 | Ga0207706_10072699 | 3300025933 | Bacteria | 3024 |
| 447 | Ga0207706_10171426 | 3300025933 | Bacteria | 1907 |
| 448 | Ga0207706_10293970 | 3300025933 | Bacteria | 1416 |
| 449 | Ga0207686_10065047 | 3300025934 | Bacteria | 2324 |
| 450 | Ga0207709_10022961 | 3300025935 | Bacteria | 3545 |
| 451 | Ga0207709_10048263 | 3300025935 | Bacteria | 2593 |
| 452 | Ga0207709_10362493 | 3300025935 | Bacteria | 1098 |
| 453 | Ga0207670_10220005 | 3300025936 | Bacteria | 1453 |
| 454 | Ga0207669_10016667 | 3300025937 | Bacteria | 3741 |
| 455 | Ga0207669_10190403 | 3300025937 | Bacteria | 1479 |
| 456 | Ga0207704_10016698 | 3300025938 | Bacteria | 3781 |
| 457 | Ga0207665_10002085 | 3300025939 | Bacteria | 13500 |
| 458 | Ga0207665_10163618 | 3300025939 | Bacteria | 1602 |
| 459 | Ga0207691_10023461 | 3300025940 | Bacteria | 5808 |
| 460 | Ga0207691_10127129 | 3300025940 | Bacteria | 2254 |
| 461 | Ga0207691_10143517 | 3300025940 | Bacteria | 2103 |
| 462 | Ga0207691_10400364 | 3300025940 | Bacteria | 1171 |
| 463 | Ga0207691_11001979 | 3300025940 | Bacteria | 697 |
| 464 | Ga0207711_10007853 | 3300025941 | Bacteria | 8919 |
| 465 | Ga0207711_10033013 | 3300025941 | Bacteria | 4378 |
| 466 | Ga0207711_10496353 | 3300025941 | Bacteria | 1137 |
| 467 | Ga0207711_10601433 | 3300025941 | Bacteria | 1026 |
| 468 | Ga0207711_10616291 | 3300025941 | Bacteria | 1013 |
| 469 | Ga0207711_10793579 | 3300025941 | Bacteria | 882 |
| 470 | Ga0207689_10014948 | 3300025942 | Bacteria | 6586 |
| 471 | Ga0207689_10304524 | 3300025942 | Bacteria | 1321 |
| 472 | Ga0207689_10382905 | 3300025942 | Bacteria | 1171 |
| 473 | Ga0207689_10436540 | 3300025942 | Bacteria | 1093 |
| 474 | Ga0207689_10579743 | 3300025942 | Bacteria | 943 |
| 475 | Ga0207661_10024141 | 3300025944 | Bacteria | 4603 |
| 476 | Ga0207679_10095198 | 3300025945 | Bacteria | 2314 |
| 477 | Ga0207679_10133218 | 3300025945 | Bacteria | 1997 |
| 478 | Ga0207679_10366036 | 3300025945 | Bacteria | 1260 |
| 479 | Ga0207667_10204841 | 3300025949 | Bacteria | 2023 |
| 480 | Ga0207712_10145797 | 3300025961 | Bacteria | 1822 |
| 481 | Ga0207712_10283488 | 3300025961 | Bacteria | 1353 |
| 482 | Ga0207668_10060228 | 3300025972 | Bacteria | 2663 |
| 483 | Ga0207668_10084266 | 3300025972 | Bacteria | 2315 |
| 484 | Ga0207668_10244942 | 3300025972 | Bacteria | 1452 |
| 485 | Ga0207640_10153939 | 3300025981 | Bacteria | 1692 |
| 486 | Ga0207658_10252466 | 3300025986 | Bacteria | 1499 |
| 487 | Ga0207658_10768282 | 3300025986 | Bacteria | 873 |
| 488 | Ga0207677_10015943 | 3300026023 | Bacteria | 4436 |
| 489 | Ga0207677_10128928 | 3300026023 | Bacteria | 1917 |
| 490 | Ga0207677_10584901 | 3300026023 | Bacteria | 978 |
| 491 | Ga0207703_10204566 | 3300026035 | Bacteria | 1756 |
| 492 | Ga0207703_10231370 | 3300026035 | Bacteria | 1657 |
| 493 | Ga0207703_10838580 | 3300026035 | Bacteria | 879 |
| 494 | Ga0207703_10860828 | 3300026035 | Bacteria | 867 |
| 495 | Ga0207703_10898011 | 3300026035 | Bacteria | 848 |
| 496 | Ga0207639_10071039 | 3300026041 | Bacteria | 2721 |
| 497 | Ga0207639_10073390 | 3300026041 | Bacteria | 2682 |
| 498 | Ga0207639_10213531 | 3300026041 | Bacteria | 1662 |
| 499 | Ga0207639_10328161 | 3300026041 | Bacteria | 1361 |
| 500 | Ga0207639_10388585 | 3300026041 | Bacteria | 1255 |
| 501 | Ga0207639_10508870 | 3300026041 | Bacteria | 1101 |
| 502 | Ga0207639_10680882 | 3300026041 | Bacteria | 953 |
| 503 | Ga0207639_10816530 | 3300026041 | Bacteria | 869 |
| 504 | Ga0207678_10003596 | 3300026067 | Bacteria | 13930 |
| 505 | Ga0207678_10011597 | 3300026067 | Bacteria | 7743 |
| 506 | Ga0207678_10026386 | 3300026067 | Bacteria | 5069 |
| 507 | Ga0207678_10060081 | 3300026067 | Bacteria | 3270 |
| 508 | Ga0207678_10071540 | 3300026067 | Bacteria | 2974 |
| 509 | Ga0207678_10081677 | 3300026067 | Bacteria | 2767 |
| 510 | Ga0207678_10108380 | 3300026067 | Bacteria | 2369 |
| 511 | Ga0207678_10166050 | 3300026067 | Bacteria | 1885 |
| 512 | Ga0207678_10437867 | 3300026067 | Bacteria | 1135 |
| 513 | Ga0207678_10993879 | 3300026067 | Bacteria | 743 |
| 514 | Ga0207708_10154498 | 3300026075 | Bacteria | 1809 |
| 515 | Ga0207702_10184364 | 3300026078 | Bacteria | 1924 |
| 516 | Ga0207702_10393911 | 3300026078 | Bacteria | 1334 |
| 517 | Ga0207641_10188351 | 3300026088 | Bacteria | 1895 |
| 518 | Ga0207641_10211920 | 3300026088 | Bacteria | 1792 |
| 519 | Ga0207641_11299022 | 3300026088 | Bacteria | 728 |
| 520 | Ga0207648_10018263 | 3300026089 | Bacteria | 6353 |
| 521 | Ga0207648_10180743 | 3300026089 | Bacteria | 1867 |
| 522 | Ga0207648_10391941 | 3300026089 | Bacteria | 1257 |
| 523 | Ga0207648_11054145 | 3300026089 | Bacteria | 762 |
| 524 | Ga0207676_10191710 | 3300026095 | Bacteria | 1799 |
| 525 | Ga0207676_10660886 | 3300026095 | Bacteria | 1009 |
| 526 | Ga0207674_10065697 | 3300026116 | Bacteria | 3656 |
| 527 | Ga0207674_10480234 | 3300026116 | Bacteria | 1201 |
| 528 | Ga0207675_100075495 | 3300026118 | Bacteria | 3155 |
| 529 | Ga0207675_100077932 | 3300026118 | Bacteria | 3105 |
| 530 | Ga0207675_100242260 | 3300026118 | Bacteria | 1743 |
| 531 | Ga0207675_100242955 | 3300026118 | Bacteria | 1740 |
| 532 | Ga0207675_100371406 | 3300026118 | Bacteria | 1405 |
| 533 | Ga0207675_100669599 | 3300026118 | Bacteria | 1045 |
| 534 | Ga0207675_100748478 | 3300026118 | Bacteria | 988 |
| 535 | Ga0207683_10067391 | 3300026121 | Bacteria | 3158 |
| 536 | Ga0207683_10068087 | 3300026121 | Bacteria | 3142 |
| 537 | Ga0207683_10225450 | 3300026121 | Bacteria | 1708 |
| 538 | Ga0207683_10229165 | 3300026121 | Bacteria | 1694 |
| 539 | Ga0207683_10262334 | 3300026121 | Bacteria | 1577 |
| 540 | Ga0207683_10358909 | 3300026121 | Bacteria | 1338 |
| 541 | Ga0207683_10751510 | 3300026121 | Bacteria | 905 |
| 542 | Ga0207698_10048144 | 3300026142 | Bacteria | 3235 |
| 543 | Ga0207698_10056286 | 3300026142 | Bacteria | 3036 |
| 544 | Ga0207698_10140596 | 3300026142 | Bacteria | 2079 |
| 545 | Ga0207698_10542858 | 3300026142 | Bacteria | 1138 |
| 546 | Ga0207698_10728485 | 3300026142 | Bacteria | 989 |
| 547 | Ga0209389_1000060 | 3300027296 | Bacteria | 106050 |
| 548 | Ga0209389_1000188 | 3300027296 | Bacteria | 46884 |
| 549 | Ga0209589_1000062 | 3300027357 | Bacteria | 106048 |
| 550 | Ga0209489_101714 | 3300027361 | Bacteria | 45077 |
| 551 | Ga0209489_113907 | 3300027361 | Bacteria | 6096 |
| 552 | Ga0209700_100437 | 3300027363 | Bacteria | 76868 |
| 553 | Ga0207428_10250158 | 3300027907 | Bacteria | 1322 |
| 554 | Ga0268266_10004379 | 3300028379 | Bacteria | 13548 |
| 555 | Ga0268266_10038047 | 3300028379 | Bacteria | 4097 |
| 556 | Ga0268266_10048162 | 3300028379 | Bacteria | 3652 |
| 557 | Ga0268266_10157317 | 3300028379 | Bacteria | 2054 |
| 558 | Ga0268266_10300642 | 3300028379 | Bacteria | 1497 |
| 559 | Ga0268266_10537726 | 3300028379 | Bacteria | 1118 |
| 560 | Ga0268265_10210923 | 3300028380 | Bacteria | 1692 |
| 561 | Ga0268265_10392349 | 3300028380 | Bacteria | 1280 |
| 562 | Ga0268265_10827395 | 3300028380 | Bacteria | 904 |
| 563 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 564 | Ga0268264_10052221 | 3300028381 | Bacteria | 3408 |
| 565 | Ga0268264_10146324 | 3300028381 | Bacteria | 2113 |
| 566 | Ga0268264_10164971 | 3300028381 | Bacteria | 1999 |
| 567 | Ga0265326_10002308 | 3300028558 | Bacteria | 6446 |
| 568 | Ga0265319_1016741 | 3300028563 | Bacteria | 2806 |
| 569 | Ga0265334_10001077 | 3300028573 | Bacteria | 13349 |
| 570 | Ga0265323_10001752 | 3300028653 | Bacteria | 10296 |
| 571 | Ga0265322_10004954 | 3300028654 | Bacteria | 3950 |
| 572 | Ga0265336_10001643 | 3300028666 | Bacteria | 9912 |
| 573 | Ga0307515_10042340 | 3300028794 | Bacteria | 7127 |
| 574 | Ga0307515_10109512 | 3300028794 | Bacteria | 3243 |
| 575 | Ga0307515_10411918 | 3300028794 | Bacteria | 974 |
| 576 | Ga0307515_10503777 | 3300028794 | Bacteria | 821 |
| 577 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 578 | Ga0265324_10005453 | 3300029957 | Bacteria | 5494 |
| 579 | Ga0265320_10063898 | 3300031240 | Bacteria | 1750 |
| 580 | Ga0265340_10035185 | 3300031247 | Bacteria | 2488 |
| 581 | Ga0265340_10118474 | 3300031247 | Bacteria | 1219 |
| 582 | Ga0265339_10007191 | 3300031249 | Bacteria | 7215 |
| 583 | Ga0265339_10008906 | 3300031249 | Bacteria | 6353 |
| 584 | Ga0265339_10185500 | 3300031249 | Bacteria | 1034 |
| 585 | Ga0307513_10161197 | 3300031456 | Bacteria | 2136 |
| 586 | Ga0307509_10076466 | 3300031507 | Bacteria | 3474 |
| 587 | Ga0307509_10479408 | 3300031507 | Bacteria | 932 |
| 588 | Ga0307508_10016258 | 3300031616 | Bacteria | 6773 |
| 589 | Ga0307508_10067251 | 3300031616 | Bacteria | 3152 |
| 590 | Ga0265314_10034725 | 3300031711 | Bacteria | 3681 |
| 591 | Ga0265342_10048846 | 3300031712 | Bacteria | 2534 |
| 592 | Ga0307516_10273434 | 3300031730 | Bacteria | 1374 |
| 593 | Ga0307516_10374215 | 3300031730 | Bacteria | 1087 |
| 594 | Ga0307405_10164710 | 3300031731 | Bacteria | 1575 |
| 595 | Ga0307405_10253375 | 3300031731 | Bacteria | 1311 |
| 596 | Ga0307410_10095307 | 3300031852 | Bacteria | 2122 |
| 597 | Ga0307406_10289470 | 3300031901 | Bacteria | 1253 |
| 598 | Ga0307412_10156006 | 3300031911 | Bacteria | 1690 |
| 599 | Ga0307412_10411398 | 3300031911 | Bacteria | 1104 |
| 600 | Ga0307412_10429205 | 3300031911 | Bacteria | 1083 |
| 601 | Ga0307412_10733133 | 3300031911 | Bacteria | 851 |
| 602 | Ga0307412_10816596 | 3300031911 | Bacteria | 811 |
| 603 | Ga0307416_100176674 | 3300032002 | Bacteria | 1996 |
| 604 | Ga0307414_10579144 | 3300032004 | Bacteria | 1004 |
| 605 | Ga0307411_10159601 | 3300032005 | Bacteria | 1687 |
| 606 | Ga0307415_100393108 | 3300032126 | Bacteria | 1181 |
| 607 | Ga0307510_10003003 | 3300033180 | Bacteria | 19416 |
| 608 | Ga0307510_10019538 | 3300033180 | Bacteria | 7944 |
| 609 | Ga0373934_0010877 | 3300035086 | Bacteria | 3421 |
| 610 | Ga0373936_0010587 | 3300035113 | Bacteria | 3481 |
| 611 | Ga0373954_0186590 | 3300035118 | Bacteria | 1017 |
| 612 | Ga0373956_0198206 | 3300035119 | Bacteria | 951 |
| 613 | Ga0373946_0183440 | 3300035171 | Bacteria | 994 |
| 614 | Ga0373931_0108054 | 3300035691 | Bacteria | 1574 |
| 615 | Ga0373935_0547281 | 3300035692 | Bacteria | 843 |
| 616 | Ga0373927_0046821 | 3300035695 | Bacteria | 2797 |
| 617 | Ga0373927_0184348 | 3300035695 | Bacteria | 1369 |
| 618 | Ga0373933_0010551 | 3300035724 | Bacteria | 5065 |
| 619 | Ga0373947_0008141 | 3300035725 | Bacteria | 6045 |
| 620 | Ga0373947_0207416 | 3300035725 | Bacteria | 1284 |
| 621 | Ga0373947_0602183 | 3300035725 | Bacteria | 749 |
| 622 | Ga0373937_0795344 | 3300036401 | Bacteria | 893 |
| 623 | Ga0373925_0320138 | 3300037068 | Bacteria | 1255 |
| 624 | Ga0373925_0768826 | 3300037068 | Bacteria | 794 |
| 625 | Ga0395900_0002185 | 3300037418 | Bacteria | 21860 |
| 626 | Ga0395900_0052611 | 3300037418 | Bacteria | 4192 |
| 627 | Ga0395898_0003639 | 3300037466 | Bacteria | 17131 |
| 628 | Ga0395905_0013071 | 3300037471 | Bacteria | 7971 |
| 629 | Ga0395905_0262755 | 3300037471 | Bacteria | 1611 |
| 630 | Ga0395905_0552294 | 3300037471 | Bacteria | 1053 |
| 631 | Ga0436364_0792686 | 3300037853 | Bacteria | 1066 |
| 632 | Ga0395901_0004684 | 3300038443 | Bacteria | 13792 |
| 633 | Ga0395901_0381792 | 3300038443 | Bacteria | 1450 |
| 634 | Ga0395901_0950641 | 3300038443 | Bacteria | 838 |
| 635 | Ga0436365_0163573 | 3300039437 | Bacteria | 1281 |
| 636 | Ga0436365_0797309 | 3300039437 | Bacteria | 23338 |
| 637 | Ga0436360_0139800 | 3300039438 | Bacteria | 4468 |
| 638 | Ga0436360_0486890 | 3300039438 | Bacteria | 1855 |
| 639 | Ga0436360_0751927 | 3300039438 | Bacteria | 909 |
| 640 | Ga0436361_0911132 | 3300039447 | Bacteria | 752 |
| 641 | Ga0436361_1122186 | 3300039447 | Bacteria | 2287 |
| 642 | Ga0436363_0405860 | 3300039450 | Bacteria | 4329 |
| 643 | Ga0436363_0657400 | 3300039450 | Bacteria | 1384 |
| 644 | Ga0436363_1578383 | 3300039450 | Bacteria | 1091 |
| 645 | Ga0436362_1242730 | 3300039453 | Bacteria | 6064 |
| 646 | Ga0451787_023315 | 3300041441 | Bacteria | 988 |
| 647 | Ga0451791_1294712 | 3300041451 | Bacteria | 937 |
| 648 | Ga0451793_0382415 | 3300041452 | Bacteria | 698 |
| 649 | Ga0451793_0590245 | 3300041452 | Bacteria | 690 |
| 650 | Ga0451795_1237397 | 3300041456 | Bacteria | 1261 |
| 651 | Ga0451802_0169445 | 3300041460 | Bacteria | 955 |
| 652 | Ga0451802_2093298 | 3300041460 | Bacteria | 1373 |
| 653 | Ga0451837_1100542 | 3300041494 | Bacteria | 941 |
| 654 | Ga0451849_0759887 | 3300041505 | Bacteria | 1180 |
| 655 | Ga0466972_0000576 | 3300044658 | Bacteria | 17815 |
| 656 | Ga0466965_0077683 | 3300044683 | Bacteria | 1676 |
| 657 | Ga0466966_0082784 | 3300044684 | Bacteria | 1997 |
| 658 | Ga0466961_0190585 | 3300044693 | Bacteria | 1271 |
| 659 | Ga0466963_0320087 | 3300044694 | Bacteria | 1091 |
| 660 | Ga0466971_0045755 | 3300044719 | Bacteria | 1966 |
| 661 | Ga0466968_0000783 | 3300044735 | Bacteria | 11080 |
| 662 | Ga0466968_0192678 | 3300044735 | Bacteria | 952 |
| 663 | Ga0466960_0111278 | 3300044901 | Bacteria | 1423 |
| 664 | Ga0466959_0068194 | 3300045049 | Bacteria | 2578 |
| 665 | Ga0466958_0521981 | 3300045836 | Bacteria | 771 |
| 666 | Ga0466967_0052907 | 3300045976 | Bacteria | 3567 |
| 667 | Ga0466967_0254910 | 3300045976 | Bacteria | 1677 |
| 668 | Ga0466967_0308948 | 3300045976 | Bacteria | 1523 |
| 669 | Ga0495627_074872 | 3300046453 | Bacteria | 986 |
| 670 | Ga0495592_0077291 | 3300046454 | Bacteria | 2413 |
| 671 | Ga0495603_0003185 | 3300046455 | Bacteria | 9760 |
| 672 | Ga0495603_0059812 | 3300046455 | Bacteria | 2252 |
| 673 | Ga0495603_0089386 | 3300046455 | Bacteria | 1802 |
| 674 | Ga0495603_0118704 | 3300046455 | Bacteria | 1542 |
| 675 | Ga0495603_0471309 | 3300046455 | Bacteria | 719 |
| 676 | Ga0495590_0056244 | 3300046457 | Bacteria | 1375 |
| 677 | Ga0495590_0090769 | 3300046457 | Bacteria | 1080 |
| 678 | Ga0495590_0153420 | 3300046457 | Bacteria | 835 |
| 679 | Ga0495629_0015079 | 3300046459 | Bacteria | 5555 |
| 680 | Ga0495638_0002654 | 3300046460 | Bacteria | 14392 |
| 681 | Ga0495638_0020245 | 3300046460 | Bacteria | 4395 |
| 682 | Ga0495638_0027347 | 3300046460 | Bacteria | 3692 |
| 683 | Ga0495638_0035036 | 3300046460 | Bacteria | 3200 |
| 684 | Ga0495638_0112339 | 3300046460 | Bacteria | 1617 |
| 685 | Ga0495651_0109977 | 3300046462 | Bacteria | 2039 |
| 686 | Ga0495653_0057045 | 3300046463 | Bacteria | 2975 |
| 687 | Ga0495650_0078522 | 3300046471 | Bacteria | 1278 |
| 688 | Ga0495580_0210427 | 3300046472 | Bacteria | 1338 |
| 689 | Ga0495582_0089972 | 3300046473 | Bacteria | 1711 |
| 690 | Ga0495605_0069723 | 3300046474 | Bacteria | 1664 |
| 691 | Ga0495605_0197195 | 3300046474 | Bacteria | 879 |
| 692 | Ga0495662_0045488 | 3300046476 | Bacteria | 2119 |
| 693 | Ga0495664_0006969 | 3300046477 | Bacteria | 6261 |
| 694 | Ga0495664_0028061 | 3300046477 | Bacteria | 3286 |
| 695 | Ga0495664_0394036 | 3300046477 | Bacteria | 832 |
| 696 | Ga0495584_0063644 | 3300046491 | Bacteria | 1854 |
| 697 | Ga0495584_0083426 | 3300046491 | Bacteria | 1609 |
| 698 | Ga0495584_0304150 | 3300046491 | Bacteria | 810 |
| 699 | Ga0495585_0134418 | 3300046492 | Bacteria | 1299 |
| 700 | Ga0495585_0187554 | 3300046492 | Bacteria | 1060 |
| 701 | Ga0495596_0234604 | 3300046500 | Bacteria | 712 |
| 702 | Ga0495607_0012642 | 3300046501 | Bacteria | 5562 |
| 703 | Ga0495583_0177598 | 3300046506 | Bacteria | 873 |
| 704 | Ga0495583_0194374 | 3300046506 | Bacteria | 826 |
| 705 | Ga0495606_0000939 | 3300046507 | Bacteria | 42966 |
| 706 | Ga0495606_0033500 | 3300046507 | Bacteria | 3542 |
| 707 | Ga0495606_0065635 | 3300046507 | Bacteria | 2305 |
| 708 | Ga0495606_0166732 | 3300046507 | Bacteria | 1281 |
| 709 | Ga0495606_0198245 | 3300046507 | Bacteria | 1146 |
| 710 | Ga0495606_0264667 | 3300046507 | Bacteria | 947 |
| 711 | Ga0495608_0014306 | 3300046511 | Bacteria | 5505 |
| 712 | Ga0495608_0043609 | 3300046511 | Bacteria | 2997 |
| 713 | Ga0495610_0078178 | 3300046512 | Bacteria | 1526 |
| 714 | Ga0495610_0142738 | 3300046512 | Bacteria | 1029 |
| 715 | Ga0495616_0069582 | 3300046513 | Bacteria | 1706 |
| 716 | Ga0495616_0226383 | 3300046513 | Bacteria | 812 |
| 717 | Ga0495618_0025347 | 3300046514 | Bacteria | 3680 |
| 718 | Ga0495618_0160656 | 3300046514 | Bacteria | 1432 |
| 719 | Ga0495620_0039967 | 3300046515 | Bacteria | 2069 |
| 720 | Ga0495620_0047059 | 3300046515 | Bacteria | 1859 |
| 721 | Ga0495628_0032399 | 3300046516 | Bacteria | 4219 |
| 722 | Ga0495630_0349398 | 3300046517 | Bacteria | 1132 |
| 723 | Ga0495631_0025915 | 3300046518 | Bacteria | 2696 |
| 724 | Ga0495631_0311307 | 3300046518 | Bacteria | 670 |
| 725 | Ga0495632_0070725 | 3300046519 | Bacteria | 1678 |
| 726 | Ga0495632_0220480 | 3300046519 | Bacteria | 858 |
| 727 | Ga0495632_0229103 | 3300046519 | Bacteria | 838 |
| 728 | Ga0495632_0345254 | 3300046519 | Bacteria | 655 |
| 729 | Ga0495637_0053267 | 3300046520 | Bacteria | 1685 |
| 730 | Ga0495637_0212186 | 3300046520 | Bacteria | 708 |
| 731 | Ga0495643_0024202 | 3300046522 | Bacteria | 3446 |
| 732 | Ga0495648_0009119 | 3300046524 | Bacteria | 7737 |
| 733 | Ga0495648_0071020 | 3300046524 | Bacteria | 2020 |
| 734 | Ga0495648_0088775 | 3300046524 | Bacteria | 1737 |
| 735 | Ga0495648_0130145 | 3300046524 | Bacteria | 1339 |
| 736 | Ga0495648_0153359 | 3300046524 | Bacteria | 1199 |
| 737 | Ga0495648_0300011 | 3300046524 | Bacteria | 753 |
| 738 | Ga0495666_0073555 | 3300046526 | Bacteria | 1622 |
| 739 | Ga0495652_0057963 | 3300046529 | Bacteria | 3282 |
| 740 | Ga0495654_0103628 | 3300046530 | Bacteria | 1306 |
| 741 | Ga0495665_0334218 | 3300046531 | Bacteria | 773 |
| 742 | Ga0495640_0016226 | 3300046533 | Bacteria | 5576 |
| 743 | Ga0495586_0008566 | 3300046535 | Bacteria | 5445 |
| 744 | Ga0495587_0058859 | 3300046536 | Bacteria | 2256 |
| 745 | Ga0495587_0115650 | 3300046536 | Bacteria | 1539 |
| 746 | Ga0495598_0020585 | 3300046537 | Bacteria | 1744 |
| 747 | Ga0495609_0097647 | 3300046538 | Bacteria | 1274 |
| 748 | Ga0495609_0215207 | 3300046538 | Bacteria | 799 |
| 749 | Ga0495597_0034811 | 3300046542 | Bacteria | 2275 |
| 750 | Ga0495597_0121964 | 3300046542 | Bacteria | 1086 |
| 751 | Ga0495645_0173379 | 3300046543 | Bacteria | 1483 |
| 752 | Ga0495622_0023849 | 3300046557 | Bacteria | 2854 |
| 753 | Ga0495622_0068065 | 3300046557 | Bacteria | 1645 |
| 754 | Ga0495622_0090186 | 3300046557 | Bacteria | 1408 |
| 755 | Ga0495622_0250859 | 3300046557 | Bacteria | 778 |
| 756 | Ga0495667_0058053 | 3300046559 | Bacteria | 2542 |
| 757 | Ga0495667_0199124 | 3300046559 | Bacteria | 1282 |
| 758 | Ga0495667_0258068 | 3300046559 | Bacteria | 1109 |
| 759 | Ga0495656_0126171 | 3300046615 | Bacteria | 1213 |
| 760 | Ga0495656_0149067 | 3300046615 | Bacteria | 1128 |
| 761 | Ga0495668_0036492 | 3300046616 | Bacteria | 2754 |
| 762 | Ga0495668_0044643 | 3300046616 | Bacteria | 2463 |
| 763 | Ga0495668_0085577 | 3300046616 | Bacteria | 1729 |
| 764 | Ga0495668_0146911 | 3300046616 | Bacteria | 1291 |
| 765 | Ga0495668_0158442 | 3300046616 | Bacteria | 1240 |
| 766 | Ga0495668_0179540 | 3300046616 | Bacteria | 1160 |
| 767 | Ga0495668_0355124 | 3300046616 | Bacteria | 804 |
| 768 | Ga0495634_0067697 | 3300046642 | Bacteria | 2361 |
| 769 | Ga0495611_0043538 | 3300046648 | Bacteria | 2007 |
| 770 | Ga0495611_0053168 | 3300046648 | Bacteria | 1828 |
| 771 | Ga0495611_0065363 | 3300046648 | Bacteria | 1657 |
| 772 | Ga0495611_0190612 | 3300046648 | Bacteria | 957 |
| 773 | Ga0495625_0110808 | 3300046660 | Bacteria | 1876 |
| 774 | Ga0495625_0366273 | 3300046660 | Bacteria | 907 |
| 775 | Ga0495625_0496367 | 3300046660 | Bacteria | 747 |
| 776 | Ga0495659_0026904 | 3300046664 | Bacteria | 1980 |
| 777 | Ga0495659_0054086 | 3300046664 | Bacteria | 1468 |
| 778 | Ga0495659_0116327 | 3300046664 | Bacteria | 1049 |
| 779 | Ga0495661_0008267 | 3300046665 | Bacteria | 7208 |
| 780 | Ga0495588_0002645 | 3300046674 | Bacteria | 7675 |
| 781 | Ga0495588_0024706 | 3300046674 | Bacteria | 2987 |
| 782 | Ga0495588_0080765 | 3300046674 | Bacteria | 1697 |
| 783 | Ga0495599_0046840 | 3300046678 | Bacteria | 2711 |
| 784 | Ga0495599_0299733 | 3300046678 | Bacteria | 970 |
| 785 | Ga0495623_0012115 | 3300046679 | Bacteria | 5584 |
| 786 | Ga0495623_0431547 | 3300046679 | Bacteria | 704 |
| 787 | Ga0495646_0155129 | 3300046680 | Bacteria | 1271 |
| 788 | Ga0495647_0089378 | 3300046681 | Bacteria | 1261 |
| 789 | Ga0495669_0014374 | 3300046684 | Bacteria | 3384 |
| 790 | Ga0495669_0268495 | 3300046684 | Bacteria | 820 |
| 791 | Ga0495613_0445759 | 3300046689 | Bacteria | 877 |
| 792 | Ga0495670_0010493 | 3300046691 | Bacteria | 4551 |
| 793 | Ga0495670_0049592 | 3300046691 | Bacteria | 2101 |
| 794 | Ga0495671_0191721 | 3300046692 | Bacteria | 992 |
| 795 | Ga0495649_0009963 | 3300046694 | Bacteria | 5619 |
| 796 | Ga0495649_0170781 | 3300046694 | Bacteria | 1138 |
| 797 | Ga0495649_0203195 | 3300046694 | Bacteria | 1028 |
| 798 | Ga0495649_0301197 | 3300046694 | Bacteria | 816 |
| 799 | Ga0495589_0129418 | 3300046794 | Bacteria | 1213 |
| 800 | Ga0495600_0080341 | 3300046809 | Bacteria | 2128 |
| 801 | Ga0495600_0224365 | 3300046809 | Bacteria | 1201 |
| 802 | Ga0495581_0019778 | 3300047315 | Bacteria | 3910 |
| 803 | Ga0495581_0095380 | 3300047315 | Bacteria | 1727 |
| 804 | Ga0495604_0030597 | 3300047317 | Bacteria | 4274 |
| 805 | Ga0495604_0064554 | 3300047317 | Bacteria | 2789 |
| 806 | Ga0495636_0080871 | 3300047318 | Bacteria | 1399 |
| 807 | Ga0495636_0120228 | 3300047318 | Bacteria | 1161 |
| 808 | Ga0495674_0159826 | 3300047319 | Bacteria | 1885 |
| 809 | Ga0495674_0335194 | 3300047319 | Bacteria | 1230 |
| 810 | Ga0495674_0494710 | 3300047319 | Bacteria | 979 |
| 811 | Ga0495674_0542316 | 3300047319 | Bacteria | 927 |
| 812 | Ga0495672_0024971 | 3300047320 | Bacteria | 3837 |
| 813 | Ga0495672_0033009 | 3300047320 | Bacteria | 3211 |
| 814 | Ga0495672_0097317 | 3300047320 | Bacteria | 1603 |
| 815 | Ga0495672_0100321 | 3300047320 | Bacteria | 1571 |
| 816 | Ga0495672_0101470 | 3300047320 | Bacteria | 1559 |
| 817 | Ga0495676_0010380 | 3300047321 | Bacteria | 8447 |
| 818 | Ga0495676_0032329 | 3300047321 | Bacteria | 4418 |
| 819 | Ga0495676_0132650 | 3300047321 | Bacteria | 1796 |
| 820 | Ga0495676_0406389 | 3300047321 | Bacteria | 903 |
| 821 | Ga0495680_0061366 | 3300047322 | Bacteria | 2892 |
| 822 | Ga0495680_0549030 | 3300047322 | Bacteria | 779 |
| 823 | Ga0495683_0173291 | 3300047323 | Bacteria | 990 |
| 824 | Ga0495683_0213960 | 3300047323 | Bacteria | 863 |
| 825 | Ga0495683_0232004 | 3300047323 | Bacteria | 818 |
| 826 | Ga0495687_015682 | 3300047443 | Bacteria | 3843 |
| 827 | Ga0495675_0030160 | 3300047444 | Bacteria | 3460 |
| 828 | Ga0495673_0023822 | 3300047469 | Bacteria | 2969 |
| 829 | Ga0495673_0168055 | 3300047469 | Bacteria | 837 |
| 830 | Ga0495673_0169683 | 3300047469 | Bacteria | 832 |
| 831 | Ga0495684_0050876 | 3300047471 | Bacteria | 3162 |
| 832 | Ga0495686_0110629 | 3300047472 | Bacteria | 1647 |
| 833 | Ga0495686_0207529 | 3300047472 | Bacteria | 1121 |
| 834 | Ga0495593_0057446 | 3300047673 | Bacteria | 2043 |
| 835 | Ga0495593_0108302 | 3300047673 | Bacteria | 1420 |
| 836 | Ga0495593_0126027 | 3300047673 | Bacteria | 1302 |
| 837 | Ga0495593_0546940 | 3300047673 | Bacteria | 581 |
| 838 | Ga0495602_0110863 | 3300048088 | Bacteria | 2229 |
| 839 | Ga0495614_0019409 | 3300048089 | Bacteria | 2941 |
| 840 | Ga0495615_0077647 | 3300048090 | Bacteria | 906 |
| 841 | Ga0496100_0016050 | 3300048903 | Bacteria | 4388 |
| 842 | Ga0496100_0031098 | 3300048903 | Bacteria | 3316 |
| 843 | Ga0496100_0088474 | 3300048903 | Bacteria | 2108 |
| 844 | Ga0496100_0158568 | 3300048903 | Bacteria | 1620 |
| 845 | Ga0496100_0820187 | 3300048903 | Bacteria | 729 |
| 846 | Ga0496101_0019064 | 3300048904 | Bacteria | 4675 |
| 847 | Ga0496101_0066306 | 3300048904 | Bacteria | 2633 |
| 848 | Ga0496101_0097067 | 3300048904 | Bacteria | 2200 |
| 849 | Ga0496101_0322655 | 3300048904 | Bacteria | 1212 |
| 850 | Ga0496101_0378797 | 3300048904 | Bacteria | 1113 |
| 851 | Ga0496102_0001018 | 3300048905 | Bacteria | 26153 |
| 852 | Ga0496102_0022346 | 3300048905 | Bacteria | 5605 |
| 853 | Ga0496102_0040983 | 3300048905 | Bacteria | 4191 |
| 854 | Ga0496102_0642655 | 3300048905 | Bacteria | 984 |
| 855 | Ga0496103_0003354 | 3300048906 | Bacteria | 9793 |
| 856 | Ga0496103_0221293 | 3300048906 | Bacteria | 1217 |
| 857 | Ga0496103_0302638 | 3300048906 | Bacteria | 1029 |
| 858 | Ga0496104_0009238 | 3300048907 | Bacteria | 8766 |
| 859 | Ga0496104_0161080 | 3300048907 | Bacteria | 2152 |
| 860 | Ga0496104_0280093 | 3300048907 | Bacteria | 1580 |
| 861 | Ga0496104_0285405 | 3300048907 | Bacteria | 1563 |
| 862 | Ga0496105_0000450 | 3300048908 | Bacteria | 27125 |
| 863 | Ga0496105_0101072 | 3300048908 | Bacteria | 2381 |
| 864 | Ga0496105_0250713 | 3300048908 | Bacteria | 1434 |
| 865 | Ga0496105_0317445 | 3300048908 | Bacteria | 1249 |
| 866 | Ga0496106_0075961 | 3300048909 | Bacteria | 2574 |
| 867 | Ga0496106_0396550 | 3300048909 | Bacteria | 1109 |
| 868 | Ga0496106_0616578 | 3300048909 | Bacteria | 868 |
| 869 | Ga0496106_0650231 | 3300048909 | Bacteria | 842 |
| 870 | Ga0496107_0006468 | 3300048910 | Bacteria | 8056 |
| 871 | Ga0496107_0079830 | 3300048910 | Bacteria | 2385 |
| 872 | Ga0496107_0089030 | 3300048910 | Bacteria | 2254 |
| 873 | Ga0496107_0145873 | 3300048910 | Bacteria | 1750 |
| 874 | Ga0496107_0322267 | 3300048910 | Bacteria | 1150 |
| 875 | Ga0496108_0007359 | 3300048911 | Bacteria | 8924 |
| 876 | Ga0496108_0018966 | 3300048911 | Bacteria | 5641 |
| 877 | Ga0496108_0115464 | 3300048911 | Bacteria | 2299 |
| 878 | Ga0496108_0381211 | 3300048911 | Bacteria | 1231 |
| 879 | Ga0496108_0775829 | 3300048911 | Bacteria | 828 |
| 880 | Ga0496109_0036795 | 3300048912 | Bacteria | 4419 |
| 881 | Ga0496109_0301361 | 3300048912 | Bacteria | 1511 |
| 882 | Ga0496109_0385414 | 3300048912 | Bacteria | 1324 |
| 883 | Ga0496110_0105535 | 3300048913 | Bacteria | 2528 |
| 884 | Ga0496110_0201138 | 3300048913 | Bacteria | 1810 |
| 885 | Ga0496110_0423716 | 3300048913 | Bacteria | 1213 |
| 886 | Ga0496110_0425537 | 3300048913 | Bacteria | 1210 |
| 887 | Ga0496110_0564918 | 3300048913 | Bacteria | 1033 |
| 888 | Ga0496111_0170950 | 3300048914 | Bacteria | 1615 |
| 889 | Ga0496111_0252927 | 3300048914 | Bacteria | 1307 |
| 890 | Ga0496111_0465846 | 3300048914 | Bacteria | 932 |
| 891 | Ga0496112_0000960 | 3300048915 | Bacteria | 20955 |
| 892 | Ga0496112_0005812 | 3300048915 | Bacteria | 10735 |
| 893 | Ga0496112_0162791 | 3300048915 | Bacteria | 2197 |
| 894 | Ga0496112_0173260 | 3300048915 | Bacteria | 2123 |
| 895 | Ga0496112_0337556 | 3300048915 | Bacteria | 1450 |
| 896 | Ga0496112_0436146 | 3300048915 | Bacteria | 1248 |
| 897 | Ga0496113_0043948 | 3300048916 | Bacteria | 3308 |
| 898 | Ga0496113_0079772 | 3300048916 | Bacteria | 2506 |
| 899 | Ga0496113_0427112 | 3300048916 | Bacteria | 1064 |
| 900 | Ga0496114_0017392 | 3300048917 | Bacteria | 5803 |
| 901 | Ga0496114_0052838 | 3300048917 | Bacteria | 3386 |
| 902 | Ga0496114_0258084 | 3300048917 | Bacteria | 1534 |
| 903 | Ga0496114_0466718 | 3300048917 | Bacteria | 1117 |
| 904 | Ga0496114_1299885 | 3300048917 | Bacteria | 614 |
| 905 | Ga0496115_0005943 | 3300048918 | Bacteria | 8910 |
| 906 | Ga0496115_0209409 | 3300048918 | Bacteria | 1610 |
| 907 | Ga0496115_0341316 | 3300048918 | Bacteria | 1222 |
| 908 | Ga0496115_0612307 | 3300048918 | Bacteria | 865 |
| 909 | Ga0496116_0001982 | 3300048919 | Bacteria | 22049 |
| 910 | Ga0496116_0023198 | 3300048919 | Bacteria | 4627 |
| 911 | Ga0496116_0262808 | 3300048919 | Bacteria | 850 |
| 912 | Ga0496117_0057178 | 3300048920 | Bacteria | 2711 |
| 913 | Ga0496117_0256798 | 3300048920 | Bacteria | 950 |
| 914 | Ga0496117_0270374 | 3300048920 | Bacteria | 916 |
| 915 | Ga0496117_0382086 | 3300048920 | Bacteria | 717 |
| 916 | Ga0496118_0018781 | 3300048921 | Bacteria | 6211 |
| 917 | Ga0496118_0043749 | 3300048921 | Bacteria | 3515 |
| 918 | Ga0496118_0054475 | 3300048921 | Bacteria | 3029 |
| 919 | Ga0496118_0064256 | 3300048921 | Bacteria | 2694 |
| 920 | Ga0496118_0087936 | 3300048921 | Bacteria | 2152 |
| 921 | Ga0496118_0175201 | 3300048921 | Bacteria | 1304 |
| 922 | Ga0496118_0269744 | 3300048921 | Bacteria | 954 |
| 923 | Ga0496118_0270611 | 3300048921 | Bacteria | 952 |
| 924 | Ga0496118_0344600 | 3300048921 | Bacteria | 797 |
| 925 | Ga0496119_0002327 | 3300048922 | Bacteria | 20938 |
| 926 | Ga0496119_0150672 | 3300048922 | Bacteria | 1247 |
| 927 | Ga0496120_0017844 | 3300048923 | Bacteria | 4586 |
| 928 | Ga0496120_0062469 | 3300048923 | Bacteria | 2075 |
| 929 | Ga0496120_0106858 | 3300048923 | Bacteria | 1469 |
| 930 | Ga0496120_0142555 | 3300048923 | Bacteria | 1215 |
| 931 | Ga0496121_0000428 | 3300048924 | Bacteria | 82718 |
| 932 | Ga0496121_0009489 | 3300048924 | Bacteria | 11170 |
| 933 | Ga0496121_0054851 | 3300048924 | Bacteria | 3326 |
| 934 | Ga0496121_0058539 | 3300048924 | Bacteria | 3184 |
| 935 | Ga0496121_0120053 | 3300048924 | Bacteria | 1987 |
| 936 | Ga0496121_0192356 | 3300048924 | Bacteria | 1462 |
| 937 | Ga0496121_0237371 | 3300048924 | Bacteria | 1273 |
| 938 | Ga0496121_0253724 | 3300048924 | Bacteria | 1218 |
| 939 | Ga0496121_0366020 | 3300048924 | Bacteria | 955 |
| 940 | Ga0496121_0512247 | 3300048924 | Bacteria | 759 |
| 941 | Ga0496122_0029420 | 3300048925 | Bacteria | 4634 |
| 942 | Ga0496122_0259352 | 3300048925 | Bacteria | 966 |
| 943 | Ga0496123_0024856 | 3300048926 | Bacteria | 4535 |
| 944 | Ga0496124_0063549 | 3300048927 | Bacteria | 3083 |
| 945 | Ga0496124_0156728 | 3300048927 | Bacteria | 1780 |
| 946 | Ga0496124_0200737 | 3300048927 | Bacteria | 1517 |
| 947 | Ga0496124_0251686 | 3300048927 | Bacteria | 1306 |
| 948 | Ga0496124_0309732 | 3300048927 | Bacteria | 1136 |
| 949 | Ga0496125_0003621 | 3300048928 | Bacteria | 18542 |
| 950 | Ga0496125_0025303 | 3300048928 | Bacteria | 5438 |
| 951 | Ga0496125_0043714 | 3300048928 | Bacteria | 3797 |
| 952 | Ga0496125_0160002 | 3300048928 | Bacteria | 1531 |
| 953 | Ga0496125_0209676 | 3300048928 | Bacteria | 1266 |
| 954 | Ga0496126_0001402 | 3300048929 | Bacteria | 38138 |
| 955 | Ga0496126_0008929 | 3300048929 | Bacteria | 10733 |
| 956 | Ga0496126_0014924 | 3300048929 | Bacteria | 7834 |
| 957 | Ga0496126_0016269 | 3300048929 | Bacteria | 7444 |
| 958 | Ga0496126_0076006 | 3300048929 | Bacteria | 2980 |
| 959 | Ga0496126_0078436 | 3300048929 | Bacteria | 2926 |
| 960 | Ga0496126_0087451 | 3300048929 | Bacteria | 2746 |
| 961 | Ga0496126_0205748 | 3300048929 | Bacteria | 1659 |
| 962 | Ga0496126_0274412 | 3300048929 | Bacteria | 1398 |
| 963 | Ga0496126_0282068 | 3300048929 | Bacteria | 1376 |
| 964 | Ga0496126_0477938 | 3300048929 | Bacteria | 999 |
| 965 | Ga0496126_0582749 | 3300048929 | Bacteria | 883 |
| 966 | Ga0496126_0642176 | 3300048929 | Bacteria | 831 |
| 967 | Ga0496126_0773081 | 3300048929 | Bacteria | 739 |
| 968 | Ga0495682_0102948 | 3300049460 | Bacteria | 1024 |
| 969 | Ga0495682_0321540 | 3300049460 | Bacteria | 545 |
| 970 | Ga0501038_0399182 | 3300049574 | Bacteria | 1064 |
| 971 | Ga0501039_0427018 | 3300049575 | Bacteria | 1041 |
| 972 | Ga0501067_0427073 | 3300049583 | Bacteria | 740 |
| 973 | Ga0501071_0602957 | 3300049587 | Bacteria | 844 |
| 974 | Ga0501076_0105817 | 3300049592 | Bacteria | 2270 |
| 975 | Ga0501081_0659364 | 3300049743 | Bacteria | 785 |
| 976 | nmdc:mga03683_16383_c1 | 3300050489 | Bacteria | 2783 |
| 977 | nmdc:mga03n38_131645_c1 | 3300050490 | Bacteria | 1240 |
| 978 | nmdc:mga03n38_169119_c1 | 3300050490 | Bacteria | 1112 |
| 979 | nmdc:mga00v17_33667_c1 | 3300050491 | Bacteria | 3037 |
| 980 | nmdc:mga00v17_360793_c1 | 3300050491 | Bacteria | 945 |
| 981 | nmdc:mga00v17_39818_c1 | 3300050491 | Bacteria | 2816 |
| 982 | nmdc:mga00v17_43856_c1 | 3300050491 | Bacteria | 2695 |
| 983 | nmdc:mga00v17_466857_c1 | 3300050491 | Unclassified | 819 |
| 984 | nmdc:mga00v17_605066_c1 | 3300050491 | Bacteria | 706 |
| 985 | nmdc:mga0yw44_104010_c1 | 3300050492 | Bacteria | 1812 |
| 986 | nmdc:mga0yw44_23337_c1 | 3300050492 | Bacteria | 3484 |
| 987 | nmdc:mga0yw44_26229_c1 | 3300050492 | Bacteria | 3326 |
| 988 | nmdc:mga0yw44_28706_c1 | 3300050492 | Bacteria | 3204 |
| 989 | nmdc:mga0yw44_531204_c1 | 3300050492 | Bacteria | 799 |
| 990 | nmdc:mga0yw44_545380_c1 | 3300050492 | Bacteria | 787 |
| 991 | nmdc:mga0yw44_65311_c1 | 3300050492 | Bacteria | 2242 |
| 992 | nmdc:mga0k408_150776_c1 | 3300050493 | Bacteria | 1384 |
| 993 | nmdc:mga06z11_143993_c1 | 3300050494 | Bacteria | 1349 |
| 994 | nmdc:mga06z11_38010_c1 | 3300050494 | Bacteria | 2387 |
| 995 | nmdc:mga06z11_434854_c1 | 3300050494 | Bacteria | 792 |
| 996 | nmdc:mga06z11_44544_c1 | 3300050494 | Bacteria | 2238 |
| 997 | nmdc:mga06z11_50473_c1 | 3300050494 | Bacteria | 2126 |
| 998 | nmdc:mga06z11_74639_c1 | 3300050494 | Bacteria | 1803 |
| 999 | nmdc:mga04h51_179955_c1 | 3300050495 | Bacteria | 823 |
| 1000 | nmdc:mga07m45_185701_c1 | 3300050496 | Bacteria | 1209 |
| 1001 | nmdc:mga07m45_22738_c1 | 3300050496 | Bacteria | 3425 |
| 1002 | nmdc:mga07m45_391203_c1 | 3300050496 | Bacteria | 807 |
| 1003 | nmdc:mga07m45_55827_c1 | 3300050496 | Bacteria | 2232 |
| 1004 | nmdc:mga05p37_277229_c1 | 3300050507 | Bacteria | 2001 |
| 1005 | nmdc:mga08y16_238984_c1 | 3300050511 | Bacteria | 1878 |
| 1006 | nmdc:mga0n895_318243_c1 | 3300050512 | Bacteria | 1577 |
| 1007 | nmdc:mga08x19_495723_c1 | 3300050514 | Unclassified | 862 |
| 1008 | nmdc:mga0sz30_20817_c1 | 3300050516 | Bacteria | 2648 |
| 1009 | nmdc:mga0sz30_25178_c1 | 3300050516 | Bacteria | 2434 |
| 1010 | nmdc:mga0sz30_31912_c1 | 3300050516 | Bacteria | 2182 |
| 1011 | nmdc:mga0sz30_86868_c1 | 3300050516 | Bacteria | 1358 |
| 1012 | Ga0495601_0057542 | 3300053077 | Bacteria | 2462 |
| 1013 | Ga0495601_0506683 | 3300053077 | Bacteria | 778 |
| 1014 | Ga0495601_0529497 | 3300053077 | Bacteria | 759 |
| 1015 | Ga0495612_0021008 | 3300053078 | Bacteria | 2618 |
| 1016 | Ga0500610_0118029 | 3300053079 | Bacteria | 1359 |
| 1017 | Ga0500610_0158740 | 3300053079 | Bacteria | 1127 |
| 1018 | Ga0495655_0014047 | 3300053083 | Bacteria | 1671 |
| 1019 | Ga0495655_0057159 | 3300053083 | Bacteria | 1052 |
| 1020 | Ga0495595_0068422 | 3300053084 | Bacteria | 1675 |
| 1021 | Ga0495619_0069535 | 3300053085 | Bacteria | 2353 |
| 1022 | Ga0495619_0307464 | 3300053085 | Bacteria | 1098 |
| 1023 | Ga0495619_0598229 | 3300053085 | Bacteria | 755 |
| 1024 | Ga0500578_0072026 | 3300053086 | Bacteria | 2203 |
| 1025 | Ga0500643_000686 | 3300053087 | Bacteria | 22575 |
| 1026 | Ga0500644_0033795 | 3300053088 | Bacteria | 1645 |
| 1027 | Ga0500646_0018209 | 3300053090 | Bacteria | 1848 |
| 1028 | Ga0500583_0029458 | 3300053092 | Bacteria | 2393 |
| 1029 | Ga0500583_0058393 | 3300053092 | Bacteria | 1814 |
| 1030 | Ga0500583_0366117 | 3300053092 | Bacteria | 696 |
| 1031 | Ga0500651_0005411 | 3300053093 | Bacteria | 7292 |
| 1032 | Ga0500651_0308412 | 3300053093 | Bacteria | 906 |
| 1033 | Ga0500566_0001250 | 3300053094 | Bacteria | 14847 |
| 1034 | Ga0500566_0002250 | 3300053094 | Bacteria | 11409 |
| 1035 | Ga0500566_0316862 | 3300053094 | Bacteria | 728 |
| 1036 | Ga0500640_000965 | 3300053095 | Bacteria | 8147 |
| 1037 | Ga0500641_0001336 | 3300053096 | Bacteria | 8771 |
| 1038 | Ga0500641_0042973 | 3300053096 | Bacteria | 1833 |
| 1039 | Ga0500641_0164735 | 3300053096 | Bacteria | 955 |
| 1040 | Ga0500650_0003551 | 3300053098 | Bacteria | 5455 |
| 1041 | Ga0500650_0096284 | 3300053098 | Bacteria | 1386 |
| 1042 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 1043 | Ga0500556_0092434 | 3300053104 | Bacteria | 1157 |
| 1044 | Ga0500556_0232544 | 3300053104 | Bacteria | 726 |
| 1045 | Ga0500557_000035 | 3300053105 | Bacteria | 71196 |
| 1046 | Ga0500562_004625 | 3300053108 | Bacteria | 3475 |
| 1047 | Ga0500562_014315 | 3300053108 | Bacteria | 2031 |
| 1048 | Ga0500569_000936 | 3300053109 | Bacteria | 5242 |
| 1049 | Ga0500569_031305 | 3300053109 | Bacteria | 1495 |
| 1050 | Ga0500572_000524 | 3300053111 | Bacteria | 13090 |
| 1051 | Ga0500592_018142 | 3300053116 | Bacteria | 1129 |
| 1052 | Ga0500594_0030739 | 3300053118 | Bacteria | 1412 |
| 1053 | Ga0500594_0044278 | 3300053118 | Bacteria | 1230 |
| 1054 | Ga0500594_0085231 | 3300053118 | Bacteria | 951 |
| 1055 | Ga0500595_005119 | 3300053119 | Bacteria | 5752 |
| 1056 | Ga0500595_065808 | 3300053119 | Bacteria | 1084 |
| 1057 | Ga0500597_141382 | 3300053120 | Bacteria | 1037 |
| 1058 | Ga0500608_012410 | 3300053122 | Bacteria | 3735 |
| 1059 | Ga0500608_046955 | 3300053122 | Bacteria | 2074 |
| 1060 | Ga0500614_022154 | 3300053123 | Bacteria | 1480 |
| 1061 | Ga0500618_041953 | 3300053125 | Bacteria | 1049 |
| 1062 | Ga0500642_0000006 | 3300053130 | Bacteria | 350064 |
| 1063 | Ga0500642_0000070 | 3300053130 | Bacteria | 55760 |
| 1064 | Ga0500642_0253287 | 3300053130 | Bacteria | 808 |
| 1065 | Ga0500652_000138 | 3300053131 | Bacteria | 27584 |
| 1066 | Ga0500658_0007080 | 3300053134 | Bacteria | 4149 |
| 1067 | Ga0500658_0092837 | 3300053134 | Bacteria | 1308 |
| 1068 | Ga0500658_0115111 | 3300053134 | Bacteria | 1187 |
| 1069 | Ga0500658_0135856 | 3300053134 | Bacteria | 1100 |
| 1070 | Ga0500658_0224753 | 3300053134 | Bacteria | 861 |
| 1071 | Ga0500559_0000171 | 3300053136 | Bacteria | 51385 |
| 1072 | Ga0500559_0012534 | 3300053136 | Bacteria | 3600 |
| 1073 | Ga0500559_0031606 | 3300053136 | Bacteria | 2271 |
| 1074 | Ga0500568_0001061 | 3300053139 | Bacteria | 18696 |
| 1075 | Ga0500568_0006253 | 3300053139 | Bacteria | 6010 |
| 1076 | Ga0500577_0000106 | 3300053142 | Bacteria | 20227 |
| 1077 | Ga0500577_0011599 | 3300053142 | Bacteria | 2635 |
| 1078 | Ga0500577_0157491 | 3300053142 | Bacteria | 966 |
| 1079 | Ga0500586_001231 | 3300053145 | Bacteria | 5354 |
| 1080 | Ga0500588_0078416 | 3300053146 | Bacteria | 1100 |
| 1081 | Ga0500589_076307 | 3300053147 | Bacteria | 1505 |
| 1082 | Ga0500589_244828 | 3300053147 | Bacteria | 661 |
| 1083 | Ga0500590_100185 | 3300053148 | Bacteria | 1392 |
| 1084 | Ga0500603_000337 | 3300053150 | Bacteria | 12273 |
| 1085 | Ga0500604_0002446 | 3300053151 | Bacteria | 5065 |
| 1086 | Ga0500604_0010292 | 3300053151 | Bacteria | 2500 |
| 1087 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1088 | Ga0500616_0044015 | 3300053153 | Bacteria | 2384 |
| 1089 | Ga0500622_0001284 | 3300053156 | Bacteria | 20454 |
| 1090 | Ga0500622_0017922 | 3300053156 | Bacteria | 3767 |
| 1091 | Ga0500624_003166 | 3300053157 | Bacteria | 2170 |
| 1092 | Ga0500627_0095479 | 3300053158 | Bacteria | 1332 |
| 1093 | Ga0500627_0107717 | 3300053158 | Bacteria | 1253 |
| 1094 | Ga0500630_001359 | 3300053159 | Bacteria | 11529 |
| 1095 | Ga0500633_0130099 | 3300053160 | Bacteria | 939 |
| 1096 | Ga0500634_0044689 | 3300053161 | Bacteria | 2398 |
| 1097 | Ga0500634_0110719 | 3300053161 | Bacteria | 1355 |
| 1098 | Ga0500634_0161638 | 3300053161 | Bacteria | 1033 |
| 1099 | Ga0500638_007609 | 3300053162 | Bacteria | 4550 |
| 1100 | Ga0500639_000003 | 3300053163 | Bacteria | 230428 |
| 1101 | Ga0500639_164495 | 3300053163 | Bacteria | 1004 |
| 1102 | Ga0500636_0172241 | 3300053177 | Bacteria | 1169 |
| 1103 | Ga0500637_0067428 | 3300053178 | Bacteria | 2056 |
| 1104 | Ga0500637_0094098 | 3300053178 | Bacteria | 1736 |
| 1105 | Ga0500611_063934 | 3300053727 | Bacteria | 879 |
| 1106 | Ga0500625_020693 | 3300053729 | Bacteria | 3097 |
| 1107 | Ga0500645_006601 | 3300053730 | Bacteria | 4118 |
| 1108 | Ga0500596_001079 | 3300053735 | Bacteria | 5497 |
| 1109 | Ga0500601_000077 | 3300053737 | Bacteria | 20039 |
| 1110 | Ga0500601_003375 | 3300053737 | Bacteria | 1731 |
| 1111 | Ga0500661_034104 | 3300055283 | Bacteria | 899 |
| 1112 | Ga0466962_0058611 | 3300061719 | Bacteria | 1838 |
| 1113 | Ga0530510_0274821 | 3300061734 | Bacteria | 1258 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10434930 | Ga0207643_104349302 | 167 |
| 2 | 3300046506 | Ga0495583_0177598 | Ga0495583_0177598_65_568 | 167 |
| 3 | 3300048924 | Ga0496121_0512247 | Ga0496121_0512247_225_728 | 167 |
| 4 | 3300049460 | Ga0495682_0321540 | Ga0495682_0321540_23_526 | 167 |
| 5 | 3300053147 | Ga0500589_244828 | Ga0500589_244828_127_630 | 167 |
| 6 | 3300047673 | Ga0495593_0546940 | Ga0495593_0546940_49_567 | 172 |
| 7 | 3300006178 | Ga0075367_10060296 | Ga0075367_100602962 | 174 |
| 8 | 3300050494 | nmdc:mga06z11_38010_c1 | nmdc:mga06z11_38010_c1_1647_2258 | 174 |
| 9 | 3300004625 | Ga0055543_1003135 | Ga0055543_10031355 | 175 |
| 10 | 3300005262 | Ga0065165_1001540 | Ga0065165_10015405 | 175 |
| 11 | 3300046491 | Ga0495584_0063644 | Ga0495584_0063644_1142_1753 | 175 |
| 12 | 3300003763 | Ga0055529_1015691 | Ga0055529_10156912 | 178 |
| 13 | 3300005548 | Ga0070665_100080196 | Ga0070665_1000801964 | 178 |
| 14 | 3300025254 | Ga0209148_1000319 | Ga0209148_100031936 | 178 |
| 15 | 3300025261 | Ga0209233_1015774 | Ga0209233_10157743 | 178 |
| 16 | 3300025272 | Ga0209455_1003594 | Ga0209455_10035944 | 178 |
| 17 | 3300035725 | Ga0373947_0207416 | Ga0373947_0207416_18_602 | 178 |
| 18 | 3300005614 | Ga0068856_100128623 | Ga0068856_1001286233 | 181 |
| 19 | 3300005616 | Ga0068852_100455965 | Ga0068852_1004559652 | 181 |
| 20 | 3300026078 | Ga0207702_10393911 | Ga0207702_103939112 | 181 |
| 21 | 3300048915 | Ga0496112_0173260 | Ga0496112_0173260_223_837 | 181 |
| 22 | 3300053077 | Ga0495601_0529497 | Ga0495601_0529497_13_564 | 183 |
| 23 | 3300046513 | Ga0495616_0069582 | Ga0495616_0069582_1065_1679 | 184 |
| 24 | 3300026075 | Ga0207708_10154498 | Ga0207708_101544983 | 185 |
| 25 | 3300046472 | Ga0495580_0210427 | Ga0495580_0210427_34_645 | 185 |
| 26 | 3300021384 | Ga0213876_10214021 | Ga0213876_102140212 | 186 |
| 27 | 3300039437 | Ga0436365_0163573 | Ga0436365_0163573_285_899 | 186 |
| 28 | 3300041494 | Ga0451837_1100542 | Ga0451837_1100542_15_575 | 186 |
| 29 | 3300003320 | rootH2_10052492 | rootH2_100524922 | 187 |
| 30 | 3300053737 | Ga0500601_000077 | Ga0500601_000077_18463_19074 | 187 |
| 31 | 3300041452 | Ga0451793_0382415 | Ga0451793_0382415_23_589 | 188 |
| 32 | 3300005539 | Ga0068853_100720870 | Ga0068853_1007208701 | 189 |
| 33 | 3300026041 | Ga0207639_10388585 | Ga0207639_103885852 | 189 |
| 34 | 3300049743 | Ga0501081_0659364 | Ga0501081_0659364_198_767 | 189 |
| 35 | 3300050490 | nmdc:mga03n38_169119_c1 | nmdc:mga03n38_169119_c1_101_670 | 189 |
| 36 | 3300050491 | nmdc:mga00v17_33667_c1 | nmdc:mga00v17_33667_c1_2450_3019 | 189 |
| 37 | 3300050516 | nmdc:mga0sz30_31912_c1 | nmdc:mga0sz30_31912_c1_1487_2056 | 189 |
| 38 | 3300006186 | Ga0075369_10117186 | Ga0075369_101171862 | 190 |
| 39 | 3300047472 | Ga0495686_0207529 | Ga0495686_0207529_17_631 | 190 |
| 40 | 3300048090 | Ga0495615_0077647 | Ga0495615_0077647_173_745 | 190 |
| 41 | 3300048906 | Ga0496103_0302638 | Ga0496103_0302638_360_932 | 190 |
| 42 | 3300048911 | Ga0496108_0018966 | Ga0496108_0018966_503_1075 | 190 |
| 43 | 3300048929 | Ga0496126_0477938 | Ga0496126_0477938_28_600 | 190 |
| 44 | 3300050516 | nmdc:mga0sz30_86868_c1 | nmdc:mga0sz30_86868_c1_360_974 | 190 |
| 45 | 3300053125 | Ga0500618_041953 | Ga0500618_041953_398_973 | 190 |
| 46 | 3300006942 | Ga0099824_1025158 | Ga0099824_10251582 | 191 |
| 47 | 3300013308 | Ga0157375_11423878 | Ga0157375_114238782 | 191 |
| 48 | 3300025919 | Ga0207657_10065566 | Ga0207657_100655664 | 191 |
| 49 | 3300027296 | Ga0209389_1000060 | Ga0209389_100006081 | 191 |
| 50 | 3300027357 | Ga0209589_1000062 | Ga0209589_100006226 | 191 |
| 51 | 3300027361 | Ga0209489_101714 | Ga0209489_10171424 | 191 |
| 52 | 3300041505 | Ga0451849_0759887 | Ga0451849_0759887_32_646 | 191 |
| 53 | 3300046559 | Ga0495667_0199124 | Ga0495667_0199124_32_607 | 191 |
| 54 | 3300048904 | Ga0496101_0019064 | Ga0496101_0019064_3348_3923 | 191 |
| 55 | 3300048905 | Ga0496102_0001018 | Ga0496102_0001018_11131_11706 | 191 |
| 56 | 3300048908 | Ga0496105_0101072 | Ga0496105_0101072_41_616 | 191 |
| 57 | 3300048909 | Ga0496106_0650231 | Ga0496106_0650231_251_826 | 191 |
| 58 | 3300048910 | Ga0496107_0006468 | Ga0496107_0006468_7050_7625 | 191 |
| 59 | 3300048911 | Ga0496108_0007359 | Ga0496108_0007359_1732_2307 | 191 |
| 60 | 3300048912 | Ga0496109_0036795 | Ga0496109_0036795_3200_3775 | 191 |
| 61 | 3300048913 | Ga0496110_0564918 | Ga0496110_0564918_128_703 | 191 |
| 62 | 3300048914 | Ga0496111_0170950 | Ga0496111_0170950_835_1410 | 191 |
| 63 | 3300048917 | Ga0496114_0017392 | Ga0496114_0017392_4237_4812 | 191 |
| 64 | 3300048917 | Ga0496114_1299885 | Ga0496114_1299885_22_597 | 191 |
| 65 | 3300048918 | Ga0496115_0005943 | Ga0496115_0005943_629_1204 | 191 |
| 66 | 3300053104 | Ga0500556_0092434 | Ga0500556_0092434_273_848 | 191 |
| 67 | 3300009148 | Ga0105243_11119732 | Ga0105243_111197321 | 192 |
| 68 | 3300041441 | Ga0451787_023315 | Ga0451787_023315_123_710 | 194 |
| 69 | 3300046679 | Ga0495623_0431547 | Ga0495623_0431547_40_627 | 194 |
| 70 | 3300048921 | Ga0496118_0344600 | Ga0496118_0344600_21_608 | 194 |
| 71 | 3300050491 | nmdc:mga00v17_466857_c1 | nmdc:mga00v17_466857_c1_116_706 | 194 |
| 72 | 3300053094 | Ga0500566_0316862 | Ga0500566_0316862_130_717 | 194 |
| 73 | 3300053088 | Ga0500644_0033795 | Ga0500644_0033795_131_751 | 195 |
| 74 | 3300053119 | Ga0500595_005119 | Ga0500595_005119_3621_4211 | 195 |
| 75 | 3300048903 | Ga0496100_0031098 | Ga0496100_0031098_151_744 | 196 |
| 76 | 3300048904 | Ga0496101_0378797 | Ga0496101_0378797_140_733 | 196 |
| 77 | 3300048905 | Ga0496102_0642655 | Ga0496102_0642655_275_868 | 196 |
| 78 | 3300048917 | Ga0496114_0466718 | Ga0496114_0466718_243_836 | 196 |
| 79 | 3300048921 | Ga0496118_0064256 | Ga0496118_0064256_226_828 | 196 |
| 80 | iso_pu_bacteria | 2602042107 | 2603860378 | 196 |
| 81 | iso_pu_bacteria | 2857524615 | 2857525325 | 196 |
| 82 | iso_pu_bacteria | 2893066018 | 2893066263 | 196 |
| 83 | iso_pu_bacteria | 2919073203 | 2919074984 | 196 |
| 84 | 3300009093 | Ga0105240_10010877 | Ga0105240_1001087710 | 197 |
| 85 | 3300009098 | Ga0105245_10129954 | Ga0105245_101299542 | 197 |
| 86 | 3300009174 | Ga0105241_10105000 | Ga0105241_101050002 | 197 |
| 87 | 3300009545 | Ga0105237_10005066 | Ga0105237_100050663 | 197 |
| 88 | 3300010375 | Ga0105239_10096270 | Ga0105239_100962704 | 197 |
| 89 | 3300039450 | Ga0436363_0405860 | Ga0436363_0405860_2425_3021 | 197 |
| 90 | 3300046474 | Ga0495605_0069723 | Ga0495605_0069723_959_1552 | 197 |
| 91 | 3300046507 | Ga0495606_0033500 | Ga0495606_0033500_794_1387 | 197 |
| 92 | 3300046524 | Ga0495648_0071020 | Ga0495648_0071020_902_1495 | 197 |
| 93 | 3300046529 | Ga0495652_0057963 | Ga0495652_0057963_296_889 | 197 |
| 94 | 3300046616 | Ga0495668_0179540 | Ga0495668_0179540_409_1002 | 197 |
| 95 | 3300046694 | Ga0495649_0009963 | Ga0495649_0009963_4923_5516 | 197 |
| 96 | 3300053130 | Ga0500642_0000070 | Ga0500642_0000070_35444_36037 | 197 |
| 97 | iso_pu_bacteria | 2874620515 | 2874625271 | 197 |
| 98 | iso_pu_bacteria | 2876808645 | 2876810510 | 197 |
| 99 | iso_pu_bacteria | 2879110137 | 2879114370 | 197 |
| 100 | iso_pu_bacteria | 2904666416 | 2904668825 | 197 |
| 101 | iso_pu_bacteria | 3005710791 | 3005712933 | 197 |
| 102 | 3300003771 | Ga0055526_1008269 | Ga0055526_10082693 | 198 |
| 103 | 3300005262 | Ga0065165_1066955 | Ga0065165_10669552 | 198 |
| 104 | 3300005548 | Ga0070665_100267780 | Ga0070665_1002677802 | 198 |
| 105 | 3300006038 | Ga0075365_10060429 | Ga0075365_100604292 | 198 |
| 106 | 3300006051 | Ga0075364_10037231 | Ga0075364_100372315 | 198 |
| 107 | 3300006051 | Ga0075364_10098009 | Ga0075364_100980093 | 198 |
| 108 | 3300006186 | Ga0075369_10010020 | Ga0075369_100100203 | 198 |
| 109 | 3300006353 | Ga0075370_10323059 | Ga0075370_103230592 | 198 |
| 110 | 3300007788 | Ga0099795_10008800 | Ga0099795_100088003 | 198 |
| 111 | 3300010159 | Ga0099796_10008663 | Ga0099796_100086634 | 198 |
| 112 | 3300025295 | Ga0209564_1001380 | Ga0209564_100138020 | 198 |
| 113 | 3300026067 | Ga0207678_10060081 | Ga0207678_100600812 | 198 |
| 114 | 3300026067 | Ga0207678_10993879 | Ga0207678_109938791 | 198 |
| 115 | 3300028379 | Ga0268266_10157317 | Ga0268266_101573172 | 198 |
| 116 | 3300028794 | Ga0307515_10109512 | Ga0307515_101095122 | 198 |
| 117 | 3300035725 | Ga0373947_0008141 | Ga0373947_0008141_2290_2889 | 198 |
| 118 | 3300039438 | Ga0436360_0751927 | Ga0436360_0751927_242_841 | 198 |
| 119 | 3300044684 | Ga0466966_0082784 | Ga0466966_0082784_267_863 | 198 |
| 120 | 3300044719 | Ga0466971_0045755 | Ga0466971_0045755_1340_1936 | 198 |
| 121 | 3300045836 | Ga0466958_0521981 | Ga0466958_0521981_114_713 | 198 |
| 122 | 3300045976 | Ga0466967_0052907 | Ga0466967_0052907_2324_2920 | 198 |
| 123 | 3300045976 | Ga0466967_0254910 | Ga0466967_0254910_662_1261 | 198 |
| 124 | 3300046460 | Ga0495638_0002654 | Ga0495638_0002654_6762_7370 | 198 |
| 125 | 3300046460 | Ga0495638_0020245 | Ga0495638_0020245_1493_2101 | 198 |
| 126 | 3300046473 | Ga0495582_0089972 | Ga0495582_0089972_232_831 | 198 |
| 127 | 3300046501 | Ga0495607_0012642 | Ga0495607_0012642_3977_4585 | 198 |
| 128 | 3300046507 | Ga0495606_0166732 | Ga0495606_0166732_46_654 | 198 |
| 129 | 3300046515 | Ga0495620_0047059 | Ga0495620_0047059_619_1227 | 198 |
| 130 | 3300046524 | Ga0495648_0009119 | Ga0495648_0009119_5543_6142 | 198 |
| 131 | 3300046524 | Ga0495648_0130145 | Ga0495648_0130145_328_936 | 198 |
| 132 | 3300046530 | Ga0495654_0103628 | Ga0495654_0103628_393_1001 | 198 |
| 133 | 3300046557 | Ga0495622_0068065 | Ga0495622_0068065_719_1327 | 198 |
| 134 | 3300046660 | Ga0495625_0110808 | Ga0495625_0110808_1207_1815 | 198 |
| 135 | 3300046665 | Ga0495661_0008267 | Ga0495661_0008267_6167_6775 | 198 |
| 136 | 3300046674 | Ga0495588_0024706 | Ga0495588_0024706_454_1062 | 198 |
| 137 | 3300046691 | Ga0495670_0010493 | Ga0495670_0010493_2945_3553 | 198 |
| 138 | 3300047315 | Ga0495581_0095380 | Ga0495581_0095380_681_1280 | 198 |
| 139 | 3300047320 | Ga0495672_0097317 | Ga0495672_0097317_724_1332 | 198 |
| 140 | 3300047321 | Ga0495676_0406389 | Ga0495676_0406389_192_791 | 198 |
| 141 | 3300047472 | Ga0495686_0110629 | Ga0495686_0110629_462_1070 | 198 |
| 142 | 3300048915 | Ga0496112_0000960 | Ga0496112_0000960_6427_7023 | 198 |
| 143 | 3300048919 | Ga0496116_0001982 | Ga0496116_0001982_1657_2265 | 198 |
| 144 | 3300048920 | Ga0496117_0057178 | Ga0496117_0057178_287_895 | 198 |
| 145 | 3300048921 | Ga0496118_0043749 | Ga0496118_0043749_1101_1709 | 198 |
| 146 | 3300048921 | Ga0496118_0054475 | Ga0496118_0054475_1393_2001 | 198 |
| 147 | 3300048923 | Ga0496120_0062469 | Ga0496120_0062469_244_852 | 198 |
| 148 | 3300048924 | Ga0496121_0009489 | Ga0496121_0009489_7766_8374 | 198 |
| 149 | 3300048924 | Ga0496121_0192356 | Ga0496121_0192356_296_892 | 198 |
| 150 | 3300048924 | Ga0496121_0237371 | Ga0496121_0237371_526_1134 | 198 |
| 151 | 3300048925 | Ga0496122_0029420 | Ga0496122_0029420_3935_4543 | 198 |
| 152 | 3300048926 | Ga0496123_0024856 | Ga0496123_0024856_165_773 | 198 |
| 153 | 3300048927 | Ga0496124_0309732 | Ga0496124_0309732_46_654 | 198 |
| 154 | 3300048928 | Ga0496125_0003621 | Ga0496125_0003621_11742_12350 | 198 |
| 155 | 3300048928 | Ga0496125_0043714 | Ga0496125_0043714_1992_2600 | 198 |
| 156 | 3300048929 | Ga0496126_0282068 | Ga0496126_0282068_16_615 | 198 |
| 157 | 3300048929 | Ga0496126_0773081 | Ga0496126_0773081_23_631 | 198 |
| 158 | 3300050491 | nmdc:mga00v17_39818_c1 | nmdc:mga00v17_39818_c1_1865_2473 | 198 |
| 159 | 3300050492 | nmdc:mga0yw44_23337_c1 | nmdc:mga0yw44_23337_c1_1954_2562 | 198 |
| 160 | 3300050496 | nmdc:mga07m45_185701_c1 | nmdc:mga07m45_185701_c1_408_1016 | 198 |
| 161 | 3300050516 | nmdc:mga0sz30_20817_c1 | nmdc:mga0sz30_20817_c1_117_725 | 198 |
| 162 | 3300053090 | Ga0500646_0018209 | Ga0500646_0018209_817_1425 | 198 |
| 163 | 3300053093 | Ga0500651_0308412 | Ga0500651_0308412_192_800 | 198 |
| 164 | 3300053094 | Ga0500566_0001250 | Ga0500566_0001250_10567_11175 | 198 |
| 165 | 3300053098 | Ga0500650_0003551 | Ga0500650_0003551_208_816 | 198 |
| 166 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_70772_71380 | 198 |
| 167 | 3300053108 | Ga0500562_014315 | Ga0500562_014315_195_803 | 198 |
| 168 | 3300053109 | Ga0500569_000936 | Ga0500569_000936_4148_4756 | 198 |
| 169 | 3300053116 | Ga0500592_018142 | Ga0500592_018142_411_1019 | 198 |
| 170 | 3300053118 | Ga0500594_0044278 | Ga0500594_0044278_486_1094 | 198 |
| 171 | 3300053122 | Ga0500608_046955 | Ga0500608_046955_181_789 | 198 |
| 172 | 3300053130 | Ga0500642_0000006 | Ga0500642_0000006_333902_334510 | 198 |
| 173 | 3300053131 | Ga0500652_000138 | Ga0500652_000138_24816_25424 | 198 |
| 174 | 3300053134 | Ga0500658_0007080 | Ga0500658_0007080_1606_2214 | 198 |
| 175 | 3300053136 | Ga0500559_0000171 | Ga0500559_0000171_20120_20728 | 198 |
| 176 | 3300053139 | Ga0500568_0001061 | Ga0500568_0001061_15816_16424 | 198 |
| 177 | 3300053142 | Ga0500577_0157491 | Ga0500577_0157491_111_719 | 198 |
| 178 | 3300053145 | Ga0500586_001231 | Ga0500586_001231_4601_5206 | 198 |
| 179 | 3300053151 | Ga0500604_0002446 | Ga0500604_0002446_3511_4119 | 198 |
| 180 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_357621_358229 | 198 |
| 181 | 3300053156 | Ga0500622_0001284 | Ga0500622_0001284_6394_7002 | 198 |
| 182 | 3300053157 | Ga0500624_003166 | Ga0500624_003166_1067_1675 | 198 |
| 183 | 3300053160 | Ga0500633_0130099 | Ga0500633_0130099_86_694 | 198 |
| 184 | 3300053178 | Ga0500637_0067428 | Ga0500637_0067428_223_831 | 198 |
| 185 | iso_pu_bacteria | 2513237092 | 2513626016 | 198 |
| 186 | iso_pu_bacteria | 2513237101 | 2513697981 | 198 |
| 187 | iso_pu_bacteria | 2513237139 | 2513877869 | 198 |
| 188 | iso_pu_bacteria | 2513237161 | 2514016243 | 198 |
| 189 | iso_pu_bacteria | 2617270735 | 2617353782 | 198 |
| 190 | iso_pu_bacteria | 2721755755 | 2723846830 | 198 |
| 191 | iso_pu_bacteria | 2791355196 | 2793063468 | 198 |
| 192 | iso_pu_bacteria | 2791355199 | 2793076416 | 198 |
| 193 | iso_pu_bacteria | 2802429603 | 2805917002 | 198 |
| 194 | iso_pu_bacteria | 2824600985 | 2824601902 | 198 |
| 195 | iso_pu_bacteria | 2824609381 | 2824612784 | 198 |
| 196 | iso_pu_bacteria | 2824653114 | 2824653203 | 198 |
| 197 | iso_pu_bacteria | 2824661429 | 2824662546 | 198 |
| 198 | iso_pu_bacteria | 2824671348 | 2824673432 | 198 |
| 199 | iso_pu_bacteria | 2824687955 | 2824689526 | 198 |
| 200 | iso_pu_bacteria | 2824696289 | 2824697341 | 198 |
| 201 | iso_pu_bacteria | 2824773399 | 2824776031 | 198 |
| 202 | iso_pu_bacteria | 2838122688 | 2838125275 | 198 |
| 203 | iso_pu_bacteria | 2841941048 | 2841948588 | 198 |
| 204 | iso_pu_bacteria | 2841949485 | 2841951484 | 198 |
| 205 | iso_pu_bacteria | 2841966195 | 2841968500 | 198 |
| 206 | iso_pu_bacteria | 2841974524 | 2841976300 | 198 |
| 207 | iso_pu_bacteria | 2841983080 | 2841987662 | 198 |
| 208 | iso_pu_bacteria | 2842038055 | 2842043163 | 198 |
| 209 | iso_pu_bacteria | 2842045827 | 2842051204 | 198 |
| 210 | iso_pu_bacteria | 2847930680 | 2847933892 | 198 |
| 211 | iso_pu_bacteria | 2847939898 | 2847944568 | 198 |
| 212 | iso_pu_bacteria | 2849076700 | 2849081191 | 198 |
| 213 | iso_pu_bacteria | 2857509624 | 2857516014 | 198 |
| 214 | iso_pu_bacteria | 2874604998 | 2874611209 | 198 |
| 215 | iso_pu_bacteria | 2874612657 | 2874613037 | 198 |
| 216 | iso_pu_bacteria | 2879083081 | 2879087422 | 198 |
| 217 | iso_pu_bacteria | 2879099564 | 2879109644 | 198 |
| 218 | iso_pu_bacteria | 2881364244 | 2881365115 | 198 |
| 219 | iso_pu_bacteria | 2885366525 | 2885367305 | 198 |
| 220 | iso_pu_bacteria | 2888419890 | 2888422507 | 198 |
| 221 | iso_pu_bacteria | 2889033259 | 2889038380 | 198 |
| 222 | iso_pu_bacteria | 2906643746 | 2906643837 | 198 |
| 223 | iso_pu_bacteria | 2922361189 | 2922362522 | 198 |
| 224 | iso_pu_bacteria | 2922368715 | 2922371836 | 198 |
| 225 | iso_pu_bacteria | 2922386360 | 2922387657 | 198 |
| 226 | iso_pu_bacteria | 2932784394 | 2932791163 | 198 |
| 227 | iso_pu_bacteria | 2932809354 | 2932811655 | 198 |
| 228 | iso_pu_bacteria | 2932818245 | 2932826428 | 198 |
| 229 | iso_pu_bacteria | 2932828146 | 2932834224 | 198 |
| 230 | iso_pu_bacteria | 2935616580 | 2935623954 | 198 |
| 231 | iso_pu_bacteria | 2935638405 | 2935646918 | 198 |
| 232 | iso_pu_bacteria | 2935665750 | 2935674102 | 198 |
| 233 | iso_pu_bacteria | 2935675223 | 2935684740 | 198 |
| 234 | iso_pu_bacteria | 2935684952 | 2935691594 | 198 |
| 235 | iso_pu_bacteria | 2935694250 | 2935699469 | 198 |
| 236 | iso_pu_bacteria | 2935703347 | 2935707697 | 198 |
| 237 | iso_pu_bacteria | 2935713505 | 2935719428 | 198 |
| 238 | iso_pu_bacteria | 2935722832 | 2935728972 | 198 |
| 239 | iso_pu_bacteria | 2935732158 | 2935737787 | 198 |
| 240 | iso_pu_bacteria | 2935741537 | 2935747163 | 198 |
| 241 | iso_pu_bacteria | 2935750917 | 2935758037 | 198 |
| 242 | iso_pu_bacteria | 2935760218 | 2935766673 | 198 |
| 243 | iso_pu_bacteria | 2935801545 | 2935809315 | 198 |
| 244 | iso_pu_bacteria | 2935810662 | 2935817794 | 198 |
| 245 | iso_pu_bacteria | 2935827899 | 2935836267 | 198 |
| 246 | iso_pu_bacteria | 2935837841 | 2935845177 | 198 |
| 247 | iso_pu_bacteria | 2935855204 | 2935862196 | 198 |
| 248 | iso_pu_bacteria | 2935864058 | 2935870877 | 198 |
| 249 | iso_pu_bacteria | 2935873716 | 2935881270 | 198 |
| 250 | iso_pu_bacteria | 2936002035 | 2936005559 | 198 |
| 251 | iso_pu_bacteria | 2936037263 | 2936042087 | 198 |
| 252 | iso_pu_bacteria | 2940556831 | 2940564052 | 198 |
| 253 | iso_pu_bacteria | 2941538514 | 2941545505 | 198 |
| 254 | iso_pu_bacteria | 3005506211 | 3005512563 | 198 |
| 255 | iso_pu_bacteria | 8006964411 | 8006969018 | 198 |
| 256 | iso_pu_bacteria | 8006984368 | 8006987543 | 198 |
| 257 | iso_pu_bacteria | 8006994254 | 8006995037 | 198 |
| 258 | iso_pu_bacteria | 8016511872 | 8016515851 | 198 |
| 259 | iso_pu_bacteria | 8017057580 | 8017060659 | 198 |
| 260 | iso_pu_bacteria | 8019576017 | 8019580172 | 198 |
| 261 | iso_pu_bacteria | 8019597564 | 8019603438 | 198 |
| 262 | iso_pu_bacteria | 8019608314 | 8019615091 | 198 |
| 263 | iso_pu_bacteria | 8056673599 | 8056679598 | 198 |
| 264 | 3300003323 | rootH1_10143147 | rootH1_101431473 | 199 |
| 265 | 3300005937 | Ga0081455_10001049 | Ga0081455_1000104919 | 199 |
| 266 | 3300006163 | Ga0070715_10261202 | Ga0070715_102612021 | 199 |
| 267 | 3300025905 | Ga0207685_10032838 | Ga0207685_100328382 | 199 |
| 268 | 3300025929 | Ga0207664_10288492 | Ga0207664_102884922 | 199 |
| 269 | 3300028379 | Ga0268266_10038047 | Ga0268266_100380473 | 199 |
| 270 | 3300031911 | Ga0307412_10429205 | Ga0307412_104292051 | 199 |
| 271 | 3300035695 | Ga0373927_0184348 | Ga0373927_0184348_724_1332 | 199 |
| 272 | 3300038443 | Ga0395901_0381792 | Ga0395901_0381792_17_625 | 199 |
| 273 | 3300045976 | Ga0466967_0308948 | Ga0466967_0308948_128_736 | 199 |
| 274 | 3300046660 | Ga0495625_0496367 | Ga0495625_0496367_53_661 | 199 |
| 275 | 3300047319 | Ga0495674_0494710 | Ga0495674_0494710_336_944 | 199 |
| 276 | 3300053084 | Ga0495595_0068422 | Ga0495595_0068422_250_858 | 199 |
| 277 | 3300053085 | Ga0495619_0307464 | Ga0495619_0307464_333_941 | 199 |
| 278 | iso_pu_bacteria | 2508501128 | 2509147745 | 199 |
| 279 | iso_pu_bacteria | 2513237098 | 2513672076 | 199 |
| 280 | iso_pu_bacteria | 2513237104 | 2513721162 | 199 |
| 281 | iso_pu_bacteria | 2513237141 | 2513893249 | 199 |
| 282 | iso_pu_bacteria | 2885383462 | 2885383631 | 199 |
| 283 | iso_pu_bacteria | 2903768456 | 2903776222 | 199 |
| 284 | iso_pu_bacteria | 2935992306 | 2935999139 | 199 |
| 285 | iso_pu_bacteria | 8056681323 | 8056682078 | 199 |
| 286 | 3300003215 | JGI25153J46596_10007639 | JGI25153J46596_100076392 | 200 |
| 287 | 3300003322 | rootL2_10076998 | rootL2_100769982 | 200 |
| 288 | 3300005328 | Ga0070676_10530967 | Ga0070676_105309671 | 200 |
| 289 | 3300005331 | Ga0070670_100801505 | Ga0070670_1008015051 | 200 |
| 290 | 3300005334 | Ga0068869_100349779 | Ga0068869_1003497792 | 200 |
| 291 | 3300005334 | Ga0068869_100485296 | Ga0068869_1004852962 | 200 |
| 292 | 3300005338 | Ga0068868_100444520 | Ga0068868_1004445201 | 200 |
| 293 | 3300005338 | Ga0068868_100493240 | Ga0068868_1004932401 | 200 |
| 294 | 3300005338 | Ga0068868_100590642 | Ga0068868_1005906422 | 200 |
| 295 | 3300005338 | Ga0068868_100702883 | Ga0068868_1007028831 | 200 |
| 296 | 3300005347 | Ga0070668_100042472 | Ga0070668_1000424723 | 200 |
| 297 | 3300005347 | Ga0070668_100227425 | Ga0070668_1002274252 | 200 |
| 298 | 3300005347 | Ga0070668_100271741 | Ga0070668_1002717412 | 200 |
| 299 | 3300005347 | Ga0070668_100359849 | Ga0070668_1003598492 | 200 |
| 300 | 3300005353 | Ga0070669_100971348 | Ga0070669_1009713481 | 200 |
| 301 | 3300005355 | Ga0070671_100938564 | Ga0070671_1009385641 | 200 |
| 302 | 3300005366 | Ga0070659_100322851 | Ga0070659_1003228512 | 200 |
| 303 | 3300005437 | Ga0070710_10069856 | Ga0070710_100698561 | 200 |
| 304 | 3300005438 | Ga0070701_10488863 | Ga0070701_104888631 | 200 |
| 305 | 3300005439 | Ga0070711_100014452 | Ga0070711_1000144521 | 200 |
| 306 | 3300005444 | Ga0070694_100300998 | Ga0070694_1003009982 | 200 |
| 307 | 3300005455 | Ga0070663_100237043 | Ga0070663_1002370432 | 200 |
| 308 | 3300005455 | Ga0070663_100347737 | Ga0070663_1003477372 | 200 |
| 309 | 3300005455 | Ga0070663_100490335 | Ga0070663_1004903352 | 200 |
| 310 | 3300005456 | Ga0070678_100154818 | Ga0070678_1001548181 | 200 |
| 311 | 3300005456 | Ga0070678_100693896 | Ga0070678_1006938961 | 200 |
| 312 | 3300005456 | Ga0070678_101027501 | Ga0070678_1010275012 | 200 |
| 313 | 3300005539 | Ga0068853_100613701 | Ga0068853_1006137011 | 200 |
| 314 | 3300005545 | Ga0070695_100559414 | Ga0070695_1005594141 | 200 |
| 315 | 3300005548 | Ga0070665_100170226 | Ga0070665_1001702263 | 200 |
| 316 | 3300005548 | Ga0070665_100387818 | Ga0070665_1003878182 | 200 |
| 317 | 3300005549 | Ga0070704_100503100 | Ga0070704_1005031002 | 200 |
| 318 | 3300005563 | Ga0068855_101399955 | Ga0068855_1013999551 | 200 |
| 319 | 3300005564 | Ga0070664_101247610 | Ga0070664_1012476101 | 200 |
| 320 | 3300005577 | Ga0068857_100598980 | Ga0068857_1005989802 | 200 |
| 321 | 3300005617 | Ga0068859_100165345 | Ga0068859_1001653452 | 200 |
| 322 | 3300005617 | Ga0068859_100359614 | Ga0068859_1003596143 | 200 |
| 323 | 3300005618 | Ga0068864_101001945 | Ga0068864_1010019452 | 200 |
| 324 | 3300005719 | Ga0068861_100090955 | Ga0068861_1000909553 | 200 |
| 325 | 3300005840 | Ga0068870_10351658 | Ga0068870_103516582 | 200 |
| 326 | 3300005842 | Ga0068858_100161066 | Ga0068858_1001610662 | 200 |
| 327 | 3300005842 | Ga0068858_100382597 | Ga0068858_1003825972 | 200 |
| 328 | 3300005843 | Ga0068860_100147994 | Ga0068860_1001479942 | 200 |
| 329 | 3300005844 | Ga0068862_100090055 | Ga0068862_1000900552 | 200 |
| 330 | 3300005844 | Ga0068862_100549458 | Ga0068862_1005494582 | 200 |
| 331 | 3300005844 | Ga0068862_101045071 | Ga0068862_1010450711 | 200 |
| 332 | 3300005937 | Ga0081455_10032582 | Ga0081455_100325823 | 200 |
| 333 | 3300005981 | Ga0081538_10008059 | Ga0081538_100080593 | 200 |
| 334 | 3300005983 | Ga0081540_1002600 | Ga0081540_100260016 | 200 |
| 335 | 3300005983 | Ga0081540_1010255 | Ga0081540_10102557 | 200 |
| 336 | 3300005985 | Ga0081539_10015201 | Ga0081539_100152017 | 200 |
| 337 | 3300006038 | Ga0075365_10001666 | Ga0075365_100016669 | 200 |
| 338 | 3300006038 | Ga0075365_10033095 | Ga0075365_100330954 | 200 |
| 339 | 3300006038 | Ga0075365_10043102 | Ga0075365_100431023 | 200 |
| 340 | 3300006042 | Ga0075368_10153030 | Ga0075368_101530302 | 200 |
| 341 | 3300006048 | Ga0075363_100168184 | Ga0075363_1001681842 | 200 |
| 342 | 3300006048 | Ga0075363_100281369 | Ga0075363_1002813692 | 200 |
| 343 | 3300006051 | Ga0075364_10100576 | Ga0075364_101005762 | 200 |
| 344 | 3300006173 | Ga0070716_100152627 | Ga0070716_1001526272 | 200 |
| 345 | 3300006175 | Ga0070712_100148225 | Ga0070712_1001482253 | 200 |
| 346 | 3300006178 | Ga0075367_10059669 | Ga0075367_100596693 | 200 |
| 347 | 3300006178 | Ga0075367_10062682 | Ga0075367_100626822 | 200 |
| 348 | 3300006178 | Ga0075367_10081927 | Ga0075367_100819273 | 200 |
| 349 | 3300006186 | Ga0075369_10052488 | Ga0075369_100524883 | 200 |
| 350 | 3300006195 | Ga0075366_10092584 | Ga0075366_100925843 | 200 |
| 351 | 3300006353 | Ga0075370_10168312 | Ga0075370_101683122 | 200 |
| 352 | 3300006844 | Ga0075428_101294431 | Ga0075428_1012944311 | 200 |
| 353 | 3300006871 | Ga0075434_100454685 | Ga0075434_1004546851 | 200 |
| 354 | 3300006931 | Ga0097620_100165357 | Ga0097620_1001653572 | 200 |
| 355 | 3300006931 | Ga0097620_100359636 | Ga0097620_1003596363 | 200 |
| 356 | 3300007265 | Ga0099794_10325812 | Ga0099794_103258122 | 200 |
| 357 | 3300009092 | Ga0105250_10064366 | Ga0105250_100643661 | 200 |
| 358 | 3300009093 | Ga0105240_10180736 | Ga0105240_101807363 | 200 |
| 359 | 3300009094 | Ga0111539_11195894 | Ga0111539_111958941 | 200 |
| 360 | 3300009101 | Ga0105247_10158611 | Ga0105247_101586112 | 200 |
| 361 | 3300009148 | Ga0105243_10196652 | Ga0105243_101966523 | 200 |
| 362 | 3300009148 | Ga0105243_10953269 | Ga0105243_109532692 | 200 |
| 363 | 3300009174 | Ga0105241_10054213 | Ga0105241_100542133 | 200 |
| 364 | 3300009176 | Ga0105242_10377892 | Ga0105242_103778923 | 200 |
| 365 | 3300009176 | Ga0105242_10441573 | Ga0105242_104415731 | 200 |
| 366 | 3300009177 | Ga0105248_10821740 | Ga0105248_108217402 | 200 |
| 367 | 3300009177 | Ga0105248_10995342 | Ga0105248_109953422 | 200 |
| 368 | 3300009177 | Ga0105248_11017521 | Ga0105248_110175211 | 200 |
| 369 | 3300009545 | Ga0105237_10147105 | Ga0105237_101471053 | 200 |
| 370 | 3300009545 | Ga0105237_10318227 | Ga0105237_103182272 | 200 |
| 371 | 3300009551 | Ga0105238_11036819 | Ga0105238_110368192 | 200 |
| 372 | 3300009553 | Ga0105249_10337489 | Ga0105249_103374891 | 200 |
| 373 | 3300009553 | Ga0105249_10928879 | Ga0105249_109288791 | 200 |
| 374 | 3300010375 | Ga0105239_10195859 | Ga0105239_101958593 | 200 |
| 375 | 3300010375 | Ga0105239_10819024 | Ga0105239_108190242 | 200 |
| 376 | 3300011119 | Ga0105246_10032962 | Ga0105246_100329624 | 200 |
| 377 | 3300011119 | Ga0105246_11017143 | Ga0105246_110171431 | 200 |
| 378 | 3300013306 | Ga0163162_10529841 | Ga0163162_105298412 | 200 |
| 379 | 3300013306 | Ga0163162_10747890 | Ga0163162_107478902 | 200 |
| 380 | 3300013306 | Ga0163162_11271134 | Ga0163162_112711342 | 200 |
| 381 | 3300013307 | Ga0157372_11058527 | Ga0157372_110585272 | 200 |
| 382 | 3300013308 | Ga0157375_10477603 | Ga0157375_104776032 | 200 |
| 383 | 3300014325 | Ga0163163_10214291 | Ga0163163_102142912 | 200 |
| 384 | 3300014325 | Ga0163163_10260966 | Ga0163163_102609661 | 200 |
| 385 | 3300014325 | Ga0163163_10508442 | Ga0163163_105084422 | 200 |
| 386 | 3300014326 | Ga0157380_10386195 | Ga0157380_103861952 | 200 |
| 387 | 3300014745 | Ga0157377_10223472 | Ga0157377_102234722 | 200 |
| 388 | 3300014968 | Ga0157379_10221728 | Ga0157379_102217282 | 200 |
| 389 | 3300014968 | Ga0157379_10502654 | Ga0157379_105026542 | 200 |
| 390 | 3300014969 | Ga0157376_10187249 | Ga0157376_101872493 | 200 |
| 391 | 3300014969 | Ga0157376_11443728 | Ga0157376_114437281 | 200 |
| 392 | 3300015262 | Ga0182007_10034887 | Ga0182007_100348872 | 200 |
| 393 | 3300017792 | Ga0163161_10516453 | Ga0163161_105164532 | 200 |
| 394 | 3300025297 | Ga0209758_1003765 | Ga0209758_100376513 | 200 |
| 395 | 3300025297 | Ga0209758_1026690 | Ga0209758_10266903 | 200 |
| 396 | 3300025297 | Ga0209758_1040682 | Ga0209758_10406822 | 200 |
| 397 | 3300025885 | Ga0207653_10178900 | Ga0207653_101789001 | 200 |
| 398 | 3300025898 | Ga0207692_10396121 | Ga0207692_103961212 | 200 |
| 399 | 3300025900 | Ga0207710_10103285 | Ga0207710_101032852 | 200 |
| 400 | 3300025901 | Ga0207688_10042362 | Ga0207688_100423624 | 200 |
| 401 | 3300025907 | Ga0207645_10165423 | Ga0207645_101654231 | 200 |
| 402 | 3300025911 | Ga0207654_10090418 | Ga0207654_100904182 | 200 |
| 403 | 3300025913 | Ga0207695_10211943 | Ga0207695_102119433 | 200 |
| 404 | 3300025914 | Ga0207671_10244480 | Ga0207671_102444802 | 200 |
| 405 | 3300025914 | Ga0207671_10254132 | Ga0207671_102541322 | 200 |
| 406 | 3300025915 | Ga0207693_10087181 | Ga0207693_100871814 | 200 |
| 407 | 3300025919 | Ga0207657_10066394 | Ga0207657_100663943 | 200 |
| 408 | 3300025924 | Ga0207694_10197881 | Ga0207694_101978813 | 200 |
| 409 | 3300025925 | Ga0207650_10362762 | Ga0207650_103627622 | 200 |
| 410 | 3300025933 | Ga0207706_10293970 | Ga0207706_102939701 | 200 |
| 411 | 3300025940 | Ga0207691_10143517 | Ga0207691_101435173 | 200 |
| 412 | 3300025941 | Ga0207711_10033013 | Ga0207711_100330134 | 200 |
| 413 | 3300025941 | Ga0207711_10601433 | Ga0207711_106014332 | 200 |
| 414 | 3300025941 | Ga0207711_10616291 | Ga0207711_106162912 | 200 |
| 415 | 3300025942 | Ga0207689_10014948 | Ga0207689_100149482 | 200 |
| 416 | 3300025942 | Ga0207689_10304524 | Ga0207689_103045242 | 200 |
| 417 | 3300025942 | Ga0207689_10382905 | Ga0207689_103829052 | 200 |
| 418 | 3300025945 | Ga0207679_10133218 | Ga0207679_101332183 | 200 |
| 419 | 3300025949 | Ga0207667_10204841 | Ga0207667_102048413 | 200 |
| 420 | 3300025972 | Ga0207668_10084266 | Ga0207668_100842663 | 200 |
| 421 | 3300026023 | Ga0207677_10128928 | Ga0207677_101289282 | 200 |
| 422 | 3300026023 | Ga0207677_10584901 | Ga0207677_105849012 | 200 |
| 423 | 3300026035 | Ga0207703_10204566 | Ga0207703_102045662 | 200 |
| 424 | 3300026035 | Ga0207703_10231370 | Ga0207703_102313702 | 200 |
| 425 | 3300026035 | Ga0207703_10860828 | Ga0207703_108608281 | 200 |
| 426 | 3300026041 | Ga0207639_10073390 | Ga0207639_100733901 | 200 |
| 427 | 3300026041 | Ga0207639_10213531 | Ga0207639_102135312 | 200 |
| 428 | 3300026041 | Ga0207639_10328161 | Ga0207639_103281612 | 200 |
| 429 | 3300026041 | Ga0207639_10508870 | Ga0207639_105088702 | 200 |
| 430 | 3300026067 | Ga0207678_10026386 | Ga0207678_100263866 | 200 |
| 431 | 3300026067 | Ga0207678_10081677 | Ga0207678_100816772 | 200 |
| 432 | 3300026067 | Ga0207678_10108380 | Ga0207678_101083802 | 200 |
| 433 | 3300026088 | Ga0207641_11299022 | Ga0207641_112990221 | 200 |
| 434 | 3300026089 | Ga0207648_10180743 | Ga0207648_101807432 | 200 |
| 435 | 3300026089 | Ga0207648_11054145 | Ga0207648_110541451 | 200 |
| 436 | 3300026095 | Ga0207676_10191710 | Ga0207676_101917103 | 200 |
| 437 | 3300026118 | Ga0207675_100242260 | Ga0207675_1002422602 | 200 |
| 438 | 3300026118 | Ga0207675_100371406 | Ga0207675_1003714062 | 200 |
| 439 | 3300026118 | Ga0207675_100669599 | Ga0207675_1006695992 | 200 |
| 440 | 3300026121 | Ga0207683_10229165 | Ga0207683_102291652 | 200 |
| 441 | 3300026121 | Ga0207683_10751510 | Ga0207683_107515101 | 200 |
| 442 | 3300028379 | Ga0268266_10004379 | Ga0268266_100043797 | 200 |
| 443 | 3300028379 | Ga0268266_10048162 | Ga0268266_100481624 | 200 |
| 444 | 3300028379 | Ga0268266_10537726 | Ga0268266_105377262 | 200 |
| 445 | 3300028380 | Ga0268265_10210923 | Ga0268265_102109232 | 200 |
| 446 | 3300028380 | Ga0268265_10392349 | Ga0268265_103923492 | 200 |
| 447 | 3300028380 | Ga0268265_10827395 | Ga0268265_108273952 | 200 |
| 448 | 3300028381 | Ga0268264_10146324 | Ga0268264_101463242 | 200 |
| 449 | 3300028381 | Ga0268264_10164971 | Ga0268264_101649712 | 200 |
| 450 | 3300028794 | Ga0307515_10042340 | Ga0307515_100423405 | 200 |
| 451 | 3300031247 | Ga0265340_10118474 | Ga0265340_101184742 | 200 |
| 452 | 3300031249 | Ga0265339_10007191 | Ga0265339_100071913 | 200 |
| 453 | 3300031249 | Ga0265339_10008906 | Ga0265339_100089062 | 200 |
| 454 | 3300031507 | Ga0307509_10076466 | Ga0307509_100764664 | 200 |
| 455 | 3300031507 | Ga0307509_10479408 | Ga0307509_104794082 | 200 |
| 456 | 3300031711 | Ga0265314_10034725 | Ga0265314_100347253 | 200 |
| 457 | 3300031712 | Ga0265342_10048846 | Ga0265342_100488463 | 200 |
| 458 | 3300031730 | Ga0307516_10273434 | Ga0307516_102734342 | 200 |
| 459 | 3300031730 | Ga0307516_10374215 | Ga0307516_103742152 | 200 |
| 460 | 3300031731 | Ga0307405_10253375 | Ga0307405_102533752 | 200 |
| 461 | 3300031852 | Ga0307410_10095307 | Ga0307410_100953073 | 200 |
| 462 | 3300031901 | Ga0307406_10289470 | Ga0307406_102894702 | 200 |
| 463 | 3300031911 | Ga0307412_10156006 | Ga0307412_101560063 | 200 |
| 464 | 3300031911 | Ga0307412_10733133 | Ga0307412_107331331 | 200 |
| 465 | 3300032002 | Ga0307416_100176674 | Ga0307416_1001766743 | 200 |
| 466 | 3300032004 | Ga0307414_10579144 | Ga0307414_105791442 | 200 |
| 467 | 3300032005 | Ga0307411_10159601 | Ga0307411_101596012 | 200 |
| 468 | 3300032126 | Ga0307415_100393108 | Ga0307415_1003931082 | 200 |
| 469 | 3300033180 | Ga0307510_10003003 | Ga0307510_100030033 | 200 |
| 470 | 3300035113 | Ga0373936_0010587 | Ga0373936_0010587_2492_3106 | 200 |
| 471 | 3300037068 | Ga0373925_0320138 | Ga0373925_0320138_281_892 | 200 |
| 472 | 3300037418 | Ga0395900_0052611 | Ga0395900_0052611_2784_3395 | 200 |
| 473 | 3300037471 | Ga0395905_0262755 | Ga0395905_0262755_560_1171 | 200 |
| 474 | 3300041460 | Ga0451802_0169445 | Ga0451802_0169445_163_774 | 200 |
| 475 | 3300041460 | Ga0451802_2093298 | Ga0451802_2093298_655_1266 | 200 |
| 476 | 3300046453 | Ga0495627_074872 | Ga0495627_074872_253_864 | 200 |
| 477 | 3300046455 | Ga0495603_0003185 | Ga0495603_0003185_1036_1647 | 200 |
| 478 | 3300046455 | Ga0495603_0059812 | Ga0495603_0059812_187_798 | 200 |
| 479 | 3300046455 | Ga0495603_0471309 | Ga0495603_0471309_25_636 | 200 |
| 480 | 3300046457 | Ga0495590_0090769 | Ga0495590_0090769_79_690 | 200 |
| 481 | 3300046457 | Ga0495590_0153420 | Ga0495590_0153420_40_651 | 200 |
| 482 | 3300046460 | Ga0495638_0027347 | Ga0495638_0027347_2300_2911 | 200 |
| 483 | 3300046460 | Ga0495638_0035036 | Ga0495638_0035036_728_1339 | 200 |
| 484 | 3300046460 | Ga0495638_0112339 | Ga0495638_0112339_257_868 | 200 |
| 485 | 3300046471 | Ga0495650_0078522 | Ga0495650_0078522_412_1023 | 200 |
| 486 | 3300046474 | Ga0495605_0197195 | Ga0495605_0197195_14_625 | 200 |
| 487 | 3300046477 | Ga0495664_0028061 | Ga0495664_0028061_2616_3227 | 200 |
| 488 | 3300046491 | Ga0495584_0083426 | Ga0495584_0083426_217_828 | 200 |
| 489 | 3300046491 | Ga0495584_0304150 | Ga0495584_0304150_110_721 | 200 |
| 490 | 3300046492 | Ga0495585_0134418 | Ga0495585_0134418_219_830 | 200 |
| 491 | 3300046506 | Ga0495583_0194374 | Ga0495583_0194374_110_721 | 200 |
| 492 | 3300046512 | Ga0495610_0142738 | Ga0495610_0142738_169_780 | 200 |
| 493 | 3300046515 | Ga0495620_0039967 | Ga0495620_0039967_100_711 | 200 |
| 494 | 3300046518 | Ga0495631_0025915 | Ga0495631_0025915_957_1568 | 200 |
| 495 | 3300046518 | Ga0495631_0311307 | Ga0495631_0311307_39_650 | 200 |
| 496 | 3300046519 | Ga0495632_0070725 | Ga0495632_0070725_525_1136 | 200 |
| 497 | 3300046519 | Ga0495632_0220480 | Ga0495632_0220480_93_704 | 200 |
| 498 | 3300046519 | Ga0495632_0229103 | Ga0495632_0229103_171_782 | 200 |
| 499 | 3300046520 | Ga0495637_0053267 | Ga0495637_0053267_123_734 | 200 |
| 500 | 3300046520 | Ga0495637_0212186 | Ga0495637_0212186_13_624 | 200 |
| 501 | 3300046524 | Ga0495648_0153359 | Ga0495648_0153359_290_901 | 200 |
| 502 | 3300046524 | Ga0495648_0300011 | Ga0495648_0300011_67_678 | 200 |
| 503 | 3300046526 | Ga0495666_0073555 | Ga0495666_0073555_118_729 | 200 |
| 504 | 3300046537 | Ga0495598_0020585 | Ga0495598_0020585_254_865 | 200 |
| 505 | 3300046557 | Ga0495622_0023849 | Ga0495622_0023849_1395_2006 | 200 |
| 506 | 3300046557 | Ga0495622_0090186 | Ga0495622_0090186_13_624 | 200 |
| 507 | 3300046615 | Ga0495656_0126171 | Ga0495656_0126171_280_891 | 200 |
| 508 | 3300046615 | Ga0495656_0149067 | Ga0495656_0149067_381_992 | 200 |
| 509 | 3300046616 | Ga0495668_0044643 | Ga0495668_0044643_750_1361 | 200 |
| 510 | 3300046648 | Ga0495611_0043538 | Ga0495611_0043538_1228_1839 | 200 |
| 511 | 3300046648 | Ga0495611_0065363 | Ga0495611_0065363_464_1075 | 200 |
| 512 | 3300046648 | Ga0495611_0190612 | Ga0495611_0190612_135_746 | 200 |
| 513 | 3300046664 | Ga0495659_0026904 | Ga0495659_0026904_1142_1753 | 200 |
| 514 | 3300046664 | Ga0495659_0054086 | Ga0495659_0054086_158_769 | 200 |
| 515 | 3300046664 | Ga0495659_0116327 | Ga0495659_0116327_101_712 | 200 |
| 516 | 3300046674 | Ga0495588_0002645 | Ga0495588_0002645_3752_4363 | 200 |
| 517 | 3300046681 | Ga0495647_0089378 | Ga0495647_0089378_361_972 | 200 |
| 518 | 3300046684 | Ga0495669_0268495 | Ga0495669_0268495_15_626 | 200 |
| 519 | 3300046691 | Ga0495670_0049592 | Ga0495670_0049592_1077_1688 | 200 |
| 520 | 3300046694 | Ga0495649_0170781 | Ga0495649_0170781_115_726 | 200 |
| 521 | 3300046694 | Ga0495649_0203195 | Ga0495649_0203195_125_736 | 200 |
| 522 | 3300046694 | Ga0495649_0301197 | Ga0495649_0301197_165_776 | 200 |
| 523 | 3300046809 | Ga0495600_0224365 | Ga0495600_0224365_436_1047 | 200 |
| 524 | 3300047318 | Ga0495636_0080871 | Ga0495636_0080871_592_1203 | 200 |
| 525 | 3300047318 | Ga0495636_0120228 | Ga0495636_0120228_465_1076 | 200 |
| 526 | 3300047321 | Ga0495676_0032329 | Ga0495676_0032329_1834_2445 | 200 |
| 527 | 3300047323 | Ga0495683_0173291 | Ga0495683_0173291_351_962 | 200 |
| 528 | 3300047323 | Ga0495683_0213960 | Ga0495683_0213960_135_746 | 200 |
| 529 | 3300047469 | Ga0495673_0169683 | Ga0495673_0169683_77_688 | 200 |
| 530 | 3300047673 | Ga0495593_0108302 | Ga0495593_0108302_775_1386 | 200 |
| 531 | 3300048903 | Ga0496100_0820187 | Ga0496100_0820187_82_693 | 200 |
| 532 | 3300048910 | Ga0496107_0145873 | Ga0496107_0145873_873_1484 | 200 |
| 533 | 3300048911 | Ga0496108_0115464 | Ga0496108_0115464_621_1232 | 200 |
| 534 | 3300048911 | Ga0496108_0775829 | Ga0496108_0775829_140_751 | 200 |
| 535 | 3300048912 | Ga0496109_0385414 | Ga0496109_0385414_283_894 | 200 |
| 536 | 3300048913 | Ga0496110_0105535 | Ga0496110_0105535_973_1584 | 200 |
| 537 | 3300048914 | Ga0496111_0465846 | Ga0496111_0465846_145_756 | 200 |
| 538 | 3300048917 | Ga0496114_0258084 | Ga0496114_0258084_870_1481 | 200 |
| 539 | 3300048918 | Ga0496115_0341316 | Ga0496115_0341316_503_1114 | 200 |
| 540 | 3300048921 | Ga0496118_0270611 | Ga0496118_0270611_88_699 | 200 |
| 541 | 3300048924 | Ga0496121_0253724 | Ga0496121_0253724_437_1048 | 200 |
| 542 | 3300048924 | Ga0496121_0366020 | Ga0496121_0366020_281_892 | 200 |
| 543 | 3300048927 | Ga0496124_0156728 | Ga0496124_0156728_622_1233 | 200 |
| 544 | 3300048929 | Ga0496126_0001402 | Ga0496126_0001402_20201_20812 | 200 |
| 545 | 3300048929 | Ga0496126_0076006 | Ga0496126_0076006_860_1471 | 200 |
| 546 | 3300048929 | Ga0496126_0582749 | Ga0496126_0582749_128_739 | 200 |
| 547 | 3300049460 | Ga0495682_0102948 | Ga0495682_0102948_60_671 | 200 |
| 548 | 3300049574 | Ga0501038_0399182 | Ga0501038_0399182_104_715 | 200 |
| 549 | 3300049575 | Ga0501039_0427018 | Ga0501039_0427018_324_935 | 200 |
| 550 | 3300049583 | Ga0501067_0427073 | Ga0501067_0427073_48_659 | 200 |
| 551 | 3300049587 | Ga0501071_0602957 | Ga0501071_0602957_214_825 | 200 |
| 552 | 3300049592 | Ga0501076_0105817 | Ga0501076_0105817_1094_1705 | 200 |
| 553 | 3300050489 | nmdc:mga03683_16383_c1 | nmdc:mga03683_16383_c1_987_1598 | 200 |
| 554 | 3300050491 | nmdc:mga00v17_43856_c1 | nmdc:mga00v17_43856_c1_1559_2170 | 200 |
| 555 | 3300050492 | nmdc:mga0yw44_26229_c1 | nmdc:mga0yw44_26229_c1_890_1501 | 200 |
| 556 | 3300050492 | nmdc:mga0yw44_28706_c1 | nmdc:mga0yw44_28706_c1_1179_1790 | 200 |
| 557 | 3300050492 | nmdc:mga0yw44_545380_c1 | nmdc:mga0yw44_545380_c1_24_635 | 200 |
| 558 | 3300050493 | nmdc:mga0k408_150776_c1 | nmdc:mga0k408_150776_c1_546_1157 | 200 |
| 559 | 3300050494 | nmdc:mga06z11_143993_c1 | nmdc:mga06z11_143993_c1_513_1124 | 200 |
| 560 | 3300050494 | nmdc:mga06z11_44544_c1 | nmdc:mga06z11_44544_c1_10_621 | 200 |
| 561 | 3300050494 | nmdc:mga06z11_50473_c1 | nmdc:mga06z11_50473_c1_877_1488 | 200 |
| 562 | 3300050494 | nmdc:mga06z11_74639_c1 | nmdc:mga06z11_74639_c1_523_1134 | 200 |
| 563 | 3300050496 | nmdc:mga07m45_391203_c1 | nmdc:mga07m45_391203_c1_44_655 | 200 |
| 564 | 3300050507 | nmdc:mga05p37_277229_c1 | nmdc:mga05p37_277229_c1_1192_1803 | 200 |
| 565 | 3300053079 | Ga0500610_0118029 | Ga0500610_0118029_66_698 | 200 |
| 566 | 3300053085 | Ga0495619_0598229 | Ga0495619_0598229_14_625 | 200 |
| 567 | 3300053092 | Ga0500583_0029458 | Ga0500583_0029458_175_786 | 200 |
| 568 | 3300053092 | Ga0500583_0366117 | Ga0500583_0366117_15_626 | 200 |
| 569 | 3300053094 | Ga0500566_0002250 | Ga0500566_0002250_12_626 | 200 |
| 570 | 3300053095 | Ga0500640_000965 | Ga0500640_000965_4304_4918 | 200 |
| 571 | 3300053096 | Ga0500641_0001336 | Ga0500641_0001336_5747_6358 | 200 |
| 572 | 3300053096 | Ga0500641_0164735 | Ga0500641_0164735_41_652 | 200 |
| 573 | 3300053111 | Ga0500572_000524 | Ga0500572_000524_1727_2341 | 200 |
| 574 | 3300053118 | Ga0500594_0085231 | Ga0500594_0085231_259_870 | 200 |
| 575 | 3300053119 | Ga0500595_065808 | Ga0500595_065808_120_731 | 200 |
| 576 | 3300053122 | Ga0500608_012410 | Ga0500608_012410_3037_3651 | 200 |
| 577 | 3300053123 | Ga0500614_022154 | Ga0500614_022154_17_631 | 200 |
| 578 | 3300053130 | Ga0500642_0253287 | Ga0500642_0253287_68_679 | 200 |
| 579 | 3300053134 | Ga0500658_0115111 | Ga0500658_0115111_209_820 | 200 |
| 580 | 3300053134 | Ga0500658_0135856 | Ga0500658_0135856_17_628 | 200 |
| 581 | 3300053134 | Ga0500658_0224753 | Ga0500658_0224753_166_777 | 200 |
| 582 | 3300053136 | Ga0500559_0031606 | Ga0500559_0031606_784_1395 | 200 |
| 583 | 3300053142 | Ga0500577_0000106 | Ga0500577_0000106_6682_7293 | 200 |
| 584 | 3300053142 | Ga0500577_0011599 | Ga0500577_0011599_1020_1631 | 200 |
| 585 | 3300053147 | Ga0500589_076307 | Ga0500589_076307_263_874 | 200 |
| 586 | 3300053150 | Ga0500603_000337 | Ga0500603_000337_10995_11609 | 200 |
| 587 | 3300053158 | Ga0500627_0095479 | Ga0500627_0095479_304_915 | 200 |
| 588 | 3300053159 | Ga0500630_001359 | Ga0500630_001359_10750_11364 | 200 |
| 589 | 3300053161 | Ga0500634_0044689 | Ga0500634_0044689_1628_2239 | 200 |
| 590 | 3300053161 | Ga0500634_0110719 | Ga0500634_0110719_239_850 | 200 |
| 591 | 3300053161 | Ga0500634_0161638 | Ga0500634_0161638_326_937 | 200 |
| 592 | 3300053162 | Ga0500638_007609 | Ga0500638_007609_3806_4420 | 200 |
| 593 | 3300053163 | Ga0500639_000003 | Ga0500639_000003_107065_107679 | 200 |
| 594 | 3300053177 | Ga0500636_0172241 | Ga0500636_0172241_410_1021 | 200 |
| 595 | 3300053178 | Ga0500637_0094098 | Ga0500637_0094098_200_814 | 200 |
| 596 | 3300053730 | Ga0500645_006601 | Ga0500645_006601_2219_2830 | 200 |
| 597 | 3300053735 | Ga0500596_001079 | Ga0500596_001079_690_1304 | 200 |
| 598 | 3300053737 | Ga0500601_003375 | Ga0500601_003375_572_1186 | 200 |
| 599 | 3300055283 | Ga0500661_034104 | Ga0500661_034104_271_885 | 200 |
| 600 | 3300061734 | Ga0530510_0274821 | Ga0530510_0274821_331_942 | 200 |
| 601 | iso_pu_bacteria | 2507262055 | 2507510717 | 200 |
| 602 | iso_pu_bacteria | 2508501009 | 2508544518 | 200 |
| 603 | iso_pu_bacteria | 2508501042 | 2508697337 | 200 |
| 604 | iso_pu_bacteria | 2511231028 | 2511398686 | 200 |
| 605 | iso_pu_bacteria | 2513237094 | 2513643110 | 200 |
| 606 | iso_pu_bacteria | 2513237095 | 2513650634 | 200 |
| 607 | iso_pu_bacteria | 2515154112 | 2515627970 | 200 |
| 608 | iso_pu_bacteria | 2517093001 | 2517105124 | 200 |
| 609 | iso_pu_bacteria | 2524023205 | 2524437108 | 200 |
| 610 | iso_pu_bacteria | 2744054633 | 2745076321 | 200 |
| 611 | iso_pu_bacteria | 2816332527 | 2818242597 | 200 |
| 612 | iso_pu_bacteria | 2824679649 | 2824680977 | 200 |
| 613 | iso_pu_bacteria | 2824704595 | 2824707911 | 200 |
| 614 | iso_pu_bacteria | 2824746037 | 2824747789 | 200 |
| 615 | iso_pu_bacteria | 2824753945 | 2824758997 | 200 |
| 616 | iso_pu_bacteria | 2824763712 | 2824763939 | 200 |
| 617 | iso_pu_bacteria | 2841957949 | 2841960519 | 200 |
| 618 | iso_pu_bacteria | 2844315083 | 2844317197 | 200 |
| 619 | iso_pu_bacteria | 2874590934 | 2874592328 | 200 |
| 620 | iso_pu_bacteria | 2874628541 | 2874634606 | 200 |
| 621 | iso_pu_bacteria | 2874645413 | 2874650065 | 200 |
| 622 | iso_pu_bacteria | 2876761206 | 2876763206 | 200 |
| 623 | iso_pu_bacteria | 2876771140 | 2876775406 | 200 |
| 624 | iso_pu_bacteria | 2876818435 | 2876826241 | 200 |
| 625 | iso_pu_bacteria | 2879074833 | 2879079506 | 200 |
| 626 | iso_pu_bacteria | 2879127579 | 2879132247 | 200 |
| 627 | iso_pu_bacteria | 2879142872 | 2879146896 | 200 |
| 628 | iso_pu_bacteria | 2881665667 | 2881668491 | 200 |
| 629 | iso_pu_bacteria | 2885409591 | 2885418911 | 200 |
| 630 | iso_pu_bacteria | 2888378607 | 2888381885 | 200 |
| 631 | iso_pu_bacteria | 2903727486 | 2903735181 | 200 |
| 632 | iso_pu_bacteria | 2904711408 | 2904720477 | 200 |
| 633 | iso_pu_bacteria | 2906602504 | 2906607236 | 200 |
| 634 | iso_pu_bacteria | 2906626472 | 2906630414 | 200 |
| 635 | iso_pu_bacteria | 2908775508 | 2908778139 | 200 |
| 636 | iso_pu_bacteria | 2922393267 | 2922399455 | 200 |
| 637 | iso_pu_bacteria | 2932794094 | 2932799213 | 200 |
| 638 | iso_pu_bacteria | 2935608549 | 2935616105 | 200 |
| 639 | iso_pu_bacteria | 2935648319 | 2935656364 | 200 |
| 640 | iso_pu_bacteria | 2935656913 | 2935665232 | 200 |
| 641 | iso_pu_bacteria | 2935769743 | 2935770665 | 200 |
| 642 | iso_pu_bacteria | 2935777560 | 2935782898 | 200 |
| 643 | iso_pu_bacteria | 2935785616 | 2935787049 | 200 |
| 644 | iso_pu_bacteria | 2935793552 | 2935795097 | 200 |
| 645 | iso_pu_bacteria | 2935819856 | 2935820001 | 200 |
| 646 | iso_pu_bacteria | 2935847175 | 2935849989 | 200 |
| 647 | iso_pu_bacteria | 2935908558 | 2935915143 | 200 |
| 648 | iso_pu_bacteria | 2935916978 | 2935923820 | 200 |
| 649 | iso_pu_bacteria | 2935926038 | 2935932640 | 200 |
| 650 | iso_pu_bacteria | 2935934488 | 2935941276 | 200 |
| 651 | iso_pu_bacteria | 2935942939 | 2935949310 | 200 |
| 652 | iso_pu_bacteria | 2935951376 | 2935958005 | 200 |
| 653 | iso_pu_bacteria | 2935959822 | 2935963754 | 200 |
| 654 | iso_pu_bacteria | 2935967501 | 2935974353 | 200 |
| 655 | iso_pu_bacteria | 2935975950 | 2935979542 | 200 |
| 656 | iso_pu_bacteria | 2935984226 | 2935991901 | 200 |
| 657 | iso_pu_bacteria | 2936011229 | 2936019213 | 200 |
| 658 | iso_pu_bacteria | 2936019824 | 2936027837 | 200 |
| 659 | iso_pu_bacteria | 2936028420 | 2936036620 | 200 |
| 660 | iso_pu_bacteria | 2936046547 | 2936054697 | 200 |
| 661 | iso_pu_bacteria | 2936055302 | 2936060961 | 200 |
| 662 | iso_pu_bacteria | 2941531003 | 2941535042 | 200 |
| 663 | iso_pu_bacteria | 3005483717 | 3005488660 | 200 |
| 664 | iso_pu_bacteria | 3005587118 | 3005594724 | 200 |
| 665 | iso_pu_bacteria | 3005594810 | 3005596900 | 200 |
| 666 | iso_pu_bacteria | 3005718088 | 3005720303 | 200 |
| 667 | iso_pu_bacteria | 8006926726 | 8006928738 | 200 |
| 668 | iso_pu_bacteria | 8016522445 | 8016523397 | 200 |
| 669 | iso_pu_bacteria | 8016530956 | 8016536899 | 200 |
| 670 | iso_pu_bacteria | 8016539877 | 8016541167 | 200 |
| 671 | iso_pu_bacteria | 8016548790 | 8016552085 | 200 |
| 672 | iso_pu_bacteria | 8016557553 | 8016560463 | 200 |
| 673 | iso_pu_bacteria | 8016566248 | 8016566558 | 200 |
| 674 | iso_pu_bacteria | 8016575299 | 8016579301 | 200 |
| 675 | iso_pu_bacteria | 8016583857 | 8016589898 | 200 |
| 676 | iso_pu_bacteria | 8016595262 | 8016598365 | 200 |
| 677 | iso_pu_bacteria | 8016603502 | 8016604466 | 200 |
| 678 | iso_pu_bacteria | 8016613128 | 8016621046 | 200 |
| 679 | iso_pu_bacteria | 8016622563 | 8016628956 | 200 |
| 680 | iso_pu_bacteria | 8016630954 | 8016633531 | 200 |
| 681 | iso_pu_bacteria | 8019530166 | 8019536597 | 200 |
| 682 | iso_pu_bacteria | 8019547302 | 8019547881 | 200 |
| 683 | iso_pu_bacteria | 8019619141 | 8019625643 | 200 |
| 684 | iso_pu_bacteria | 8019629233 | 8019636649 | 200 |
| 685 | iso_pu_bacteria | 8019638758 | 8019642977 | 200 |
| 686 | iso_pu_bacteria | 8019648815 | 8019655873 | 200 |
| 687 | iso_pu_bacteria | 8019659431 | 8019664448 | 200 |
| 688 | iso_pu_bacteria | 8019668869 | 8019674040 | 200 |
| 689 | iso_pu_bacteria | 8019678201 | 8019682083 | 200 |
| 690 | iso_pu_bacteria | 8019687851 | 8019693510 | 200 |
| 691 | iso_pu_bacteria | 8056967851 | 8056976261 | 200 |
| 692 | 3300003659 | JGI25404J52841_10009341 | JGI25404J52841_100093412 | 201 |
| 693 | 3300005329 | Ga0070683_100708738 | Ga0070683_1007087382 | 201 |
| 694 | 3300005331 | Ga0070670_100357754 | Ga0070670_1003577542 | 201 |
| 695 | 3300005334 | Ga0068869_100420179 | Ga0068869_1004201792 | 201 |
| 696 | 3300005335 | Ga0070666_10318802 | Ga0070666_103188022 | 201 |
| 697 | 3300005336 | Ga0070680_100500992 | Ga0070680_1005009922 | 201 |
| 698 | 3300005337 | Ga0070682_100918069 | Ga0070682_1009180691 | 201 |
| 699 | 3300005339 | Ga0070660_100204312 | Ga0070660_1002043122 | 201 |
| 700 | 3300005347 | Ga0070668_100198229 | Ga0070668_1001982292 | 201 |
| 701 | 3300005354 | Ga0070675_100928914 | Ga0070675_1009289142 | 201 |
| 702 | 3300005356 | Ga0070674_100051355 | Ga0070674_1000513553 | 201 |
| 703 | 3300005364 | Ga0070673_101210468 | Ga0070673_1012104681 | 201 |
| 704 | 3300005367 | Ga0070667_100117359 | Ga0070667_1001173593 | 201 |
| 705 | 3300005434 | Ga0070709_10000728 | Ga0070709_100007284 | 201 |
| 706 | 3300005434 | Ga0070709_10019151 | Ga0070709_100191512 | 201 |
| 707 | 3300005435 | Ga0070714_100017734 | Ga0070714_1000177346 | 201 |
| 708 | 3300005435 | Ga0070714_100025169 | Ga0070714_1000251693 | 201 |
| 709 | 3300005436 | Ga0070713_100047868 | Ga0070713_1000478684 | 201 |
| 710 | 3300005436 | Ga0070713_100209310 | Ga0070713_1002093102 | 201 |
| 711 | 3300005437 | Ga0070710_10003264 | Ga0070710_100032642 | 201 |
| 712 | 3300005437 | Ga0070710_10004979 | Ga0070710_100049797 | 201 |
| 713 | 3300005437 | Ga0070710_10036756 | Ga0070710_100367564 | 201 |
| 714 | 3300005439 | Ga0070711_100003505 | Ga0070711_1000035055 | 201 |
| 715 | 3300005439 | Ga0070711_100004294 | Ga0070711_1000042942 | 201 |
| 716 | 3300005439 | Ga0070711_100006316 | Ga0070711_1000063164 | 201 |
| 717 | 3300005439 | Ga0070711_100617833 | Ga0070711_1006178332 | 201 |
| 718 | 3300005441 | Ga0070700_100950722 | Ga0070700_1009507221 | 201 |
| 719 | 3300005445 | Ga0070708_100191892 | Ga0070708_1001918922 | 201 |
| 720 | 3300005455 | Ga0070663_100020188 | Ga0070663_1000201886 | 201 |
| 721 | 3300005456 | Ga0070678_100036932 | Ga0070678_1000369323 | 201 |
| 722 | 3300005456 | Ga0070678_100184923 | Ga0070678_1001849232 | 201 |
| 723 | 3300005456 | Ga0070678_100244536 | Ga0070678_1002445362 | 201 |
| 724 | 3300005457 | Ga0070662_100098881 | Ga0070662_1000988812 | 201 |
| 725 | 3300005466 | Ga0070685_10143345 | Ga0070685_101433452 | 201 |
| 726 | 3300005467 | Ga0070706_100076633 | Ga0070706_1000766331 | 201 |
| 727 | 3300005467 | Ga0070706_100207185 | Ga0070706_1002071853 | 201 |
| 728 | 3300005471 | Ga0070698_100136085 | Ga0070698_1001360853 | 201 |
| 729 | 3300005471 | Ga0070698_100270290 | Ga0070698_1002702901 | 201 |
| 730 | 3300005535 | Ga0070684_100001738 | Ga0070684_1000017388 | 201 |
| 731 | 3300005536 | Ga0070697_100723360 | Ga0070697_1007233601 | 201 |
| 732 | 3300005539 | Ga0068853_100951177 | Ga0068853_1009511771 | 201 |
| 733 | 3300005543 | Ga0070672_100024849 | Ga0070672_1000248492 | 201 |
| 734 | 3300005543 | Ga0070672_100193609 | Ga0070672_1001936092 | 201 |
| 735 | 3300005548 | Ga0070665_100240068 | Ga0070665_1002400683 | 201 |
| 736 | 3300005548 | Ga0070665_100448951 | Ga0070665_1004489512 | 201 |
| 737 | 3300005563 | Ga0068855_100273509 | Ga0068855_1002735093 | 201 |
| 738 | 3300005577 | Ga0068857_100591784 | Ga0068857_1005917842 | 201 |
| 739 | 3300005614 | Ga0068856_100232200 | Ga0068856_1002322002 | 201 |
| 740 | 3300005615 | Ga0070702_100471666 | Ga0070702_1004716662 | 201 |
| 741 | 3300005616 | Ga0068852_100030973 | Ga0068852_1000309734 | 201 |
| 742 | 3300005616 | Ga0068852_100066218 | Ga0068852_1000662182 | 201 |
| 743 | 3300005618 | Ga0068864_100708859 | Ga0068864_1007088592 | 201 |
| 744 | 3300005718 | Ga0068866_10022148 | Ga0068866_100221483 | 201 |
| 745 | 3300005842 | Ga0068858_100517447 | Ga0068858_1005174472 | 201 |
| 746 | 3300005842 | Ga0068858_100573269 | Ga0068858_1005732692 | 201 |
| 747 | 3300005937 | Ga0081455_10001400 | Ga0081455_100014007 | 201 |
| 748 | 3300005937 | Ga0081455_10010625 | Ga0081455_100106252 | 201 |
| 749 | 3300005937 | Ga0081455_10035291 | Ga0081455_100352914 | 201 |
| 750 | 3300005983 | Ga0081540_1000308 | Ga0081540_10003082 | 201 |
| 751 | 3300005983 | Ga0081540_1003068 | Ga0081540_100306816 | 201 |
| 752 | 3300005983 | Ga0081540_1003948 | Ga0081540_100394816 | 201 |
| 753 | 3300005983 | Ga0081540_1015571 | Ga0081540_10155716 | 201 |
| 754 | 3300005983 | Ga0081540_1027416 | Ga0081540_10274163 | 201 |
| 755 | 3300005983 | Ga0081540_1040558 | Ga0081540_10405582 | 201 |
| 756 | 3300005983 | Ga0081540_1155196 | Ga0081540_11551962 | 201 |
| 757 | 3300005985 | Ga0081539_10000152 | Ga0081539_1000015295 | 201 |
| 758 | 3300006028 | Ga0070717_10255715 | Ga0070717_102557152 | 201 |
| 759 | 3300006038 | Ga0075365_10026706 | Ga0075365_100267062 | 201 |
| 760 | 3300006038 | Ga0075365_10047865 | Ga0075365_100478652 | 201 |
| 761 | 3300006048 | Ga0075363_100076507 | Ga0075363_1000765072 | 201 |
| 762 | 3300006048 | Ga0075363_100192631 | Ga0075363_1001926312 | 201 |
| 763 | 3300006163 | Ga0070715_10000375 | Ga0070715_100003752 | 201 |
| 764 | 3300006163 | Ga0070715_10074126 | Ga0070715_100741262 | 201 |
| 765 | 3300006173 | Ga0070716_100001019 | Ga0070716_10000101910 | 201 |
| 766 | 3300006173 | Ga0070716_100088605 | Ga0070716_1000886052 | 201 |
| 767 | 3300006175 | Ga0070712_100012939 | Ga0070712_1000129395 | 201 |
| 768 | 3300006175 | Ga0070712_100054091 | Ga0070712_1000540912 | 201 |
| 769 | 3300006175 | Ga0070712_100340482 | Ga0070712_1003404821 | 201 |
| 770 | 3300006178 | Ga0075367_10233446 | Ga0075367_102334462 | 201 |
| 771 | 3300006237 | Ga0097621_100169549 | Ga0097621_1001695493 | 201 |
| 772 | 3300006358 | Ga0068871_100351962 | Ga0068871_1003519622 | 201 |
| 773 | 3300006358 | Ga0068871_100480077 | Ga0068871_1004800772 | 201 |
| 774 | 3300006871 | Ga0075434_100415364 | Ga0075434_1004153642 | 201 |
| 775 | 3300007265 | Ga0099794_10108827 | Ga0099794_101088271 | 201 |
| 776 | 3300007788 | Ga0099795_10008270 | Ga0099795_100082703 | 201 |
| 777 | 3300009093 | Ga0105240_10943384 | Ga0105240_109433841 | 201 |
| 778 | 3300009094 | Ga0111539_10169924 | Ga0111539_101699244 | 201 |
| 779 | 3300009098 | Ga0105245_10210908 | Ga0105245_102109082 | 201 |
| 780 | 3300009101 | Ga0105247_10049713 | Ga0105247_100497133 | 201 |
| 781 | 3300009148 | Ga0105243_10035452 | Ga0105243_100354523 | 201 |
| 782 | 3300009148 | Ga0105243_10141567 | Ga0105243_101415673 | 201 |
| 783 | 3300009148 | Ga0105243_11309294 | Ga0105243_113092941 | 201 |
| 784 | 3300009174 | Ga0105241_10684884 | Ga0105241_106848841 | 201 |
| 785 | 3300009176 | Ga0105242_10179193 | Ga0105242_101791932 | 201 |
| 786 | 3300009176 | Ga0105242_10346065 | Ga0105242_103460652 | 201 |
| 787 | 3300009177 | Ga0105248_10068603 | Ga0105248_100686034 | 201 |
| 788 | 3300009177 | Ga0105248_10273822 | Ga0105248_102738222 | 201 |
| 789 | 3300009551 | Ga0105238_10344279 | Ga0105238_103442792 | 201 |
| 790 | 3300009553 | Ga0105249_10328458 | Ga0105249_103284583 | 201 |
| 791 | 3300010375 | Ga0105239_10561602 | Ga0105239_105616022 | 201 |
| 792 | 3300010375 | Ga0105239_11033299 | Ga0105239_110332991 | 201 |
| 793 | 3300011119 | Ga0105246_10045259 | Ga0105246_100452593 | 201 |
| 794 | 3300011119 | Ga0105246_10292029 | Ga0105246_102920292 | 201 |
| 795 | 3300013297 | Ga0157378_10630520 | Ga0157378_106305202 | 201 |
| 796 | 3300013306 | Ga0163162_10031457 | Ga0163162_100314573 | 201 |
| 797 | 3300013306 | Ga0163162_10073750 | Ga0163162_100737504 | 201 |
| 798 | 3300013306 | Ga0163162_10303432 | Ga0163162_103034323 | 201 |
| 799 | 3300013306 | Ga0163162_11433730 | Ga0163162_114337302 | 201 |
| 800 | 3300013308 | Ga0157375_10088023 | Ga0157375_100880232 | 201 |
| 801 | 3300013308 | Ga0157375_11830323 | Ga0157375_118303231 | 201 |
| 802 | 3300014326 | Ga0157380_10227515 | Ga0157380_102275152 | 201 |
| 803 | 3300014326 | Ga0157380_10611034 | Ga0157380_106110341 | 201 |
| 804 | 3300014745 | Ga0157377_10229994 | Ga0157377_102299942 | 201 |
| 805 | 3300014968 | Ga0157379_10133485 | Ga0157379_101334853 | 201 |
| 806 | 3300014969 | Ga0157376_10117436 | Ga0157376_101174362 | 201 |
| 807 | 3300014969 | Ga0157376_10151042 | Ga0157376_101510423 | 201 |
| 808 | 3300017792 | Ga0163161_10051652 | Ga0163161_100516525 | 201 |
| 809 | 3300017792 | Ga0163161_10054139 | Ga0163161_100541393 | 201 |
| 810 | 3300021361 | Ga0213872_10020587 | Ga0213872_100205872 | 201 |
| 811 | 3300021361 | Ga0213872_10081290 | Ga0213872_100812901 | 201 |
| 812 | 3300021384 | Ga0213876_10005504 | Ga0213876_100055047 | 201 |
| 813 | 3300025297 | Ga0209758_1002041 | Ga0209758_100204119 | 201 |
| 814 | 3300025893 | Ga0207682_10298062 | Ga0207682_102980622 | 201 |
| 815 | 3300025898 | Ga0207692_10010166 | Ga0207692_100101663 | 201 |
| 816 | 3300025898 | Ga0207692_10140044 | Ga0207692_101400442 | 201 |
| 817 | 3300025899 | Ga0207642_10004478 | Ga0207642_100044781 | 201 |
| 818 | 3300025900 | Ga0207710_10086136 | Ga0207710_100861362 | 201 |
| 819 | 3300025901 | Ga0207688_10279757 | Ga0207688_102797572 | 201 |
| 820 | 3300025901 | Ga0207688_10327720 | Ga0207688_103277202 | 201 |
| 821 | 3300025903 | Ga0207680_10523479 | Ga0207680_105234791 | 201 |
| 822 | 3300025904 | Ga0207647_10062717 | Ga0207647_100627172 | 201 |
| 823 | 3300025905 | Ga0207685_10071488 | Ga0207685_100714882 | 201 |
| 824 | 3300025906 | Ga0207699_10005178 | Ga0207699_100051787 | 201 |
| 825 | 3300025906 | Ga0207699_10015917 | Ga0207699_100159174 | 201 |
| 826 | 3300025910 | Ga0207684_10248755 | Ga0207684_102487552 | 201 |
| 827 | 3300025913 | Ga0207695_10105874 | Ga0207695_101058742 | 201 |
| 828 | 3300025915 | Ga0207693_10002089 | Ga0207693_100020893 | 201 |
| 829 | 3300025915 | Ga0207693_10019541 | Ga0207693_100195413 | 201 |
| 830 | 3300025915 | Ga0207693_10193679 | Ga0207693_101936792 | 201 |
| 831 | 3300025916 | Ga0207663_10001142 | Ga0207663_100011425 | 201 |
| 832 | 3300025916 | Ga0207663_10016886 | Ga0207663_100168864 | 201 |
| 833 | 3300025917 | Ga0207660_10210454 | Ga0207660_102104542 | 201 |
| 834 | 3300025919 | Ga0207657_10222298 | Ga0207657_102222982 | 201 |
| 835 | 3300025920 | Ga0207649_10078370 | Ga0207649_100783703 | 201 |
| 836 | 3300025921 | Ga0207652_10287823 | Ga0207652_102878232 | 201 |
| 837 | 3300025922 | Ga0207646_10334697 | Ga0207646_103346972 | 201 |
| 838 | 3300025926 | Ga0207659_10792341 | Ga0207659_107923412 | 201 |
| 839 | 3300025927 | Ga0207687_10152740 | Ga0207687_101527402 | 201 |
| 840 | 3300025927 | Ga0207687_10632969 | Ga0207687_106329691 | 201 |
| 841 | 3300025928 | Ga0207700_10006146 | Ga0207700_100061463 | 201 |
| 842 | 3300025928 | Ga0207700_10171192 | Ga0207700_101711922 | 201 |
| 843 | 3300025929 | Ga0207664_10018451 | Ga0207664_100184513 | 201 |
| 844 | 3300025929 | Ga0207664_10208746 | Ga0207664_102087462 | 201 |
| 845 | 3300025931 | Ga0207644_10188394 | Ga0207644_101883942 | 201 |
| 846 | 3300025933 | Ga0207706_10045771 | Ga0207706_100457713 | 201 |
| 847 | 3300025934 | Ga0207686_10065047 | Ga0207686_100650473 | 201 |
| 848 | 3300025935 | Ga0207709_10022961 | Ga0207709_100229613 | 201 |
| 849 | 3300025935 | Ga0207709_10048263 | Ga0207709_100482631 | 201 |
| 850 | 3300025936 | Ga0207670_10220005 | Ga0207670_102200052 | 201 |
| 851 | 3300025937 | Ga0207669_10016667 | Ga0207669_100166673 | 201 |
| 852 | 3300025938 | Ga0207704_10016698 | Ga0207704_100166983 | 201 |
| 853 | 3300025939 | Ga0207665_10002085 | Ga0207665_1000208512 | 201 |
| 854 | 3300025939 | Ga0207665_10163618 | Ga0207665_101636183 | 201 |
| 855 | 3300025940 | Ga0207691_10023461 | Ga0207691_100234613 | 201 |
| 856 | 3300025940 | Ga0207691_10127129 | Ga0207691_101271293 | 201 |
| 857 | 3300025940 | Ga0207691_11001979 | Ga0207691_110019791 | 201 |
| 858 | 3300025941 | Ga0207711_10007853 | Ga0207711_100078534 | 201 |
| 859 | 3300025942 | Ga0207689_10436540 | Ga0207689_104365402 | 201 |
| 860 | 3300025942 | Ga0207689_10579743 | Ga0207689_105797432 | 201 |
| 861 | 3300025944 | Ga0207661_10024141 | Ga0207661_100241413 | 201 |
| 862 | 3300025945 | Ga0207679_10095198 | Ga0207679_100951982 | 201 |
| 863 | 3300025945 | Ga0207679_10366036 | Ga0207679_103660362 | 201 |
| 864 | 3300025961 | Ga0207712_10145797 | Ga0207712_101457972 | 201 |
| 865 | 3300025961 | Ga0207712_10283488 | Ga0207712_102834882 | 201 |
| 866 | 3300025972 | Ga0207668_10060228 | Ga0207668_100602283 | 201 |
| 867 | 3300025986 | Ga0207658_10252466 | Ga0207658_102524662 | 201 |
| 868 | 3300026023 | Ga0207677_10015943 | Ga0207677_100159435 | 201 |
| 869 | 3300026035 | Ga0207703_10898011 | Ga0207703_108980112 | 201 |
| 870 | 3300026067 | Ga0207678_10003596 | Ga0207678_1000359619 | 201 |
| 871 | 3300026067 | Ga0207678_10011597 | Ga0207678_100115973 | 201 |
| 872 | 3300026078 | Ga0207702_10184364 | Ga0207702_101843642 | 201 |
| 873 | 3300026088 | Ga0207641_10211920 | Ga0207641_102119202 | 201 |
| 874 | 3300026089 | Ga0207648_10018263 | Ga0207648_100182634 | 201 |
| 875 | 3300026095 | Ga0207676_10660886 | Ga0207676_106608862 | 201 |
| 876 | 3300026116 | Ga0207674_10480234 | Ga0207674_104802342 | 201 |
| 877 | 3300026118 | Ga0207675_100075495 | Ga0207675_1000754953 | 201 |
| 878 | 3300026118 | Ga0207675_100242955 | Ga0207675_1002429553 | 201 |
| 879 | 3300026121 | Ga0207683_10067391 | Ga0207683_100673913 | 201 |
| 880 | 3300026121 | Ga0207683_10068087 | Ga0207683_100680872 | 201 |
| 881 | 3300026121 | Ga0207683_10225450 | Ga0207683_102254503 | 201 |
| 882 | 3300026142 | Ga0207698_10048144 | Ga0207698_100481444 | 201 |
| 883 | 3300026142 | Ga0207698_10056286 | Ga0207698_100562862 | 201 |
| 884 | 3300026142 | Ga0207698_10728485 | Ga0207698_107284851 | 201 |
| 885 | 3300027907 | Ga0207428_10250158 | Ga0207428_102501582 | 201 |
| 886 | 3300028379 | Ga0268266_10300642 | Ga0268266_103006422 | 201 |
| 887 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020254 | 201 |
| 888 | 3300028794 | Ga0307515_10411918 | Ga0307515_104119181 | 201 |
| 889 | 3300028794 | Ga0307515_10503777 | Ga0307515_105037771 | 201 |
| 890 | 3300031240 | Ga0265320_10063898 | Ga0265320_100638982 | 201 |
| 891 | 3300031247 | Ga0265340_10035185 | Ga0265340_100351852 | 201 |
| 892 | 3300031249 | Ga0265339_10185500 | Ga0265339_101855002 | 201 |
| 893 | 3300031456 | Ga0307513_10161197 | Ga0307513_101611973 | 201 |
| 894 | 3300031616 | Ga0307508_10016258 | Ga0307508_100162583 | 201 |
| 895 | 3300031616 | Ga0307508_10067251 | Ga0307508_100672513 | 201 |
| 896 | 3300031731 | Ga0307405_10164710 | Ga0307405_101647102 | 201 |
| 897 | 3300031911 | Ga0307412_10411398 | Ga0307412_104113981 | 201 |
| 898 | 3300031911 | Ga0307412_10816596 | Ga0307412_108165962 | 201 |
| 899 | 3300035086 | Ga0373934_0010877 | Ga0373934_0010877_1426_2040 | 201 |
| 900 | 3300035118 | Ga0373954_0186590 | Ga0373954_0186590_247_861 | 201 |
| 901 | 3300035119 | Ga0373956_0198206 | Ga0373956_0198206_104_718 | 201 |
| 902 | 3300035171 | Ga0373946_0183440 | Ga0373946_0183440_310_924 | 201 |
| 903 | 3300035691 | Ga0373931_0108054 | Ga0373931_0108054_243_857 | 201 |
| 904 | 3300035692 | Ga0373935_0547281 | Ga0373935_0547281_107_721 | 201 |
| 905 | 3300035724 | Ga0373933_0010551 | Ga0373933_0010551_3881_4495 | 201 |
| 906 | 3300036401 | Ga0373937_0795344 | Ga0373937_0795344_250_864 | 201 |
| 907 | 3300037068 | Ga0373925_0768826 | Ga0373925_0768826_38_652 | 201 |
| 908 | 3300039437 | Ga0436365_0797309 | Ga0436365_0797309_717_1328 | 201 |
| 909 | 3300039438 | Ga0436360_0486890 | Ga0436360_0486890_787_1398 | 201 |
| 910 | 3300039447 | Ga0436361_0911132 | Ga0436361_0911132_105_716 | 201 |
| 911 | 3300039447 | Ga0436361_1122186 | Ga0436361_1122186_624_1247 | 201 |
| 912 | 3300039450 | Ga0436363_1578383 | Ga0436363_1578383_352_963 | 201 |
| 913 | 3300039453 | Ga0436362_1242730 | Ga0436362_1242730_3918_4529 | 201 |
| 914 | 3300044693 | Ga0466961_0190585 | Ga0466961_0190585_52_666 | 201 |
| 915 | 3300044694 | Ga0466963_0320087 | Ga0466963_0320087_452_1063 | 201 |
| 916 | 3300044735 | Ga0466968_0192678 | Ga0466968_0192678_303_908 | 201 |
| 917 | 3300045049 | Ga0466959_0068194 | Ga0466959_0068194_1796_2407 | 201 |
| 918 | 3300046454 | Ga0495592_0077291 | Ga0495592_0077291_1572_2186 | 201 |
| 919 | 3300046455 | Ga0495603_0089386 | Ga0495603_0089386_248_862 | 201 |
| 920 | 3300046459 | Ga0495629_0015079 | Ga0495629_0015079_3713_4327 | 201 |
| 921 | 3300046462 | Ga0495651_0109977 | Ga0495651_0109977_1190_1804 | 201 |
| 922 | 3300046463 | Ga0495653_0057045 | Ga0495653_0057045_1524_2138 | 201 |
| 923 | 3300046476 | Ga0495662_0045488 | Ga0495662_0045488_121_735 | 201 |
| 924 | 3300046477 | Ga0495664_0006969 | Ga0495664_0006969_177_791 | 201 |
| 925 | 3300046477 | Ga0495664_0394036 | Ga0495664_0394036_75_689 | 201 |
| 926 | 3300046507 | Ga0495606_0000939 | Ga0495606_0000939_27315_27929 | 201 |
| 927 | 3300046511 | Ga0495608_0014306 | Ga0495608_0014306_3426_4040 | 201 |
| 928 | 3300046514 | Ga0495618_0160656 | Ga0495618_0160656_593_1207 | 201 |
| 929 | 3300046516 | Ga0495628_0032399 | Ga0495628_0032399_374_988 | 201 |
| 930 | 3300046531 | Ga0495665_0334218 | Ga0495665_0334218_118_732 | 201 |
| 931 | 3300046533 | Ga0495640_0016226 | Ga0495640_0016226_1689_2303 | 201 |
| 932 | 3300046535 | Ga0495586_0008566 | Ga0495586_0008566_1074_1688 | 201 |
| 933 | 3300046536 | Ga0495587_0058859 | Ga0495587_0058859_30_644 | 201 |
| 934 | 3300046538 | Ga0495609_0215207 | Ga0495609_0215207_153_767 | 201 |
| 935 | 3300046543 | Ga0495645_0173379 | Ga0495645_0173379_699_1313 | 201 |
| 936 | 3300046559 | Ga0495667_0058053 | Ga0495667_0058053_1719_2333 | 201 |
| 937 | 3300046616 | Ga0495668_0036492 | Ga0495668_0036492_660_1274 | 201 |
| 938 | 3300046616 | Ga0495668_0085577 | Ga0495668_0085577_1096_1710 | 201 |
| 939 | 3300046616 | Ga0495668_0146911 | Ga0495668_0146911_494_1108 | 201 |
| 940 | 3300046642 | Ga0495634_0067697 | Ga0495634_0067697_1719_2333 | 201 |
| 941 | 3300046678 | Ga0495599_0046840 | Ga0495599_0046840_833_1447 | 201 |
| 942 | 3300046678 | Ga0495599_0299733 | Ga0495599_0299733_217_831 | 201 |
| 943 | 3300046679 | Ga0495623_0012115 | Ga0495623_0012115_1528_2142 | 201 |
| 944 | 3300046680 | Ga0495646_0155129 | Ga0495646_0155129_176_790 | 201 |
| 945 | 3300046684 | Ga0495669_0014374 | Ga0495669_0014374_2501_3115 | 201 |
| 946 | 3300046689 | Ga0495613_0445759 | Ga0495613_0445759_62_676 | 201 |
| 947 | 3300046809 | Ga0495600_0080341 | Ga0495600_0080341_1018_1632 | 201 |
| 948 | 3300047317 | Ga0495604_0064554 | Ga0495604_0064554_1663_2277 | 201 |
| 949 | 3300047319 | Ga0495674_0335194 | Ga0495674_0335194_501_1115 | 201 |
| 950 | 3300047319 | Ga0495674_0542316 | Ga0495674_0542316_156_770 | 201 |
| 951 | 3300047320 | Ga0495672_0024971 | Ga0495672_0024971_1703_2317 | 201 |
| 952 | 3300047320 | Ga0495672_0033009 | Ga0495672_0033009_819_1433 | 201 |
| 953 | 3300047320 | Ga0495672_0100321 | Ga0495672_0100321_443_1054 | 201 |
| 954 | 3300047320 | Ga0495672_0101470 | Ga0495672_0101470_456_1070 | 201 |
| 955 | 3300047322 | Ga0495680_0061366 | Ga0495680_0061366_2224_2838 | 201 |
| 956 | 3300047322 | Ga0495680_0549030 | Ga0495680_0549030_62_676 | 201 |
| 957 | 3300047444 | Ga0495675_0030160 | Ga0495675_0030160_1947_2561 | 201 |
| 958 | 3300047469 | Ga0495673_0023822 | Ga0495673_0023822_163_777 | 201 |
| 959 | 3300047471 | Ga0495684_0050876 | Ga0495684_0050876_977_1591 | 201 |
| 960 | 3300047673 | Ga0495593_0057446 | Ga0495593_0057446_1355_1969 | 201 |
| 961 | 3300047673 | Ga0495593_0126027 | Ga0495593_0126027_586_1200 | 201 |
| 962 | 3300048088 | Ga0495602_0110863 | Ga0495602_0110863_1031_1645 | 201 |
| 963 | 3300048903 | Ga0496100_0016050 | Ga0496100_0016050_3390_4004 | 201 |
| 964 | 3300048907 | Ga0496104_0280093 | Ga0496104_0280093_99_713 | 201 |
| 965 | 3300048909 | Ga0496106_0396550 | Ga0496106_0396550_231_845 | 201 |
| 966 | 3300048910 | Ga0496107_0089030 | Ga0496107_0089030_1292_1906 | 201 |
| 967 | 3300048913 | Ga0496110_0423716 | Ga0496110_0423716_20_634 | 201 |
| 968 | 3300048915 | Ga0496112_0005812 | Ga0496112_0005812_7029_7643 | 201 |
| 969 | 3300048915 | Ga0496112_0436146 | Ga0496112_0436146_37_651 | 201 |
| 970 | 3300048919 | Ga0496116_0262808 | Ga0496116_0262808_147_761 | 201 |
| 971 | 3300048921 | Ga0496118_0018781 | Ga0496118_0018781_3622_4236 | 201 |
| 972 | 3300048921 | Ga0496118_0175201 | Ga0496118_0175201_140_754 | 201 |
| 973 | 3300048922 | Ga0496119_0150672 | Ga0496119_0150672_167_781 | 201 |
| 974 | 3300048924 | Ga0496121_0000428 | Ga0496121_0000428_23952_24566 | 201 |
| 975 | 3300048924 | Ga0496121_0054851 | Ga0496121_0054851_1816_2430 | 201 |
| 976 | 3300048929 | Ga0496126_0008929 | Ga0496126_0008929_1111_1725 | 201 |
| 977 | 3300048929 | Ga0496126_0014924 | Ga0496126_0014924_236_850 | 201 |
| 978 | 3300048929 | Ga0496126_0078436 | Ga0496126_0078436_594_1208 | 201 |
| 979 | 3300048929 | Ga0496126_0642176 | Ga0496126_0642176_184_798 | 201 |
| 980 | 3300050490 | nmdc:mga03n38_131645_c1 | nmdc:mga03n38_131645_c1_615_1229 | 201 |
| 981 | 3300050492 | nmdc:mga0yw44_65311_c1 | nmdc:mga0yw44_65311_c1_252_866 | 201 |
| 982 | 3300050494 | nmdc:mga06z11_434854_c1 | nmdc:mga06z11_434854_c1_56_670 | 201 |
| 983 | 3300050511 | nmdc:mga08y16_238984_c1 | nmdc:mga08y16_238984_c1_826_1440 | 201 |
| 984 | 3300050512 | nmdc:mga0n895_318243_c1 | nmdc:mga0n895_318243_c1_651_1265 | 201 |
| 985 | 3300050514 | nmdc:mga08x19_495723_c1 | nmdc:mga08x19_495723_c1_134_748 | 201 |
| 986 | 3300053077 | Ga0495601_0057542 | Ga0495601_0057542_900_1514 | 201 |
| 987 | 3300053077 | Ga0495601_0506683 | Ga0495601_0506683_22_636 | 201 |
| 988 | 3300053078 | Ga0495612_0021008 | Ga0495612_0021008_285_899 | 201 |
| 989 | 3300053083 | Ga0495655_0057159 | Ga0495655_0057159_136_771 | 201 |
| 990 | 3300053085 | Ga0495619_0069535 | Ga0495619_0069535_1573_2187 | 201 |
| 991 | 3300053086 | Ga0500578_0072026 | Ga0500578_0072026_645_1259 | 201 |
| 992 | 3300053093 | Ga0500651_0005411 | Ga0500651_0005411_1411_2025 | 201 |
| 993 | 3300053098 | Ga0500650_0096284 | Ga0500650_0096284_703_1317 | 201 |
| 994 | 3300053727 | Ga0500611_063934 | Ga0500611_063934_20_634 | 201 |
| 995 | 3300061719 | Ga0466962_0058611 | Ga0466962_0058611_1042_1653 | 201 |
| 996 | 3300001989 | JGI24739J22299_10044129 | JGI24739J22299_100441292 | 202 |
| 997 | 3300003215 | JGI25153J46596_10001185 | JGI25153J46596_100011855 | 202 |
| 998 | 3300003215 | JGI25153J46596_10001639 | JGI25153J46596_100016392 | 202 |
| 999 | 3300003215 | JGI25153J46596_10002188 | JGI25153J46596_1000218815 | 202 |
| 1000 | 3300003794 | Ga0055531_10003312 | Ga0055531_100033129 | 202 |
| 1001 | 3300003794 | Ga0055531_10020075 | Ga0055531_100200754 | 202 |
| 1002 | 3300004625 | Ga0055543_1044879 | Ga0055543_10448791 | 202 |
| 1003 | 3300005262 | Ga0065165_1006854 | Ga0065165_10068543 | 202 |
| 1004 | 3300005334 | Ga0068869_100413498 | Ga0068869_1004134982 | 202 |
| 1005 | 3300005339 | Ga0070660_100309693 | Ga0070660_1003096932 | 202 |
| 1006 | 3300005344 | Ga0070661_100546520 | Ga0070661_1005465201 | 202 |
| 1007 | 3300005347 | Ga0070668_100051531 | Ga0070668_1000515312 | 202 |
| 1008 | 3300005354 | Ga0070675_100083596 | Ga0070675_1000835962 | 202 |
| 1009 | 3300005356 | Ga0070674_100049522 | Ga0070674_1000495224 | 202 |
| 1010 | 3300005367 | Ga0070667_100465284 | Ga0070667_1004652841 | 202 |
| 1011 | 3300005436 | Ga0070713_100670055 | Ga0070713_1006700551 | 202 |
| 1012 | 3300005455 | Ga0070663_100035135 | Ga0070663_1000351354 | 202 |
| 1013 | 3300005455 | Ga0070663_100036246 | Ga0070663_1000362463 | 202 |
| 1014 | 3300005455 | Ga0070663_100363344 | Ga0070663_1003633442 | 202 |
| 1015 | 3300005455 | Ga0070663_100667663 | Ga0070663_1006676631 | 202 |
| 1016 | 3300005456 | Ga0070678_100094201 | Ga0070678_1000942013 | 202 |
| 1017 | 3300005456 | Ga0070678_100182553 | Ga0070678_1001825533 | 202 |
| 1018 | 3300005457 | Ga0070662_100097337 | Ga0070662_1000973372 | 202 |
| 1019 | 3300005457 | Ga0070662_100357604 | Ga0070662_1003576042 | 202 |
| 1020 | 3300005459 | Ga0068867_100238838 | Ga0068867_1002388382 | 202 |
| 1021 | 3300005539 | Ga0068853_100300036 | Ga0068853_1003000362 | 202 |
| 1022 | 3300005543 | Ga0070672_100535309 | Ga0070672_1005353092 | 202 |
| 1023 | 3300005547 | Ga0070693_100274441 | Ga0070693_1002744412 | 202 |
| 1024 | 3300005548 | Ga0070665_100265853 | Ga0070665_1002658533 | 202 |
| 1025 | 3300005563 | Ga0068855_100059927 | Ga0068855_1000599276 | 202 |
| 1026 | 3300005564 | Ga0070664_100179406 | Ga0070664_1001794062 | 202 |
| 1027 | 3300005577 | Ga0068857_100124881 | Ga0068857_1001248811 | 202 |
| 1028 | 3300005578 | Ga0068854_100196643 | Ga0068854_1001966432 | 202 |
| 1029 | 3300005614 | Ga0068856_100343683 | Ga0068856_1003436832 | 202 |
| 1030 | 3300005615 | Ga0070702_100423059 | Ga0070702_1004230591 | 202 |
| 1031 | 3300005616 | Ga0068852_100149369 | Ga0068852_1001493693 | 202 |
| 1032 | 3300005616 | Ga0068852_100568428 | Ga0068852_1005684282 | 202 |
| 1033 | 3300005617 | Ga0068859_100617806 | Ga0068859_1006178062 | 202 |
| 1034 | 3300005617 | Ga0068859_100900193 | Ga0068859_1009001932 | 202 |
| 1035 | 3300005718 | Ga0068866_10120433 | Ga0068866_101204332 | 202 |
| 1036 | 3300005842 | Ga0068858_100480790 | Ga0068858_1004807902 | 202 |
| 1037 | 3300005843 | Ga0068860_100352959 | Ga0068860_1003529592 | 202 |
| 1038 | 3300005843 | Ga0068860_100641071 | Ga0068860_1006410712 | 202 |
| 1039 | 3300006038 | Ga0075365_10017560 | Ga0075365_100175603 | 202 |
| 1040 | 3300006038 | Ga0075365_10068618 | Ga0075365_100686183 | 202 |
| 1041 | 3300006038 | Ga0075365_10757890 | Ga0075365_107578901 | 202 |
| 1042 | 3300006042 | Ga0075368_10059026 | Ga0075368_100590262 | 202 |
| 1043 | 3300006048 | Ga0075363_100047857 | Ga0075363_1000478572 | 202 |
| 1044 | 3300006051 | Ga0075364_10132788 | Ga0075364_101327882 | 202 |
| 1045 | 3300006051 | Ga0075364_10510726 | Ga0075364_105107262 | 202 |
| 1046 | 3300006195 | Ga0075366_10006876 | Ga0075366_100068767 | 202 |
| 1047 | 3300006353 | Ga0075370_10137176 | Ga0075370_101371762 | 202 |
| 1048 | 3300006358 | Ga0068871_101441619 | Ga0068871_1014416191 | 202 |
| 1049 | 3300006931 | Ga0097620_100617831 | Ga0097620_1006178312 | 202 |
| 1050 | 3300006931 | Ga0097620_100900124 | Ga0097620_1009001242 | 202 |
| 1051 | 3300006941 | Ga0099825_1013172 | Ga0099825_10131724 | 202 |
| 1052 | 3300006942 | Ga0099824_1053379 | Ga0099824_10533791 | 202 |
| 1053 | 3300009093 | Ga0105240_10169998 | Ga0105240_101699982 | 202 |
| 1054 | 3300009101 | Ga0105247_10283311 | Ga0105247_102833112 | 202 |
| 1055 | 3300009148 | Ga0105243_10220751 | Ga0105243_102207512 | 202 |
| 1056 | 3300009148 | Ga0105243_10447262 | Ga0105243_104472622 | 202 |
| 1057 | 3300009174 | Ga0105241_10388083 | Ga0105241_103880831 | 202 |
| 1058 | 3300009176 | Ga0105242_11593318 | Ga0105242_115933181 | 202 |
| 1059 | 3300009177 | Ga0105248_10051239 | Ga0105248_100512397 | 202 |
| 1060 | 3300009177 | Ga0105248_10193501 | Ga0105248_101935013 | 202 |
| 1061 | 3300009177 | Ga0105248_10852723 | Ga0105248_108527232 | 202 |
| 1062 | 3300009545 | Ga0105237_10014113 | Ga0105237_1001411311 | 202 |
| 1063 | 3300009545 | Ga0105237_10091868 | Ga0105237_100918682 | 202 |
| 1064 | 3300009545 | Ga0105237_10481348 | Ga0105237_104813482 | 202 |
| 1065 | 3300009545 | Ga0105237_11002228 | Ga0105237_110022282 | 202 |
| 1066 | 3300009551 | Ga0105238_10484587 | Ga0105238_104845872 | 202 |
| 1067 | 3300010375 | Ga0105239_10177229 | Ga0105239_101772293 | 202 |
| 1068 | 3300010375 | Ga0105239_10278904 | Ga0105239_102789042 | 202 |
| 1069 | 3300010375 | Ga0105239_10381015 | Ga0105239_103810154 | 202 |
| 1070 | 3300010375 | Ga0105239_10421118 | Ga0105239_104211182 | 202 |
| 1071 | 3300013100 | Ga0157373_10137455 | Ga0157373_101374552 | 202 |
| 1072 | 3300013104 | Ga0157370_10497404 | Ga0157370_104974041 | 202 |
| 1073 | 3300013306 | Ga0163162_10058069 | Ga0163162_100580695 | 202 |
| 1074 | 3300013308 | Ga0157375_10386304 | Ga0157375_103863043 | 202 |
| 1075 | 3300014325 | Ga0163163_10021432 | Ga0163163_100214327 | 202 |
| 1076 | 3300014325 | Ga0163163_10099735 | Ga0163163_100997352 | 202 |
| 1077 | 3300014968 | Ga0157379_10779769 | Ga0157379_107797692 | 202 |
| 1078 | 3300021320 | Ga0214544_1000013 | Ga0214544_1000013161 | 202 |
| 1079 | 3300021321 | Ga0214542_1000013 | Ga0214542_100001373 | 202 |
| 1080 | 3300021324 | Ga0214545_1000012 | Ga0214545_1000012162 | 202 |
| 1081 | 3300021327 | Ga0214543_1000065 | Ga0214543_100006531 | 202 |
| 1082 | 3300025245 | Ga0207425_1014310 | Ga0207425_10143101 | 202 |
| 1083 | 3300025261 | Ga0209233_1009436 | Ga0209233_10094363 | 202 |
| 1084 | 3300025295 | Ga0209564_1003835 | Ga0209564_10038356 | 202 |
| 1085 | 3300025295 | Ga0209564_1066793 | Ga0209564_10667931 | 202 |
| 1086 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026318 | 202 |
| 1087 | 3300025297 | Ga0209758_1000097 | Ga0209758_100009719 | 202 |
| 1088 | 3300025297 | Ga0209758_1001430 | Ga0209758_100143015 | 202 |
| 1089 | 3300025302 | Ga0207426_1000624 | Ga0207426_100062427 | 202 |
| 1090 | 3300025302 | Ga0207426_1001451 | Ga0207426_100145123 | 202 |
| 1091 | 3300025302 | Ga0207426_1007728 | Ga0207426_10077285 | 202 |
| 1092 | 3300025302 | Ga0207426_1016481 | Ga0207426_10164814 | 202 |
| 1093 | 3300025304 | Ga0209257_1000201 | Ga0209257_1000201139 | 202 |
| 1094 | 3300025304 | Ga0209257_1016006 | Ga0209257_10160063 | 202 |
| 1095 | 3300025304 | Ga0209257_1038057 | Ga0209257_10380573 | 202 |
| 1096 | 3300025304 | Ga0209257_1060449 | Ga0209257_10604492 | 202 |
| 1097 | 3300025315 | Ga0207697_10049786 | Ga0207697_100497862 | 202 |
| 1098 | 3300025899 | Ga0207642_10324907 | Ga0207642_103249071 | 202 |
| 1099 | 3300025900 | Ga0207710_10180397 | Ga0207710_101803972 | 202 |
| 1100 | 3300025900 | Ga0207710_10357368 | Ga0207710_103573681 | 202 |
| 1101 | 3300025901 | Ga0207688_10053597 | Ga0207688_100535972 | 202 |
| 1102 | 3300025901 | Ga0207688_10156463 | Ga0207688_101564631 | 202 |
| 1103 | 3300025901 | Ga0207688_10221559 | Ga0207688_102215592 | 202 |
| 1104 | 3300025904 | Ga0207647_10026721 | Ga0207647_100267212 | 202 |
| 1105 | 3300025904 | Ga0207647_10028852 | Ga0207647_100288522 | 202 |
| 1106 | 3300025911 | Ga0207654_10024645 | Ga0207654_100246454 | 202 |
| 1107 | 3300025911 | Ga0207654_10026168 | Ga0207654_100261684 | 202 |
| 1108 | 3300025911 | Ga0207654_10262070 | Ga0207654_102620702 | 202 |
| 1109 | 3300025911 | Ga0207654_10527217 | Ga0207654_105272171 | 202 |
| 1110 | 3300025913 | Ga0207695_10000240 | Ga0207695_1000024025 | 202 |
| 1111 | 3300025914 | Ga0207671_10002558 | Ga0207671_100025584 | 202 |
| 1112 | 3300025914 | Ga0207671_10061143 | Ga0207671_100611434 | 202 |
| 1113 | 3300025914 | Ga0207671_10088938 | Ga0207671_100889382 | 202 |
| 1114 | 3300025917 | Ga0207660_10121892 | Ga0207660_101218922 | 202 |
| 1115 | 3300025919 | Ga0207657_10199560 | Ga0207657_101995602 | 202 |
| 1116 | 3300025921 | Ga0207652_10974864 | Ga0207652_109748641 | 202 |
| 1117 | 3300025923 | Ga0207681_10087353 | Ga0207681_100873533 | 202 |
| 1118 | 3300025924 | Ga0207694_10175678 | Ga0207694_101756782 | 202 |
| 1119 | 3300025927 | Ga0207687_10301737 | Ga0207687_103017372 | 202 |
| 1120 | 3300025931 | Ga0207644_10136629 | Ga0207644_101366291 | 202 |
| 1121 | 3300025932 | Ga0207690_10652755 | Ga0207690_106527551 | 202 |
| 1122 | 3300025933 | Ga0207706_10072699 | Ga0207706_100726992 | 202 |
| 1123 | 3300025933 | Ga0207706_10171426 | Ga0207706_101714262 | 202 |
| 1124 | 3300025935 | Ga0207709_10362493 | Ga0207709_103624932 | 202 |
| 1125 | 3300025937 | Ga0207669_10190403 | Ga0207669_101904032 | 202 |
| 1126 | 3300025940 | Ga0207691_10400364 | Ga0207691_104003642 | 202 |
| 1127 | 3300025941 | Ga0207711_10496353 | Ga0207711_104963532 | 202 |
| 1128 | 3300025941 | Ga0207711_10793579 | Ga0207711_107935792 | 202 |
| 1129 | 3300025972 | Ga0207668_10244942 | Ga0207668_102449422 | 202 |
| 1130 | 3300025981 | Ga0207640_10153939 | Ga0207640_101539392 | 202 |
| 1131 | 3300025986 | Ga0207658_10768282 | Ga0207658_107682821 | 202 |
| 1132 | 3300026035 | Ga0207703_10838580 | Ga0207703_108385801 | 202 |
| 1133 | 3300026041 | Ga0207639_10071039 | Ga0207639_100710392 | 202 |
| 1134 | 3300026041 | Ga0207639_10680882 | Ga0207639_106808822 | 202 |
| 1135 | 3300026041 | Ga0207639_10816530 | Ga0207639_108165301 | 202 |
| 1136 | 3300026067 | Ga0207678_10071540 | Ga0207678_100715402 | 202 |
| 1137 | 3300026067 | Ga0207678_10166050 | Ga0207678_101660502 | 202 |
| 1138 | 3300026067 | Ga0207678_10437867 | Ga0207678_104378671 | 202 |
| 1139 | 3300026088 | Ga0207641_10188351 | Ga0207641_101883512 | 202 |
| 1140 | 3300026089 | Ga0207648_10391941 | Ga0207648_103919411 | 202 |
| 1141 | 3300026116 | Ga0207674_10065697 | Ga0207674_100656973 | 202 |
| 1142 | 3300026118 | Ga0207675_100077932 | Ga0207675_1000779323 | 202 |
| 1143 | 3300026118 | Ga0207675_100748478 | Ga0207675_1007484782 | 202 |
| 1144 | 3300026121 | Ga0207683_10262334 | Ga0207683_102623342 | 202 |
| 1145 | 3300026121 | Ga0207683_10358909 | Ga0207683_103589092 | 202 |
| 1146 | 3300026142 | Ga0207698_10140596 | Ga0207698_101405962 | 202 |
| 1147 | 3300026142 | Ga0207698_10542858 | Ga0207698_105428582 | 202 |
| 1148 | 3300027296 | Ga0209389_1000188 | Ga0209389_100018829 | 202 |
| 1149 | 3300027361 | Ga0209489_113907 | Ga0209489_1139075 | 202 |
| 1150 | 3300027363 | Ga0209700_100437 | Ga0209700_10043756 | 202 |
| 1151 | 3300028381 | Ga0268264_10052221 | Ga0268264_100522215 | 202 |
| 1152 | 3300028558 | Ga0265326_10002308 | Ga0265326_100023087 | 202 |
| 1153 | 3300028563 | Ga0265319_1016741 | Ga0265319_10167412 | 202 |
| 1154 | 3300028573 | Ga0265334_10001077 | Ga0265334_100010776 | 202 |
| 1155 | 3300028653 | Ga0265323_10001752 | Ga0265323_100017529 | 202 |
| 1156 | 3300028654 | Ga0265322_10004954 | Ga0265322_100049543 | 202 |
| 1157 | 3300028666 | Ga0265336_10001643 | Ga0265336_100016438 | 202 |
| 1158 | 3300028800 | Ga0265338_10000013 | Ga0265338_10000013217 | 202 |
| 1159 | 3300029957 | Ga0265324_10005453 | Ga0265324_100054532 | 202 |
| 1160 | 3300033180 | Ga0307510_10019538 | Ga0307510_100195383 | 202 |
| 1161 | 3300035695 | Ga0373927_0046821 | Ga0373927_0046821_2122_2739 | 202 |
| 1162 | 3300035725 | Ga0373947_0602183 | Ga0373947_0602183_76_693 | 202 |
| 1163 | 3300037418 | Ga0395900_0002185 | Ga0395900_0002185_15341_15955 | 202 |
| 1164 | 3300037466 | Ga0395898_0003639 | Ga0395898_0003639_13987_14601 | 202 |
| 1165 | 3300037471 | Ga0395905_0013071 | Ga0395905_0013071_5536_6144 | 202 |
| 1166 | 3300037471 | Ga0395905_0552294 | Ga0395905_0552294_120_734 | 202 |
| 1167 | 3300037853 | Ga0436364_0792686 | Ga0436364_0792686_240_851 | 202 |
| 1168 | 3300038443 | Ga0395901_0004684 | Ga0395901_0004684_6477_7091 | 202 |
| 1169 | 3300038443 | Ga0395901_0950641 | Ga0395901_0950641_53_661 | 202 |
| 1170 | 3300039438 | Ga0436360_0139800 | Ga0436360_0139800_2660_3271 | 202 |
| 1171 | 3300039450 | Ga0436363_0657400 | Ga0436363_0657400_629_1243 | 202 |
| 1172 | 3300041451 | Ga0451791_1294712 | Ga0451791_1294712_288_902 | 202 |
| 1173 | 3300041452 | Ga0451793_0590245 | Ga0451793_0590245_22_636 | 202 |
| 1174 | 3300041456 | Ga0451795_1237397 | Ga0451795_1237397_233_847 | 202 |
| 1175 | 3300044658 | Ga0466972_0000576 | Ga0466972_0000576_1542_2156 | 202 |
| 1176 | 3300044683 | Ga0466965_0077683 | Ga0466965_0077683_567_1175 | 202 |
| 1177 | 3300044735 | Ga0466968_0000783 | Ga0466968_0000783_3770_4384 | 202 |
| 1178 | 3300044901 | Ga0466960_0111278 | Ga0466960_0111278_408_1022 | 202 |
| 1179 | 3300046455 | Ga0495603_0118704 | Ga0495603_0118704_708_1316 | 202 |
| 1180 | 3300046457 | Ga0495590_0056244 | Ga0495590_0056244_745_1353 | 202 |
| 1181 | 3300046492 | Ga0495585_0187554 | Ga0495585_0187554_163_777 | 202 |
| 1182 | 3300046500 | Ga0495596_0234604 | Ga0495596_0234604_36_644 | 202 |
| 1183 | 3300046507 | Ga0495606_0065635 | Ga0495606_0065635_471_1085 | 202 |
| 1184 | 3300046507 | Ga0495606_0198245 | Ga0495606_0198245_288_902 | 202 |
| 1185 | 3300046507 | Ga0495606_0264667 | Ga0495606_0264667_273_881 | 202 |
| 1186 | 3300046511 | Ga0495608_0043609 | Ga0495608_0043609_1151_1765 | 202 |
| 1187 | 3300046512 | Ga0495610_0078178 | Ga0495610_0078178_341_949 | 202 |
| 1188 | 3300046513 | Ga0495616_0226383 | Ga0495616_0226383_38_646 | 202 |
| 1189 | 3300046514 | Ga0495618_0025347 | Ga0495618_0025347_2550_3164 | 202 |
| 1190 | 3300046517 | Ga0495630_0349398 | Ga0495630_0349398_272_886 | 202 |
| 1191 | 3300046519 | Ga0495632_0345254 | Ga0495632_0345254_35_643 | 202 |
| 1192 | 3300046522 | Ga0495643_0024202 | Ga0495643_0024202_1858_2472 | 202 |
| 1193 | 3300046524 | Ga0495648_0088775 | Ga0495648_0088775_543_1157 | 202 |
| 1194 | 3300046536 | Ga0495587_0115650 | Ga0495587_0115650_421_1035 | 202 |
| 1195 | 3300046538 | Ga0495609_0097647 | Ga0495609_0097647_305_913 | 202 |
| 1196 | 3300046542 | Ga0495597_0034811 | Ga0495597_0034811_1587_2201 | 202 |
| 1197 | 3300046542 | Ga0495597_0121964 | Ga0495597_0121964_57_665 | 202 |
| 1198 | 3300046557 | Ga0495622_0250859 | Ga0495622_0250859_12_620 | 202 |
| 1199 | 3300046559 | Ga0495667_0258068 | Ga0495667_0258068_85_699 | 202 |
| 1200 | 3300046616 | Ga0495668_0158442 | Ga0495668_0158442_136_750 | 202 |
| 1201 | 3300046616 | Ga0495668_0355124 | Ga0495668_0355124_50_658 | 202 |
| 1202 | 3300046648 | Ga0495611_0053168 | Ga0495611_0053168_506_1114 | 202 |
| 1203 | 3300046660 | Ga0495625_0366273 | Ga0495625_0366273_173_781 | 202 |
| 1204 | 3300046674 | Ga0495588_0080765 | Ga0495588_0080765_687_1295 | 202 |
| 1205 | 3300046692 | Ga0495671_0191721 | Ga0495671_0191721_302_910 | 202 |
| 1206 | 3300046794 | Ga0495589_0129418 | Ga0495589_0129418_93_701 | 202 |
| 1207 | 3300047315 | Ga0495581_0019778 | Ga0495581_0019778_1392_2006 | 202 |
| 1208 | 3300047317 | Ga0495604_0030597 | Ga0495604_0030597_2471_3085 | 202 |
| 1209 | 3300047319 | Ga0495674_0159826 | Ga0495674_0159826_590_1204 | 202 |
| 1210 | 3300047321 | Ga0495676_0010380 | Ga0495676_0010380_6911_7525 | 202 |
| 1211 | 3300047321 | Ga0495676_0132650 | Ga0495676_0132650_115_723 | 202 |
| 1212 | 3300047323 | Ga0495683_0232004 | Ga0495683_0232004_32_646 | 202 |
| 1213 | 3300047443 | Ga0495687_015682 | Ga0495687_015682_518_1132 | 202 |
| 1214 | 3300047469 | Ga0495673_0168055 | Ga0495673_0168055_118_726 | 202 |
| 1215 | 3300048089 | Ga0495614_0019409 | Ga0495614_0019409_581_1195 | 202 |
| 1216 | 3300048903 | Ga0496100_0088474 | Ga0496100_0088474_360_974 | 202 |
| 1217 | 3300048903 | Ga0496100_0158568 | Ga0496100_0158568_620_1228 | 202 |
| 1218 | 3300048904 | Ga0496101_0066306 | Ga0496101_0066306_987_1601 | 202 |
| 1219 | 3300048904 | Ga0496101_0097067 | Ga0496101_0097067_974_1582 | 202 |
| 1220 | 3300048904 | Ga0496101_0322655 | Ga0496101_0322655_527_1141 | 202 |
| 1221 | 3300048905 | Ga0496102_0022346 | Ga0496102_0022346_4204_4818 | 202 |
| 1222 | 3300048905 | Ga0496102_0040983 | Ga0496102_0040983_2111_2719 | 202 |
| 1223 | 3300048906 | Ga0496103_0003354 | Ga0496103_0003354_113_727 | 202 |
| 1224 | 3300048906 | Ga0496103_0221293 | Ga0496103_0221293_222_830 | 202 |
| 1225 | 3300048907 | Ga0496104_0009238 | Ga0496104_0009238_7377_7991 | 202 |
| 1226 | 3300048907 | Ga0496104_0161080 | Ga0496104_0161080_1049_1657 | 202 |
| 1227 | 3300048907 | Ga0496104_0285405 | Ga0496104_0285405_634_1248 | 202 |
| 1228 | 3300048908 | Ga0496105_0000450 | Ga0496105_0000450_7019_7633 | 202 |
| 1229 | 3300048908 | Ga0496105_0250713 | Ga0496105_0250713_461_1075 | 202 |
| 1230 | 3300048908 | Ga0496105_0317445 | Ga0496105_0317445_413_1021 | 202 |
| 1231 | 3300048909 | Ga0496106_0075961 | Ga0496106_0075961_643_1251 | 202 |
| 1232 | 3300048909 | Ga0496106_0616578 | Ga0496106_0616578_129_743 | 202 |
| 1233 | 3300048910 | Ga0496107_0079830 | Ga0496107_0079830_1198_1806 | 202 |
| 1234 | 3300048910 | Ga0496107_0322267 | Ga0496107_0322267_493_1107 | 202 |
| 1235 | 3300048911 | Ga0496108_0381211 | Ga0496108_0381211_541_1155 | 202 |
| 1236 | 3300048912 | Ga0496109_0301361 | Ga0496109_0301361_870_1484 | 202 |
| 1237 | 3300048913 | Ga0496110_0201138 | Ga0496110_0201138_598_1206 | 202 |
| 1238 | 3300048913 | Ga0496110_0425537 | Ga0496110_0425537_130_744 | 202 |
| 1239 | 3300048914 | Ga0496111_0252927 | Ga0496111_0252927_544_1158 | 202 |
| 1240 | 3300048915 | Ga0496112_0162791 | Ga0496112_0162791_525_1133 | 202 |
| 1241 | 3300048915 | Ga0496112_0337556 | Ga0496112_0337556_473_1087 | 202 |
| 1242 | 3300048916 | Ga0496113_0043948 | Ga0496113_0043948_671_1285 | 202 |
| 1243 | 3300048916 | Ga0496113_0079772 | Ga0496113_0079772_1139_1753 | 202 |
| 1244 | 3300048916 | Ga0496113_0427112 | Ga0496113_0427112_406_1014 | 202 |
| 1245 | 3300048917 | Ga0496114_0052838 | Ga0496114_0052838_548_1156 | 202 |
| 1246 | 3300048918 | Ga0496115_0209409 | Ga0496115_0209409_619_1227 | 202 |
| 1247 | 3300048918 | Ga0496115_0612307 | Ga0496115_0612307_116_730 | 202 |
| 1248 | 3300048919 | Ga0496116_0023198 | Ga0496116_0023198_117_725 | 202 |
| 1249 | 3300048920 | Ga0496117_0256798 | Ga0496117_0256798_55_669 | 202 |
| 1250 | 3300048920 | Ga0496117_0270374 | Ga0496117_0270374_82_696 | 202 |
| 1251 | 3300048920 | Ga0496117_0382086 | Ga0496117_0382086_64_675 | 202 |
| 1252 | 3300048921 | Ga0496118_0087936 | Ga0496118_0087936_825_1433 | 202 |
| 1253 | 3300048921 | Ga0496118_0269744 | Ga0496118_0269744_323_937 | 202 |
| 1254 | 3300048922 | Ga0496119_0002327 | Ga0496119_0002327_6980_7594 | 202 |
| 1255 | 3300048923 | Ga0496120_0017844 | Ga0496120_0017844_1127_1741 | 202 |
| 1256 | 3300048923 | Ga0496120_0106858 | Ga0496120_0106858_59_667 | 202 |
| 1257 | 3300048923 | Ga0496120_0142555 | Ga0496120_0142555_103_717 | 202 |
| 1258 | 3300048924 | Ga0496121_0058539 | Ga0496121_0058539_400_1008 | 202 |
| 1259 | 3300048924 | Ga0496121_0120053 | Ga0496121_0120053_1188_1802 | 202 |
| 1260 | 3300048925 | Ga0496122_0259352 | Ga0496122_0259352_119_733 | 202 |
| 1261 | 3300048927 | Ga0496124_0063549 | Ga0496124_0063549_2393_3007 | 202 |
| 1262 | 3300048927 | Ga0496124_0200737 | Ga0496124_0200737_524_1132 | 202 |
| 1263 | 3300048927 | Ga0496124_0251686 | Ga0496124_0251686_643_1257 | 202 |
| 1264 | 3300048928 | Ga0496125_0025303 | Ga0496125_0025303_4310_4924 | 202 |
| 1265 | 3300048928 | Ga0496125_0160002 | Ga0496125_0160002_747_1361 | 202 |
| 1266 | 3300048928 | Ga0496125_0209676 | Ga0496125_0209676_225_839 | 202 |
| 1267 | 3300048929 | Ga0496126_0016269 | Ga0496126_0016269_6509_7123 | 202 |
| 1268 | 3300048929 | Ga0496126_0087451 | Ga0496126_0087451_151_765 | 202 |
| 1269 | 3300048929 | Ga0496126_0205748 | Ga0496126_0205748_762_1370 | 202 |
| 1270 | 3300048929 | Ga0496126_0274412 | Ga0496126_0274412_295_909 | 202 |
| 1271 | 3300050491 | nmdc:mga00v17_360793_c1 | nmdc:mga00v17_360793_c1_98_712 | 202 |
| 1272 | 3300050491 | nmdc:mga00v17_605066_c1 | nmdc:mga00v17_605066_c1_46_654 | 202 |
| 1273 | 3300050492 | nmdc:mga0yw44_104010_c1 | nmdc:mga0yw44_104010_c1_600_1214 | 202 |
| 1274 | 3300050492 | nmdc:mga0yw44_531204_c1 | nmdc:mga0yw44_531204_c1_138_752 | 202 |
| 1275 | 3300050495 | nmdc:mga04h51_179955_c1 | nmdc:mga04h51_179955_c1_29_643 | 202 |
| 1276 | 3300050496 | nmdc:mga07m45_22738_c1 | nmdc:mga07m45_22738_c1_2414_3028 | 202 |
| 1277 | 3300050496 | nmdc:mga07m45_55827_c1 | nmdc:mga07m45_55827_c1_1576_2184 | 202 |
| 1278 | 3300050516 | nmdc:mga0sz30_25178_c1 | nmdc:mga0sz30_25178_c1_1141_1755 | 202 |
| 1279 | 3300053079 | Ga0500610_0158740 | Ga0500610_0158740_139_753 | 202 |
| 1280 | 3300053083 | Ga0495655_0014047 | Ga0495655_0014047_484_1092 | 202 |
| 1281 | 3300053087 | Ga0500643_000686 | Ga0500643_000686_21163_21777 | 202 |
| 1282 | 3300053092 | Ga0500583_0058393 | Ga0500583_0058393_720_1334 | 202 |
| 1283 | 3300053096 | Ga0500641_0042973 | Ga0500641_0042973_720_1334 | 202 |
| 1284 | 3300053104 | Ga0500556_0232544 | Ga0500556_0232544_26_640 | 202 |
| 1285 | 3300053105 | Ga0500557_000035 | Ga0500557_000035_62701_63315 | 202 |
| 1286 | 3300053108 | Ga0500562_004625 | Ga0500562_004625_380_994 | 202 |
| 1287 | 3300053109 | Ga0500569_031305 | Ga0500569_031305_328_942 | 202 |
| 1288 | 3300053118 | Ga0500594_0030739 | Ga0500594_0030739_436_1050 | 202 |
| 1289 | 3300053120 | Ga0500597_141382 | Ga0500597_141382_249_863 | 202 |
| 1290 | 3300053134 | Ga0500658_0092837 | Ga0500658_0092837_310_924 | 202 |
| 1291 | 3300053136 | Ga0500559_0012534 | Ga0500559_0012534_717_1331 | 202 |
| 1292 | 3300053139 | Ga0500568_0006253 | Ga0500568_0006253_1574_2188 | 202 |
| 1293 | 3300053146 | Ga0500588_0078416 | Ga0500588_0078416_239_853 | 202 |
| 1294 | 3300053148 | Ga0500590_100185 | Ga0500590_100185_529_1143 | 202 |
| 1295 | 3300053151 | Ga0500604_0010292 | Ga0500604_0010292_465_1079 | 202 |
| 1296 | 3300053153 | Ga0500616_0044015 | Ga0500616_0044015_526_1140 | 202 |
| 1297 | 3300053156 | Ga0500622_0017922 | Ga0500622_0017922_589_1203 | 202 |
| 1298 | 3300053158 | Ga0500627_0107717 | Ga0500627_0107717_406_1020 | 202 |
| 1299 | 3300053163 | Ga0500639_164495 | Ga0500639_164495_200_814 | 202 |
| 1300 | 3300053729 | Ga0500625_020693 | Ga0500625_020693_1238_1852 | 202 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qsd-assembly1.cif.gz_B | rbl2p, beta-tubulin binding post-chaperonin cofactor | 0.812 | 112 | 199 |
| 4whe-assembly1.cif.gz_A | crystal structure of e. coli phage shock protein a (pspa 1-144) | 0.7651 | 93 | 201 |
| 1qsd-assembly1.cif.gz_B | rbl2p, beta-tubulin binding post-chaperonin cofactor | 0.7004 | 112 | 199 |
| 3tul-assembly5.cif.gz_B | crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226) | 0.6949 | 80 | 190 |
| 6u28-assembly2.cif.gz_D | crystal structure of 1918 ns1-ed w187a in complex with the p85-beta-ish2 domain of human pi3k | 0.6692 | 76 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1qsdA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8129 | 112 | 199 | 1.20.58.90 |
| 1qsdB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.812 | 112 | 199 | 1.20.58.90 |
| 3layE00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7649 | 111 | 176 | 1.20.120.1490 |
| af_P0AAA9_39_119_1.20.120.1490 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7644 | 109 | 184 | 1.20.120.1490 |
| 3layA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7586 | 108 | 183 | 1.20.120.1490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R3MHA7-F1-model_v4 | Uncharacterized protein | 0.9445 | 18 | 202 |
|
| AF-A0A7Y4LV17-F1-model_v4 | Uncharacterized protein | 0.934 | 15 | 202 |
|
| AF-A0A257PDZ7-F1-model_v4 | Uncharacterized protein | 0.9333 | 32 | 202 |
|
| AF-A0A1L3LH52-F1-model_v4 | Uncharacterized protein | 0.9296 | 20 | 200 |
|
| AF-A0A257PDZ7-F1-model_v4 | Uncharacterized protein | 0.9282 | 32 | 202 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar