F492714
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1298 | 485 | 1229 | 482 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10000521|Ga0105247_1000052114 |
| Length | 527 |
| Sequence | LKLFHRISENLRNREGLHAGPCKAKETAGRPRAISSGGRLAYHGLMIIGSGAAAAEALTSLYTASVDSLKCAIRDHASGKPPGQDQASAKAFVYPEIAITYHGSQETPRTRRSFARLSRPGRYVTTVTRPDIFGDYLAEQIDLLIADYGVTVEIGPSEEPIPFPYVLDGFDMHSLDTVAVSELAAHFAGTDLAVLGDEIADGLFLSGPDGDRPLALFDGPRTDFSLARLRHYTGTPAEHVQRYILFTNYHRYVDEFVAWACAQLQTPGSRYDALSGAGDVYVTRDTADADRMIADSAWRKHQMPAYHLMAPDRRGISLVNIGVGPSNAKTICDHLAVLRPEAWLIIGHCAGLRPSQKIGDYVLAHAYLRDDHILDDVLPPEIPIPAIAEVQVAMARAAELVLGGDTPEFKRRLRTGTVVTTADRNWELHYSKSALRFSQSRAVAIDMESATIAAQGYRFRVPYGTLLCVSDKPLHGELKLPGQANRFYEEAIARHLRIGIETCELLRDEGERLHSRKLRAFNEPPFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 4 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 5 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 6 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 7 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 8 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 9 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 10 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 11 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 12 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 13 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 14 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 15 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 16 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 17 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 18 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 19 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 20 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 21 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 22 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 23 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 24 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 25 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 26 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 27 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 28 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 29 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 30 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 31 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 32 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 33 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 34 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 35 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 36 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 37 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 38 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 39 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 40 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 41 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 42 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 43 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 44 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 45 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 46 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 47 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 48 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 49 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 50 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 51 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 52 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 53 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 54 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 55 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 56 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 57 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 58 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 59 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 60 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 61 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 62 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 63 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 64 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 65 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 66 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 67 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 68 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 69 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 70 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 71 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 72 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 73 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 74 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 75 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 76 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 77 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 78 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 79 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 80 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 81 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 82 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 83 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 84 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 85 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 86 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 90 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 92 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 94 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 98 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 99 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 103 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 105 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 108 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 119 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 128 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 130 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 132 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 135 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 137 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 138 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 139 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 140 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 141 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 142 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 143 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 144 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 145 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 146 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 147 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 148 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 149 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 150 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 152 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 153 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 154 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 155 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 156 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 157 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 158 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 160 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 161 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 162 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 163 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 165 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 176 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 179 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 193 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 195 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 201 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 202 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 213 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 216 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 278 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 279 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 280 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 281 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 282 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 283 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 284 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 285 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 286 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 287 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 288 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 289 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 290 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 291 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 292 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 293 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 294 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 295 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 296 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 300 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 302 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 305 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 306 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 307 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 308 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 309 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 312 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 313 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 315 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 316 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 317 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 318 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 319 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 320 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 321 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 322 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 323 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 324 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 325 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 326 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 327 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 328 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 329 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 330 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 331 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 393 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 394 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 397 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 398 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 399 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 400 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 401 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 402 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 403 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 405 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 406 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 407 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 408 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 420 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 421 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 422 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 423 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 425 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 426 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 427 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 431 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 432 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 433 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 434 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 436 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 438 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 441 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 442 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 444 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 447 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 449 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 450 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 451 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 452 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 454 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 456 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 457 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 458 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 461 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 463 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 465 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 466 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 470 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 472 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 473 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 475 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 476 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 477 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 478 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 480 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 481 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 482 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 484 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 485 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.68 |
| Metatranscriptomes | 0 |
| Isolates | 5.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 14.56 |
| Nodule | 0.08 |
| Rhizoplane | 3.93 |
| Rhizosphere | 72.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1042224 | 2162886007 | Bacteria | 2268 |
| 2 | SwRhRL2b_contig_1442462 | 2162886007 | Bacteria | 3064 |
| 3 | JGI24736J21556_1001848 | 3300001904 | Bacteria | 3779 |
| 4 | JGI24736J21556_1002453 | 3300001904 | Bacteria | 3280 |
| 5 | JGI24741J21665_1000043 | 3300001915 | Bacteria | 30255 |
| 6 | JGI24752J21851_1001304 | 3300001976 | Bacteria | 3379 |
| 7 | JGI24740J21852_10006172 | 3300001979 | Bacteria | 4994 |
| 8 | JGI24740J21852_10008136 | 3300001979 | Bacteria | 4205 |
| 9 | JGI24740J21852_10008321 | 3300001979 | Bacteria | 4140 |
| 10 | JGI24739J22299_10001382 | 3300001989 | Bacteria | 9114 |
| 11 | JGI24739J22299_10005269 | 3300001989 | Bacteria | 4927 |
| 12 | JGI24739J22299_10007274 | 3300001989 | Bacteria | 4159 |
| 13 | JGI24739J22299_10013062 | 3300001989 | Bacteria | 3038 |
| 14 | JGI24737J22298_10001823 | 3300001990 | Bacteria | 7628 |
| 15 | JGI24737J22298_10004210 | 3300001990 | Bacteria | 5030 |
| 16 | JGI24737J22298_10004820 | 3300001990 | Bacteria | 4686 |
| 17 | JGI24737J22298_10020850 | 3300001990 | Bacteria | 2089 |
| 18 | JGI24735J21928_10000642 | 3300002067 | Bacteria | 12313 |
| 19 | JGI24735J21928_10000915 | 3300002067 | Bacteria | 10535 |
| 20 | JGI24735J21928_10009418 | 3300002067 | Bacteria | 3136 |
| 21 | JGI24735J21928_10015221 | 3300002067 | Bacteria | 2402 |
| 22 | JGI24750J21931_1000631 | 3300002070 | Bacteria | 5290 |
| 23 | JGI24748J21848_1000052 | 3300002074 | Bacteria | 50713 |
| 24 | JGI24738J21930_10000424 | 3300002075 | Bacteria | 11883 |
| 25 | JGI24738J21930_10001963 | 3300002075 | Bacteria | 5540 |
| 26 | JGI24738J21930_10002973 | 3300002075 | Bacteria | 4330 |
| 27 | JGI24749J21850_1000531 | 3300002076 | Bacteria | 5590 |
| 28 | JGI24744J21845_10009416 | 3300002077 | Bacteria | 2003 |
| 29 | JGI24034J26672_10000031 | 3300002239 | Bacteria | 93812 |
| 30 | JGI24751J29686_10000052 | 3300002459 | Bacteria | 65492 |
| 31 | JGI24751J29686_10004618 | 3300002459 | Bacteria | 2797 |
| 32 | JGI25150J39212_1000046 | 3300002774 | Bacteria | 78180 |
| 33 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 34 | JGI25165J46597_1000073 | 3300003214 | Bacteria | 192140 |
| 35 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 36 | JGI25153J46596_10000124 | 3300003215 | Bacteria | 86430 |
| 37 | Ga0055525_1000090 | 3300003759 | Bacteria | 141071 |
| 38 | Ga0055542_1000046 | 3300003762 | Bacteria | 201922 |
| 39 | Ga0055529_1000007 | 3300003763 | Bacteria | 403604 |
| 40 | Ga0055529_1000109 | 3300003763 | Bacteria | 121019 |
| 41 | Ga0055526_1006062 | 3300003771 | Bacteria | 6689 |
| 42 | Ga0055537_1001888 | 3300003773 | Bacteria | 7521 |
| 43 | Ga0055536_1000542 | 3300003781 | Bacteria | 25852 |
| 44 | Ga0055536_1002254 | 3300003781 | Bacteria | 10976 |
| 45 | Ga0055536_1013600 | 3300003781 | Bacteria | 2920 |
| 46 | Ga0055528_1009909 | 3300003790 | Bacteria | 3933 |
| 47 | Ga0055530_10000187 | 3300003791 | Bacteria | 55610 |
| 48 | Ga0055530_10002060 | 3300003791 | Bacteria | 13517 |
| 49 | Ga0055530_10018279 | 3300003791 | Bacteria | 2167 |
| 50 | Ga0055531_10000008 | 3300003794 | Bacteria | 222269 |
| 51 | Ga0055531_10000760 | 3300003794 | Bacteria | 27012 |
| 52 | Ga0055531_10003005 | 3300003794 | Bacteria | 10952 |
| 53 | Ga0055531_10005948 | 3300003794 | Bacteria | 7012 |
| 54 | Ga0055531_10012125 | 3300003794 | Bacteria | 4082 |
| 55 | Ga0055531_10019415 | 3300003794 | Bacteria | 2749 |
| 56 | Ga0065165_1001443 | 3300005262 | Bacteria | 25758 |
| 57 | Ga0065165_1001513 | 3300005262 | Bacteria | 24537 |
| 58 | Ga0065165_1004716 | 3300005262 | Bacteria | 8188 |
| 59 | Ga0065165_1006815 | 3300005262 | Bacteria | 5828 |
| 60 | Ga0065704_10001757 | 3300005289 | Bacteria | 9465 |
| 61 | Ga0065704_10070744 | 3300005289 | Bacteria | 16791 |
| 62 | Ga0065704_10075395 | 3300005289 | Bacteria | 5604 |
| 63 | Ga0065704_10081083 | 3300005289 | Bacteria | 3823 |
| 64 | Ga0065715_10097503 | 3300005293 | Bacteria | 3695 |
| 65 | Ga0065707_10091947 | 3300005295 | Bacteria | 3854 |
| 66 | Ga0065707_10097824 | 3300005295 | Bacteria | 3137 |
| 67 | Ga0070658_10000124 | 3300005327 | Bacteria | 68224 |
| 68 | Ga0070658_10000227 | 3300005327 | Bacteria | 50101 |
| 69 | Ga0070658_10000779 | 3300005327 | Bacteria | 27389 |
| 70 | Ga0070658_10002006 | 3300005327 | Bacteria | 17101 |
| 71 | Ga0070658_10002716 | 3300005327 | Bacteria | 14716 |
| 72 | Ga0070658_10006118 | 3300005327 | Bacteria | 9760 |
| 73 | Ga0070658_10010801 | 3300005327 | Bacteria | 7320 |
| 74 | Ga0070658_10025186 | 3300005327 | Bacteria | 4768 |
| 75 | Ga0070658_10032583 | 3300005327 | Bacteria | 4190 |
| 76 | Ga0070658_10039940 | 3300005327 | Bacteria | 3786 |
| 77 | Ga0070658_10049997 | 3300005327 | Bacteria | 3388 |
| 78 | Ga0070658_10059045 | 3300005327 | Bacteria | 3123 |
| 79 | Ga0070658_10072459 | 3300005327 | Bacteria | 2823 |
| 80 | Ga0070676_10026726 | 3300005328 | Bacteria | 3268 |
| 81 | Ga0070683_100179416 | 3300005329 | Bacteria | 2010 |
| 82 | Ga0070690_100000010 | 3300005330 | Bacteria | 103492 |
| 83 | Ga0070670_100000007 | 3300005331 | Bacteria | 318672 |
| 84 | Ga0070670_100000024 | 3300005331 | Bacteria | 189811 |
| 85 | Ga0070670_100076000 | 3300005331 | Bacteria | 2886 |
| 86 | Ga0068869_100000200 | 3300005334 | Bacteria | 31213 |
| 87 | Ga0068869_100037418 | 3300005334 | Bacteria | 3450 |
| 88 | Ga0068869_100192549 | 3300005334 | Bacteria | 1604 |
| 89 | Ga0070666_10000006 | 3300005335 | Bacteria | 319173 |
| 90 | Ga0070666_10000098 | 3300005335 | Bacteria | 59878 |
| 91 | Ga0070666_10007850 | 3300005335 | Bacteria | 6592 |
| 92 | Ga0070666_10013559 | 3300005335 | Bacteria | 5175 |
| 93 | Ga0070666_10014711 | 3300005335 | Bacteria | 4984 |
| 94 | Ga0070680_100020235 | 3300005336 | Bacteria | 5281 |
| 95 | Ga0068868_100000049 | 3300005338 | Bacteria | 67274 |
| 96 | Ga0068868_100003120 | 3300005338 | Bacteria | 11534 |
| 97 | Ga0068868_100119874 | 3300005338 | Bacteria | 2145 |
| 98 | Ga0070660_100002130 | 3300005339 | Bacteria | 13657 |
| 99 | Ga0070660_100010609 | 3300005339 | Bacteria | 6512 |
| 100 | Ga0070660_100028758 | 3300005339 | Bacteria | 4161 |
| 101 | Ga0070660_100039855 | 3300005339 | Bacteria | 3571 |
| 102 | Ga0070660_100041808 | 3300005339 | Bacteria | 3495 |
| 103 | Ga0070660_100065253 | 3300005339 | Bacteria | 2833 |
| 104 | Ga0070660_100127423 | 3300005339 | Bacteria | 2035 |
| 105 | Ga0070689_100011273 | 3300005340 | Bacteria | 6400 |
| 106 | Ga0070691_10004611 | 3300005341 | Bacteria | 6262 |
| 107 | Ga0070661_100000095 | 3300005344 | Bacteria | 72935 |
| 108 | Ga0070661_100002364 | 3300005344 | Bacteria | 12951 |
| 109 | Ga0070661_100068906 | 3300005344 | Bacteria | 2600 |
| 110 | Ga0070668_100000027 | 3300005347 | Bacteria | 89913 |
| 111 | Ga0070668_100000646 | 3300005347 | Bacteria | 23522 |
| 112 | Ga0070668_100000835 | 3300005347 | Bacteria | 21310 |
| 113 | Ga0070668_100006292 | 3300005347 | Bacteria | 8789 |
| 114 | Ga0070668_100016692 | 3300005347 | Bacteria | 5487 |
| 115 | Ga0070668_100019269 | 3300005347 | Bacteria | 5135 |
| 116 | Ga0070668_100041954 | 3300005347 | Bacteria | 3506 |
| 117 | Ga0070669_100000029 | 3300005353 | Bacteria | 163005 |
| 118 | Ga0070669_100000047 | 3300005353 | Bacteria | 118892 |
| 119 | Ga0070669_100000076 | 3300005353 | Bacteria | 97334 |
| 120 | Ga0070669_100000433 | 3300005353 | Bacteria | 31979 |
| 121 | Ga0070669_100001232 | 3300005353 | Bacteria | 18563 |
| 122 | Ga0070669_100002305 | 3300005353 | Bacteria | 13824 |
| 123 | Ga0070669_100003517 | 3300005353 | Bacteria | 11299 |
| 124 | Ga0070675_100013925 | 3300005354 | Bacteria | 6330 |
| 125 | Ga0070671_100000016 | 3300005355 | Bacteria | 156166 |
| 126 | Ga0070671_100000145 | 3300005355 | Bacteria | 46029 |
| 127 | Ga0070671_100009488 | 3300005355 | Bacteria | 7811 |
| 128 | Ga0070671_100016202 | 3300005355 | Bacteria | 6028 |
| 129 | Ga0070671_100018377 | 3300005355 | Bacteria | 5678 |
| 130 | Ga0070671_100019072 | 3300005355 | Bacteria | 5579 |
| 131 | Ga0070671_100058428 | 3300005355 | Bacteria | 3211 |
| 132 | Ga0070671_100125969 | 3300005355 | Bacteria | 2156 |
| 133 | Ga0070671_100141879 | 3300005355 | Bacteria | 2027 |
| 134 | Ga0070671_100219396 | 3300005355 | Bacteria | 1613 |
| 135 | Ga0070674_100017214 | 3300005356 | Bacteria | 4542 |
| 136 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 137 | Ga0070673_100092613 | 3300005364 | Bacteria | 2473 |
| 138 | Ga0070673_100146105 | 3300005364 | Bacteria | 1999 |
| 139 | Ga0070688_100002221 | 3300005365 | Bacteria | 9797 |
| 140 | Ga0070659_100001710 | 3300005366 | Bacteria | 15785 |
| 141 | Ga0070659_100002355 | 3300005366 | Bacteria | 13434 |
| 142 | Ga0070659_100015944 | 3300005366 | Bacteria | 5635 |
| 143 | Ga0070659_100050460 | 3300005366 | Bacteria | 3271 |
| 144 | Ga0070659_100070320 | 3300005366 | Bacteria | 2780 |
| 145 | Ga0070659_100126735 | 3300005366 | Bacteria | 2071 |
| 146 | Ga0070659_100149712 | 3300005366 | Bacteria | 1903 |
| 147 | Ga0070659_100154613 | 3300005366 | Bacteria | 1872 |
| 148 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 149 | Ga0070667_100000066 | 3300005367 | Bacteria | 134529 |
| 150 | Ga0070667_100000067 | 3300005367 | Bacteria | 133023 |
| 151 | Ga0070667_100000155 | 3300005367 | Bacteria | 85527 |
| 152 | Ga0070667_100000459 | 3300005367 | Bacteria | 41954 |
| 153 | Ga0070667_100000480 | 3300005367 | Bacteria | 40910 |
| 154 | Ga0070667_100004083 | 3300005367 | Bacteria | 12350 |
| 155 | Ga0070667_100045508 | 3300005367 | Bacteria | 3690 |
| 156 | Ga0070705_100033162 | 3300005440 | Bacteria | 2875 |
| 157 | Ga0070708_100043566 | 3300005445 | Bacteria | 3943 |
| 158 | Ga0070663_100000291 | 3300005455 | Bacteria | 25597 |
| 159 | Ga0070663_100050955 | 3300005455 | Bacteria | 2946 |
| 160 | Ga0070663_100084044 | 3300005455 | Bacteria | 2345 |
| 161 | Ga0070678_100000076 | 3300005456 | Bacteria | 37213 |
| 162 | Ga0070678_100022573 | 3300005456 | Bacteria | 4174 |
| 163 | Ga0070678_100027109 | 3300005456 | Bacteria | 3885 |
| 164 | Ga0070678_100088021 | 3300005456 | Bacteria | 2373 |
| 165 | Ga0070662_100002319 | 3300005457 | Bacteria | 11690 |
| 166 | Ga0070662_100006034 | 3300005457 | Bacteria | 7776 |
| 167 | Ga0070662_100012864 | 3300005457 | Bacteria | 5559 |
| 168 | Ga0070662_100028476 | 3300005457 | Bacteria | 3887 |
| 169 | Ga0070662_100055200 | 3300005457 | Bacteria | 2881 |
| 170 | Ga0070662_100107667 | 3300005457 | Bacteria | 2119 |
| 171 | Ga0070662_100131020 | 3300005457 | Bacteria | 1933 |
| 172 | Ga0070681_10007565 | 3300005458 | Bacteria | 10617 |
| 173 | Ga0070681_10019939 | 3300005458 | Bacteria | 6717 |
| 174 | Ga0070681_10166681 | 3300005458 | Bacteria | 2126 |
| 175 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 176 | Ga0070685_10021094 | 3300005466 | Bacteria | 3537 |
| 177 | Ga0070679_100014656 | 3300005530 | Bacteria | 7534 |
| 178 | Ga0070679_100023960 | 3300005530 | Bacteria | 5981 |
| 179 | Ga0070684_100123426 | 3300005535 | Bacteria | 2331 |
| 180 | Ga0068853_100004158 | 3300005539 | Bacteria | 11155 |
| 181 | Ga0070686_100000042 | 3300005544 | Bacteria | 103828 |
| 182 | Ga0070665_100000019 | 3300005548 | Bacteria | 413972 |
| 183 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 184 | Ga0070665_100002155 | 3300005548 | Bacteria | 21958 |
| 185 | Ga0070665_100002676 | 3300005548 | Bacteria | 19370 |
| 186 | Ga0070665_100004060 | 3300005548 | Bacteria | 15401 |
| 187 | Ga0070665_100005588 | 3300005548 | Bacteria | 12931 |
| 188 | Ga0070665_100021024 | 3300005548 | Bacteria | 6560 |
| 189 | Ga0070665_100024168 | 3300005548 | Bacteria | 6120 |
| 190 | Ga0070665_100026184 | 3300005548 | Bacteria | 5873 |
| 191 | Ga0070665_100033590 | 3300005548 | Bacteria | 5162 |
| 192 | Ga0070665_100055792 | 3300005548 | Bacteria | 3962 |
| 193 | Ga0070665_100059894 | 3300005548 | Bacteria | 3816 |
| 194 | Ga0070665_100068272 | 3300005548 | Bacteria | 3565 |
| 195 | Ga0068855_100000023 | 3300005563 | Bacteria | 190440 |
| 196 | Ga0068855_100010626 | 3300005563 | Bacteria | 11098 |
| 197 | Ga0068855_100085239 | 3300005563 | Bacteria | 3656 |
| 198 | Ga0068855_100115866 | 3300005563 | Bacteria | 3071 |
| 199 | Ga0068855_100123321 | 3300005563 | Bacteria | 2964 |
| 200 | Ga0068855_100205581 | 3300005563 | Bacteria | 2215 |
| 201 | Ga0070664_100015334 | 3300005564 | Bacteria | 6266 |
| 202 | Ga0070664_100077301 | 3300005564 | Bacteria | 2862 |
| 203 | Ga0068857_100006583 | 3300005577 | Bacteria | 9973 |
| 204 | Ga0068857_100025477 | 3300005577 | Bacteria | 5208 |
| 205 | Ga0068857_100091382 | 3300005577 | Bacteria | 2725 |
| 206 | Ga0068854_100000224 | 3300005578 | Bacteria | 38449 |
| 207 | Ga0068854_100001591 | 3300005578 | Bacteria | 13812 |
| 208 | Ga0068854_100013256 | 3300005578 | Bacteria | 5404 |
| 209 | Ga0068854_100039985 | 3300005578 | Bacteria | 3306 |
| 210 | Ga0068854_100067457 | 3300005578 | Bacteria | 2606 |
| 211 | Ga0068854_100102845 | 3300005578 | Bacteria | 2144 |
| 212 | Ga0068856_100026950 | 3300005614 | Bacteria | 5606 |
| 213 | Ga0068856_100149157 | 3300005614 | Bacteria | 2347 |
| 214 | Ga0068856_100228905 | 3300005614 | Bacteria | 1874 |
| 215 | Ga0068852_100000996 | 3300005616 | Bacteria | 18697 |
| 216 | Ga0068852_100001336 | 3300005616 | Bacteria | 16535 |
| 217 | Ga0068852_100003424 | 3300005616 | Bacteria | 11081 |
| 218 | Ga0068852_100007968 | 3300005616 | Bacteria | 7767 |
| 219 | Ga0068852_100010220 | 3300005616 | Bacteria | 6996 |
| 220 | Ga0068852_100071029 | 3300005616 | Bacteria | 3056 |
| 221 | Ga0068859_100001618 | 3300005617 | Bacteria | 23030 |
| 222 | Ga0068859_100003218 | 3300005617 | Bacteria | 16624 |
| 223 | Ga0068859_100004889 | 3300005617 | Bacteria | 13646 |
| 224 | Ga0068859_100006146 | 3300005617 | Bacteria | 12204 |
| 225 | Ga0068859_100031085 | 3300005617 | Bacteria | 5360 |
| 226 | Ga0068864_100000036 | 3300005618 | Bacteria | 189811 |
| 227 | Ga0068864_100000128 | 3300005618 | Bacteria | 73813 |
| 228 | Ga0068864_100001646 | 3300005618 | Bacteria | 18401 |
| 229 | Ga0068864_100005875 | 3300005618 | Bacteria | 10056 |
| 230 | Ga0068864_100011026 | 3300005618 | Bacteria | 7471 |
| 231 | Ga0068864_100022005 | 3300005618 | Bacteria | 5344 |
| 232 | Ga0068864_100030737 | 3300005618 | Bacteria | 4554 |
| 233 | Ga0068864_100030978 | 3300005618 | Bacteria | 4536 |
| 234 | Ga0068861_100000005 | 3300005719 | Bacteria | 101677 |
| 235 | Ga0068861_100025695 | 3300005719 | Bacteria | 4274 |
| 236 | Ga0068861_100032053 | 3300005719 | Bacteria | 3866 |
| 237 | Ga0068861_100109813 | 3300005719 | Bacteria | 2208 |
| 238 | Ga0068851_10005214 | 3300005834 | Bacteria | 5897 |
| 239 | Ga0068863_100000038 | 3300005841 | Bacteria | 161477 |
| 240 | Ga0068863_100000063 | 3300005841 | Bacteria | 118269 |
| 241 | Ga0068863_100000069 | 3300005841 | Bacteria | 116525 |
| 242 | Ga0068863_100000360 | 3300005841 | Bacteria | 46300 |
| 243 | Ga0068863_100000603 | 3300005841 | Bacteria | 36544 |
| 244 | Ga0068863_100013726 | 3300005841 | Bacteria | 7809 |
| 245 | Ga0068863_100015575 | 3300005841 | Bacteria | 7306 |
| 246 | Ga0068863_100027645 | 3300005841 | Bacteria | 5412 |
| 247 | Ga0068863_100034947 | 3300005841 | Bacteria | 4787 |
| 248 | Ga0068863_100066924 | 3300005841 | Bacteria | 3398 |
| 249 | Ga0068863_100068959 | 3300005841 | Bacteria | 3345 |
| 250 | Ga0068858_100000103 | 3300005842 | Bacteria | 88754 |
| 251 | Ga0068858_100000777 | 3300005842 | Bacteria | 33348 |
| 252 | Ga0068858_100003592 | 3300005842 | Bacteria | 15350 |
| 253 | Ga0068858_100023998 | 3300005842 | Bacteria | 5682 |
| 254 | Ga0068858_100030505 | 3300005842 | Bacteria | 5006 |
| 255 | Ga0068858_100031104 | 3300005842 | Bacteria | 4957 |
| 256 | Ga0068858_100062004 | 3300005842 | Bacteria | 3457 |
| 257 | Ga0068860_100000008 | 3300005843 | Bacteria | 427367 |
| 258 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 259 | Ga0068860_100000014 | 3300005843 | Bacteria | 319437 |
| 260 | Ga0068860_100000047 | 3300005843 | Bacteria | 213287 |
| 261 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 262 | Ga0068860_100004284 | 3300005843 | Bacteria | 14590 |
| 263 | Ga0068860_100007191 | 3300005843 | Bacteria | 11131 |
| 264 | Ga0068860_100107746 | 3300005843 | Bacteria | 2663 |
| 265 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 266 | Ga0068862_100000485 | 3300005844 | Bacteria | 42458 |
| 267 | Ga0068862_100000606 | 3300005844 | Bacteria | 37254 |
| 268 | Ga0068862_100001031 | 3300005844 | Bacteria | 26791 |
| 269 | Ga0068862_100002295 | 3300005844 | Bacteria | 17093 |
| 270 | Ga0068862_100005376 | 3300005844 | Bacteria | 10718 |
| 271 | Ga0068862_100009581 | 3300005844 | Bacteria | 8007 |
| 272 | Ga0081538_10009804 | 3300005981 | Bacteria | 7925 |
| 273 | Ga0081539_10007513 | 3300005985 | Bacteria | 9896 |
| 274 | Ga0070717_10008928 | 3300006028 | Bacteria | 7511 |
| 275 | Ga0075368_10000454 | 3300006042 | Bacteria | 12096 |
| 276 | Ga0075368_10000704 | 3300006042 | Bacteria | 10189 |
| 277 | Ga0075368_10004849 | 3300006042 | Bacteria | 4586 |
| 278 | Ga0075363_100000079 | 3300006048 | Bacteria | 20652 |
| 279 | Ga0075364_10000499 | 3300006051 | Bacteria | 19964 |
| 280 | Ga0075364_10017101 | 3300006051 | Bacteria | 4525 |
| 281 | Ga0075362_10000006 | 3300006177 | Bacteria | 123313 |
| 282 | Ga0075367_10000042 | 3300006178 | Bacteria | 28460 |
| 283 | Ga0075369_10004233 | 3300006186 | Bacteria | 5287 |
| 284 | Ga0075369_10015793 | 3300006186 | Bacteria | 3036 |
| 285 | Ga0075366_10000497 | 3300006195 | Bacteria | 18210 |
| 286 | Ga0075366_10019123 | 3300006195 | Bacteria | 3958 |
| 287 | Ga0097621_100006540 | 3300006237 | Bacteria | 8279 |
| 288 | Ga0075370_10000005 | 3300006353 | Bacteria | 112202 |
| 289 | Ga0075370_10005294 | 3300006353 | Bacteria | 6391 |
| 290 | Ga0075370_10040975 | 3300006353 | Bacteria | 2614 |
| 291 | Ga0075370_10042569 | 3300006353 | Bacteria | 2565 |
| 292 | Ga0068871_100024993 | 3300006358 | Bacteria | 4641 |
| 293 | Ga0075430_100161703 | 3300006846 | Bacteria | 1864 |
| 294 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 295 | Ga0068865_100009151 | 3300006881 | Bacteria | 6129 |
| 296 | Ga0068865_100048234 | 3300006881 | Bacteria | 2930 |
| 297 | Ga0097620_100001618 | 3300006931 | Bacteria | 23030 |
| 298 | Ga0097620_100003218 | 3300006931 | Bacteria | 16624 |
| 299 | Ga0097620_100006146 | 3300006931 | Bacteria | 12204 |
| 300 | Ga0097620_100031087 | 3300006931 | Bacteria | 5360 |
| 301 | Ga0079104_1009947 | 3300006946 | Bacteria | 3175 |
| 302 | Ga0105240_10008624 | 3300009093 | Bacteria | 14565 |
| 303 | Ga0105240_10012012 | 3300009093 | Bacteria | 12003 |
| 304 | Ga0105240_10111858 | 3300009093 | Bacteria | 3302 |
| 305 | Ga0105240_10144090 | 3300009093 | Bacteria | 2845 |
| 306 | Ga0105240_10220846 | 3300009093 | Bacteria | 2208 |
| 307 | Ga0105245_10000113 | 3300009098 | Bacteria | 78545 |
| 308 | Ga0105245_10002260 | 3300009098 | Bacteria | 17440 |
| 309 | Ga0105245_10013994 | 3300009098 | Bacteria | 6988 |
| 310 | Ga0105245_10047951 | 3300009098 | Bacteria | 3820 |
| 311 | Ga0105247_10000521 | 3300009101 | Bacteria | 31494 |
| 312 | Ga0105243_10000224 | 3300009148 | Bacteria | 65196 |
| 313 | Ga0105243_10000938 | 3300009148 | Bacteria | 27317 |
| 314 | Ga0105241_10004099 | 3300009174 | Bacteria | 10761 |
| 315 | Ga0105241_10025975 | 3300009174 | Bacteria | 4355 |
| 316 | Ga0105242_10000165 | 3300009176 | Bacteria | 49974 |
| 317 | Ga0105248_10000091 | 3300009177 | Bacteria | 101191 |
| 318 | Ga0105248_10003098 | 3300009177 | Bacteria | 18437 |
| 319 | Ga0105248_10008150 | 3300009177 | Bacteria | 11507 |
| 320 | Ga0105248_10010014 | 3300009177 | Bacteria | 10436 |
| 321 | Ga0105248_10102764 | 3300009177 | Bacteria | 3221 |
| 322 | Ga0105248_10318656 | 3300009177 | Bacteria | 1751 |
| 323 | Ga0105248_10329014 | 3300009177 | Bacteria | 1721 |
| 324 | Ga0105237_10095892 | 3300009545 | Bacteria | 2956 |
| 325 | Ga0105238_10007800 | 3300009551 | Bacteria | 10707 |
| 326 | Ga0105238_10020144 | 3300009551 | Bacteria | 6788 |
| 327 | Ga0105238_10054955 | 3300009551 | Bacteria | 3998 |
| 328 | Ga0105249_10000035 | 3300009553 | Bacteria | 201325 |
| 329 | Ga0105249_10000567 | 3300009553 | Bacteria | 33975 |
| 330 | Ga0105249_10001611 | 3300009553 | Bacteria | 19752 |
| 331 | Ga0105249_10009549 | 3300009553 | Bacteria | 8500 |
| 332 | Ga0105249_10034291 | 3300009553 | Bacteria | 4599 |
| 333 | Ga0105249_10047506 | 3300009553 | Bacteria | 3912 |
| 334 | Ga0105249_10122737 | 3300009553 | Bacteria | 2471 |
| 335 | Ga0105148_100444 | 3300009978 | Bacteria | 3979 |
| 336 | Ga0105239_10144329 | 3300010375 | Bacteria | 2654 |
| 337 | Ga0105239_10162022 | 3300010375 | Bacteria | 2499 |
| 338 | Ga0105246_10012042 | 3300011119 | Bacteria | 5388 |
| 339 | Ga0105246_10039544 | 3300011119 | Bacteria | 3178 |
| 340 | Ga0157326_1000068 | 3300012513 | Bacteria | 10055 |
| 341 | Ga0157373_10009105 | 3300013100 | Bacteria | 7344 |
| 342 | Ga0157373_10010652 | 3300013100 | Bacteria | 6767 |
| 343 | Ga0157373_10026321 | 3300013100 | Bacteria | 4202 |
| 344 | Ga0157373_10058420 | 3300013100 | Bacteria | 2735 |
| 345 | Ga0157373_10065747 | 3300013100 | Bacteria | 2566 |
| 346 | Ga0157371_10000097 | 3300013102 | Bacteria | 134150 |
| 347 | Ga0157371_10012865 | 3300013102 | Bacteria | 6372 |
| 348 | Ga0157371_10040150 | 3300013102 | Bacteria | 3345 |
| 349 | Ga0157370_10000069 | 3300013104 | Bacteria | 112889 |
| 350 | Ga0157370_10060808 | 3300013104 | Bacteria | 3585 |
| 351 | Ga0157370_10107590 | 3300013104 | Bacteria | 2608 |
| 352 | Ga0157369_10191142 | 3300013105 | Bacteria | 2151 |
| 353 | Ga0157369_10332956 | 3300013105 | Bacteria | 1577 |
| 354 | Ga0157374_10001016 | 3300013296 | Bacteria | 24345 |
| 355 | Ga0157374_10112266 | 3300013296 | Bacteria | 2622 |
| 356 | Ga0157378_10001151 | 3300013297 | Bacteria | 24035 |
| 357 | Ga0157378_10008397 | 3300013297 | Bacteria | 8997 |
| 358 | Ga0157378_10020678 | 3300013297 | Bacteria | 5789 |
| 359 | Ga0157378_10062593 | 3300013297 | Bacteria | 3323 |
| 360 | Ga0163162_10003018 | 3300013306 | Bacteria | 16081 |
| 361 | Ga0163162_10011232 | 3300013306 | Bacteria | 8731 |
| 362 | Ga0163162_10032482 | 3300013306 | Bacteria | 5185 |
| 363 | Ga0157372_10000605 | 3300013307 | Bacteria | 39162 |
| 364 | Ga0157372_10006096 | 3300013307 | Bacteria | 12807 |
| 365 | Ga0157372_10019824 | 3300013307 | Bacteria | 7247 |
| 366 | Ga0157372_10119158 | 3300013307 | Bacteria | 3029 |
| 367 | Ga0163163_10000123 | 3300014325 | Bacteria | 82366 |
| 368 | Ga0163163_10054955 | 3300014325 | Bacteria | 3935 |
| 369 | Ga0157380_10000217 | 3300014326 | Bacteria | 34251 |
| 370 | Ga0157380_10014535 | 3300014326 | Bacteria | 5760 |
| 371 | Ga0157380_10051590 | 3300014326 | Bacteria | 3254 |
| 372 | Ga0157377_10087013 | 3300014745 | Bacteria | 1838 |
| 373 | Ga0157379_10003874 | 3300014968 | Bacteria | 12752 |
| 374 | Ga0157379_10029120 | 3300014968 | Bacteria | 4911 |
| 375 | Ga0157379_10186217 | 3300014968 | Bacteria | 1876 |
| 376 | Ga0157379_10223187 | 3300014968 | Bacteria | 1707 |
| 377 | Ga0157376_10000089 | 3300014969 | Bacteria | 69351 |
| 378 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 379 | Ga0163161_10058287 | 3300017792 | Bacteria | 2807 |
| 380 | Ga0213876_10000791 | 3300021384 | Bacteria | 21470 |
| 381 | Ga0207672_1001086 | 3300025223 | Bacteria | 2482 |
| 382 | Ga0209147_100321 | 3300025229 | Bacteria | 36587 |
| 383 | Ga0209563_100111 | 3300025230 | Bacteria | 141123 |
| 384 | Ga0207427_100541 | 3300025231 | Bacteria | 19607 |
| 385 | Ga0207425_1000020 | 3300025245 | Bacteria | 372623 |
| 386 | Ga0209646_1007217 | 3300025246 | Bacteria | 1824 |
| 387 | Ga0209026_1001356 | 3300025250 | Bacteria | 10921 |
| 388 | Ga0209677_109735 | 3300025253 | Bacteria | 1685 |
| 389 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 390 | Ga0209148_1000238 | 3300025254 | Bacteria | 87836 |
| 391 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 392 | Ga0209233_1000142 | 3300025261 | Bacteria | 192193 |
| 393 | Ga0209565_1000179 | 3300025263 | Bacteria | 79300 |
| 394 | Ga0209565_1000210 | 3300025263 | Bacteria | 67800 |
| 395 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 396 | Ga0209673_1001240 | 3300025273 | Bacteria | 26584 |
| 397 | Ga0209673_1007764 | 3300025273 | Bacteria | 4876 |
| 398 | Ga0207673_1001768 | 3300025290 | Bacteria | 2398 |
| 399 | Ga0209675_1000196 | 3300025291 | Bacteria | 65422 |
| 400 | Ga0209676_1000253 | 3300025292 | Bacteria | 113412 |
| 401 | Ga0209676_1000518 | 3300025292 | Bacteria | 60512 |
| 402 | Ga0209676_1000569 | 3300025292 | Bacteria | 55557 |
| 403 | Ga0209676_1000929 | 3300025292 | Bacteria | 36184 |
| 404 | Ga0209676_1002091 | 3300025292 | Bacteria | 15424 |
| 405 | Ga0209676_1016025 | 3300025292 | Bacteria | 2729 |
| 406 | Ga0209025_1000326 | 3300025294 | Bacteria | 106087 |
| 407 | Ga0209025_1006572 | 3300025294 | Bacteria | 8964 |
| 408 | Ga0209564_1001114 | 3300025295 | Bacteria | 31654 |
| 409 | Ga0209564_1003913 | 3300025295 | Bacteria | 9537 |
| 410 | Ga0209564_1015718 | 3300025295 | Bacteria | 3060 |
| 411 | Ga0209564_1023739 | 3300025295 | Bacteria | 2119 |
| 412 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 413 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 414 | Ga0209758_1000562 | 3300025297 | Bacteria | 58446 |
| 415 | Ga0209758_1000894 | 3300025297 | Bacteria | 40579 |
| 416 | Ga0209758_1003287 | 3300025297 | Bacteria | 14980 |
| 417 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 418 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 419 | Ga0209050_1000173 | 3300025298 | Bacteria | 149800 |
| 420 | Ga0209050_1000218 | 3300025298 | Bacteria | 128776 |
| 421 | Ga0209050_1000649 | 3300025298 | Bacteria | 53856 |
| 422 | Ga0209050_1001834 | 3300025298 | Bacteria | 20662 |
| 423 | Ga0209050_1002610 | 3300025298 | Bacteria | 14895 |
| 424 | Ga0209050_1012126 | 3300025298 | Bacteria | 3993 |
| 425 | Ga0209256_1005813 | 3300025299 | Bacteria | 6875 |
| 426 | Ga0209051_1000476 | 3300025303 | Bacteria | 51944 |
| 427 | Ga0209051_1002693 | 3300025303 | Bacteria | 12365 |
| 428 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 429 | Ga0209257_1000130 | 3300025304 | Bacteria | 212188 |
| 430 | Ga0209257_1000196 | 3300025304 | Bacteria | 149656 |
| 431 | Ga0209257_1001405 | 3300025304 | Bacteria | 28723 |
| 432 | Ga0209257_1002800 | 3300025304 | Bacteria | 16403 |
| 433 | Ga0209257_1002949 | 3300025304 | Bacteria | 15613 |
| 434 | Ga0209257_1005712 | 3300025304 | Bacteria | 8542 |
| 435 | Ga0209257_1007291 | 3300025304 | Bacteria | 6733 |
| 436 | Ga0207697_10000164 | 3300025315 | Bacteria | 33417 |
| 437 | Ga0207656_10018821 | 3300025321 | Bacteria | 2723 |
| 438 | Ga0207696_1002742 | 3300025711 | Bacteria | 8384 |
| 439 | Ga0207710_10001431 | 3300025900 | Bacteria | 11928 |
| 440 | Ga0207680_10000011 | 3300025903 | Bacteria | 391225 |
| 441 | Ga0207680_10000130 | 3300025903 | Bacteria | 35102 |
| 442 | Ga0207680_10002989 | 3300025903 | Bacteria | 7926 |
| 443 | Ga0207680_10003644 | 3300025903 | Bacteria | 7242 |
| 444 | Ga0207680_10010937 | 3300025903 | Bacteria | 4562 |
| 445 | Ga0207647_10000832 | 3300025904 | Bacteria | 23993 |
| 446 | Ga0207647_10001216 | 3300025904 | Bacteria | 19802 |
| 447 | Ga0207647_10001683 | 3300025904 | Bacteria | 17030 |
| 448 | Ga0207647_10004249 | 3300025904 | Bacteria | 10616 |
| 449 | Ga0207647_10004936 | 3300025904 | Bacteria | 9836 |
| 450 | Ga0207647_10015278 | 3300025904 | Bacteria | 5269 |
| 451 | Ga0207647_10017008 | 3300025904 | Bacteria | 4951 |
| 452 | Ga0207647_10018508 | 3300025904 | Bacteria | 4708 |
| 453 | Ga0207647_10041598 | 3300025904 | Bacteria | 2888 |
| 454 | Ga0207645_10036749 | 3300025907 | Bacteria | 3145 |
| 455 | Ga0207645_10094666 | 3300025907 | Bacteria | 1923 |
| 456 | Ga0207645_10132882 | 3300025907 | Bacteria | 1620 |
| 457 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 458 | Ga0207705_10000121 | 3300025909 | Bacteria | 86649 |
| 459 | Ga0207705_10000450 | 3300025909 | Bacteria | 35404 |
| 460 | Ga0207705_10001242 | 3300025909 | Bacteria | 20522 |
| 461 | Ga0207705_10001784 | 3300025909 | Bacteria | 16963 |
| 462 | Ga0207705_10016359 | 3300025909 | Bacteria | 5319 |
| 463 | Ga0207705_10021229 | 3300025909 | Bacteria | 4632 |
| 464 | Ga0207705_10038257 | 3300025909 | Bacteria | 3434 |
| 465 | Ga0207705_10061213 | 3300025909 | Bacteria | 2719 |
| 466 | Ga0207705_10089686 | 3300025909 | Bacteria | 2250 |
| 467 | Ga0207654_10004079 | 3300025911 | Bacteria | 7359 |
| 468 | Ga0207654_10008188 | 3300025911 | Bacteria | 5272 |
| 469 | Ga0207707_10034926 | 3300025912 | Bacteria | 4397 |
| 470 | Ga0207695_10001288 | 3300025913 | Bacteria | 42577 |
| 471 | Ga0207695_10002305 | 3300025913 | Bacteria | 28454 |
| 472 | Ga0207695_10008440 | 3300025913 | Bacteria | 12898 |
| 473 | Ga0207695_10015037 | 3300025913 | Bacteria | 9132 |
| 474 | Ga0207695_10104874 | 3300025913 | Bacteria | 2815 |
| 475 | Ga0207695_10217672 | 3300025913 | Bacteria | 1818 |
| 476 | Ga0207671_10011321 | 3300025914 | Bacteria | 7269 |
| 477 | Ga0207671_10012661 | 3300025914 | Bacteria | 6770 |
| 478 | Ga0207660_10000681 | 3300025917 | Bacteria | 22727 |
| 479 | Ga0207660_10025154 | 3300025917 | Bacteria | 4039 |
| 480 | Ga0207657_10001673 | 3300025919 | Bacteria | 23919 |
| 481 | Ga0207657_10005111 | 3300025919 | Bacteria | 13744 |
| 482 | Ga0207657_10006366 | 3300025919 | Bacteria | 12264 |
| 483 | Ga0207657_10006851 | 3300025919 | Bacteria | 11753 |
| 484 | Ga0207657_10009905 | 3300025919 | Bacteria | 9540 |
| 485 | Ga0207657_10016359 | 3300025919 | Bacteria | 7156 |
| 486 | Ga0207657_10078521 | 3300025919 | Bacteria | 2779 |
| 487 | Ga0207657_10105585 | 3300025919 | Bacteria | 2331 |
| 488 | Ga0207657_10127378 | 3300025919 | Bacteria | 2090 |
| 489 | Ga0207649_10000093 | 3300025920 | Bacteria | 74490 |
| 490 | Ga0207649_10002255 | 3300025920 | Bacteria | 10883 |
| 491 | Ga0207649_10015823 | 3300025920 | Bacteria | 4240 |
| 492 | Ga0207649_10017766 | 3300025920 | Bacteria | 4033 |
| 493 | Ga0207649_10107492 | 3300025920 | Bacteria | 1858 |
| 494 | Ga0207652_10004669 | 3300025921 | Bacteria | 11109 |
| 495 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 496 | Ga0207681_10000040 | 3300025923 | Bacteria | 147547 |
| 497 | Ga0207681_10000088 | 3300025923 | Bacteria | 80059 |
| 498 | Ga0207681_10000153 | 3300025923 | Bacteria | 57579 |
| 499 | Ga0207681_10000259 | 3300025923 | Bacteria | 40452 |
| 500 | Ga0207681_10001688 | 3300025923 | Bacteria | 14203 |
| 501 | Ga0207681_10070849 | 3300025923 | Bacteria | 2429 |
| 502 | Ga0207694_10000776 | 3300025924 | Bacteria | 28653 |
| 503 | Ga0207694_10015899 | 3300025924 | Bacteria | 5677 |
| 504 | Ga0207694_10047916 | 3300025924 | Bacteria | 3305 |
| 505 | Ga0207694_10121220 | 3300025924 | Bacteria | 2088 |
| 506 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 507 | Ga0207650_10000030 | 3300025925 | Bacteria | 235824 |
| 508 | Ga0207650_10008442 | 3300025925 | Bacteria | 7032 |
| 509 | Ga0207650_10030386 | 3300025925 | Bacteria | 3891 |
| 510 | Ga0207650_10035362 | 3300025925 | Bacteria | 3626 |
| 511 | Ga0207650_10060553 | 3300025925 | Bacteria | 2825 |
| 512 | Ga0207659_10010577 | 3300025926 | Bacteria | 5801 |
| 513 | Ga0207687_10000225 | 3300025927 | Bacteria | 38523 |
| 514 | Ga0207687_10001763 | 3300025927 | Bacteria | 14882 |
| 515 | Ga0207687_10146661 | 3300025927 | Bacteria | 1796 |
| 516 | Ga0207664_10151664 | 3300025929 | Bacteria | 1969 |
| 517 | Ga0207644_10000023 | 3300025931 | Bacteria | 156180 |
| 518 | Ga0207644_10000060 | 3300025931 | Bacteria | 79209 |
| 519 | Ga0207644_10000230 | 3300025931 | Bacteria | 38307 |
| 520 | Ga0207644_10000574 | 3300025931 | Bacteria | 23595 |
| 521 | Ga0207644_10001257 | 3300025931 | Bacteria | 16312 |
| 522 | Ga0207644_10004362 | 3300025931 | Bacteria | 9175 |
| 523 | Ga0207644_10010449 | 3300025931 | Bacteria | 6118 |
| 524 | Ga0207644_10016847 | 3300025931 | Bacteria | 4923 |
| 525 | Ga0207644_10037750 | 3300025931 | Bacteria | 3400 |
| 526 | Ga0207644_10072793 | 3300025931 | Bacteria | 2518 |
| 527 | Ga0207644_10093402 | 3300025931 | Bacteria | 2246 |
| 528 | Ga0207644_10098658 | 3300025931 | Bacteria | 2190 |
| 529 | Ga0207644_10152169 | 3300025931 | Bacteria | 1791 |
| 530 | Ga0207644_10160184 | 3300025931 | Bacteria | 1749 |
| 531 | Ga0207690_10000116 | 3300025932 | Bacteria | 65776 |
| 532 | Ga0207690_10005830 | 3300025932 | Bacteria | 7286 |
| 533 | Ga0207690_10035337 | 3300025932 | Bacteria | 3227 |
| 534 | Ga0207706_10000791 | 3300025933 | Bacteria | 32709 |
| 535 | Ga0207706_10002854 | 3300025933 | Bacteria | 16774 |
| 536 | Ga0207706_10009488 | 3300025933 | Bacteria | 8937 |
| 537 | Ga0207706_10011772 | 3300025933 | Bacteria | 7966 |
| 538 | Ga0207706_10022097 | 3300025933 | Bacteria | 5709 |
| 539 | Ga0207706_10025811 | 3300025933 | Bacteria | 5263 |
| 540 | Ga0207706_10028678 | 3300025933 | Bacteria | 4969 |
| 541 | Ga0207706_10031534 | 3300025933 | Bacteria | 4721 |
| 542 | Ga0207706_10034999 | 3300025933 | Bacteria | 4467 |
| 543 | Ga0207686_10002854 | 3300025934 | Bacteria | 9320 |
| 544 | Ga0207709_10000173 | 3300025935 | Bacteria | 86350 |
| 545 | Ga0207709_10000519 | 3300025935 | Bacteria | 33581 |
| 546 | Ga0207669_10000161 | 3300025937 | Bacteria | 32114 |
| 547 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 548 | Ga0207704_10010909 | 3300025938 | Bacteria | 4454 |
| 549 | Ga0207691_10002685 | 3300025940 | Bacteria | 17397 |
| 550 | Ga0207691_10073318 | 3300025940 | Bacteria | 3087 |
| 551 | Ga0207691_10150950 | 3300025940 | Bacteria | 2043 |
| 552 | Ga0207711_10000107 | 3300025941 | Bacteria | 87146 |
| 553 | Ga0207711_10000252 | 3300025941 | Bacteria | 57840 |
| 554 | Ga0207711_10000464 | 3300025941 | Bacteria | 42035 |
| 555 | Ga0207711_10001704 | 3300025941 | Bacteria | 20237 |
| 556 | Ga0207711_10003251 | 3300025941 | Bacteria | 14161 |
| 557 | Ga0207711_10005998 | 3300025941 | Bacteria | 10272 |
| 558 | Ga0207711_10006796 | 3300025941 | Bacteria | 9613 |
| 559 | Ga0207711_10013203 | 3300025941 | Bacteria | 6860 |
| 560 | Ga0207711_10022921 | 3300025941 | Bacteria | 5226 |
| 561 | Ga0207711_10033348 | 3300025941 | Bacteria | 4356 |
| 562 | Ga0207711_10102334 | 3300025941 | Bacteria | 2535 |
| 563 | Ga0207711_10245817 | 3300025941 | Bacteria | 1641 |
| 564 | Ga0207689_10000744 | 3300025942 | Bacteria | 31242 |
| 565 | Ga0207689_10032872 | 3300025942 | Bacteria | 4312 |
| 566 | Ga0207661_10089743 | 3300025944 | Bacteria | 2558 |
| 567 | Ga0207679_10009675 | 3300025945 | Bacteria | 6179 |
| 568 | Ga0207679_10070227 | 3300025945 | Bacteria | 2638 |
| 569 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 570 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 571 | Ga0207667_10003106 | 3300025949 | Bacteria | 20551 |
| 572 | Ga0207667_10032150 | 3300025949 | Bacteria | 5657 |
| 573 | Ga0207667_10040012 | 3300025949 | Bacteria | 4991 |
| 574 | Ga0207667_10047794 | 3300025949 | Bacteria | 4527 |
| 575 | Ga0207667_10122692 | 3300025949 | Bacteria | 2677 |
| 576 | Ga0207667_10138977 | 3300025949 | Bacteria | 2501 |
| 577 | Ga0207667_10162948 | 3300025949 | Bacteria | 2293 |
| 578 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 579 | Ga0207651_10001783 | 3300025960 | Bacteria | 9995 |
| 580 | Ga0207651_10011173 | 3300025960 | Bacteria | 5013 |
| 581 | Ga0207651_10050724 | 3300025960 | Bacteria | 2819 |
| 582 | Ga0207712_10000008 | 3300025961 | Bacteria | 527957 |
| 583 | Ga0207712_10000013 | 3300025961 | Bacteria | 391208 |
| 584 | Ga0207712_10009432 | 3300025961 | Bacteria | 6175 |
| 585 | Ga0207712_10017704 | 3300025961 | Bacteria | 4631 |
| 586 | Ga0207668_10000010 | 3300025972 | Bacteria | 185249 |
| 587 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 588 | Ga0207668_10000230 | 3300025972 | Bacteria | 37555 |
| 589 | Ga0207668_10000629 | 3300025972 | Bacteria | 21816 |
| 590 | Ga0207668_10000754 | 3300025972 | Bacteria | 19803 |
| 591 | Ga0207668_10003159 | 3300025972 | Bacteria | 9645 |
| 592 | Ga0207668_10007271 | 3300025972 | Bacteria | 6574 |
| 593 | Ga0207668_10053205 | 3300025972 | Bacteria | 2804 |
| 594 | Ga0207640_10000063 | 3300025981 | Bacteria | 87065 |
| 595 | Ga0207640_10008882 | 3300025981 | Bacteria | 5598 |
| 596 | Ga0207640_10009509 | 3300025981 | Bacteria | 5445 |
| 597 | Ga0207640_10026537 | 3300025981 | Bacteria | 3518 |
| 598 | Ga0207640_10093007 | 3300025981 | Bacteria | 2094 |
| 599 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 600 | Ga0207658_10000089 | 3300025986 | Bacteria | 100308 |
| 601 | Ga0207658_10000132 | 3300025986 | Bacteria | 80078 |
| 602 | Ga0207658_10000265 | 3300025986 | Bacteria | 55108 |
| 603 | Ga0207658_10000291 | 3300025986 | Bacteria | 52585 |
| 604 | Ga0207658_10002473 | 3300025986 | Bacteria | 13492 |
| 605 | Ga0207658_10002799 | 3300025986 | Bacteria | 12544 |
| 606 | Ga0207658_10006048 | 3300025986 | Bacteria | 8262 |
| 607 | Ga0207658_10024878 | 3300025986 | Bacteria | 4188 |
| 608 | Ga0207658_10045530 | 3300025986 | Bacteria | 3199 |
| 609 | Ga0207658_10082985 | 3300025986 | Bacteria | 2462 |
| 610 | Ga0207677_10000030 | 3300026023 | Bacteria | 120692 |
| 611 | Ga0207677_10002440 | 3300026023 | Bacteria | 9762 |
| 612 | Ga0207677_10003169 | 3300026023 | Bacteria | 8684 |
| 613 | Ga0207703_10000691 | 3300026035 | Bacteria | 33391 |
| 614 | Ga0207703_10000959 | 3300026035 | Bacteria | 27891 |
| 615 | Ga0207703_10001013 | 3300026035 | Bacteria | 27010 |
| 616 | Ga0207703_10002678 | 3300026035 | Bacteria | 15293 |
| 617 | Ga0207703_10007167 | 3300026035 | Bacteria | 8871 |
| 618 | Ga0207703_10013579 | 3300026035 | Bacteria | 6346 |
| 619 | Ga0207703_10015240 | 3300026035 | Bacteria | 5997 |
| 620 | Ga0207703_10024463 | 3300026035 | Bacteria | 4751 |
| 621 | Ga0207703_10129812 | 3300026035 | Bacteria | 2175 |
| 622 | Ga0207639_10000554 | 3300026041 | Bacteria | 25675 |
| 623 | Ga0207639_10007537 | 3300026041 | Bacteria | 7421 |
| 624 | Ga0207639_10093024 | 3300026041 | Bacteria | 2417 |
| 625 | Ga0207678_10000622 | 3300026067 | Bacteria | 32445 |
| 626 | Ga0207678_10001173 | 3300026067 | Bacteria | 23989 |
| 627 | Ga0207678_10099449 | 3300026067 | Bacteria | 2484 |
| 628 | Ga0207678_10175246 | 3300026067 | Bacteria | 1831 |
| 629 | Ga0207702_10005143 | 3300026078 | Bacteria | 11511 |
| 630 | Ga0207702_10014674 | 3300026078 | Bacteria | 6501 |
| 631 | Ga0207702_10015232 | 3300026078 | Bacteria | 6375 |
| 632 | Ga0207702_10018383 | 3300026078 | Bacteria | 5784 |
| 633 | Ga0207702_10040115 | 3300026078 | Bacteria | 3924 |
| 634 | Ga0207641_10000060 | 3300026088 | Bacteria | 161514 |
| 635 | Ga0207641_10000081 | 3300026088 | Bacteria | 139770 |
| 636 | Ga0207641_10000112 | 3300026088 | Bacteria | 120365 |
| 637 | Ga0207641_10001074 | 3300026088 | Bacteria | 27484 |
| 638 | Ga0207641_10002092 | 3300026088 | Bacteria | 18889 |
| 639 | Ga0207641_10003106 | 3300026088 | Bacteria | 14934 |
| 640 | Ga0207641_10006239 | 3300026088 | Bacteria | 10085 |
| 641 | Ga0207641_10022545 | 3300026088 | Bacteria | 5182 |
| 642 | Ga0207641_10052963 | 3300026088 | Bacteria | 3438 |
| 643 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 644 | Ga0207648_10005659 | 3300026089 | Bacteria | 12549 |
| 645 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 646 | Ga0207676_10000183 | 3300026095 | Bacteria | 55220 |
| 647 | Ga0207676_10002294 | 3300026095 | Bacteria | 13722 |
| 648 | Ga0207676_10002964 | 3300026095 | Bacteria | 12109 |
| 649 | Ga0207676_10004432 | 3300026095 | Bacteria | 9925 |
| 650 | Ga0207676_10024910 | 3300026095 | Bacteria | 4434 |
| 651 | Ga0207676_10028473 | 3300026095 | Bacteria | 4173 |
| 652 | Ga0207676_10071028 | 3300026095 | Bacteria | 2793 |
| 653 | Ga0207676_10174334 | 3300026095 | Bacteria | 1877 |
| 654 | Ga0207674_10009434 | 3300026116 | Bacteria | 11149 |
| 655 | Ga0207674_10030042 | 3300026116 | Bacteria | 5717 |
| 656 | Ga0207675_100000020 | 3300026118 | Bacteria | 117374 |
| 657 | Ga0207675_100000582 | 3300026118 | Bacteria | 35705 |
| 658 | Ga0207675_100004785 | 3300026118 | Bacteria | 13038 |
| 659 | Ga0207675_100120006 | 3300026118 | Bacteria | 2487 |
| 660 | Ga0207683_10000655 | 3300026121 | Bacteria | 31727 |
| 661 | Ga0207683_10031600 | 3300026121 | Bacteria | 4594 |
| 662 | Ga0207683_10043198 | 3300026121 | Bacteria | 3938 |
| 663 | Ga0207698_10000111 | 3300026142 | Bacteria | 50675 |
| 664 | Ga0207698_10000901 | 3300026142 | Bacteria | 17299 |
| 665 | Ga0207698_10004991 | 3300026142 | Bacteria | 8136 |
| 666 | Ga0207698_10079100 | 3300026142 | Bacteria | 2643 |
| 667 | Ga0207698_10162483 | 3300026142 | Bacteria | 1955 |
| 668 | Ga0209981_1000450 | 3300027378 | Bacteria | 5205 |
| 669 | Ga0209999_1001309 | 3300027543 | Bacteria | 4268 |
| 670 | Ga0209813_10000042 | 3300027866 | Bacteria | 53213 |
| 671 | Ga0209813_10000126 | 3300027866 | Bacteria | 27944 |
| 672 | Ga0209974_10000935 | 3300027876 | Bacteria | 10190 |
| 673 | Ga0209974_10022986 | 3300027876 | Bacteria | 2064 |
| 674 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 675 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 676 | Ga0268266_10000025 | 3300028379 | Bacteria | 477143 |
| 677 | Ga0268266_10000656 | 3300028379 | Bacteria | 46813 |
| 678 | Ga0268266_10001270 | 3300028379 | Bacteria | 30813 |
| 679 | Ga0268266_10005609 | 3300028379 | Bacteria | 11655 |
| 680 | Ga0268266_10008036 | 3300028379 | Bacteria | 9426 |
| 681 | Ga0268266_10011818 | 3300028379 | Bacteria | 7568 |
| 682 | Ga0268266_10065129 | 3300028379 | Bacteria | 3150 |
| 683 | Ga0268266_10187890 | 3300028379 | Bacteria | 1885 |
| 684 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 685 | Ga0268265_10000082 | 3300028380 | Bacteria | 120835 |
| 686 | Ga0268265_10000096 | 3300028380 | Bacteria | 111507 |
| 687 | Ga0268265_10000098 | 3300028380 | Bacteria | 110108 |
| 688 | Ga0268265_10000958 | 3300028380 | Bacteria | 26520 |
| 689 | Ga0268265_10001171 | 3300028380 | Bacteria | 22981 |
| 690 | Ga0268265_10006244 | 3300028380 | Bacteria | 8075 |
| 691 | Ga0268264_10000018 | 3300028381 | Bacteria | 495324 |
| 692 | Ga0268264_10000037 | 3300028381 | Bacteria | 391116 |
| 693 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 694 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 695 | Ga0268264_10000125 | 3300028381 | Bacteria | 186416 |
| 696 | Ga0268264_10000141 | 3300028381 | Bacteria | 170966 |
| 697 | Ga0268264_10000933 | 3300028381 | Bacteria | 30321 |
| 698 | Ga0268264_10000935 | 3300028381 | Bacteria | 30301 |
| 699 | Ga0268264_10021281 | 3300028381 | Bacteria | 5297 |
| 700 | Ga0268264_10030502 | 3300028381 | Bacteria | 4420 |
| 701 | Ga0307517_10003203 | 3300028786 | Bacteria | 25702 |
| 702 | Ga0307517_10028536 | 3300028786 | Bacteria | 6645 |
| 703 | Ga0307517_10031733 | 3300028786 | Bacteria | 6136 |
| 704 | Ga0307517_10122409 | 3300028786 | Bacteria | 1916 |
| 705 | Ga0265338_10012923 | 3300028800 | Bacteria | 9481 |
| 706 | Ga0265338_10103029 | 3300028800 | Bacteria | 2319 |
| 707 | Ga0265327_10009725 | 3300031251 | Bacteria | 6884 |
| 708 | Ga0307513_10000077 | 3300031456 | Bacteria | 134167 |
| 709 | Ga0307513_10003660 | 3300031456 | Bacteria | 20800 |
| 710 | Ga0307513_10007104 | 3300031456 | Bacteria | 14560 |
| 711 | Ga0307513_10008325 | 3300031456 | Bacteria | 13279 |
| 712 | Ga0307513_10036337 | 3300031456 | Bacteria | 5496 |
| 713 | Ga0307408_100034134 | 3300031548 | Bacteria | 3560 |
| 714 | Ga0307408_100060171 | 3300031548 | Bacteria | 2768 |
| 715 | Ga0307408_100064942 | 3300031548 | Bacteria | 2675 |
| 716 | Ga0307408_100154617 | 3300031548 | Bacteria | 1814 |
| 717 | Ga0307508_10013919 | 3300031616 | Bacteria | 7342 |
| 718 | Ga0307508_10028051 | 3300031616 | Bacteria | 5094 |
| 719 | Ga0265314_10025857 | 3300031711 | Bacteria | 4420 |
| 720 | Ga0307405_10011985 | 3300031731 | Bacteria | 4568 |
| 721 | Ga0307413_10003794 | 3300031824 | Bacteria | 6441 |
| 722 | Ga0307413_10011429 | 3300031824 | Bacteria | 4365 |
| 723 | Ga0307413_10016574 | 3300031824 | Bacteria | 3811 |
| 724 | Ga0307413_10024251 | 3300031824 | Bacteria | 3304 |
| 725 | Ga0307413_10025760 | 3300031824 | Bacteria | 3230 |
| 726 | Ga0307413_10060505 | 3300031824 | Bacteria | 2332 |
| 727 | Ga0307410_10000171 | 3300031852 | Bacteria | 23683 |
| 728 | Ga0307410_10002446 | 3300031852 | Bacteria | 8971 |
| 729 | Ga0307410_10003744 | 3300031852 | Bacteria | 7698 |
| 730 | Ga0307410_10009876 | 3300031852 | Bacteria | 5378 |
| 731 | Ga0307410_10036364 | 3300031852 | Bacteria | 3206 |
| 732 | Ga0307410_10125035 | 3300031852 | Bacteria | 1881 |
| 733 | Ga0307406_10007470 | 3300031901 | Bacteria | 6061 |
| 734 | Ga0307406_10029628 | 3300031901 | Bacteria | 3316 |
| 735 | Ga0307406_10090504 | 3300031901 | Bacteria | 2059 |
| 736 | Ga0307407_10001776 | 3300031903 | Bacteria | 8057 |
| 737 | Ga0307407_10077426 | 3300031903 | Bacteria | 2000 |
| 738 | Ga0307412_10010645 | 3300031911 | Bacteria | 5301 |
| 739 | Ga0307412_10023286 | 3300031911 | Bacteria | 3809 |
| 740 | Ga0307412_10041749 | 3300031911 | Bacteria | 2975 |
| 741 | Ga0307409_100005102 | 3300031995 | Bacteria | 7495 |
| 742 | Ga0307409_100023720 | 3300031995 | Bacteria | 4260 |
| 743 | Ga0307409_100033235 | 3300031995 | Bacteria | 3751 |
| 744 | Ga0307409_100043149 | 3300031995 | Bacteria | 3383 |
| 745 | Ga0307409_100071255 | 3300031995 | Bacteria | 2763 |
| 746 | Ga0307409_100109535 | 3300031995 | Bacteria | 2312 |
| 747 | Ga0307416_100000451 | 3300032002 | Bacteria | 21079 |
| 748 | Ga0307416_100092614 | 3300032002 | Bacteria | 2600 |
| 749 | Ga0307416_100204353 | 3300032002 | Bacteria | 1877 |
| 750 | Ga0307414_10000346 | 3300032004 | Bacteria | 26022 |
| 751 | Ga0307414_10000914 | 3300032004 | Bacteria | 15107 |
| 752 | Ga0307414_10005824 | 3300032004 | Bacteria | 6815 |
| 753 | Ga0307414_10008577 | 3300032004 | Bacteria | 5809 |
| 754 | Ga0307414_10012599 | 3300032004 | Bacteria | 5007 |
| 755 | Ga0307414_10016703 | 3300032004 | Bacteria | 4470 |
| 756 | Ga0307414_10027143 | 3300032004 | Bacteria | 3696 |
| 757 | Ga0307414_10045572 | 3300032004 | Bacteria | 3004 |
| 758 | Ga0307414_10070467 | 3300032004 | Bacteria | 2518 |
| 759 | Ga0307414_10125643 | 3300032004 | Bacteria | 1981 |
| 760 | Ga0307411_10003505 | 3300032005 | Bacteria | 7291 |
| 761 | Ga0307411_10061254 | 3300032005 | Bacteria | 2504 |
| 762 | Ga0307411_10085085 | 3300032005 | Bacteria | 2189 |
| 763 | Ga0307411_10093961 | 3300032005 | Bacteria | 2101 |
| 764 | Ga0307415_100070909 | 3300032126 | Bacteria | 2448 |
| 765 | Ga0307415_100091584 | 3300032126 | Bacteria | 2202 |
| 766 | Ga0307510_10043919 | 3300033180 | Bacteria | 4849 |
| 767 | Ga0373936_0015112 | 3300035113 | Bacteria | 2957 |
| 768 | Ga0373946_0035131 | 3300035171 | Bacteria | 2027 |
| 769 | Ga0373955_0005549 | 3300035172 | Bacteria | 5673 |
| 770 | Ga0373962_0011746 | 3300035242 | Bacteria | 2198 |
| 771 | Ga0373935_0065252 | 3300035692 | Bacteria | 2336 |
| 772 | Ga0373927_0000831 | 3300035695 | Bacteria | 23649 |
| 773 | Ga0373937_0058132 | 3300036401 | Bacteria | 3553 |
| 774 | Ga0373925_0000984 | 3300037068 | Bacteria | 25954 |
| 775 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 776 | Ga0395899_0000395 | 3300037312 | Bacteria | 51851 |
| 777 | Ga0395899_0002657 | 3300037312 | Bacteria | 14408 |
| 778 | Ga0395899_0009522 | 3300037312 | Bacteria | 7456 |
| 779 | Ga0395899_0011904 | 3300037312 | Bacteria | 6661 |
| 780 | Ga0395899_0031785 | 3300037312 | Bacteria | 3966 |
| 781 | Ga0395899_0060292 | 3300037312 | Bacteria | 2795 |
| 782 | Ga0395899_0088690 | 3300037312 | Bacteria | 2243 |
| 783 | Ga0395899_0139280 | 3300037312 | Bacteria | 1727 |
| 784 | Ga0395899_0139426 | 3300037312 | Bacteria | 1726 |
| 785 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 786 | Ga0395900_0044693 | 3300037418 | Bacteria | 4563 |
| 787 | Ga0395900_0049269 | 3300037418 | Bacteria | 4339 |
| 788 | Ga0395900_0150494 | 3300037418 | Bacteria | 2377 |
| 789 | Ga0395900_0261901 | 3300037418 | Bacteria | 1726 |
| 790 | Ga0395898_0007219 | 3300037466 | Bacteria | 11790 |
| 791 | Ga0395898_0019791 | 3300037466 | Bacteria | 6845 |
| 792 | Ga0395898_0039258 | 3300037466 | Bacteria | 4686 |
| 793 | Ga0395898_0137636 | 3300037466 | Bacteria | 2338 |
| 794 | Ga0395898_0218803 | 3300037466 | Bacteria | 1817 |
| 795 | Ga0395898_0219438 | 3300037466 | Bacteria | 1814 |
| 796 | Ga0395898_0240278 | 3300037466 | Bacteria | 1727 |
| 797 | Ga0395905_0002515 | 3300037471 | Bacteria | 20250 |
| 798 | Ga0395905_0003251 | 3300037471 | Bacteria | 17474 |
| 799 | Ga0395905_0011963 | 3300037471 | Bacteria | 8366 |
| 800 | Ga0395905_0017528 | 3300037471 | Bacteria | 6798 |
| 801 | Ga0395905_0062605 | 3300037471 | Bacteria | 3480 |
| 802 | Ga0395905_0074477 | 3300037471 | Bacteria | 3181 |
| 803 | Ga0395905_0074500 | 3300037471 | Bacteria | 3181 |
| 804 | Ga0395905_0103227 | 3300037471 | Bacteria | 2677 |
| 805 | Ga0395905_0386055 | 3300037471 | Bacteria | 1295 |
| 806 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 807 | Ga0395901_0014093 | 3300038443 | Bacteria | 8139 |
| 808 | Ga0395901_0119948 | 3300038443 | Bacteria | 2763 |
| 809 | Ga0395901_0219488 | 3300038443 | Bacteria | 1988 |
| 810 | Ga0395901_0249534 | 3300038443 | Bacteria | 1849 |
| 811 | Ga0395901_0271819 | 3300038443 | Bacteria | 1762 |
| 812 | Ga0237819_00846 | 3300038705 | Bacteria | 9641 |
| 813 | Ga0436365_0480987 | 3300039437 | Bacteria | 6783 |
| 814 | Ga0436365_1342500 | 3300039437 | Bacteria | 41382 |
| 815 | Ga0439461_0000297 | 3300041410 | Bacteria | 7073 |
| 816 | Ga0439465_0000420 | 3300041413 | Bacteria | 12395 |
| 817 | Ga0451806_680459 | 3300041462 | Bacteria | 4338 |
| 818 | Ga0439431_0000645 | 3300041997 | Bacteria | 7421 |
| 819 | Ga0439431_0000807 | 3300041997 | Bacteria | 6766 |
| 820 | Ga0439445_0008249 | 3300042004 | Bacteria | 2433 |
| 821 | Ga0439448_0000252 | 3300042005 | Bacteria | 11561 |
| 822 | Ga0439448_0002085 | 3300042005 | Bacteria | 5366 |
| 823 | Ga0439455_0006627 | 3300042012 | Bacteria | 2413 |
| 824 | Ga0439462_0000249 | 3300042015 | Bacteria | 9622 |
| 825 | Ga0439458_0000528 | 3300042157 | Bacteria | 9833 |
| 826 | Ga0439458_0000550 | 3300042157 | Bacteria | 9644 |
| 827 | Ga0439458_0002113 | 3300042157 | Bacteria | 4922 |
| 828 | Ga0439434_0000823 | 3300042435 | Bacteria | 8928 |
| 829 | Ga0466961_0011905 | 3300044693 | Bacteria | 5560 |
| 830 | Ga0466961_0091701 | 3300044693 | Bacteria | 1918 |
| 831 | Ga0466963_0026776 | 3300044694 | Bacteria | 3689 |
| 832 | Ga0466971_0003958 | 3300044719 | Bacteria | 6369 |
| 833 | Ga0466968_0022779 | 3300044735 | Bacteria | 2548 |
| 834 | Ga0466968_0026553 | 3300044735 | Bacteria | 2377 |
| 835 | Ga0466957_0000560 | 3300044842 | Bacteria | 18785 |
| 836 | Ga0466957_0031342 | 3300044842 | Bacteria | 3177 |
| 837 | Ga0466957_0033408 | 3300044842 | Bacteria | 3087 |
| 838 | Ga0466960_0004332 | 3300044901 | Bacteria | 5537 |
| 839 | Ga0466959_0059099 | 3300045049 | Bacteria | 2792 |
| 840 | Ga0451576_0035173 | 3300045051 | Bacteria | 5316 |
| 841 | Ga0451576_0112747 | 3300045051 | Bacteria | 2830 |
| 842 | Ga0466958_0001653 | 3300045836 | Bacteria | 10750 |
| 843 | Ga0466958_0070759 | 3300045836 | Bacteria | 2135 |
| 844 | Ga0466967_0003617 | 3300045976 | Bacteria | 10151 |
| 845 | Ga0466967_0004762 | 3300045976 | Bacteria | 9239 |
| 846 | Ga0466967_0060899 | 3300045976 | Bacteria | 3347 |
| 847 | Ga0466967_0071267 | 3300045976 | Bacteria | 3111 |
| 848 | Ga0495627_000158 | 3300046453 | Bacteria | 77210 |
| 849 | Ga0495627_000511 | 3300046453 | Bacteria | 32184 |
| 850 | Ga0495627_000636 | 3300046453 | Bacteria | 27717 |
| 851 | Ga0495627_001522 | 3300046453 | Bacteria | 13320 |
| 852 | Ga0495590_0004507 | 3300046457 | Bacteria | 5619 |
| 853 | Ga0495638_0000016 | 3300046460 | Bacteria | 396505 |
| 854 | Ga0495638_0001235 | 3300046460 | Bacteria | 24108 |
| 855 | Ga0495638_0002237 | 3300046460 | Bacteria | 16075 |
| 856 | Ga0495638_0009533 | 3300046460 | Bacteria | 6805 |
| 857 | Ga0495638_0014288 | 3300046460 | Bacteria | 5374 |
| 858 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 859 | Ga0495650_0000492 | 3300046471 | Bacteria | 59983 |
| 860 | Ga0495650_0005540 | 3300046471 | Bacteria | 8155 |
| 861 | Ga0495650_0034765 | 3300046471 | Bacteria | 2226 |
| 862 | Ga0495584_0006800 | 3300046491 | Bacteria | 5973 |
| 863 | Ga0495585_0003684 | 3300046492 | Bacteria | 10241 |
| 864 | Ga0495594_0063695 | 3300046499 | Bacteria | 2043 |
| 865 | Ga0495596_0000141 | 3300046500 | Bacteria | 49474 |
| 866 | Ga0495596_0007358 | 3300046500 | Bacteria | 4971 |
| 867 | Ga0495596_0007523 | 3300046500 | Bacteria | 4910 |
| 868 | Ga0495607_0019591 | 3300046501 | Bacteria | 4296 |
| 869 | Ga0495583_0000025 | 3300046506 | Bacteria | 263775 |
| 870 | Ga0495583_0002564 | 3300046506 | Bacteria | 15303 |
| 871 | Ga0495583_0011021 | 3300046506 | Bacteria | 5213 |
| 872 | Ga0495583_0011071 | 3300046506 | Bacteria | 5198 |
| 873 | Ga0495583_0029586 | 3300046506 | Bacteria | 2678 |
| 874 | Ga0495606_0000434 | 3300046507 | Bacteria | 69495 |
| 875 | Ga0495606_0006495 | 3300046507 | Bacteria | 10756 |
| 876 | Ga0495606_0061506 | 3300046507 | Bacteria | 2401 |
| 877 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 878 | Ga0495610_0000071 | 3300046512 | Bacteria | 121210 |
| 879 | Ga0495610_0000478 | 3300046512 | Bacteria | 41250 |
| 880 | Ga0495610_0002395 | 3300046512 | Bacteria | 15792 |
| 881 | Ga0495616_0000007 | 3300046513 | Bacteria | 227689 |
| 882 | Ga0495616_0005214 | 3300046513 | Bacteria | 8035 |
| 883 | Ga0495616_0022892 | 3300046513 | Bacteria | 3368 |
| 884 | Ga0495632_0000211 | 3300046519 | Bacteria | 59066 |
| 885 | Ga0495632_0004458 | 3300046519 | Bacteria | 9510 |
| 886 | Ga0495632_0011966 | 3300046519 | Bacteria | 5032 |
| 887 | Ga0495632_0017082 | 3300046519 | Bacteria | 4016 |
| 888 | Ga0495632_0018793 | 3300046519 | Bacteria | 3783 |
| 889 | Ga0495637_0025747 | 3300046520 | Bacteria | 2649 |
| 890 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 891 | Ga0495643_0000132 | 3300046522 | Bacteria | 121567 |
| 892 | Ga0495643_0004044 | 3300046522 | Bacteria | 10460 |
| 893 | Ga0495643_0004426 | 3300046522 | Bacteria | 9829 |
| 894 | Ga0495643_0009605 | 3300046522 | Bacteria | 6000 |
| 895 | Ga0495643_0036370 | 3300046522 | Bacteria | 2705 |
| 896 | Ga0495648_0000101 | 3300046524 | Bacteria | 107124 |
| 897 | Ga0495648_0000256 | 3300046524 | Bacteria | 60519 |
| 898 | Ga0495648_0000634 | 3300046524 | Bacteria | 37553 |
| 899 | Ga0495648_0012976 | 3300046524 | Bacteria | 6184 |
| 900 | Ga0495648_0028854 | 3300046524 | Bacteria | 3690 |
| 901 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 902 | Ga0495663_0001269 | 3300046525 | Bacteria | 8015 |
| 903 | Ga0495663_0005529 | 3300046525 | Bacteria | 3507 |
| 904 | Ga0495663_0028431 | 3300046525 | Bacteria | 1646 |
| 905 | Ga0495642_0012414 | 3300046528 | Bacteria | 3284 |
| 906 | Ga0495654_0000135 | 3300046530 | Bacteria | 77516 |
| 907 | Ga0495587_0043433 | 3300046536 | Bacteria | 2677 |
| 908 | Ga0495609_0005528 | 3300046538 | Bacteria | 6604 |
| 909 | Ga0495621_0000349 | 3300046539 | Bacteria | 11275 |
| 910 | Ga0495621_0000432 | 3300046539 | Bacteria | 10366 |
| 911 | Ga0495621_0032968 | 3300046539 | Bacteria | 1783 |
| 912 | Ga0495597_0003528 | 3300046542 | Bacteria | 9046 |
| 913 | Ga0495622_0007231 | 3300046557 | Bacteria | 5154 |
| 914 | Ga0495633_0000983 | 3300046558 | Bacteria | 23405 |
| 915 | Ga0495633_0001072 | 3300046558 | Bacteria | 22116 |
| 916 | Ga0495633_0002904 | 3300046558 | Bacteria | 11752 |
| 917 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 918 | Ga0495668_0000163 | 3300046616 | Bacteria | 99607 |
| 919 | Ga0495668_0000291 | 3300046616 | Bacteria | 68802 |
| 920 | Ga0495668_0004834 | 3300046616 | Bacteria | 9372 |
| 921 | Ga0495668_0014658 | 3300046616 | Bacteria | 4591 |
| 922 | Ga0495668_0069472 | 3300046616 | Bacteria | 1937 |
| 923 | Ga0495625_0000332 | 3300046660 | Bacteria | 71947 |
| 924 | Ga0495625_0000546 | 3300046660 | Bacteria | 55126 |
| 925 | Ga0495625_0000676 | 3300046660 | Bacteria | 48679 |
| 926 | Ga0495625_0002176 | 3300046660 | Bacteria | 21762 |
| 927 | Ga0495625_0002942 | 3300046660 | Bacteria | 17765 |
| 928 | Ga0495625_0018991 | 3300046660 | Bacteria | 5349 |
| 929 | Ga0495625_0020518 | 3300046660 | Bacteria | 5099 |
| 930 | Ga0495625_0021050 | 3300046660 | Bacteria | 5027 |
| 931 | Ga0495625_0021743 | 3300046660 | Bacteria | 4931 |
| 932 | Ga0495625_0046856 | 3300046660 | Bacteria | 3118 |
| 933 | Ga0495625_0063896 | 3300046660 | Bacteria | 2598 |
| 934 | Ga0495661_0083784 | 3300046665 | Bacteria | 1832 |
| 935 | Ga0495623_0004939 | 3300046679 | Bacteria | 8745 |
| 936 | Ga0495669_0000044 | 3300046684 | Bacteria | 85633 |
| 937 | Ga0495669_0000629 | 3300046684 | Bacteria | 15335 |
| 938 | Ga0495670_0004421 | 3300046691 | Bacteria | 6897 |
| 939 | Ga0495670_0027463 | 3300046691 | Bacteria | 2820 |
| 940 | Ga0495670_0088067 | 3300046691 | Bacteria | 1587 |
| 941 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 942 | Ga0495671_0000063 | 3300046692 | Bacteria | 106655 |
| 943 | Ga0495671_0050737 | 3300046692 | Bacteria | 2065 |
| 944 | Ga0495589_0047849 | 3300046794 | Bacteria | 2118 |
| 945 | Ga0495600_0000914 | 3300046809 | Bacteria | 15826 |
| 946 | Ga0495672_0001086 | 3300047320 | Bacteria | 27612 |
| 947 | Ga0495672_0017193 | 3300047320 | Bacteria | 4842 |
| 948 | Ga0495683_0030185 | 3300047323 | Bacteria | 2766 |
| 949 | Ga0495687_001516 | 3300047443 | Bacteria | 21182 |
| 950 | Ga0495687_001938 | 3300047443 | Bacteria | 17742 |
| 951 | Ga0495677_0009768 | 3300047445 | Bacteria | 3536 |
| 952 | Ga0495677_0017382 | 3300047445 | Bacteria | 2608 |
| 953 | Ga0495677_0020464 | 3300047445 | Bacteria | 2399 |
| 954 | Ga0495677_0044726 | 3300047445 | Bacteria | 1623 |
| 955 | Ga0495677_0046206 | 3300047445 | Bacteria | 1598 |
| 956 | Ga0495679_004380 | 3300047446 | Bacteria | 6535 |
| 957 | Ga0495673_0000170 | 3300047469 | Bacteria | 106688 |
| 958 | Ga0495673_0001300 | 3300047469 | Bacteria | 20332 |
| 959 | Ga0495673_0001684 | 3300047469 | Bacteria | 16985 |
| 960 | Ga0495681_0000008 | 3300047470 | Bacteria | 215295 |
| 961 | Ga0495681_0000094 | 3300047470 | Bacteria | 77400 |
| 962 | Ga0495681_0003826 | 3300047470 | Bacteria | 10415 |
| 963 | Ga0495681_0012889 | 3300047470 | Bacteria | 4886 |
| 964 | Ga0495686_0000013 | 3300047472 | Bacteria | 489656 |
| 965 | Ga0495686_0000201 | 3300047472 | Bacteria | 110982 |
| 966 | Ga0495686_0005293 | 3300047472 | Bacteria | 10228 |
| 967 | Ga0495686_0005596 | 3300047472 | Bacteria | 9871 |
| 968 | Ga0495686_0005965 | 3300047472 | Bacteria | 9483 |
| 969 | Ga0495686_0014688 | 3300047472 | Bacteria | 5383 |
| 970 | Ga0495686_0089886 | 3300047472 | Bacteria | 1865 |
| 971 | Ga0495686_0104624 | 3300047472 | Bacteria | 1704 |
| 972 | Ga0495602_0031175 | 3300048088 | Bacteria | 5045 |
| 973 | Ga0495615_0000239 | 3300048090 | Bacteria | 11254 |
| 974 | Ga0495626_0001260 | 3300048091 | Bacteria | 20761 |
| 975 | Ga0496100_0129311 | 3300048903 | Bacteria | 1777 |
| 976 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 977 | Ga0496102_0002374 | 3300048905 | Bacteria | 16067 |
| 978 | Ga0496102_0018995 | 3300048905 | Bacteria | 6048 |
| 979 | Ga0496102_0087676 | 3300048905 | Bacteria | 2876 |
| 980 | Ga0496102_0095343 | 3300048905 | Bacteria | 2758 |
| 981 | Ga0496102_0129581 | 3300048905 | Bacteria | 2360 |
| 982 | Ga0496102_0162071 | 3300048905 | Bacteria | 2104 |
| 983 | Ga0496103_0000095 | 3300048906 | Bacteria | 98260 |
| 984 | Ga0496103_0001305 | 3300048906 | Bacteria | 16975 |
| 985 | Ga0496103_0001454 | 3300048906 | Bacteria | 15856 |
| 986 | Ga0496103_0072439 | 3300048906 | Bacteria | 2158 |
| 987 | Ga0496104_0000060 | 3300048907 | Bacteria | 117966 |
| 988 | Ga0496105_0000274 | 3300048908 | Bacteria | 34048 |
| 989 | Ga0496105_0009547 | 3300048908 | Bacteria | 7594 |
| 990 | Ga0496106_0000338 | 3300048909 | Bacteria | 32910 |
| 991 | Ga0496106_0017067 | 3300048909 | Bacteria | 5373 |
| 992 | Ga0496106_0113377 | 3300048909 | Bacteria | 2113 |
| 993 | Ga0496107_0000028 | 3300048910 | Bacteria | 105641 |
| 994 | Ga0496107_0004473 | 3300048910 | Bacteria | 9480 |
| 995 | Ga0496107_0015199 | 3300048910 | Bacteria | 5392 |
| 996 | Ga0496107_0031961 | 3300048910 | Bacteria | 3759 |
| 997 | Ga0496108_0001094 | 3300048911 | Bacteria | 21158 |
| 998 | Ga0496108_0012717 | 3300048911 | Bacteria | 6854 |
| 999 | Ga0496108_0109446 | 3300048911 | Bacteria | 2361 |
| 1000 | Ga0496109_0108966 | 3300048912 | Bacteria | 2574 |
| 1001 | Ga0496109_0152687 | 3300048912 | Bacteria | 2162 |
| 1002 | Ga0496110_0000347 | 3300048913 | Bacteria | 30884 |
| 1003 | Ga0496110_0008273 | 3300048913 | Bacteria | 8364 |
| 1004 | Ga0496110_0019550 | 3300048913 | Bacteria | 5703 |
| 1005 | Ga0496110_0036585 | 3300048913 | Bacteria | 4263 |
| 1006 | Ga0496111_0002388 | 3300048914 | Bacteria | 11319 |
| 1007 | Ga0496111_0020528 | 3300048914 | Bacteria | 4600 |
| 1008 | Ga0496112_0001900 | 3300048915 | Bacteria | 16480 |
| 1009 | Ga0496112_0004060 | 3300048915 | Bacteria | 12286 |
| 1010 | Ga0496112_0014185 | 3300048915 | Bacteria | 7385 |
| 1011 | Ga0496112_0115844 | 3300048915 | Bacteria | 2650 |
| 1012 | Ga0496113_0000377 | 3300048916 | Bacteria | 21522 |
| 1013 | Ga0496113_0001402 | 3300048916 | Bacteria | 13411 |
| 1014 | Ga0496113_0003962 | 3300048916 | Bacteria | 8994 |
| 1015 | Ga0496113_0094249 | 3300048916 | Bacteria | 2313 |
| 1016 | Ga0496114_0046477 | 3300048917 | Bacteria | 3608 |
| 1017 | Ga0496115_0000134 | 3300048918 | Bacteria | 67910 |
| 1018 | Ga0496115_0000172 | 3300048918 | Bacteria | 59971 |
| 1019 | Ga0496115_0000954 | 3300048918 | Bacteria | 20988 |
| 1020 | Ga0496115_0001701 | 3300048918 | Bacteria | 15773 |
| 1021 | Ga0496115_0002063 | 3300048918 | Bacteria | 14389 |
| 1022 | Ga0496115_0039667 | 3300048918 | Bacteria | 3741 |
| 1023 | Ga0496115_0056899 | 3300048918 | Bacteria | 3144 |
| 1024 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 1025 | Ga0496116_0014370 | 3300048919 | Bacteria | 6328 |
| 1026 | Ga0496116_0034323 | 3300048919 | Bacteria | 3582 |
| 1027 | Ga0496117_0000366 | 3300048920 | Bacteria | 78816 |
| 1028 | Ga0496117_0000582 | 3300048920 | Bacteria | 60157 |
| 1029 | Ga0496117_0017388 | 3300048920 | Bacteria | 6005 |
| 1030 | Ga0496117_0018898 | 3300048920 | Bacteria | 5685 |
| 1031 | Ga0496118_0000392 | 3300048921 | Bacteria | 74074 |
| 1032 | Ga0496118_0003332 | 3300048921 | Bacteria | 20326 |
| 1033 | Ga0496118_0037076 | 3300048921 | Bacteria | 3930 |
| 1034 | Ga0496119_0001213 | 3300048922 | Bacteria | 32201 |
| 1035 | Ga0496119_0094698 | 3300048922 | Bacteria | 1689 |
| 1036 | Ga0496120_0001109 | 3300048923 | Bacteria | 35064 |
| 1037 | Ga0496120_0038397 | 3300048923 | Bacteria | 2832 |
| 1038 | Ga0496121_0000175 | 3300048924 | Bacteria | 142910 |
| 1039 | Ga0496121_0000509 | 3300048924 | Bacteria | 74211 |
| 1040 | Ga0496121_0002522 | 3300048924 | Bacteria | 27770 |
| 1041 | Ga0496121_0002895 | 3300048924 | Bacteria | 25241 |
| 1042 | Ga0496121_0004566 | 3300048924 | Bacteria | 18476 |
| 1043 | Ga0496121_0005053 | 3300048924 | Bacteria | 17236 |
| 1044 | Ga0496121_0005396 | 3300048924 | Bacteria | 16416 |
| 1045 | Ga0496121_0012664 | 3300048924 | Bacteria | 9158 |
| 1046 | Ga0496121_0013959 | 3300048924 | Bacteria | 8580 |
| 1047 | Ga0496121_0127269 | 3300048924 | Bacteria | 1913 |
| 1048 | Ga0496122_0002369 | 3300048925 | Bacteria | 26990 |
| 1049 | Ga0496122_0002582 | 3300048925 | Bacteria | 25400 |
| 1050 | Ga0496122_0004287 | 3300048925 | Bacteria | 17866 |
| 1051 | Ga0496122_0005688 | 3300048925 | Bacteria | 14715 |
| 1052 | Ga0496122_0006401 | 3300048925 | Bacteria | 13531 |
| 1053 | Ga0496122_0009082 | 3300048925 | Bacteria | 10542 |
| 1054 | Ga0496123_0000155 | 3300048926 | Bacteria | 139646 |
| 1055 | Ga0496123_0000577 | 3300048926 | Bacteria | 62448 |
| 1056 | Ga0496123_0001557 | 3300048926 | Bacteria | 31501 |
| 1057 | Ga0496123_0007047 | 3300048926 | Bacteria | 10696 |
| 1058 | Ga0496123_0010484 | 3300048926 | Bacteria | 8185 |
| 1059 | Ga0496124_0000606 | 3300048927 | Bacteria | 60251 |
| 1060 | Ga0496124_0001819 | 3300048927 | Bacteria | 29505 |
| 1061 | Ga0496124_0021696 | 3300048927 | Bacteria | 5913 |
| 1062 | Ga0496124_0025910 | 3300048927 | Bacteria | 5298 |
| 1063 | Ga0496124_0028114 | 3300048927 | Bacteria | 5033 |
| 1064 | Ga0496125_0000666 | 3300048928 | Bacteria | 57200 |
| 1065 | Ga0496125_0004173 | 3300048928 | Bacteria | 16846 |
| 1066 | Ga0496125_0019436 | 3300048928 | Bacteria | 6406 |
| 1067 | Ga0496125_0020409 | 3300048928 | Bacteria | 6218 |
| 1068 | Ga0496125_0020819 | 3300048928 | Bacteria | 6142 |
| 1069 | Ga0496125_0025122 | 3300048928 | Bacteria | 5464 |
| 1070 | Ga0496125_0025348 | 3300048928 | Bacteria | 5432 |
| 1071 | Ga0496125_0025844 | 3300048928 | Bacteria | 5367 |
| 1072 | Ga0496125_0058805 | 3300048928 | Bacteria | 3102 |
| 1073 | Ga0496125_0061058 | 3300048928 | Bacteria | 3026 |
| 1074 | Ga0496125_0159591 | 3300048928 | Bacteria | 1534 |
| 1075 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 1076 | Ga0496126_0000294 | 3300048929 | Bacteria | 106327 |
| 1077 | Ga0496126_0004606 | 3300048929 | Bacteria | 16354 |
| 1078 | Ga0496126_0005782 | 3300048929 | Bacteria | 13983 |
| 1079 | Ga0496126_0007586 | 3300048929 | Bacteria | 11855 |
| 1080 | Ga0496126_0025071 | 3300048929 | Bacteria | 5747 |
| 1081 | Ga0495678_000699 | 3300049459 | Bacteria | 30520 |
| 1082 | Ga0501290_000086 | 3300049513 | Bacteria | 13288 |
| 1083 | Ga0501292_000019 | 3300049515 | Bacteria | 55694 |
| 1084 | Ga0501294_000190 | 3300049517 | Bacteria | 7585 |
| 1085 | Ga0501300_000128 | 3300049523 | Bacteria | 11180 |
| 1086 | Ga0501300_001748 | 3300049523 | Bacteria | 3253 |
| 1087 | Ga0501032_0002828 | 3300049569 | Bacteria | 13502 |
| 1088 | Ga0501032_0046399 | 3300049569 | Bacteria | 2937 |
| 1089 | Ga0501036_0098438 | 3300049572 | Bacteria | 2472 |
| 1090 | Ga0501036_0114026 | 3300049572 | Bacteria | 2284 |
| 1091 | Ga0501037_0018728 | 3300049573 | Bacteria | 5102 |
| 1092 | Ga0501037_0045975 | 3300049573 | Bacteria | 3203 |
| 1093 | Ga0501038_0024614 | 3300049574 | Bacteria | 5369 |
| 1094 | Ga0501043_0185581 | 3300049579 | Bacteria | 1619 |
| 1095 | Ga0501046_0098342 | 3300049580 | Bacteria | 2247 |
| 1096 | Ga0501047_0002252 | 3300049581 | Bacteria | 18471 |
| 1097 | Ga0501047_0003383 | 3300049581 | Bacteria | 15102 |
| 1098 | Ga0501047_0013163 | 3300049581 | Bacteria | 7835 |
| 1099 | Ga0501047_0016166 | 3300049581 | Bacteria | 7119 |
| 1100 | Ga0501047_0054093 | 3300049581 | Bacteria | 3883 |
| 1101 | Ga0501047_0159386 | 3300049581 | Bacteria | 2128 |
| 1102 | Ga0501047_0240044 | 3300049581 | Bacteria | 1663 |
| 1103 | Ga0501067_0002981 | 3300049583 | Bacteria | 9340 |
| 1104 | Ga0501067_0081413 | 3300049583 | Bacteria | 1795 |
| 1105 | Ga0501068_0001660 | 3300049584 | Bacteria | 11890 |
| 1106 | Ga0501073_0000141 | 3300049589 | Bacteria | 47264 |
| 1107 | Ga0501073_0000761 | 3300049589 | Bacteria | 22878 |
| 1108 | Ga0501077_0000007 | 3300049593 | Bacteria | 110582 |
| 1109 | Ga0501222_000788 | 3300049662 | Bacteria | 4564 |
| 1110 | Ga0501223_000099 | 3300049663 | Bacteria | 25017 |
| 1111 | Ga0501223_000193 | 3300049663 | Bacteria | 16020 |
| 1112 | Ga0501223_002457 | 3300049663 | Bacteria | 4113 |
| 1113 | Ga0501224_000015 | 3300049664 | Bacteria | 90971 |
| 1114 | Ga0501233_001277 | 3300049668 | Bacteria | 4302 |
| 1115 | Ga0501235_000351 | 3300049669 | Bacteria | 8794 |
| 1116 | Ga0501249_000162 | 3300049679 | Bacteria | 20650 |
| 1117 | Ga0501261_000061 | 3300049690 | Bacteria | 19269 |
| 1118 | Ga0501225_0000038 | 3300049705 | Bacteria | 45168 |
| 1119 | Ga0501225_0000131 | 3300049705 | Bacteria | 22852 |
| 1120 | Ga0501225_0002229 | 3300049705 | Bacteria | 5993 |
| 1121 | Ga0501234_000254 | 3300049707 | Bacteria | 7749 |
| 1122 | Ga0501080_0001234 | 3300049742 | Bacteria | 21266 |
| 1123 | Ga0501080_0003465 | 3300049742 | Bacteria | 13915 |
| 1124 | Ga0501080_0056978 | 3300049742 | Bacteria | 3639 |
| 1125 | Ga0501083_0005151 | 3300049744 | Bacteria | 9254 |
| 1126 | Ga0501083_0051504 | 3300049744 | Bacteria | 2768 |
| 1127 | Ga0501279_000008 | 3300049775 | Bacteria | 125267 |
| 1128 | Ga0501280_000131 | 3300049776 | Bacteria | 19531 |
| 1129 | Ga0501281_00097 | 3300049777 | Bacteria | 10413 |
| 1130 | Ga0501282_000184 | 3300049778 | Bacteria | 7616 |
| 1131 | Ga0501044_0010820 | 3300049823 | Bacteria | 9898 |
| 1132 | Ga0501044_0011325 | 3300049823 | Bacteria | 9664 |
| 1133 | Ga0501044_0027513 | 3300049823 | Bacteria | 6008 |
| 1134 | Ga0501226_000122 | 3300049853 | Bacteria | 16163 |
| 1135 | nmdc:mga03683_3_c1 | 3300050489 | Bacteria | 285872 |
| 1136 | nmdc:mga03683_6910_c1 | 3300050489 | Bacteria | 3911 |
| 1137 | nmdc:mga03n38_715_c1 | 3300050490 | Bacteria | 8716 |
| 1138 | nmdc:mga00v17_1761_c1 | 3300050491 | Bacteria | 11247 |
| 1139 | nmdc:mga00v17_599_c1 | 3300050491 | Bacteria | 19989 |
| 1140 | nmdc:mga0yw44_71676_c1 | 3300050492 | Bacteria | 2152 |
| 1141 | nmdc:mga0k408_20_c1 | 3300050493 | Bacteria | 109563 |
| 1142 | nmdc:mga0k408_4871_c1 | 3300050493 | Bacteria | 7118 |
| 1143 | nmdc:mga0k408_72823_c1 | 3300050493 | Bacteria | 2007 |
| 1144 | nmdc:mga06z11_26_c1 | 3300050494 | Bacteria | 64283 |
| 1145 | nmdc:mga06z11_6034_c1 | 3300050494 | Bacteria | 4901 |
| 1146 | nmdc:mga06z11_62412_c1 | 3300050494 | Bacteria | 1947 |
| 1147 | nmdc:mga06z11_761_c1 | 3300050494 | Bacteria | 11746 |
| 1148 | nmdc:mga04h51_118_c1 | 3300050495 | Bacteria | 23239 |
| 1149 | nmdc:mga04h51_22_c1 | 3300050495 | Bacteria | 64371 |
| 1150 | nmdc:mga04h51_5130_c1 | 3300050495 | Bacteria | 3319 |
| 1151 | nmdc:mga07m45_1_c1 | 3300050496 | Bacteria | 485809 |
| 1152 | nmdc:mga07m45_711_c1 | 3300050496 | Bacteria | 14140 |
| 1153 | nmdc:mga07m45_95776_c1 | 3300050496 | Bacteria | 1703 |
| 1154 | nmdc:mga0sz30_39184_c1 | 3300050516 | Bacteria | 1988 |
| 1155 | Ga0500610_0000385 | 3300053079 | Bacteria | 13390 |
| 1156 | Ga0500578_0000159 | 3300053086 | Bacteria | 79246 |
| 1157 | Ga0500643_001071 | 3300053087 | Bacteria | 16543 |
| 1158 | Ga0500643_002494 | 3300053087 | Bacteria | 9443 |
| 1159 | Ga0500643_003004 | 3300053087 | Bacteria | 8354 |
| 1160 | Ga0500643_004784 | 3300053087 | Bacteria | 5991 |
| 1161 | Ga0500643_005712 | 3300053087 | Bacteria | 5306 |
| 1162 | Ga0500643_005911 | 3300053087 | Bacteria | 5190 |
| 1163 | Ga0500643_006277 | 3300053087 | Bacteria | 4987 |
| 1164 | Ga0500644_0000269 | 3300053088 | Bacteria | 29380 |
| 1165 | Ga0500647_0074727 | 3300053091 | Bacteria | 1626 |
| 1166 | Ga0500651_0011395 | 3300053093 | Bacteria | 5358 |
| 1167 | Ga0500641_0003922 | 3300053096 | Bacteria | 5260 |
| 1168 | Ga0500641_0029798 | 3300053096 | Bacteria | 2140 |
| 1169 | Ga0500650_0064011 | 3300053098 | Bacteria | 1718 |
| 1170 | Ga0500555_006371 | 3300053103 | Bacteria | 3352 |
| 1171 | Ga0500556_0000031 | 3300053104 | Bacteria | 156000 |
| 1172 | Ga0500556_0014060 | 3300053104 | Bacteria | 2437 |
| 1173 | Ga0500556_0015464 | 3300053104 | Bacteria | 2354 |
| 1174 | Ga0500562_002265 | 3300053108 | Bacteria | 4813 |
| 1175 | Ga0500562_004945 | 3300053108 | Bacteria | 3360 |
| 1176 | Ga0500562_014739 | 3300053108 | Bacteria | 2003 |
| 1177 | Ga0500572_002012 | 3300053111 | Bacteria | 5066 |
| 1178 | Ga0500592_000270 | 3300053116 | Bacteria | 9225 |
| 1179 | Ga0500594_0000312 | 3300053118 | Bacteria | 10863 |
| 1180 | Ga0500594_0003663 | 3300053118 | Bacteria | 3387 |
| 1181 | Ga0500595_001337 | 3300053119 | Bacteria | 13334 |
| 1182 | Ga0500607_001726 | 3300053121 | Bacteria | 18994 |
| 1183 | Ga0500607_002875 | 3300053121 | Bacteria | 13266 |
| 1184 | Ga0500608_000348 | 3300053122 | Bacteria | 17856 |
| 1185 | Ga0500617_020891 | 3300053124 | Bacteria | 2875 |
| 1186 | Ga0500618_000570 | 3300053125 | Bacteria | 22812 |
| 1187 | Ga0500618_003408 | 3300053125 | Bacteria | 5472 |
| 1188 | Ga0500618_016467 | 3300053125 | Bacteria | 1850 |
| 1189 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 1190 | Ga0500642_0000337 | 3300053130 | Bacteria | 16075 |
| 1191 | Ga0500642_0001871 | 3300053130 | Bacteria | 6079 |
| 1192 | Ga0500642_0048665 | 3300053130 | Bacteria | 1863 |
| 1193 | Ga0500655_001064 | 3300053133 | Bacteria | 5273 |
| 1194 | Ga0500559_0000098 | 3300053136 | Bacteria | 69305 |
| 1195 | Ga0500559_0000147 | 3300053136 | Bacteria | 55307 |
| 1196 | Ga0500559_0002377 | 3300053136 | Bacteria | 9801 |
| 1197 | Ga0500559_0017612 | 3300053136 | Bacteria | 3018 |
| 1198 | Ga0500564_005262 | 3300053138 | Bacteria | 5276 |
| 1199 | Ga0500568_0014770 | 3300053139 | Bacteria | 3514 |
| 1200 | Ga0500573_0000034 | 3300053140 | Bacteria | 113547 |
| 1201 | Ga0500616_0014001 | 3300053153 | Bacteria | 4625 |
| 1202 | Ga0500622_0002660 | 3300053156 | Bacteria | 12677 |
| 1203 | Ga0500622_0003893 | 3300053156 | Bacteria | 9667 |
| 1204 | Ga0500622_0007480 | 3300053156 | Bacteria | 6200 |
| 1205 | Ga0500622_0013218 | 3300053156 | Bacteria | 4456 |
| 1206 | Ga0500622_0059721 | 3300053156 | Bacteria | 1946 |
| 1207 | Ga0500624_000022 | 3300053157 | Bacteria | 116892 |
| 1208 | Ga0500624_000024 | 3300053157 | Bacteria | 114404 |
| 1209 | Ga0500627_0000101 | 3300053158 | Bacteria | 28527 |
| 1210 | Ga0500627_0000489 | 3300053158 | Bacteria | 10672 |
| 1211 | Ga0500637_0000095 | 3300053178 | Bacteria | 31675 |
| 1212 | Ga0500637_0001187 | 3300053178 | Bacteria | 10847 |
| 1213 | Ga0500567_000103 | 3300053723 | Bacteria | 21300 |
| 1214 | Ga0500570_002262 | 3300053724 | Bacteria | 9442 |
| 1215 | Ga0500625_000029 | 3300053729 | Bacteria | 54479 |
| 1216 | Ga0500645_000300 | 3300053730 | Bacteria | 35408 |
| 1217 | Ga0500645_000452 | 3300053730 | Bacteria | 28126 |
| 1218 | Ga0500645_000996 | 3300053730 | Bacteria | 15975 |
| 1219 | Ga0500645_003145 | 3300053730 | Bacteria | 6866 |
| 1220 | Ga0500645_003367 | 3300053730 | Bacteria | 6543 |
| 1221 | Ga0500645_003519 | 3300053730 | Bacteria | 6328 |
| 1222 | Ga0500645_007126 | 3300053730 | Bacteria | 3927 |
| 1223 | Ga0500645_013667 | 3300053730 | Bacteria | 2601 |
| 1224 | Ga0500609_000273 | 3300053731 | Bacteria | 7534 |
| 1225 | Ga0500596_001261 | 3300053735 | Bacteria | 5117 |
| 1226 | Ga0500661_002227 | 3300055283 | Bacteria | 3664 |
| 1227 | Ga0501082_0016306 | 3300060353 | Bacteria | 6395 |
| 1228 | Ga0466962_0007859 | 3300061719 | Bacteria | 5117 |
| 1229 | Ga0466962_0015235 | 3300061719 | Bacteria | 3707 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0059099 | Ga0466959_0059099_1573_2751 | 390 |
| 2 | 3300049581 | Ga0501047_0159386 | Ga0501047_0159386_27_1274 | 410 |
| 3 | 3300013297 | Ga0157378_10008397 | Ga0157378_100083975 | 412 |
| 4 | 3300037471 | Ga0395905_0386055 | Ga0395905_0386055_10_1281 | 414 |
| 5 | 3300009553 | Ga0105249_10001611 | Ga0105249_1000161117 | 425 |
| 6 | 3300037466 | Ga0395898_0137636 | Ga0395898_0137636_1009_2319 | 431 |
| 7 | 3300048916 | Ga0496113_0094249 | Ga0496113_0094249_573_1976 | 443 |
| 8 | 3300025940 | Ga0207691_10150950 | Ga0207691_101509503 | 445 |
| 9 | 3300049581 | Ga0501047_0240044 | Ga0501047_0240044_219_1634 | 449 |
| 10 | 3300005347 | Ga0070668_100041954 | Ga0070668_1000419542 | 451 |
| 11 | 3300005353 | Ga0070669_100002305 | Ga0070669_1000023054 | 451 |
| 12 | 3300005355 | Ga0070671_100016202 | Ga0070671_1000162027 | 451 |
| 13 | 3300005367 | Ga0070667_100045508 | Ga0070667_1000455081 | 451 |
| 14 | 3300005617 | Ga0068859_100001618 | Ga0068859_10000161812 | 451 |
| 15 | 3300005841 | Ga0068863_100015575 | Ga0068863_1000155752 | 451 |
| 16 | 3300005842 | Ga0068858_100023998 | Ga0068858_1000239983 | 451 |
| 17 | 3300006931 | Ga0097620_100001618 | Ga0097620_10000161813 | 451 |
| 18 | 3300009177 | Ga0105248_10010014 | Ga0105248_100100143 | 451 |
| 19 | 3300014968 | Ga0157379_10003874 | Ga0157379_100038748 | 451 |
| 20 | 3300025923 | Ga0207681_10001688 | Ga0207681_100016888 | 451 |
| 21 | 3300025931 | Ga0207644_10004362 | Ga0207644_1000436210 | 451 |
| 22 | 3300025941 | Ga0207711_10102334 | Ga0207711_101023342 | 451 |
| 23 | 3300025972 | Ga0207668_10053205 | Ga0207668_100532052 | 451 |
| 24 | 3300037471 | Ga0395905_0017528 | Ga0395905_0017528_3907_5355 | 452 |
| 25 | 3300035692 | Ga0373935_0065252 | Ga0373935_0065252_443_1954 | 457 |
| 26 | 3300037471 | Ga0395905_0003251 | Ga0395905_0003251_4824_6320 | 457 |
| 27 | 3300003794 | Ga0055531_10012125 | Ga0055531_100121253 | 459 |
| 28 | 3300005843 | Ga0068860_100004284 | Ga0068860_1000042844 | 459 |
| 29 | 3300005844 | Ga0068862_100000485 | Ga0068862_10000048512 | 459 |
| 30 | 3300009553 | Ga0105249_10000567 | Ga0105249_100005678 | 459 |
| 31 | 3300025292 | Ga0209676_1002091 | Ga0209676_10020912 | 459 |
| 32 | 3300025298 | Ga0209050_1001834 | Ga0209050_10018343 | 459 |
| 33 | 3300025304 | Ga0209257_1002800 | Ga0209257_10028002 | 459 |
| 34 | 3300025961 | Ga0207712_10000008 | Ga0207712_100000087 | 459 |
| 35 | 3300028380 | Ga0268265_10000082 | Ga0268265_1000008276 | 459 |
| 36 | 3300028381 | Ga0268264_10000933 | Ga0268264_1000093317 | 459 |
| 37 | 3300028381 | Ga0268264_10000935 | Ga0268264_100009358 | 459 |
| 38 | 3300046453 | Ga0495627_000511 | Ga0495627_000511_23419_24873 | 459 |
| 39 | 3300046616 | Ga0495668_0000291 | Ga0495668_0000291_3788_5242 | 459 |
| 40 | 3300046794 | Ga0495589_0047849 | Ga0495589_0047849_481_1935 | 459 |
| 41 | 3300047469 | Ga0495673_0001684 | Ga0495673_0001684_323_1777 | 459 |
| 42 | 3300053136 | Ga0500559_0000098 | Ga0500559_0000098_21259_22713 | 460 |
| 43 | 3300048928 | Ga0496125_0025122 | Ga0496125_0025122_1989_3443 | 461 |
| 44 | 3300048929 | Ga0496126_0007586 | Ga0496126_0007586_8371_9825 | 461 |
| 45 | 3300005327 | Ga0070658_10039940 | Ga0070658_100399402 | 462 |
| 46 | 3300005327 | Ga0070658_10072459 | Ga0070658_100724592 | 462 |
| 47 | 3300005364 | Ga0070673_100146105 | Ga0070673_1001461052 | 462 |
| 48 | 3300005457 | Ga0070662_100006034 | Ga0070662_1000060347 | 462 |
| 49 | 3300005457 | Ga0070662_100107667 | Ga0070662_1001076672 | 462 |
| 50 | 3300005535 | Ga0070684_100123426 | Ga0070684_1001234262 | 462 |
| 51 | 3300005563 | Ga0068855_100205581 | Ga0068855_1002055812 | 462 |
| 52 | 3300005616 | Ga0068852_100000996 | Ga0068852_10000099614 | 462 |
| 53 | 3300011119 | Ga0105246_10039544 | Ga0105246_100395444 | 462 |
| 54 | 3300013102 | Ga0157371_10012865 | Ga0157371_100128653 | 462 |
| 55 | 3300013102 | Ga0157371_10040150 | Ga0157371_100401502 | 462 |
| 56 | 3300013105 | Ga0157369_10332956 | Ga0157369_103329561 | 462 |
| 57 | 3300014745 | Ga0157377_10087013 | Ga0157377_100870132 | 462 |
| 58 | 3300025909 | Ga0207705_10061213 | Ga0207705_100612133 | 462 |
| 59 | 3300025917 | Ga0207660_10025154 | Ga0207660_100251542 | 462 |
| 60 | 3300025931 | Ga0207644_10072793 | Ga0207644_100727932 | 462 |
| 61 | 3300025933 | Ga0207706_10022097 | Ga0207706_100220972 | 462 |
| 62 | 3300025949 | Ga0207667_10032150 | Ga0207667_100321505 | 462 |
| 63 | 3300025949 | Ga0207667_10162948 | Ga0207667_101629482 | 462 |
| 64 | 3300026142 | Ga0207698_10000901 | Ga0207698_100009015 | 462 |
| 65 | iso_pu_bacteria | 2895880812 | 2895882643 | 462 |
| 66 | iso_pu_bacteria | 2896184354 | 2896187040 | 462 |
| 67 | 3300005335 | Ga0070666_10014711 | Ga0070666_100147112 | 463 |
| 68 | 3300005347 | Ga0070668_100019269 | Ga0070668_1000192694 | 463 |
| 69 | 3300005367 | Ga0070667_100000067 | Ga0070667_10000006777 | 463 |
| 70 | 3300005564 | Ga0070664_100077301 | Ga0070664_1000773012 | 463 |
| 71 | 3300005841 | Ga0068863_100000038 | Ga0068863_10000003875 | 463 |
| 72 | 3300025903 | Ga0207680_10002989 | Ga0207680_100029895 | 463 |
| 73 | 3300025945 | Ga0207679_10070227 | Ga0207679_100702272 | 463 |
| 74 | 3300025972 | Ga0207668_10000629 | Ga0207668_1000062910 | 463 |
| 75 | 3300025986 | Ga0207658_10000089 | Ga0207658_1000008956 | 463 |
| 76 | 3300026088 | Ga0207641_10000060 | Ga0207641_1000006086 | 463 |
| 77 | 3300046471 | Ga0495650_0034765 | Ga0495650_0034765_742_2190 | 463 |
| 78 | 3300046513 | Ga0495616_0000007 | Ga0495616_0000007_122079_123590 | 463 |
| 79 | 3300046616 | Ga0495668_0004834 | Ga0495668_0004834_2315_3766 | 463 |
| 80 | 3300053158 | Ga0500627_0000489 | Ga0500627_0000489_3928_5439 | 463 |
| 81 | iso_pu_bacteria | 2848297114 | 2848297701 | 463 |
| 82 | 3300005262 | Ga0065165_1001513 | Ga0065165_10015133 | 464 |
| 83 | 3300005327 | Ga0070658_10032583 | Ga0070658_100325833 | 464 |
| 84 | 3300005339 | Ga0070660_100041808 | Ga0070660_1000418082 | 464 |
| 85 | 3300005366 | Ga0070659_100015944 | Ga0070659_1000159447 | 464 |
| 86 | 3300005458 | Ga0070681_10019939 | Ga0070681_100199393 | 464 |
| 87 | 3300005577 | Ga0068857_100006583 | Ga0068857_1000065833 | 464 |
| 88 | 3300005616 | Ga0068852_100003424 | Ga0068852_1000034243 | 464 |
| 89 | 3300009093 | Ga0105240_10012012 | Ga0105240_100120124 | 464 |
| 90 | 3300009551 | Ga0105238_10054955 | Ga0105238_100549552 | 464 |
| 91 | 3300010375 | Ga0105239_10144329 | Ga0105239_101443291 | 464 |
| 92 | 3300013100 | Ga0157373_10026321 | Ga0157373_100263213 | 464 |
| 93 | 3300013307 | Ga0157372_10006096 | Ga0157372_100060966 | 464 |
| 94 | 3300025904 | Ga0207647_10000832 | Ga0207647_100008323 | 464 |
| 95 | 3300025919 | Ga0207657_10009905 | Ga0207657_100099053 | 464 |
| 96 | 3300025920 | Ga0207649_10017766 | Ga0207649_100177663 | 464 |
| 97 | 3300025924 | Ga0207694_10000776 | Ga0207694_100007768 | 464 |
| 98 | 3300025944 | Ga0207661_10089743 | Ga0207661_100897432 | 464 |
| 99 | 3300026041 | Ga0207639_10000554 | Ga0207639_1000055416 | 464 |
| 100 | 3300026116 | Ga0207674_10009434 | Ga0207674_100094346 | 464 |
| 101 | 3300053087 | Ga0500643_006277 | Ga0500643_006277_2988_4442 | 464 |
| 102 | 3300053104 | Ga0500556_0014060 | Ga0500556_0014060_859_2313 | 464 |
| 103 | 3300053153 | Ga0500616_0014001 | Ga0500616_0014001_1833_3287 | 464 |
| 104 | 3300053156 | Ga0500622_0007480 | Ga0500622_0007480_119_1573 | 464 |
| 105 | 3300053730 | Ga0500645_003519 | Ga0500645_003519_3409_4863 | 464 |
| 106 | 3300025949 | Ga0207667_10003106 | Ga0207667_1000310614 | 465 |
| 107 | 3300031456 | Ga0307513_10003660 | Ga0307513_1000366012 | 465 |
| 108 | 3300046491 | Ga0495584_0006800 | Ga0495584_0006800_2077_3531 | 465 |
| 109 | 3300046519 | Ga0495632_0000211 | Ga0495632_0000211_5059_6513 | 465 |
| 110 | 3300046522 | Ga0495643_0000053 | Ga0495643_0000053_130401_131855 | 465 |
| 111 | 3300046525 | Ga0495663_0000020 | Ga0495663_0000020_70553_72007 | 465 |
| 112 | 3300046558 | Ga0495633_0000983 | Ga0495633_0000983_10413_11867 | 465 |
| 113 | 3300046692 | Ga0495671_0000031 | Ga0495671_0000031_70176_71630 | 465 |
| 114 | 3300047470 | Ga0495681_0012889 | Ga0495681_0012889_2268_3722 | 465 |
| 115 | 3300005842 | Ga0068858_100030505 | Ga0068858_1000305052 | 466 |
| 116 | 3300026035 | Ga0207703_10015240 | Ga0207703_100152402 | 466 |
| 117 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_462411_463985 | 466 |
| 118 | 3300048929 | Ga0496126_0005782 | Ga0496126_0005782_10540_11970 | 466 |
| 119 | 3300005355 | Ga0070671_100018377 | Ga0070671_1000183775 | 467 |
| 120 | 3300025931 | Ga0207644_10010449 | Ga0207644_100104493 | 467 |
| 121 | 3300031995 | Ga0307409_100071255 | Ga0307409_1000712552 | 467 |
| 122 | 3300037312 | Ga0395899_0000018 | Ga0395899_0000018_274294_275754 | 468 |
| 123 | 3300046558 | Ga0495633_0001072 | Ga0495633_0001072_10362_11816 | 468 |
| 124 | 3300049572 | Ga0501036_0114026 | Ga0501036_0114026_512_1951 | 468 |
| 125 | 3300049581 | Ga0501047_0013163 | Ga0501047_0013163_3732_5171 | 468 |
| 126 | iso_pu_bacteria | 8057101203 | 8057103307 | 468 |
| 127 | 3300006042 | Ga0075368_10000704 | Ga0075368_100007047 | 469 |
| 128 | 3300006178 | Ga0075367_10000042 | Ga0075367_100000429 | 469 |
| 129 | 3300006353 | Ga0075370_10040975 | Ga0075370_100409752 | 469 |
| 130 | 3300027866 | Ga0209813_10000042 | Ga0209813_1000004233 | 469 |
| 131 | 3300050494 | nmdc:mga06z11_26_c1 | nmdc:mga06z11_26_c1_45139_46593 | 469 |
| 132 | 3300050495 | nmdc:mga04h51_22_c1 | nmdc:mga04h51_22_c1_17821_19275 | 469 |
| 133 | 3300050496 | nmdc:mga07m45_95776_c1 | nmdc:mga07m45_95776_c1_225_1679 | 469 |
| 134 | 3300053087 | Ga0500643_002494 | Ga0500643_002494_4431_5852 | 469 |
| 135 | iso_pu_bacteria | 2830075706 | 2830077117 | 469 |
| 136 | iso_pu_bacteria | 2739367664 | 2739650371 | 470 |
| 137 | iso_pu_bacteria | 2739367865 | 2740028844 | 470 |
| 138 | iso_pu_bacteria | 2885429604 | 2885429714 | 470 |
| 139 | iso_pu_bacteria | 2946787523 | 2946788829 | 470 |
| 140 | iso_pu_bacteria | 2990265787 | 2990269329 | 470 |
| 141 | iso_pu_bacteria | 2993693658 | 2993694336 | 470 |
| 142 | 3300031548 | Ga0307408_100060171 | Ga0307408_1000601712 | 471 |
| 143 | 3300047472 | Ga0495686_0000013 | Ga0495686_0000013_401102_402568 | 471 |
| 144 | 3300049569 | Ga0501032_0002828 | Ga0501032_0002828_9960_11429 | 471 |
| 145 | 3300049569 | Ga0501032_0046399 | Ga0501032_0046399_649_2103 | 471 |
| 146 | 3300049572 | Ga0501036_0098438 | Ga0501036_0098438_845_2314 | 471 |
| 147 | 3300049573 | Ga0501037_0018728 | Ga0501037_0018728_1630_3099 | 471 |
| 148 | 3300049573 | Ga0501037_0045975 | Ga0501037_0045975_1725_3179 | 471 |
| 149 | 3300049574 | Ga0501038_0024614 | Ga0501038_0024614_1198_2652 | 471 |
| 150 | 3300049580 | Ga0501046_0098342 | Ga0501046_0098342_74_1528 | 471 |
| 151 | 3300049581 | Ga0501047_0016166 | Ga0501047_0016166_1833_3287 | 471 |
| 152 | 3300049583 | Ga0501067_0002981 | Ga0501067_0002981_1638_3107 | 471 |
| 153 | 3300049583 | Ga0501067_0081413 | Ga0501067_0081413_178_1632 | 471 |
| 154 | 3300049584 | Ga0501068_0001660 | Ga0501068_0001660_5873_7342 | 471 |
| 155 | 3300049589 | Ga0501073_0000141 | Ga0501073_0000141_36976_38445 | 471 |
| 156 | 3300049589 | Ga0501073_0000761 | Ga0501073_0000761_18574_20028 | 471 |
| 157 | 3300049593 | Ga0501077_0000007 | Ga0501077_0000007_56922_58391 | 471 |
| 158 | 3300049742 | Ga0501080_0001234 | Ga0501080_0001234_5709_7178 | 471 |
| 159 | 3300049742 | Ga0501080_0003465 | Ga0501080_0003465_775_2229 | 471 |
| 160 | 3300049744 | Ga0501083_0005151 | Ga0501083_0005151_3124_4578 | 471 |
| 161 | 3300049744 | Ga0501083_0051504 | Ga0501083_0051504_435_1904 | 471 |
| 162 | 3300049823 | Ga0501044_0010820 | Ga0501044_0010820_2706_4175 | 471 |
| 163 | 3300049823 | Ga0501044_0027513 | Ga0501044_0027513_3414_4868 | 471 |
| 164 | 3300060353 | Ga0501082_0016306 | Ga0501082_0016306_1670_3124 | 471 |
| 165 | iso_pu_bacteria | 2643221614 | 2644087988 | 471 |
| 166 | iso_pu_bacteria | 2643221661 | 2644344125 | 471 |
| 167 | iso_pu_bacteria | 2643221666 | 2644367345 | 471 |
| 168 | iso_pu_bacteria | 2919138771 | 2919141387 | 471 |
| 169 | 3300001979 | JGI24740J21852_10008136 | JGI24740J21852_100081361 | 472 |
| 170 | 3300001989 | JGI24739J22299_10007274 | JGI24739J22299_100072741 | 472 |
| 171 | 3300001990 | JGI24737J22298_10004820 | JGI24737J22298_100048202 | 472 |
| 172 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006350 | 472 |
| 173 | 3300003759 | Ga0055525_1000090 | Ga0055525_1000090146 | 472 |
| 174 | 3300003762 | Ga0055542_1000046 | Ga0055542_1000046185 | 472 |
| 175 | 3300003763 | Ga0055529_1000007 | Ga0055529_100000744 | 472 |
| 176 | 3300003763 | Ga0055529_1000109 | Ga0055529_100010927 | 472 |
| 177 | 3300005327 | Ga0070658_10000227 | Ga0070658_1000022717 | 472 |
| 178 | 3300005344 | Ga0070661_100002364 | Ga0070661_1000023644 | 472 |
| 179 | 3300005456 | Ga0070678_100000076 | Ga0070678_10000007623 | 472 |
| 180 | 3300005457 | Ga0070662_100131020 | Ga0070662_1001310201 | 472 |
| 181 | 3300005548 | Ga0070665_100000086 | Ga0070665_100000086175 | 472 |
| 182 | 3300005578 | Ga0068854_100039985 | Ga0068854_1000399852 | 472 |
| 183 | 3300006042 | Ga0075368_10004849 | Ga0075368_100048492 | 472 |
| 184 | 3300006051 | Ga0075364_10000499 | Ga0075364_100004993 | 472 |
| 185 | 3300009148 | Ga0105243_10000224 | Ga0105243_1000022410 | 472 |
| 186 | 3300009177 | Ga0105248_10000091 | Ga0105248_1000009190 | 472 |
| 187 | 3300013102 | Ga0157371_10000097 | Ga0157371_10000097100 | 472 |
| 188 | 3300014326 | Ga0157380_10000217 | Ga0157380_1000021718 | 472 |
| 189 | 3300025230 | Ga0209563_100111 | Ga0209563_10011110 | 472 |
| 190 | 3300025246 | Ga0209646_1007217 | Ga0209646_10072172 | 472 |
| 191 | 3300025253 | Ga0209677_109735 | Ga0209677_1097352 | 472 |
| 192 | 3300025254 | Ga0209148_1000026 | Ga0209148_1000026341 | 472 |
| 193 | 3300025272 | Ga0209455_1000005 | Ga0209455_10000051088 | 472 |
| 194 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011476 | 472 |
| 195 | 3300025904 | Ga0207647_10041598 | Ga0207647_100415982 | 472 |
| 196 | 3300025909 | Ga0207705_10000450 | Ga0207705_1000045018 | 472 |
| 197 | 3300025911 | Ga0207654_10004079 | Ga0207654_100040796 | 472 |
| 198 | 3300025913 | Ga0207695_10015037 | Ga0207695_100150373 | 472 |
| 199 | 3300025914 | Ga0207671_10012661 | Ga0207671_100126617 | 472 |
| 200 | 3300025920 | Ga0207649_10002255 | Ga0207649_100022555 | 472 |
| 201 | 3300025933 | Ga0207706_10011772 | Ga0207706_100117723 | 472 |
| 202 | 3300025935 | Ga0207709_10000519 | Ga0207709_100005199 | 472 |
| 203 | 3300025937 | Ga0207669_10000161 | Ga0207669_1000016124 | 472 |
| 204 | 3300025949 | Ga0207667_10000010 | Ga0207667_10000010347 | 472 |
| 205 | 3300025986 | Ga0207658_10082985 | Ga0207658_100829853 | 472 |
| 206 | 3300026121 | Ga0207683_10000655 | Ga0207683_1000065523 | 472 |
| 207 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022385 | 472 |
| 208 | 3300028786 | Ga0307517_10028536 | Ga0307517_100285367 | 472 |
| 209 | 3300028786 | Ga0307517_10031733 | Ga0307517_100317333 | 472 |
| 210 | 3300031456 | Ga0307513_10036337 | Ga0307513_100363376 | 472 |
| 211 | 3300031911 | Ga0307412_10041749 | Ga0307412_100417494 | 472 |
| 212 | 3300032004 | Ga0307414_10008577 | Ga0307414_100085776 | 472 |
| 213 | 3300037471 | Ga0395905_0103227 | Ga0395905_0103227_129_1574 | 472 |
| 214 | 3300046471 | Ga0495650_0000492 | Ga0495650_0000492_728_2164 | 472 |
| 215 | 3300046492 | Ga0495585_0003684 | Ga0495585_0003684_3241_4677 | 472 |
| 216 | 3300046500 | Ga0495596_0007358 | Ga0495596_0007358_968_2404 | 472 |
| 217 | 3300046506 | Ga0495583_0002564 | Ga0495583_0002564_9470_10906 | 472 |
| 218 | 3300046506 | Ga0495583_0029586 | Ga0495583_0029586_651_2087 | 472 |
| 219 | 3300046507 | Ga0495606_0000434 | Ga0495606_0000434_29549_30985 | 472 |
| 220 | 3300046520 | Ga0495637_0025747 | Ga0495637_0025747_576_2012 | 472 |
| 221 | 3300046522 | Ga0495643_0004426 | Ga0495643_0004426_699_2135 | 472 |
| 222 | 3300046524 | Ga0495648_0000256 | Ga0495648_0000256_5876_7312 | 472 |
| 223 | 3300046525 | Ga0495663_0001269 | Ga0495663_0001269_6129_7565 | 472 |
| 224 | 3300046536 | Ga0495587_0043433 | Ga0495587_0043433_435_1871 | 472 |
| 225 | 3300046557 | Ga0495622_0007231 | Ga0495622_0007231_2980_4416 | 472 |
| 226 | 3300046558 | Ga0495633_0002904 | Ga0495633_0002904_3381_4817 | 472 |
| 227 | 3300046616 | Ga0495668_0000163 | Ga0495668_0000163_82743_84179 | 472 |
| 228 | 3300046660 | Ga0495625_0000546 | Ga0495625_0000546_3537_4973 | 472 |
| 229 | 3300046660 | Ga0495625_0021743 | Ga0495625_0021743_3024_4460 | 472 |
| 230 | 3300046660 | Ga0495625_0063896 | Ga0495625_0063896_517_1953 | 472 |
| 231 | 3300046665 | Ga0495661_0083784 | Ga0495661_0083784_338_1774 | 472 |
| 232 | 3300046684 | Ga0495669_0000629 | Ga0495669_0000629_4867_6303 | 472 |
| 233 | 3300046809 | Ga0495600_0000914 | Ga0495600_0000914_4864_6300 | 472 |
| 234 | 3300047323 | Ga0495683_0030185 | Ga0495683_0030185_750_2186 | 472 |
| 235 | 3300047443 | Ga0495687_001516 | Ga0495687_001516_15400_16836 | 472 |
| 236 | 3300047443 | Ga0495687_001938 | Ga0495687_001938_7266_8702 | 472 |
| 237 | 3300047470 | Ga0495681_0003826 | Ga0495681_0003826_2416_3852 | 472 |
| 238 | 3300047472 | Ga0495686_0005293 | Ga0495686_0005293_8681_10117 | 472 |
| 239 | 3300047472 | Ga0495686_0104624 | Ga0495686_0104624_196_1656 | 472 |
| 240 | 3300048905 | Ga0496102_0002374 | Ga0496102_0002374_5493_6929 | 472 |
| 241 | 3300048906 | Ga0496103_0001305 | Ga0496103_0001305_6586_8022 | 472 |
| 242 | 3300048908 | Ga0496105_0009547 | Ga0496105_0009547_4323_5759 | 472 |
| 243 | 3300048913 | Ga0496110_0008273 | Ga0496110_0008273_6122_7558 | 472 |
| 244 | 3300048917 | Ga0496114_0046477 | Ga0496114_0046477_1051_2487 | 472 |
| 245 | 3300048918 | Ga0496115_0000172 | Ga0496115_0000172_8992_10428 | 472 |
| 246 | 3300048919 | Ga0496116_0014370 | Ga0496116_0014370_4537_5973 | 472 |
| 247 | 3300048920 | Ga0496117_0000582 | Ga0496117_0000582_9149_10585 | 472 |
| 248 | 3300048921 | Ga0496118_0000392 | Ga0496118_0000392_26910_28346 | 472 |
| 249 | 3300048923 | Ga0496120_0038397 | Ga0496120_0038397_901_2337 | 472 |
| 250 | 3300048924 | Ga0496121_0002895 | Ga0496121_0002895_1451_2884 | 472 |
| 251 | 3300048924 | Ga0496121_0005396 | Ga0496121_0005396_9230_10666 | 472 |
| 252 | 3300048927 | Ga0496124_0000606 | Ga0496124_0000606_49621_51057 | 472 |
| 253 | 3300048928 | Ga0496125_0000666 | Ga0496125_0000666_9358_10794 | 472 |
| 254 | 3300048929 | Ga0496126_0004606 | Ga0496126_0004606_9152_10588 | 472 |
| 255 | 3300053079 | Ga0500610_0000385 | Ga0500610_0000385_11366_12802 | 472 |
| 256 | 3300053119 | Ga0500595_001337 | Ga0500595_001337_2560_3996 | 472 |
| 257 | 3300053130 | Ga0500642_0000337 | Ga0500642_0000337_13919_15355 | 472 |
| 258 | 3300053140 | Ga0500573_0000034 | Ga0500573_0000034_13858_15294 | 472 |
| 259 | 3300053156 | Ga0500622_0003893 | Ga0500622_0003893_1702_3156 | 472 |
| 260 | 3300053730 | Ga0500645_000300 | Ga0500645_000300_8909_10345 | 472 |
| 261 | 3300053735 | Ga0500596_001261 | Ga0500596_001261_2290_3726 | 472 |
| 262 | iso_pu_bacteria | 2599185354 | 2600200589 | 472 |
| 263 | iso_pu_bacteria | 2643221598 | 2644001584 | 472 |
| 264 | iso_pu_bacteria | 2751185897 | 2753763632 | 472 |
| 265 | iso_pu_bacteria | 2818991438 | 2819553161 | 472 |
| 266 | 3300002075 | JGI24738J21930_10002973 | JGI24738J21930_100029733 | 473 |
| 267 | 3300002774 | JGI25150J39212_1000046 | JGI25150J39212_10000461 | 473 |
| 268 | 3300003214 | JGI25165J46597_1000073 | JGI25165J46597_100007362 | 473 |
| 269 | 3300003215 | JGI25153J46596_10000124 | JGI25153J46596_1000012464 | 473 |
| 270 | 3300003771 | Ga0055526_1006062 | Ga0055526_10060623 | 473 |
| 271 | 3300003791 | Ga0055530_10002060 | Ga0055530_100020605 | 473 |
| 272 | 3300003791 | Ga0055530_10018279 | Ga0055530_100182791 | 473 |
| 273 | 3300003794 | Ga0055531_10000008 | Ga0055531_10000008121 | 473 |
| 274 | 3300003794 | Ga0055531_10003005 | Ga0055531_100030052 | 473 |
| 275 | 3300005262 | Ga0065165_1001443 | Ga0065165_100144317 | 473 |
| 276 | 3300005327 | Ga0070658_10000124 | Ga0070658_1000012439 | 473 |
| 277 | 3300005329 | Ga0070683_100179416 | Ga0070683_1001794162 | 473 |
| 278 | 3300005334 | Ga0068869_100192549 | Ga0068869_1001925491 | 473 |
| 279 | 3300005366 | Ga0070659_100050460 | Ga0070659_1000504603 | 473 |
| 280 | 3300005366 | Ga0070659_100070320 | Ga0070659_1000703203 | 473 |
| 281 | 3300005455 | Ga0070663_100084044 | Ga0070663_1000840443 | 473 |
| 282 | 3300005548 | Ga0070665_100068272 | Ga0070665_1000682723 | 473 |
| 283 | 3300005563 | Ga0068855_100085239 | Ga0068855_1000852395 | 473 |
| 284 | 3300005614 | Ga0068856_100026950 | Ga0068856_1000269501 | 473 |
| 285 | 3300005616 | Ga0068852_100001336 | Ga0068852_10000133613 | 473 |
| 286 | 3300005616 | Ga0068852_100010220 | Ga0068852_1000102207 | 473 |
| 287 | 3300005617 | Ga0068859_100004889 | Ga0068859_1000048897 | 473 |
| 288 | 3300005618 | Ga0068864_100022005 | Ga0068864_1000220058 | 473 |
| 289 | 3300005618 | Ga0068864_100030978 | Ga0068864_1000309784 | 473 |
| 290 | 3300005719 | Ga0068861_100000005 | Ga0068861_10000000524 | 473 |
| 291 | 3300005842 | Ga0068858_100000777 | Ga0068858_10000077721 | 473 |
| 292 | 3300005842 | Ga0068858_100031104 | Ga0068858_1000311045 | 473 |
| 293 | 3300006353 | Ga0075370_10042569 | Ga0075370_100425692 | 473 |
| 294 | 3300009093 | Ga0105240_10008624 | Ga0105240_100086249 | 473 |
| 295 | 3300009098 | Ga0105245_10002260 | Ga0105245_1000226011 | 473 |
| 296 | 3300009177 | Ga0105248_10003098 | Ga0105248_1000309812 | 473 |
| 297 | 3300009551 | Ga0105238_10020144 | Ga0105238_100201446 | 473 |
| 298 | 3300013104 | Ga0157370_10060808 | Ga0157370_100608082 | 473 |
| 299 | 3300013296 | Ga0157374_10112266 | Ga0157374_101122663 | 473 |
| 300 | 3300013297 | Ga0157378_10062593 | Ga0157378_100625934 | 473 |
| 301 | 3300014325 | Ga0163163_10000123 | Ga0163163_1000012344 | 473 |
| 302 | 3300015690 | Ga0183363_1001 | Ga0183363_1001144 | 473 |
| 303 | 3300025245 | Ga0207425_1000020 | Ga0207425_1000020350 | 473 |
| 304 | 3300025261 | Ga0209233_1000142 | Ga0209233_1000142119 | 473 |
| 305 | 3300025263 | Ga0209565_1000210 | Ga0209565_100021014 | 473 |
| 306 | 3300025273 | Ga0209673_1007764 | Ga0209673_10077645 | 473 |
| 307 | 3300025292 | Ga0209676_1016025 | Ga0209676_10160251 | 473 |
| 308 | 3300025294 | Ga0209025_1000326 | Ga0209025_100032666 | 473 |
| 309 | 3300025295 | Ga0209564_1001114 | Ga0209564_100111435 | 473 |
| 310 | 3300025295 | Ga0209564_1015718 | Ga0209564_10157184 | 473 |
| 311 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004614 | 473 |
| 312 | 3300025297 | Ga0209758_1000894 | Ga0209758_100089443 | 473 |
| 313 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012577 | 473 |
| 314 | 3300025298 | Ga0209050_1000026 | Ga0209050_100002662 | 473 |
| 315 | 3300025298 | Ga0209050_1000173 | Ga0209050_100017335 | 473 |
| 316 | 3300025303 | Ga0209051_1000476 | Ga0209051_100047660 | 473 |
| 317 | 3300025304 | Ga0209257_1000009 | Ga0209257_100000962 | 473 |
| 318 | 3300025304 | Ga0209257_1000196 | Ga0209257_100019635 | 473 |
| 319 | 3300025304 | Ga0209257_1002949 | Ga0209257_10029493 | 473 |
| 320 | 3300025904 | Ga0207647_10015278 | Ga0207647_100152783 | 473 |
| 321 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009526 | 473 |
| 322 | 3300025913 | Ga0207695_10008440 | Ga0207695_1000844010 | 473 |
| 323 | 3300025924 | Ga0207694_10047916 | Ga0207694_100479162 | 473 |
| 324 | 3300025927 | Ga0207687_10001763 | Ga0207687_1000176311 | 473 |
| 325 | 3300025929 | Ga0207664_10151664 | Ga0207664_101516642 | 473 |
| 326 | 3300025932 | Ga0207690_10035337 | Ga0207690_100353373 | 473 |
| 327 | 3300025941 | Ga0207711_10003251 | Ga0207711_100032515 | 473 |
| 328 | 3300025949 | Ga0207667_10122692 | Ga0207667_101226921 | 473 |
| 329 | 3300025981 | Ga0207640_10008882 | Ga0207640_100088825 | 473 |
| 330 | 3300025986 | Ga0207658_10000291 | Ga0207658_1000029129 | 473 |
| 331 | 3300026035 | Ga0207703_10001013 | Ga0207703_1000101315 | 473 |
| 332 | 3300026035 | Ga0207703_10024463 | Ga0207703_100244634 | 473 |
| 333 | 3300026067 | Ga0207678_10175246 | Ga0207678_101752462 | 473 |
| 334 | 3300026078 | Ga0207702_10014674 | Ga0207702_100146747 | 473 |
| 335 | 3300026118 | Ga0207675_100000020 | Ga0207675_10000002044 | 473 |
| 336 | 3300026142 | Ga0207698_10000111 | Ga0207698_1000011124 | 473 |
| 337 | 3300026142 | Ga0207698_10079100 | Ga0207698_100791003 | 473 |
| 338 | 3300028379 | Ga0268266_10008036 | Ga0268266_100080363 | 473 |
| 339 | 3300028379 | Ga0268266_10187890 | Ga0268266_101878901 | 473 |
| 340 | 3300028800 | Ga0265338_10012923 | Ga0265338_100129232 | 473 |
| 341 | 3300031616 | Ga0307508_10013919 | Ga0307508_100139192 | 473 |
| 342 | 3300032004 | Ga0307414_10125643 | Ga0307414_101256432 | 473 |
| 343 | 3300035172 | Ga0373955_0005549 | Ga0373955_0005549_2022_3467 | 473 |
| 344 | 3300036401 | Ga0373937_0058132 | Ga0373937_0058132_414_1859 | 473 |
| 345 | 3300037312 | Ga0395899_0002657 | Ga0395899_0002657_11578_13026 | 473 |
| 346 | 3300037312 | Ga0395899_0011904 | Ga0395899_0011904_2252_3712 | 473 |
| 347 | 3300037466 | Ga0395898_0019791 | Ga0395898_0019791_3410_4858 | 473 |
| 348 | 3300037466 | Ga0395898_0219438 | Ga0395898_0219438_250_1695 | 473 |
| 349 | 3300041410 | Ga0439461_0000297 | Ga0439461_0000297_279_1715 | 473 |
| 350 | 3300041413 | Ga0439465_0000420 | Ga0439465_0000420_2625_4061 | 473 |
| 351 | 3300041997 | Ga0439431_0000645 | Ga0439431_0000645_4540_5976 | 473 |
| 352 | 3300041997 | Ga0439431_0000807 | Ga0439431_0000807_4902_6347 | 473 |
| 353 | 3300042004 | Ga0439445_0008249 | Ga0439445_0008249_458_1894 | 473 |
| 354 | 3300042015 | Ga0439462_0000249 | Ga0439462_0000249_3444_4880 | 473 |
| 355 | 3300042435 | Ga0439434_0000823 | Ga0439434_0000823_1776_3212 | 473 |
| 356 | 3300044694 | Ga0466963_0026776 | Ga0466963_0026776_32_1477 | 473 |
| 357 | 3300044842 | Ga0466957_0000560 | Ga0466957_0000560_16655_18100 | 473 |
| 358 | 3300044842 | Ga0466957_0031342 | Ga0466957_0031342_636_2081 | 473 |
| 359 | 3300045836 | Ga0466958_0001653 | Ga0466958_0001653_2078_3523 | 473 |
| 360 | 3300045976 | Ga0466967_0003617 | Ga0466967_0003617_460_1905 | 473 |
| 361 | 3300045976 | Ga0466967_0071267 | Ga0466967_0071267_216_1661 | 473 |
| 362 | 3300046460 | Ga0495638_0002237 | Ga0495638_0002237_6447_7901 | 473 |
| 363 | 3300046506 | Ga0495583_0011071 | Ga0495583_0011071_1824_3263 | 473 |
| 364 | 3300046522 | Ga0495643_0004044 | Ga0495643_0004044_8010_9461 | 473 |
| 365 | 3300046524 | Ga0495648_0028854 | Ga0495648_0028854_2092_3543 | 473 |
| 366 | 3300046616 | Ga0495668_0014658 | Ga0495668_0014658_283_1728 | 473 |
| 367 | 3300046616 | Ga0495668_0069472 | Ga0495668_0069472_62_1504 | 473 |
| 368 | 3300046660 | Ga0495625_0000332 | Ga0495625_0000332_65811_67250 | 473 |
| 369 | 3300046660 | Ga0495625_0018991 | Ga0495625_0018991_3052_4494 | 473 |
| 370 | 3300046679 | Ga0495623_0004939 | Ga0495623_0004939_2410_3855 | 473 |
| 371 | 3300047445 | Ga0495677_0044726 | Ga0495677_0044726_161_1612 | 473 |
| 372 | 3300047445 | Ga0495677_0046206 | Ga0495677_0046206_27_1466 | 473 |
| 373 | 3300047472 | Ga0495686_0005596 | Ga0495686_0005596_6305_7759 | 473 |
| 374 | 3300048088 | Ga0495602_0031175 | Ga0495602_0031175_3257_4702 | 473 |
| 375 | 3300048918 | Ga0496115_0000134 | Ga0496115_0000134_6418_7863 | 473 |
| 376 | 3300048924 | Ga0496121_0127269 | Ga0496121_0127269_135_1571 | 473 |
| 377 | 3300049742 | Ga0501080_0056978 | Ga0501080_0056978_602_2047 | 473 |
| 378 | 3300053087 | Ga0500643_004784 | Ga0500643_004784_4451_5890 | 473 |
| 379 | 3300053096 | Ga0500641_0029798 | Ga0500641_0029798_487_1941 | 473 |
| 380 | 3300053098 | Ga0500650_0064011 | Ga0500650_0064011_52_1494 | 473 |
| 381 | 3300053104 | Ga0500556_0000031 | Ga0500556_0000031_2992_4434 | 473 |
| 382 | 3300053124 | Ga0500617_020891 | Ga0500617_020891_1065_2507 | 473 |
| 383 | 3300053130 | Ga0500642_0000003 | Ga0500642_0000003_124305_125747 | 473 |
| 384 | 3300053139 | Ga0500568_0014770 | Ga0500568_0014770_54_1490 | 473 |
| 385 | 3300053730 | Ga0500645_000452 | Ga0500645_000452_7319_8758 | 473 |
| 386 | 3300053730 | Ga0500645_003367 | Ga0500645_003367_2677_4155 | 473 |
| 387 | 3300053730 | Ga0500645_013667 | Ga0500645_013667_300_1745 | 473 |
| 388 | iso_pu_bacteria | 2510917020 | 2511121040 | 473 |
| 389 | iso_pu_bacteria | 2512564014 | 2512642124 | 473 |
| 390 | iso_pu_bacteria | 2582581279 | 2585148172 | 473 |
| 391 | iso_pu_bacteria | 2582581280 | 2585155153 | 473 |
| 392 | iso_pu_bacteria | 2582581293 | 2585194834 | 473 |
| 393 | iso_pu_bacteria | 2582581305 | 2585260016 | 473 |
| 394 | iso_pu_bacteria | 2585428106 | 2587917077 | 473 |
| 395 | iso_pu_bacteria | 2643221541 | 2643726849 | 473 |
| 396 | iso_pu_bacteria | 2643221545 | 2643747368 | 473 |
| 397 | iso_pu_bacteria | 2643221552 | 2643782339 | 473 |
| 398 | iso_pu_bacteria | 2643221584 | 2643929848 | 473 |
| 399 | iso_pu_bacteria | 2643221605 | 2644040746 | 473 |
| 400 | iso_pu_bacteria | 2643221606 | 2644046110 | 473 |
| 401 | iso_pu_bacteria | 2643221640 | 2644223718 | 473 |
| 402 | iso_pu_bacteria | 2643221642 | 2644236194 | 473 |
| 403 | iso_pu_bacteria | 2643221671 | 2644393079 | 473 |
| 404 | iso_pu_bacteria | 2643221691 | 2644507433 | 473 |
| 405 | iso_pu_bacteria | 2775507255 | 2778123980 | 473 |
| 406 | iso_pu_bacteria | 2791355048 | 2792461738 | 473 |
| 407 | iso_pu_bacteria | 2808606401 | 2809063649 | 473 |
| 408 | iso_pu_bacteria | 2808606404 | 2809079733 | 473 |
| 409 | iso_pu_bacteria | 2808606405 | 2809084098 | 473 |
| 410 | iso_pu_bacteria | 2818991435 | 2819538484 | 473 |
| 411 | iso_pu_bacteria | 2818991454 | 2819648071 | 473 |
| 412 | iso_pu_bacteria | 2843744320 | 2843745899 | 473 |
| 413 | iso_pu_bacteria | 2849560528 | 2849561741 | 473 |
| 414 | iso_pu_bacteria | 2849573788 | 2849577759 | 473 |
| 415 | iso_pu_bacteria | 2851153111 | 2851156679 | 473 |
| 416 | iso_pu_bacteria | 2857504554 | 2857506112 | 473 |
| 417 | iso_pu_bacteria | 2880518877 | 2880519422 | 473 |
| 418 | iso_pu_bacteria | 2882806704 | 2882808367 | 473 |
| 419 | iso_pu_bacteria | 2884960567 | 2884963470 | 473 |
| 420 | iso_pu_bacteria | 2898329390 | 2898330692 | 473 |
| 421 | iso_pu_bacteria | 2919709256 | 2919711160 | 473 |
| 422 | iso_pu_bacteria | 2928531327 | 2928534608 | 473 |
| 423 | 3300005262 | Ga0065165_1004716 | Ga0065165_10047167 | 474 |
| 424 | 3300005293 | Ga0065715_10097503 | Ga0065715_100975033 | 474 |
| 425 | 3300005364 | Ga0070673_100092613 | Ga0070673_1000926132 | 474 |
| 426 | 3300005548 | Ga0070665_100026184 | Ga0070665_1000261845 | 474 |
| 427 | 3300005618 | Ga0068864_100011026 | Ga0068864_1000110265 | 474 |
| 428 | 3300005841 | Ga0068863_100068959 | Ga0068863_1000689592 | 474 |
| 429 | 3300009177 | Ga0105248_10329014 | Ga0105248_103290142 | 474 |
| 430 | 3300014325 | Ga0163163_10054955 | Ga0163163_100549552 | 474 |
| 431 | 3300025907 | Ga0207645_10132882 | Ga0207645_101328821 | 474 |
| 432 | 3300025931 | Ga0207644_10016847 | Ga0207644_100168474 | 474 |
| 433 | 3300025931 | Ga0207644_10098658 | Ga0207644_100986582 | 474 |
| 434 | 3300025931 | Ga0207644_10160184 | Ga0207644_101601842 | 474 |
| 435 | 3300025941 | Ga0207711_10005998 | Ga0207711_100059987 | 474 |
| 436 | 3300025960 | Ga0207651_10011173 | Ga0207651_100111732 | 474 |
| 437 | 3300026088 | Ga0207641_10052963 | Ga0207641_100529632 | 474 |
| 438 | 3300026095 | Ga0207676_10024910 | Ga0207676_100249102 | 474 |
| 439 | 3300027876 | Ga0209974_10000935 | Ga0209974_100009354 | 474 |
| 440 | 3300028786 | Ga0307517_10003203 | Ga0307517_1000320317 | 474 |
| 441 | 3300028786 | Ga0307517_10122409 | Ga0307517_101224091 | 474 |
| 442 | 3300031456 | Ga0307513_10007104 | Ga0307513_1000710414 | 474 |
| 443 | 3300031548 | Ga0307408_100034134 | Ga0307408_1000341342 | 474 |
| 444 | 3300031548 | Ga0307408_100064942 | Ga0307408_1000649421 | 474 |
| 445 | 3300031824 | Ga0307413_10003794 | Ga0307413_100037941 | 474 |
| 446 | 3300031824 | Ga0307413_10025760 | Ga0307413_100257602 | 474 |
| 447 | 3300031852 | Ga0307410_10002446 | Ga0307410_100024469 | 474 |
| 448 | 3300031852 | Ga0307410_10003744 | Ga0307410_100037442 | 474 |
| 449 | 3300031852 | Ga0307410_10009876 | Ga0307410_100098765 | 474 |
| 450 | 3300031852 | Ga0307410_10036364 | Ga0307410_100363642 | 474 |
| 451 | 3300031901 | Ga0307406_10007470 | Ga0307406_100074702 | 474 |
| 452 | 3300031901 | Ga0307406_10090504 | Ga0307406_100905042 | 474 |
| 453 | 3300031903 | Ga0307407_10077426 | Ga0307407_100774262 | 474 |
| 454 | 3300031911 | Ga0307412_10010645 | Ga0307412_100106454 | 474 |
| 455 | 3300031911 | Ga0307412_10023286 | Ga0307412_100232863 | 474 |
| 456 | 3300031995 | Ga0307409_100005102 | Ga0307409_1000051027 | 474 |
| 457 | 3300031995 | Ga0307409_100033235 | Ga0307409_1000332352 | 474 |
| 458 | 3300031995 | Ga0307409_100043149 | Ga0307409_1000431492 | 474 |
| 459 | 3300031995 | Ga0307409_100109535 | Ga0307409_1001095352 | 474 |
| 460 | 3300032002 | Ga0307416_100092614 | Ga0307416_1000926143 | 474 |
| 461 | 3300032002 | Ga0307416_100204353 | Ga0307416_1002043531 | 474 |
| 462 | 3300032004 | Ga0307414_10016703 | Ga0307414_100167033 | 474 |
| 463 | 3300032004 | Ga0307414_10027143 | Ga0307414_100271434 | 474 |
| 464 | 3300032004 | Ga0307414_10045572 | Ga0307414_100455723 | 474 |
| 465 | 3300032004 | Ga0307414_10070467 | Ga0307414_100704673 | 474 |
| 466 | 3300032005 | Ga0307411_10003505 | Ga0307411_1000350510 | 474 |
| 467 | 3300032005 | Ga0307411_10061254 | Ga0307411_100612541 | 474 |
| 468 | 3300032126 | Ga0307415_100070909 | Ga0307415_1000709093 | 474 |
| 469 | 3300033180 | Ga0307510_10043919 | Ga0307510_100439192 | 474 |
| 470 | 3300037418 | Ga0395900_0044693 | Ga0395900_0044693_3034_4482 | 474 |
| 471 | 3300037471 | Ga0395905_0002515 | Ga0395905_0002515_7369_8817 | 474 |
| 472 | 3300037471 | Ga0395905_0074500 | Ga0395905_0074500_642_2087 | 474 |
| 473 | 3300046525 | Ga0495663_0028431 | Ga0495663_0028431_132_1580 | 474 |
| 474 | 3300046528 | Ga0495642_0012414 | Ga0495642_0012414_1776_3224 | 474 |
| 475 | 3300046660 | Ga0495625_0046856 | Ga0495625_0046856_10_1458 | 474 |
| 476 | 3300046684 | Ga0495669_0000044 | Ga0495669_0000044_42605_44053 | 474 |
| 477 | 3300046691 | Ga0495670_0027463 | Ga0495670_0027463_342_1793 | 474 |
| 478 | 3300046691 | Ga0495670_0088067 | Ga0495670_0088067_34_1482 | 474 |
| 479 | 3300047320 | Ga0495672_0017193 | Ga0495672_0017193_1135_2583 | 474 |
| 480 | 3300047445 | Ga0495677_0009768 | Ga0495677_0009768_807_2255 | 474 |
| 481 | 3300047445 | Ga0495677_0017382 | Ga0495677_0017382_438_1886 | 474 |
| 482 | 3300047445 | Ga0495677_0020464 | Ga0495677_0020464_305_1753 | 474 |
| 483 | 3300048903 | Ga0496100_0129311 | Ga0496100_0129311_198_1646 | 474 |
| 484 | 3300048905 | Ga0496102_0095343 | Ga0496102_0095343_172_1620 | 474 |
| 485 | 3300048909 | Ga0496106_0113377 | Ga0496106_0113377_451_1899 | 474 |
| 486 | 3300048913 | Ga0496110_0036585 | Ga0496110_0036585_1568_3016 | 474 |
| 487 | 3300048915 | Ga0496112_0014185 | Ga0496112_0014185_1113_2561 | 474 |
| 488 | 3300048928 | Ga0496125_0061058 | Ga0496125_0061058_558_2003 | 474 |
| 489 | 3300049581 | Ga0501047_0054093 | Ga0501047_0054093_1184_2632 | 474 |
| 490 | 3300053108 | Ga0500562_004945 | Ga0500562_004945_1597_3078 | 474 |
| 491 | 3300053136 | Ga0500559_0017612 | Ga0500559_0017612_339_1778 | 474 |
| 492 | 3300053723 | Ga0500567_000103 | Ga0500567_000103_15422_16861 | 474 |
| 493 | 3300053729 | Ga0500625_000029 | Ga0500625_000029_9773_11212 | 474 |
| 494 | iso_pu_bacteria | 2510917021 | 2511130120 | 474 |
| 495 | iso_pu_bacteria | 2643221560 | 2643820558 | 474 |
| 496 | iso_pu_bacteria | 2643221563 | 2643836393 | 474 |
| 497 | iso_pu_bacteria | 2643221608 | 2644052869 | 474 |
| 498 | iso_pu_bacteria | 2852653556 | 2852653992 | 474 |
| 499 | iso_pu_bacteria | 2852680915 | 2852682844 | 474 |
| 500 | iso_pu_bacteria | 8054302542 | 8054304790 | 474 |
| 501 | 3300001904 | JGI24736J21556_1002453 | JGI24736J21556_10024532 | 475 |
| 502 | 3300001976 | JGI24752J21851_1001304 | JGI24752J21851_10013042 | 475 |
| 503 | 3300001989 | JGI24739J22299_10005269 | JGI24739J22299_100052695 | 475 |
| 504 | 3300001989 | JGI24739J22299_10013062 | JGI24739J22299_100130622 | 475 |
| 505 | 3300001990 | JGI24737J22298_10004210 | JGI24737J22298_100042102 | 475 |
| 506 | 3300001990 | JGI24737J22298_10020850 | JGI24737J22298_100208502 | 475 |
| 507 | 3300002067 | JGI24735J21928_10000915 | JGI24735J21928_100009153 | 475 |
| 508 | 3300002067 | JGI24735J21928_10009418 | JGI24735J21928_100094182 | 475 |
| 509 | 3300002067 | JGI24735J21928_10015221 | JGI24735J21928_100152212 | 475 |
| 510 | 3300002075 | JGI24738J21930_10000424 | JGI24738J21930_1000042411 | 475 |
| 511 | 3300002077 | JGI24744J21845_10009416 | JGI24744J21845_100094162 | 475 |
| 512 | 3300002459 | JGI24751J29686_10004618 | JGI24751J29686_100046183 | 475 |
| 513 | 3300003214 | JGI25165J46597_1000043 | JGI25165J46597_1000043195 | 475 |
| 514 | 3300005327 | Ga0070658_10000779 | Ga0070658_1000077910 | 475 |
| 515 | 3300005327 | Ga0070658_10002006 | Ga0070658_100020069 | 475 |
| 516 | 3300005327 | Ga0070658_10002716 | Ga0070658_100027162 | 475 |
| 517 | 3300005327 | Ga0070658_10006118 | Ga0070658_100061184 | 475 |
| 518 | 3300005327 | Ga0070658_10010801 | Ga0070658_100108014 | 475 |
| 519 | 3300005327 | Ga0070658_10025186 | Ga0070658_100251864 | 475 |
| 520 | 3300005327 | Ga0070658_10059045 | Ga0070658_100590453 | 475 |
| 521 | 3300005328 | Ga0070676_10026726 | Ga0070676_100267263 | 475 |
| 522 | 3300005331 | Ga0070670_100000007 | Ga0070670_100000007167 | 475 |
| 523 | 3300005331 | Ga0070670_100076000 | Ga0070670_1000760003 | 475 |
| 524 | 3300005334 | Ga0068869_100000200 | Ga0068869_1000002005 | 475 |
| 525 | 3300005334 | Ga0068869_100037418 | Ga0068869_1000374182 | 475 |
| 526 | 3300005335 | Ga0070666_10000098 | Ga0070666_1000009817 | 475 |
| 527 | 3300005335 | Ga0070666_10007850 | Ga0070666_100078507 | 475 |
| 528 | 3300005335 | Ga0070666_10013559 | Ga0070666_100135595 | 475 |
| 529 | 3300005336 | Ga0070680_100020235 | Ga0070680_1000202352 | 475 |
| 530 | 3300005338 | Ga0068868_100000049 | Ga0068868_10000004963 | 475 |
| 531 | 3300005338 | Ga0068868_100003120 | Ga0068868_1000031207 | 475 |
| 532 | 3300005338 | Ga0068868_100119874 | Ga0068868_1001198742 | 475 |
| 533 | 3300005339 | Ga0070660_100002130 | Ga0070660_10000213011 | 475 |
| 534 | 3300005339 | Ga0070660_100010609 | Ga0070660_1000106093 | 475 |
| 535 | 3300005339 | Ga0070660_100028758 | Ga0070660_1000287582 | 475 |
| 536 | 3300005339 | Ga0070660_100065253 | Ga0070660_1000652532 | 475 |
| 537 | 3300005339 | Ga0070660_100127423 | Ga0070660_1001274232 | 475 |
| 538 | 3300005341 | Ga0070691_10004611 | Ga0070691_100046112 | 475 |
| 539 | 3300005344 | Ga0070661_100068906 | Ga0070661_1000689063 | 475 |
| 540 | 3300005347 | Ga0070668_100000835 | Ga0070668_1000008353 | 475 |
| 541 | 3300005347 | Ga0070668_100006292 | Ga0070668_1000062928 | 475 |
| 542 | 3300005353 | Ga0070669_100000029 | Ga0070669_10000002991 | 475 |
| 543 | 3300005353 | Ga0070669_100000433 | Ga0070669_10000043312 | 475 |
| 544 | 3300005353 | Ga0070669_100003517 | Ga0070669_1000035174 | 475 |
| 545 | 3300005354 | Ga0070675_100013925 | Ga0070675_1000139252 | 475 |
| 546 | 3300005355 | Ga0070671_100000016 | Ga0070671_10000001665 | 475 |
| 547 | 3300005355 | Ga0070671_100000145 | Ga0070671_1000001456 | 475 |
| 548 | 3300005355 | Ga0070671_100009488 | Ga0070671_1000094887 | 475 |
| 549 | 3300005355 | Ga0070671_100019072 | Ga0070671_1000190726 | 475 |
| 550 | 3300005355 | Ga0070671_100125969 | Ga0070671_1001259692 | 475 |
| 551 | 3300005355 | Ga0070671_100141879 | Ga0070671_1001418792 | 475 |
| 552 | 3300005355 | Ga0070671_100219396 | Ga0070671_1002193961 | 475 |
| 553 | 3300005356 | Ga0070674_100017214 | Ga0070674_1000172143 | 475 |
| 554 | 3300005364 | Ga0070673_100000006 | Ga0070673_100000006145 | 475 |
| 555 | 3300005366 | Ga0070659_100001710 | Ga0070659_10000171014 | 475 |
| 556 | 3300005366 | Ga0070659_100002355 | Ga0070659_1000023559 | 475 |
| 557 | 3300005366 | Ga0070659_100126735 | Ga0070659_1001267351 | 475 |
| 558 | 3300005366 | Ga0070659_100149712 | Ga0070659_1001497122 | 475 |
| 559 | 3300005367 | Ga0070667_100000155 | Ga0070667_10000015567 | 475 |
| 560 | 3300005440 | Ga0070705_100033162 | Ga0070705_1000331622 | 475 |
| 561 | 3300005445 | Ga0070708_100043566 | Ga0070708_1000435662 | 475 |
| 562 | 3300005455 | Ga0070663_100000291 | Ga0070663_1000002916 | 475 |
| 563 | 3300005456 | Ga0070678_100022573 | Ga0070678_1000225733 | 475 |
| 564 | 3300005456 | Ga0070678_100027109 | Ga0070678_1000271094 | 475 |
| 565 | 3300005456 | Ga0070678_100088021 | Ga0070678_1000880213 | 475 |
| 566 | 3300005457 | Ga0070662_100002319 | Ga0070662_1000023192 | 475 |
| 567 | 3300005457 | Ga0070662_100012864 | Ga0070662_1000128645 | 475 |
| 568 | 3300005457 | Ga0070662_100028476 | Ga0070662_1000284764 | 475 |
| 569 | 3300005457 | Ga0070662_100055200 | Ga0070662_1000552003 | 475 |
| 570 | 3300005458 | Ga0070681_10007565 | Ga0070681_100075655 | 475 |
| 571 | 3300005458 | Ga0070681_10166681 | Ga0070681_101666812 | 475 |
| 572 | 3300005459 | Ga0068867_100000001 | Ga0068867_100000001390 | 475 |
| 573 | 3300005530 | Ga0070679_100014656 | Ga0070679_1000146565 | 475 |
| 574 | 3300005530 | Ga0070679_100023960 | Ga0070679_1000239602 | 475 |
| 575 | 3300005539 | Ga0068853_100004158 | Ga0068853_10000415810 | 475 |
| 576 | 3300005548 | Ga0070665_100002155 | Ga0070665_1000021558 | 475 |
| 577 | 3300005548 | Ga0070665_100002676 | Ga0070665_1000026768 | 475 |
| 578 | 3300005548 | Ga0070665_100005588 | Ga0070665_1000055883 | 475 |
| 579 | 3300005548 | Ga0070665_100021024 | Ga0070665_1000210247 | 475 |
| 580 | 3300005548 | Ga0070665_100055792 | Ga0070665_1000557922 | 475 |
| 581 | 3300005548 | Ga0070665_100059894 | Ga0070665_1000598944 | 475 |
| 582 | 3300005563 | Ga0068855_100000023 | Ga0068855_10000002349 | 475 |
| 583 | 3300005563 | Ga0068855_100010626 | Ga0068855_1000106266 | 475 |
| 584 | 3300005563 | Ga0068855_100115866 | Ga0068855_1001158662 | 475 |
| 585 | 3300005563 | Ga0068855_100123321 | Ga0068855_1001233213 | 475 |
| 586 | 3300005564 | Ga0070664_100015334 | Ga0070664_1000153342 | 475 |
| 587 | 3300005578 | Ga0068854_100000224 | Ga0068854_10000022430 | 475 |
| 588 | 3300005578 | Ga0068854_100067457 | Ga0068854_1000674572 | 475 |
| 589 | 3300005578 | Ga0068854_100102845 | Ga0068854_1001028452 | 475 |
| 590 | 3300005614 | Ga0068856_100149157 | Ga0068856_1001491572 | 475 |
| 591 | 3300005616 | Ga0068852_100007968 | Ga0068852_1000079683 | 475 |
| 592 | 3300005617 | Ga0068859_100003218 | Ga0068859_10000321815 | 475 |
| 593 | 3300005618 | Ga0068864_100000128 | Ga0068864_10000012838 | 475 |
| 594 | 3300005618 | Ga0068864_100030737 | Ga0068864_1000307372 | 475 |
| 595 | 3300005719 | Ga0068861_100109813 | Ga0068861_1001098132 | 475 |
| 596 | 3300005834 | Ga0068851_10005214 | Ga0068851_100052144 | 475 |
| 597 | 3300005841 | Ga0068863_100000360 | Ga0068863_10000036040 | 475 |
| 598 | 3300005841 | Ga0068863_100027645 | Ga0068863_1000276456 | 475 |
| 599 | 3300005841 | Ga0068863_100034947 | Ga0068863_1000349473 | 475 |
| 600 | 3300005841 | Ga0068863_100066924 | Ga0068863_1000669242 | 475 |
| 601 | 3300005842 | Ga0068858_100062004 | Ga0068858_1000620043 | 475 |
| 602 | 3300005843 | Ga0068860_100000047 | Ga0068860_100000047168 | 475 |
| 603 | 3300005843 | Ga0068860_100007191 | Ga0068860_1000071915 | 475 |
| 604 | 3300005844 | Ga0068862_100000606 | Ga0068862_10000060625 | 475 |
| 605 | 3300005844 | Ga0068862_100001031 | Ga0068862_10000103126 | 475 |
| 606 | 3300005981 | Ga0081538_10009804 | Ga0081538_100098044 | 475 |
| 607 | 3300005985 | Ga0081539_10007513 | Ga0081539_100075133 | 475 |
| 608 | 3300006028 | Ga0070717_10008928 | Ga0070717_100089282 | 475 |
| 609 | 3300006237 | Ga0097621_100006540 | Ga0097621_1000065405 | 475 |
| 610 | 3300006358 | Ga0068871_100024993 | Ga0068871_1000249935 | 475 |
| 611 | 3300006846 | Ga0075430_100161703 | Ga0075430_1001617031 | 475 |
| 612 | 3300006881 | Ga0068865_100000003 | Ga0068865_100000003221 | 475 |
| 613 | 3300006881 | Ga0068865_100009151 | Ga0068865_1000091512 | 475 |
| 614 | 3300006881 | Ga0068865_100048234 | Ga0068865_1000482343 | 475 |
| 615 | 3300006931 | Ga0097620_100003218 | Ga0097620_10000321815 | 475 |
| 616 | 3300009093 | Ga0105240_10111858 | Ga0105240_101118582 | 475 |
| 617 | 3300009093 | Ga0105240_10144090 | Ga0105240_101440903 | 475 |
| 618 | 3300009098 | Ga0105245_10000113 | Ga0105245_1000011373 | 475 |
| 619 | 3300009098 | Ga0105245_10013994 | Ga0105245_100139944 | 475 |
| 620 | 3300009098 | Ga0105245_10047951 | Ga0105245_100479512 | 475 |
| 621 | 3300009101 | Ga0105247_10000521 | Ga0105247_1000052114 | 475 |
| 622 | 3300009148 | Ga0105243_10000938 | Ga0105243_1000093822 | 475 |
| 623 | 3300009174 | Ga0105241_10025975 | Ga0105241_100259753 | 475 |
| 624 | 3300009176 | Ga0105242_10000165 | Ga0105242_1000016526 | 475 |
| 625 | 3300009177 | Ga0105248_10318656 | Ga0105248_103186561 | 475 |
| 626 | 3300009551 | Ga0105238_10007800 | Ga0105238_100078002 | 475 |
| 627 | 3300009553 | Ga0105249_10009549 | Ga0105249_100095498 | 475 |
| 628 | 3300009553 | Ga0105249_10034291 | Ga0105249_100342913 | 475 |
| 629 | 3300009553 | Ga0105249_10047506 | Ga0105249_100475064 | 475 |
| 630 | 3300011119 | Ga0105246_10012042 | Ga0105246_100120422 | 475 |
| 631 | 3300013100 | Ga0157373_10009105 | Ga0157373_100091053 | 475 |
| 632 | 3300013100 | Ga0157373_10058420 | Ga0157373_100584202 | 475 |
| 633 | 3300013100 | Ga0157373_10065747 | Ga0157373_100657472 | 475 |
| 634 | 3300013104 | Ga0157370_10000069 | Ga0157370_1000006987 | 475 |
| 635 | 3300013105 | Ga0157369_10191142 | Ga0157369_101911422 | 475 |
| 636 | 3300013296 | Ga0157374_10001016 | Ga0157374_100010168 | 475 |
| 637 | 3300013297 | Ga0157378_10001151 | Ga0157378_100011518 | 475 |
| 638 | 3300013297 | Ga0157378_10020678 | Ga0157378_100206783 | 475 |
| 639 | 3300013306 | Ga0163162_10003018 | Ga0163162_100030186 | 475 |
| 640 | 3300013306 | Ga0163162_10011232 | Ga0163162_100112325 | 475 |
| 641 | 3300013306 | Ga0163162_10032482 | Ga0163162_100324824 | 475 |
| 642 | 3300013307 | Ga0157372_10000605 | Ga0157372_100006056 | 475 |
| 643 | 3300013307 | Ga0157372_10019824 | Ga0157372_100198247 | 475 |
| 644 | 3300013307 | Ga0157372_10119158 | Ga0157372_101191582 | 475 |
| 645 | 3300014326 | Ga0157380_10014535 | Ga0157380_100145355 | 475 |
| 646 | 3300014968 | Ga0157379_10029120 | Ga0157379_100291203 | 475 |
| 647 | 3300014968 | Ga0157379_10223187 | Ga0157379_102231871 | 475 |
| 648 | 3300014969 | Ga0157376_10000089 | Ga0157376_1000008974 | 475 |
| 649 | 3300017792 | Ga0163161_10058287 | Ga0163161_100582872 | 475 |
| 650 | 3300021384 | Ga0213876_10000791 | Ga0213876_1000079111 | 475 |
| 651 | 3300025231 | Ga0207427_100541 | Ga0207427_1005415 | 475 |
| 652 | 3300025250 | Ga0209026_1001356 | Ga0209026_10013562 | 475 |
| 653 | 3300025254 | Ga0209148_1000238 | Ga0209148_100023887 | 475 |
| 654 | 3300025261 | Ga0209233_1000079 | Ga0209233_100007975 | 475 |
| 655 | 3300025290 | Ga0207673_1001768 | Ga0207673_10017682 | 475 |
| 656 | 3300025315 | Ga0207697_10000164 | Ga0207697_1000016429 | 475 |
| 657 | 3300025321 | Ga0207656_10018821 | Ga0207656_100188212 | 475 |
| 658 | 3300025900 | Ga0207710_10001431 | Ga0207710_100014311 | 475 |
| 659 | 3300025903 | Ga0207680_10000130 | Ga0207680_1000013020 | 475 |
| 660 | 3300025903 | Ga0207680_10003644 | Ga0207680_100036443 | 475 |
| 661 | 3300025903 | Ga0207680_10010937 | Ga0207680_100109373 | 475 |
| 662 | 3300025904 | Ga0207647_10001216 | Ga0207647_100012164 | 475 |
| 663 | 3300025904 | Ga0207647_10001683 | Ga0207647_100016839 | 475 |
| 664 | 3300025904 | Ga0207647_10004249 | Ga0207647_100042499 | 475 |
| 665 | 3300025904 | Ga0207647_10018508 | Ga0207647_100185086 | 475 |
| 666 | 3300025907 | Ga0207645_10036749 | Ga0207645_100367493 | 475 |
| 667 | 3300025907 | Ga0207645_10094666 | Ga0207645_100946661 | 475 |
| 668 | 3300025909 | Ga0207705_10000121 | Ga0207705_1000012148 | 475 |
| 669 | 3300025909 | Ga0207705_10001242 | Ga0207705_1000124216 | 475 |
| 670 | 3300025909 | Ga0207705_10001784 | Ga0207705_1000178412 | 475 |
| 671 | 3300025909 | Ga0207705_10016359 | Ga0207705_100163595 | 475 |
| 672 | 3300025909 | Ga0207705_10021229 | Ga0207705_100212293 | 475 |
| 673 | 3300025909 | Ga0207705_10038257 | Ga0207705_100382573 | 475 |
| 674 | 3300025909 | Ga0207705_10089686 | Ga0207705_100896861 | 475 |
| 675 | 3300025912 | Ga0207707_10034926 | Ga0207707_100349262 | 475 |
| 676 | 3300025913 | Ga0207695_10001288 | Ga0207695_1000128826 | 475 |
| 677 | 3300025913 | Ga0207695_10002305 | Ga0207695_1000230516 | 475 |
| 678 | 3300025913 | Ga0207695_10217672 | Ga0207695_102176722 | 475 |
| 679 | 3300025917 | Ga0207660_10000681 | Ga0207660_100006816 | 475 |
| 680 | 3300025919 | Ga0207657_10001673 | Ga0207657_1000167321 | 475 |
| 681 | 3300025919 | Ga0207657_10005111 | Ga0207657_100051112 | 475 |
| 682 | 3300025919 | Ga0207657_10006851 | Ga0207657_100068513 | 475 |
| 683 | 3300025919 | Ga0207657_10016359 | Ga0207657_100163593 | 475 |
| 684 | 3300025919 | Ga0207657_10078521 | Ga0207657_100785212 | 475 |
| 685 | 3300025919 | Ga0207657_10105585 | Ga0207657_101055852 | 475 |
| 686 | 3300025919 | Ga0207657_10127378 | Ga0207657_101273781 | 475 |
| 687 | 3300025920 | Ga0207649_10015823 | Ga0207649_100158233 | 475 |
| 688 | 3300025920 | Ga0207649_10107492 | Ga0207649_101074922 | 475 |
| 689 | 3300025921 | Ga0207652_10004669 | Ga0207652_100046697 | 475 |
| 690 | 3300025923 | Ga0207681_10000040 | Ga0207681_1000004090 | 475 |
| 691 | 3300025923 | Ga0207681_10000153 | Ga0207681_1000015321 | 475 |
| 692 | 3300025924 | Ga0207694_10015899 | Ga0207694_100158992 | 475 |
| 693 | 3300025925 | Ga0207650_10000030 | Ga0207650_10000030184 | 475 |
| 694 | 3300025925 | Ga0207650_10030386 | Ga0207650_100303865 | 475 |
| 695 | 3300025926 | Ga0207659_10010577 | Ga0207659_100105774 | 475 |
| 696 | 3300025927 | Ga0207687_10000225 | Ga0207687_1000022544 | 475 |
| 697 | 3300025927 | Ga0207687_10146661 | Ga0207687_101466612 | 475 |
| 698 | 3300025931 | Ga0207644_10000023 | Ga0207644_1000002365 | 475 |
| 699 | 3300025931 | Ga0207644_10000060 | Ga0207644_1000006038 | 475 |
| 700 | 3300025931 | Ga0207644_10000230 | Ga0207644_1000023024 | 475 |
| 701 | 3300025931 | Ga0207644_10001257 | Ga0207644_100012575 | 475 |
| 702 | 3300025931 | Ga0207644_10037750 | Ga0207644_100377502 | 475 |
| 703 | 3300025931 | Ga0207644_10093402 | Ga0207644_100934022 | 475 |
| 704 | 3300025931 | Ga0207644_10152169 | Ga0207644_101521692 | 475 |
| 705 | 3300025932 | Ga0207690_10000116 | Ga0207690_1000011652 | 475 |
| 706 | 3300025932 | Ga0207690_10005830 | Ga0207690_100058303 | 475 |
| 707 | 3300025933 | Ga0207706_10000791 | Ga0207706_1000079135 | 475 |
| 708 | 3300025933 | Ga0207706_10002854 | Ga0207706_1000285412 | 475 |
| 709 | 3300025933 | Ga0207706_10009488 | Ga0207706_1000948811 | 475 |
| 710 | 3300025933 | Ga0207706_10025811 | Ga0207706_100258115 | 475 |
| 711 | 3300025933 | Ga0207706_10034999 | Ga0207706_100349992 | 475 |
| 712 | 3300025934 | Ga0207686_10002854 | Ga0207686_100028542 | 475 |
| 713 | 3300025935 | Ga0207709_10000173 | Ga0207709_1000017370 | 475 |
| 714 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001298 | 475 |
| 715 | 3300025938 | Ga0207704_10010909 | Ga0207704_100109094 | 475 |
| 716 | 3300025940 | Ga0207691_10002685 | Ga0207691_1000268516 | 475 |
| 717 | 3300025940 | Ga0207691_10073318 | Ga0207691_100733182 | 475 |
| 718 | 3300025941 | Ga0207711_10000107 | Ga0207711_1000010770 | 475 |
| 719 | 3300025941 | Ga0207711_10000464 | Ga0207711_1000046422 | 475 |
| 720 | 3300025941 | Ga0207711_10001704 | Ga0207711_1000170415 | 475 |
| 721 | 3300025941 | Ga0207711_10006796 | Ga0207711_100067962 | 475 |
| 722 | 3300025941 | Ga0207711_10022921 | Ga0207711_100229214 | 475 |
| 723 | 3300025941 | Ga0207711_10033348 | Ga0207711_100333483 | 475 |
| 724 | 3300025941 | Ga0207711_10245817 | Ga0207711_102458171 | 475 |
| 725 | 3300025942 | Ga0207689_10000744 | Ga0207689_100007445 | 475 |
| 726 | 3300025942 | Ga0207689_10032872 | Ga0207689_100328723 | 475 |
| 727 | 3300025945 | Ga0207679_10009675 | Ga0207679_100096756 | 475 |
| 728 | 3300025949 | Ga0207667_10000016 | Ga0207667_1000001658 | 475 |
| 729 | 3300025949 | Ga0207667_10040012 | Ga0207667_100400122 | 475 |
| 730 | 3300025949 | Ga0207667_10138977 | Ga0207667_101389773 | 475 |
| 731 | 3300025960 | Ga0207651_10000002 | Ga0207651_1000000259 | 475 |
| 732 | 3300025960 | Ga0207651_10001783 | Ga0207651_100017839 | 475 |
| 733 | 3300025960 | Ga0207651_10050724 | Ga0207651_100507241 | 475 |
| 734 | 3300025961 | Ga0207712_10017704 | Ga0207712_100177043 | 475 |
| 735 | 3300025972 | Ga0207668_10000010 | Ga0207668_1000001029 | 475 |
| 736 | 3300025972 | Ga0207668_10000230 | Ga0207668_1000023026 | 475 |
| 737 | 3300025972 | Ga0207668_10000754 | Ga0207668_1000075410 | 475 |
| 738 | 3300025981 | Ga0207640_10000063 | Ga0207640_100000636 | 475 |
| 739 | 3300025981 | Ga0207640_10093007 | Ga0207640_100930071 | 475 |
| 740 | 3300025986 | Ga0207658_10000265 | Ga0207658_1000026539 | 475 |
| 741 | 3300025986 | Ga0207658_10002799 | Ga0207658_1000279912 | 475 |
| 742 | 3300025986 | Ga0207658_10024878 | Ga0207658_100248784 | 475 |
| 743 | 3300025986 | Ga0207658_10045530 | Ga0207658_100455302 | 475 |
| 744 | 3300026023 | Ga0207677_10000030 | Ga0207677_1000003078 | 475 |
| 745 | 3300026023 | Ga0207677_10002440 | Ga0207677_100024401 | 475 |
| 746 | 3300026023 | Ga0207677_10003169 | Ga0207677_100031695 | 475 |
| 747 | 3300026035 | Ga0207703_10000959 | Ga0207703_100009592 | 475 |
| 748 | 3300026035 | Ga0207703_10007167 | Ga0207703_100071678 | 475 |
| 749 | 3300026035 | Ga0207703_10013579 | Ga0207703_100135793 | 475 |
| 750 | 3300026041 | Ga0207639_10093024 | Ga0207639_100930242 | 475 |
| 751 | 3300026067 | Ga0207678_10001173 | Ga0207678_100011739 | 475 |
| 752 | 3300026067 | Ga0207678_10099449 | Ga0207678_100994491 | 475 |
| 753 | 3300026078 | Ga0207702_10005143 | Ga0207702_1000514311 | 475 |
| 754 | 3300026078 | Ga0207702_10040115 | Ga0207702_100401153 | 475 |
| 755 | 3300026088 | Ga0207641_10003106 | Ga0207641_1000310611 | 475 |
| 756 | 3300026088 | Ga0207641_10006239 | Ga0207641_100062397 | 475 |
| 757 | 3300026088 | Ga0207641_10022545 | Ga0207641_100225455 | 475 |
| 758 | 3300026089 | Ga0207648_10000001 | Ga0207648_1000000159 | 475 |
| 759 | 3300026089 | Ga0207648_10005659 | Ga0207648_1000565914 | 475 |
| 760 | 3300026095 | Ga0207676_10000183 | Ga0207676_1000018316 | 475 |
| 761 | 3300026095 | Ga0207676_10002964 | Ga0207676_100029644 | 475 |
| 762 | 3300026095 | Ga0207676_10004432 | Ga0207676_100044324 | 475 |
| 763 | 3300026118 | Ga0207675_100000582 | Ga0207675_10000058231 | 475 |
| 764 | 3300026121 | Ga0207683_10031600 | Ga0207683_100316003 | 475 |
| 765 | 3300026121 | Ga0207683_10043198 | Ga0207683_100431984 | 475 |
| 766 | 3300026142 | Ga0207698_10004991 | Ga0207698_100049913 | 475 |
| 767 | 3300027378 | Ga0209981_1000450 | Ga0209981_10004504 | 475 |
| 768 | 3300027543 | Ga0209999_1001309 | Ga0209999_10013094 | 475 |
| 769 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003901 | 475 |
| 770 | 3300028379 | Ga0268266_10000656 | Ga0268266_1000065628 | 475 |
| 771 | 3300028379 | Ga0268266_10005609 | Ga0268266_100056095 | 475 |
| 772 | 3300028379 | Ga0268266_10065129 | Ga0268266_100651292 | 475 |
| 773 | 3300028380 | Ga0268265_10000098 | Ga0268265_1000009851 | 475 |
| 774 | 3300028380 | Ga0268265_10001171 | Ga0268265_1000117116 | 475 |
| 775 | 3300028381 | Ga0268264_10000125 | Ga0268264_1000012517 | 475 |
| 776 | 3300028381 | Ga0268264_10000141 | Ga0268264_1000014189 | 475 |
| 777 | 3300028800 | Ga0265338_10103029 | Ga0265338_101030292 | 475 |
| 778 | 3300031456 | Ga0307513_10000077 | Ga0307513_1000007715 | 475 |
| 779 | 3300031456 | Ga0307513_10008325 | Ga0307513_1000832510 | 475 |
| 780 | 3300031824 | Ga0307413_10011429 | Ga0307413_100114292 | 475 |
| 781 | 3300031824 | Ga0307413_10024251 | Ga0307413_100242512 | 475 |
| 782 | 3300031852 | Ga0307410_10000171 | Ga0307410_100001717 | 475 |
| 783 | 3300031852 | Ga0307410_10125035 | Ga0307410_101250352 | 475 |
| 784 | 3300031901 | Ga0307406_10029628 | Ga0307406_100296281 | 475 |
| 785 | 3300031903 | Ga0307407_10001776 | Ga0307407_100017762 | 475 |
| 786 | 3300031995 | Ga0307409_100023720 | Ga0307409_1000237202 | 475 |
| 787 | 3300032002 | Ga0307416_100000451 | Ga0307416_10000045116 | 475 |
| 788 | 3300032004 | Ga0307414_10000914 | Ga0307414_1000091414 | 475 |
| 789 | 3300032004 | Ga0307414_10005824 | Ga0307414_100058242 | 475 |
| 790 | 3300032005 | Ga0307411_10085085 | Ga0307411_100850852 | 475 |
| 791 | 3300032005 | Ga0307411_10093961 | Ga0307411_100939612 | 475 |
| 792 | 3300032126 | Ga0307415_100091584 | Ga0307415_1000915842 | 475 |
| 793 | 3300035113 | Ga0373936_0015112 | Ga0373936_0015112_926_2377 | 475 |
| 794 | 3300035171 | Ga0373946_0035131 | Ga0373946_0035131_26_1477 | 475 |
| 795 | 3300035695 | Ga0373927_0000831 | Ga0373927_0000831_14189_15640 | 475 |
| 796 | 3300037068 | Ga0373925_0000984 | Ga0373925_0000984_16272_17723 | 475 |
| 797 | 3300037312 | Ga0395899_0000395 | Ga0395899_0000395_29486_30925 | 475 |
| 798 | 3300037312 | Ga0395899_0009522 | Ga0395899_0009522_2688_4136 | 475 |
| 799 | 3300037312 | Ga0395899_0031785 | Ga0395899_0031785_1182_2633 | 475 |
| 800 | 3300037312 | Ga0395899_0060292 | Ga0395899_0060292_488_1939 | 475 |
| 801 | 3300037312 | Ga0395899_0088690 | Ga0395899_0088690_305_1756 | 475 |
| 802 | 3300037312 | Ga0395899_0139280 | Ga0395899_0139280_14_1465 | 475 |
| 803 | 3300037312 | Ga0395899_0139426 | Ga0395899_0139426_14_1465 | 475 |
| 804 | 3300037418 | Ga0395900_0000008 | Ga0395900_0000008_46974_48422 | 475 |
| 805 | 3300037418 | Ga0395900_0049269 | Ga0395900_0049269_1695_3146 | 475 |
| 806 | 3300037418 | Ga0395900_0150494 | Ga0395900_0150494_97_1548 | 475 |
| 807 | 3300037418 | Ga0395900_0261901 | Ga0395900_0261901_14_1465 | 475 |
| 808 | 3300037466 | Ga0395898_0007219 | Ga0395898_0007219_2376_3824 | 475 |
| 809 | 3300037466 | Ga0395898_0039258 | Ga0395898_0039258_2916_4367 | 475 |
| 810 | 3300037466 | Ga0395898_0240278 | Ga0395898_0240278_263_1714 | 475 |
| 811 | 3300037471 | Ga0395905_0011963 | Ga0395905_0011963_892_2340 | 475 |
| 812 | 3300037471 | Ga0395905_0062605 | Ga0395905_0062605_1212_2663 | 475 |
| 813 | 3300037471 | Ga0395905_0074477 | Ga0395905_0074477_901_2352 | 475 |
| 814 | 3300038443 | Ga0395901_0000008 | Ga0395901_0000008_432044_433492 | 475 |
| 815 | 3300038443 | Ga0395901_0014093 | Ga0395901_0014093_4214_5665 | 475 |
| 816 | 3300038443 | Ga0395901_0119948 | Ga0395901_0119948_97_1548 | 475 |
| 817 | 3300038443 | Ga0395901_0219488 | Ga0395901_0219488_453_1919 | 475 |
| 818 | 3300038443 | Ga0395901_0271819 | Ga0395901_0271819_26_1477 | 475 |
| 819 | 3300038705 | Ga0237819_00846 | Ga0237819_00846_3976_5418 | 475 |
| 820 | 3300039437 | Ga0436365_0480987 | Ga0436365_0480987_2314_3765 | 475 |
| 821 | 3300039437 | Ga0436365_1342500 | Ga0436365_1342500_31687_33138 | 475 |
| 822 | 3300041462 | Ga0451806_680459 | Ga0451806_680459_1371_2810 | 475 |
| 823 | 3300042005 | Ga0439448_0000252 | Ga0439448_0000252_5787_7226 | 475 |
| 824 | 3300042005 | Ga0439448_0002085 | Ga0439448_0002085_977_2416 | 475 |
| 825 | 3300042012 | Ga0439455_0006627 | Ga0439455_0006627_272_1711 | 475 |
| 826 | 3300042157 | Ga0439458_0000528 | Ga0439458_0000528_2589_4028 | 475 |
| 827 | 3300042157 | Ga0439458_0000550 | Ga0439458_0000550_7458_8897 | 475 |
| 828 | 3300042157 | Ga0439458_0002113 | Ga0439458_0002113_1547_2986 | 475 |
| 829 | 3300044693 | Ga0466961_0011905 | Ga0466961_0011905_3733_5172 | 475 |
| 830 | 3300044693 | Ga0466961_0091701 | Ga0466961_0091701_401_1852 | 475 |
| 831 | 3300044719 | Ga0466971_0003958 | Ga0466971_0003958_2231_3670 | 475 |
| 832 | 3300044735 | Ga0466968_0022779 | Ga0466968_0022779_510_1949 | 475 |
| 833 | 3300044842 | Ga0466957_0033408 | Ga0466957_0033408_172_1623 | 475 |
| 834 | 3300044901 | Ga0466960_0004332 | Ga0466960_0004332_1840_3279 | 475 |
| 835 | 3300045051 | Ga0451576_0112747 | Ga0451576_0112747_1332_2780 | 475 |
| 836 | 3300045836 | Ga0466958_0070759 | Ga0466958_0070759_474_1991 | 475 |
| 837 | 3300045976 | Ga0466967_0004762 | Ga0466967_0004762_5541_6992 | 475 |
| 838 | 3300045976 | Ga0466967_0060899 | Ga0466967_0060899_127_1566 | 475 |
| 839 | 3300046499 | Ga0495594_0063695 | Ga0495594_0063695_478_1986 | 475 |
| 840 | 3300046525 | Ga0495663_0005529 | Ga0495663_0005529_870_2321 | 475 |
| 841 | 3300046539 | Ga0495621_0000349 | Ga0495621_0000349_2365_3816 | 475 |
| 842 | 3300046539 | Ga0495621_0000432 | Ga0495621_0000432_5195_6646 | 475 |
| 843 | 3300046539 | Ga0495621_0032968 | Ga0495621_0032968_244_1695 | 475 |
| 844 | 3300046691 | Ga0495670_0004421 | Ga0495670_0004421_3203_4654 | 475 |
| 845 | 3300046692 | Ga0495671_0050737 | Ga0495671_0050737_474_1928 | 475 |
| 846 | 3300048905 | Ga0496102_0018995 | Ga0496102_0018995_4327_5778 | 475 |
| 847 | 3300048905 | Ga0496102_0129581 | Ga0496102_0129581_68_1519 | 475 |
| 848 | 3300048905 | Ga0496102_0162071 | Ga0496102_0162071_40_1488 | 475 |
| 849 | 3300048906 | Ga0496103_0072439 | Ga0496103_0072439_77_1528 | 475 |
| 850 | 3300048909 | Ga0496106_0000338 | Ga0496106_0000338_18829_20343 | 475 |
| 851 | 3300048910 | Ga0496107_0015199 | Ga0496107_0015199_2386_3900 | 475 |
| 852 | 3300048911 | Ga0496108_0001094 | Ga0496108_0001094_10603_12054 | 475 |
| 853 | 3300048911 | Ga0496108_0109446 | Ga0496108_0109446_153_1604 | 475 |
| 854 | 3300048912 | Ga0496109_0108966 | Ga0496109_0108966_691_2202 | 475 |
| 855 | 3300048912 | Ga0496109_0152687 | Ga0496109_0152687_309_1760 | 475 |
| 856 | 3300048913 | Ga0496110_0000347 | Ga0496110_0000347_7259_8710 | 475 |
| 857 | 3300048914 | Ga0496111_0002388 | Ga0496111_0002388_5293_6744 | 475 |
| 858 | 3300048914 | Ga0496111_0020528 | Ga0496111_0020528_3158_4585 | 475 |
| 859 | 3300048915 | Ga0496112_0001900 | Ga0496112_0001900_10603_12054 | 475 |
| 860 | 3300048915 | Ga0496112_0004060 | Ga0496112_0004060_2060_3511 | 475 |
| 861 | 3300048915 | Ga0496112_0115844 | Ga0496112_0115844_487_1938 | 475 |
| 862 | 3300048916 | Ga0496113_0000377 | Ga0496113_0000377_18944_20455 | 475 |
| 863 | 3300048916 | Ga0496113_0001402 | Ga0496113_0001402_5284_6735 | 475 |
| 864 | 3300048918 | Ga0496115_0000954 | Ga0496115_0000954_8669_10120 | 475 |
| 865 | 3300048918 | Ga0496115_0001701 | Ga0496115_0001701_13278_14729 | 475 |
| 866 | 3300048918 | Ga0496115_0056899 | Ga0496115_0056899_954_2405 | 475 |
| 867 | 3300048920 | Ga0496117_0017388 | Ga0496117_0017388_2079_3518 | 475 |
| 868 | 3300048922 | Ga0496119_0094698 | Ga0496119_0094698_79_1518 | 475 |
| 869 | 3300048924 | Ga0496121_0012664 | Ga0496121_0012664_1895_3334 | 475 |
| 870 | 3300048925 | Ga0496122_0002582 | Ga0496122_0002582_6762_8204 | 475 |
| 871 | 3300048925 | Ga0496122_0005688 | Ga0496122_0005688_9780_11234 | 475 |
| 872 | 3300048925 | Ga0496122_0006401 | Ga0496122_0006401_6022_7461 | 475 |
| 873 | 3300048926 | Ga0496123_0000155 | Ga0496123_0000155_3550_5004 | 475 |
| 874 | 3300048926 | Ga0496123_0000577 | Ga0496123_0000577_37277_38719 | 475 |
| 875 | 3300048928 | Ga0496125_0004173 | Ga0496125_0004173_8313_9752 | 475 |
| 876 | 3300048928 | Ga0496125_0025348 | Ga0496125_0025348_1289_2737 | 475 |
| 877 | 3300049581 | Ga0501047_0002252 | Ga0501047_0002252_4345_5799 | 475 |
| 878 | 3300049663 | Ga0501223_000193 | Ga0501223_000193_13246_14763 | 475 |
| 879 | 3300049664 | Ga0501224_000015 | Ga0501224_000015_13246_14763 | 475 |
| 880 | 3300049668 | Ga0501233_001277 | Ga0501233_001277_2199_3650 | 475 |
| 881 | 3300049705 | Ga0501225_0000038 | Ga0501225_0000038_38075_39592 | 475 |
| 882 | 3300049707 | Ga0501234_000254 | Ga0501234_000254_1483_3000 | 475 |
| 883 | 3300049853 | Ga0501226_000122 | Ga0501226_000122_13246_14763 | 475 |
| 884 | 3300050491 | nmdc:mga00v17_599_c1 | nmdc:mga00v17_599_c1_3004_4455 | 475 |
| 885 | 3300050494 | nmdc:mga06z11_62412_c1 | nmdc:mga06z11_62412_c1_490_1932 | 475 |
| 886 | 3300050495 | nmdc:mga04h51_5130_c1 | nmdc:mga04h51_5130_c1_1124_2575 | 475 |
| 887 | 3300053087 | Ga0500643_001071 | Ga0500643_001071_14934_16376 | 475 |
| 888 | 3300053087 | Ga0500643_003004 | Ga0500643_003004_4633_6108 | 475 |
| 889 | 3300053087 | Ga0500643_005712 | Ga0500643_005712_3576_5024 | 475 |
| 890 | 3300053096 | Ga0500641_0003922 | Ga0500641_0003922_1144_2595 | 475 |
| 891 | 3300053103 | Ga0500555_006371 | Ga0500555_006371_1624_3075 | 475 |
| 892 | 3300053108 | Ga0500562_014739 | Ga0500562_014739_260_1711 | 475 |
| 893 | 3300053118 | Ga0500594_0003663 | Ga0500594_0003663_1731_3185 | 475 |
| 894 | 3300053130 | Ga0500642_0048665 | Ga0500642_0048665_117_1568 | 475 |
| 895 | 3300053157 | Ga0500624_000022 | Ga0500624_000022_100333_101775 | 475 |
| 896 | 3300053178 | Ga0500637_0000095 | Ga0500637_0000095_15116_16558 | 475 |
| 897 | 3300055283 | Ga0500661_002227 | Ga0500661_002227_1743_3218 | 475 |
| 898 | 3300061719 | Ga0466962_0007859 | Ga0466962_0007859_3381_4820 | 475 |
| 899 | 3300061719 | Ga0466962_0015235 | Ga0466962_0015235_254_1705 | 475 |
| 900 | 3300001904 | JGI24736J21556_1001848 | JGI24736J21556_10018483 | 476 |
| 901 | 3300001915 | JGI24741J21665_1000043 | JGI24741J21665_10000433 | 476 |
| 902 | 3300001979 | JGI24740J21852_10006172 | JGI24740J21852_100061722 | 476 |
| 903 | 3300001979 | JGI24740J21852_10008321 | JGI24740J21852_100083213 | 476 |
| 904 | 3300001989 | JGI24739J22299_10001382 | JGI24739J22299_100013826 | 476 |
| 905 | 3300001990 | JGI24737J22298_10001823 | JGI24737J22298_100018233 | 476 |
| 906 | 3300002067 | JGI24735J21928_10000642 | JGI24735J21928_100006424 | 476 |
| 907 | 3300002070 | JGI24750J21931_1000631 | JGI24750J21931_10006312 | 476 |
| 908 | 3300002074 | JGI24748J21848_1000052 | JGI24748J21848_100005259 | 476 |
| 909 | 3300002075 | JGI24738J21930_10001963 | JGI24738J21930_100019636 | 476 |
| 910 | 3300002076 | JGI24749J21850_1000531 | JGI24749J21850_10005314 | 476 |
| 911 | 3300002239 | JGI24034J26672_10000031 | JGI24034J26672_1000003135 | 476 |
| 912 | 3300002459 | JGI24751J29686_10000052 | JGI24751J29686_1000005227 | 476 |
| 913 | 3300003773 | Ga0055537_1001888 | Ga0055537_10018885 | 476 |
| 914 | 3300003790 | Ga0055528_1009909 | Ga0055528_10099094 | 476 |
| 915 | 3300005262 | Ga0065165_1006815 | Ga0065165_10068151 | 476 |
| 916 | 3300005289 | Ga0065704_10001757 | Ga0065704_100017575 | 476 |
| 917 | 3300005289 | Ga0065704_10081083 | Ga0065704_100810833 | 476 |
| 918 | 3300005295 | Ga0065707_10091947 | Ga0065707_100919474 | 476 |
| 919 | 3300005295 | Ga0065707_10097824 | Ga0065707_100978243 | 476 |
| 920 | 3300005327 | Ga0070658_10049997 | Ga0070658_100499974 | 476 |
| 921 | 3300005330 | Ga0070690_100000010 | Ga0070690_10000001070 | 476 |
| 922 | 3300005331 | Ga0070670_100000024 | Ga0070670_10000002489 | 476 |
| 923 | 3300005335 | Ga0070666_10000006 | Ga0070666_10000006267 | 476 |
| 924 | 3300005339 | Ga0070660_100039855 | Ga0070660_1000398553 | 476 |
| 925 | 3300005340 | Ga0070689_100011273 | Ga0070689_1000112734 | 476 |
| 926 | 3300005344 | Ga0070661_100000095 | Ga0070661_10000009523 | 476 |
| 927 | 3300005347 | Ga0070668_100000027 | Ga0070668_10000002733 | 476 |
| 928 | 3300005347 | Ga0070668_100016692 | Ga0070668_1000166924 | 476 |
| 929 | 3300005353 | Ga0070669_100000047 | Ga0070669_10000004793 | 476 |
| 930 | 3300005353 | Ga0070669_100000076 | Ga0070669_10000007618 | 476 |
| 931 | 3300005355 | Ga0070671_100058428 | Ga0070671_1000584283 | 476 |
| 932 | 3300005365 | Ga0070688_100002221 | Ga0070688_1000022214 | 476 |
| 933 | 3300005366 | Ga0070659_100154613 | Ga0070659_1001546131 | 476 |
| 934 | 3300005367 | Ga0070667_100000017 | Ga0070667_100000017210 | 476 |
| 935 | 3300005367 | Ga0070667_100000066 | Ga0070667_10000006695 | 476 |
| 936 | 3300005367 | Ga0070667_100000459 | Ga0070667_10000045922 | 476 |
| 937 | 3300005367 | Ga0070667_100000480 | Ga0070667_10000048014 | 476 |
| 938 | 3300005455 | Ga0070663_100050955 | Ga0070663_1000509553 | 476 |
| 939 | 3300005466 | Ga0070685_10021094 | Ga0070685_100210943 | 476 |
| 940 | 3300005544 | Ga0070686_100000042 | Ga0070686_10000004270 | 476 |
| 941 | 3300005548 | Ga0070665_100000019 | Ga0070665_10000001971 | 476 |
| 942 | 3300005548 | Ga0070665_100004060 | Ga0070665_10000406019 | 476 |
| 943 | 3300005548 | Ga0070665_100033590 | Ga0070665_1000335904 | 476 |
| 944 | 3300005577 | Ga0068857_100025477 | Ga0068857_1000254774 | 476 |
| 945 | 3300005577 | Ga0068857_100091382 | Ga0068857_1000913822 | 476 |
| 946 | 3300005578 | Ga0068854_100001591 | Ga0068854_1000015912 | 476 |
| 947 | 3300005614 | Ga0068856_100228905 | Ga0068856_1002289051 | 476 |
| 948 | 3300005616 | Ga0068852_100071029 | Ga0068852_1000710293 | 476 |
| 949 | 3300005617 | Ga0068859_100006146 | Ga0068859_1000061467 | 476 |
| 950 | 3300005617 | Ga0068859_100031085 | Ga0068859_1000310854 | 476 |
| 951 | 3300005618 | Ga0068864_100000036 | Ga0068864_10000003690 | 476 |
| 952 | 3300005618 | Ga0068864_100001646 | Ga0068864_10000164612 | 476 |
| 953 | 3300005719 | Ga0068861_100025695 | Ga0068861_1000256954 | 476 |
| 954 | 3300005719 | Ga0068861_100032053 | Ga0068861_1000320533 | 476 |
| 955 | 3300005841 | Ga0068863_100000069 | Ga0068863_100000069108 | 476 |
| 956 | 3300005841 | Ga0068863_100000603 | Ga0068863_10000060319 | 476 |
| 957 | 3300005841 | Ga0068863_100013726 | Ga0068863_1000137267 | 476 |
| 958 | 3300005842 | Ga0068858_100000103 | Ga0068858_10000010357 | 476 |
| 959 | 3300005843 | Ga0068860_100000013 | Ga0068860_100000013214 | 476 |
| 960 | 3300005843 | Ga0068860_100000014 | Ga0068860_100000014267 | 476 |
| 961 | 3300005843 | Ga0068860_100000056 | Ga0068860_10000005634 | 476 |
| 962 | 3300005844 | Ga0068862_100000033 | Ga0068862_10000003315 | 476 |
| 963 | 3300005844 | Ga0068862_100002295 | Ga0068862_10000229510 | 476 |
| 964 | 3300005844 | Ga0068862_100005376 | Ga0068862_1000053767 | 476 |
| 965 | 3300006195 | Ga0075366_10019123 | Ga0075366_100191232 | 476 |
| 966 | 3300006931 | Ga0097620_100006146 | Ga0097620_1000061465 | 476 |
| 967 | 3300006931 | Ga0097620_100031087 | Ga0097620_1000310874 | 476 |
| 968 | 3300009093 | Ga0105240_10220846 | Ga0105240_102208462 | 476 |
| 969 | 3300009174 | Ga0105241_10004099 | Ga0105241_100040993 | 476 |
| 970 | 3300009177 | Ga0105248_10008150 | Ga0105248_100081503 | 476 |
| 971 | 3300009545 | Ga0105237_10095892 | Ga0105237_100958922 | 476 |
| 972 | 3300009553 | Ga0105249_10000035 | Ga0105249_1000003565 | 476 |
| 973 | 3300009553 | Ga0105249_10122737 | Ga0105249_101227372 | 476 |
| 974 | 3300009978 | Ga0105148_100444 | Ga0105148_1004444 | 476 |
| 975 | 3300010375 | Ga0105239_10162022 | Ga0105239_101620222 | 476 |
| 976 | 3300012513 | Ga0157326_1000068 | Ga0157326_10000687 | 476 |
| 977 | 3300013100 | Ga0157373_10010652 | Ga0157373_100106523 | 476 |
| 978 | 3300013104 | Ga0157370_10107590 | Ga0157370_101075903 | 476 |
| 979 | 3300014326 | Ga0157380_10051590 | Ga0157380_100515903 | 476 |
| 980 | 3300014968 | Ga0157379_10186217 | Ga0157379_101862171 | 476 |
| 981 | 3300025223 | Ga0207672_1001086 | Ga0207672_10010862 | 476 |
| 982 | 3300025229 | Ga0209147_100321 | Ga0209147_10032112 | 476 |
| 983 | 3300025263 | Ga0209565_1000179 | Ga0209565_100017923 | 476 |
| 984 | 3300025273 | Ga0209673_1001240 | Ga0209673_100124016 | 476 |
| 985 | 3300025292 | Ga0209676_1000253 | Ga0209676_100025324 | 476 |
| 986 | 3300025295 | Ga0209564_1003913 | Ga0209564_10039135 | 476 |
| 987 | 3300025295 | Ga0209564_1023739 | Ga0209564_10237392 | 476 |
| 988 | 3300025297 | Ga0209758_1000562 | Ga0209758_100056259 | 476 |
| 989 | 3300025297 | Ga0209758_1003287 | Ga0209758_10032871 | 476 |
| 990 | 3300025298 | Ga0209050_1000649 | Ga0209050_100064929 | 476 |
| 991 | 3300025298 | Ga0209050_1002610 | Ga0209050_10026108 | 476 |
| 992 | 3300025299 | Ga0209256_1005813 | Ga0209256_10058136 | 476 |
| 993 | 3300025303 | Ga0209051_1002693 | Ga0209051_100269312 | 476 |
| 994 | 3300025304 | Ga0209257_1005712 | Ga0209257_10057121 | 476 |
| 995 | 3300025903 | Ga0207680_10000011 | Ga0207680_10000011264 | 476 |
| 996 | 3300025904 | Ga0207647_10004936 | Ga0207647_100049367 | 476 |
| 997 | 3300025904 | Ga0207647_10017008 | Ga0207647_100170083 | 476 |
| 998 | 3300025911 | Ga0207654_10008188 | Ga0207654_100081884 | 476 |
| 999 | 3300025913 | Ga0207695_10104874 | Ga0207695_101048743 | 476 |
| 1000 | 3300025914 | Ga0207671_10011321 | Ga0207671_100113211 | 476 |
| 1001 | 3300025919 | Ga0207657_10006366 | Ga0207657_1000636611 | 476 |
| 1002 | 3300025920 | Ga0207649_10000093 | Ga0207649_1000009323 | 476 |
| 1003 | 3300025923 | Ga0207681_10000014 | Ga0207681_10000014175 | 476 |
| 1004 | 3300025923 | Ga0207681_10000088 | Ga0207681_1000008816 | 476 |
| 1005 | 3300025923 | Ga0207681_10070849 | Ga0207681_100708492 | 476 |
| 1006 | 3300025924 | Ga0207694_10121220 | Ga0207694_101212202 | 476 |
| 1007 | 3300025925 | Ga0207650_10000015 | Ga0207650_10000015190 | 476 |
| 1008 | 3300025925 | Ga0207650_10008442 | Ga0207650_100084426 | 476 |
| 1009 | 3300025925 | Ga0207650_10035362 | Ga0207650_100353624 | 476 |
| 1010 | 3300025925 | Ga0207650_10060553 | Ga0207650_100605532 | 476 |
| 1011 | 3300025931 | Ga0207644_10000574 | Ga0207644_1000057412 | 476 |
| 1012 | 3300025933 | Ga0207706_10028678 | Ga0207706_100286783 | 476 |
| 1013 | 3300025933 | Ga0207706_10031534 | Ga0207706_100315344 | 476 |
| 1014 | 3300025941 | Ga0207711_10000252 | Ga0207711_1000025233 | 476 |
| 1015 | 3300025941 | Ga0207711_10013203 | Ga0207711_100132032 | 476 |
| 1016 | 3300025949 | Ga0207667_10047794 | Ga0207667_100477943 | 476 |
| 1017 | 3300025961 | Ga0207712_10000013 | Ga0207712_10000013264 | 476 |
| 1018 | 3300025961 | Ga0207712_10009432 | Ga0207712_100094324 | 476 |
| 1019 | 3300025972 | Ga0207668_10000012 | Ga0207668_1000001232 | 476 |
| 1020 | 3300025972 | Ga0207668_10007271 | Ga0207668_100072714 | 476 |
| 1021 | 3300025981 | Ga0207640_10026537 | Ga0207640_100265373 | 476 |
| 1022 | 3300025986 | Ga0207658_10000011 | Ga0207658_1000001133 | 476 |
| 1023 | 3300025986 | Ga0207658_10000132 | Ga0207658_1000013214 | 476 |
| 1024 | 3300025986 | Ga0207658_10002473 | Ga0207658_100024737 | 476 |
| 1025 | 3300025986 | Ga0207658_10006048 | Ga0207658_100060483 | 476 |
| 1026 | 3300026035 | Ga0207703_10000691 | Ga0207703_100006916 | 476 |
| 1027 | 3300026035 | Ga0207703_10129812 | Ga0207703_101298122 | 476 |
| 1028 | 3300026041 | Ga0207639_10007537 | Ga0207639_100075374 | 476 |
| 1029 | 3300026067 | Ga0207678_10000622 | Ga0207678_1000062218 | 476 |
| 1030 | 3300026078 | Ga0207702_10015232 | Ga0207702_100152323 | 476 |
| 1031 | 3300026078 | Ga0207702_10018383 | Ga0207702_100183834 | 476 |
| 1032 | 3300026088 | Ga0207641_10000112 | Ga0207641_1000011231 | 476 |
| 1033 | 3300026088 | Ga0207641_10001074 | Ga0207641_1000107410 | 476 |
| 1034 | 3300026088 | Ga0207641_10002092 | Ga0207641_1000209210 | 476 |
| 1035 | 3300026095 | Ga0207676_10000021 | Ga0207676_10000021212 | 476 |
| 1036 | 3300026095 | Ga0207676_10002294 | Ga0207676_100022946 | 476 |
| 1037 | 3300026095 | Ga0207676_10071028 | Ga0207676_100710281 | 476 |
| 1038 | 3300026095 | Ga0207676_10174334 | Ga0207676_101743341 | 476 |
| 1039 | 3300026116 | Ga0207674_10030042 | Ga0207674_100300424 | 476 |
| 1040 | 3300026118 | Ga0207675_100004785 | Ga0207675_1000047858 | 476 |
| 1041 | 3300026118 | Ga0207675_100120006 | Ga0207675_1001200062 | 476 |
| 1042 | 3300026142 | Ga0207698_10162483 | Ga0207698_101624831 | 476 |
| 1043 | 3300028379 | Ga0268266_10000025 | Ga0268266_10000025418 | 476 |
| 1044 | 3300028379 | Ga0268266_10001270 | Ga0268266_1000127040 | 476 |
| 1045 | 3300028380 | Ga0268265_10000013 | Ga0268265_10000013183 | 476 |
| 1046 | 3300028380 | Ga0268265_10000096 | Ga0268265_1000009654 | 476 |
| 1047 | 3300028380 | Ga0268265_10000958 | Ga0268265_100009587 | 476 |
| 1048 | 3300028381 | Ga0268264_10000037 | Ga0268264_10000037264 | 476 |
| 1049 | 3300028381 | Ga0268264_10000039 | Ga0268264_10000039212 | 476 |
| 1050 | 3300028381 | Ga0268264_10000089 | Ga0268264_10000089217 | 476 |
| 1051 | 3300028381 | Ga0268264_10030502 | Ga0268264_100305023 | 476 |
| 1052 | 3300031251 | Ga0265327_10009725 | Ga0265327_100097252 | 476 |
| 1053 | 3300031548 | Ga0307408_100154617 | Ga0307408_1001546172 | 476 |
| 1054 | 3300031711 | Ga0265314_10025857 | Ga0265314_100258572 | 476 |
| 1055 | 3300031731 | Ga0307405_10011985 | Ga0307405_100119854 | 476 |
| 1056 | 3300031824 | Ga0307413_10016574 | Ga0307413_100165743 | 476 |
| 1057 | 3300031824 | Ga0307413_10060505 | Ga0307413_100605052 | 476 |
| 1058 | 3300032004 | Ga0307414_10012599 | Ga0307414_100125995 | 476 |
| 1059 | 3300037466 | Ga0395898_0218803 | Ga0395898_0218803_29_1495 | 476 |
| 1060 | 3300038443 | Ga0395901_0249534 | Ga0395901_0249534_54_1520 | 476 |
| 1061 | 3300044735 | Ga0466968_0026553 | Ga0466968_0026553_154_1611 | 476 |
| 1062 | 3300046453 | Ga0495627_000158 | Ga0495627_000158_57224_58654 | 476 |
| 1063 | 3300046453 | Ga0495627_000636 | Ga0495627_000636_24074_25528 | 476 |
| 1064 | 3300046453 | Ga0495627_001522 | Ga0495627_001522_3844_5298 | 476 |
| 1065 | 3300046457 | Ga0495590_0004507 | Ga0495590_0004507_40_1494 | 476 |
| 1066 | 3300046460 | Ga0495638_0000016 | Ga0495638_0000016_2481_3932 | 476 |
| 1067 | 3300046460 | Ga0495638_0001235 | Ga0495638_0001235_18429_19883 | 476 |
| 1068 | 3300046460 | Ga0495638_0009533 | Ga0495638_0009533_4310_5764 | 476 |
| 1069 | 3300046471 | Ga0495650_0000024 | Ga0495650_0000024_84914_86368 | 476 |
| 1070 | 3300046471 | Ga0495650_0005540 | Ga0495650_0005540_1502_2932 | 476 |
| 1071 | 3300046500 | Ga0495596_0000141 | Ga0495596_0000141_36898_38334 | 476 |
| 1072 | 3300046500 | Ga0495596_0007523 | Ga0495596_0007523_1480_2910 | 476 |
| 1073 | 3300046501 | Ga0495607_0019591 | Ga0495607_0019591_129_1565 | 476 |
| 1074 | 3300046506 | Ga0495583_0000025 | Ga0495583_0000025_104517_105971 | 476 |
| 1075 | 3300046506 | Ga0495583_0011021 | Ga0495583_0011021_2354_3805 | 476 |
| 1076 | 3300046507 | Ga0495606_0006495 | Ga0495606_0006495_4227_5681 | 476 |
| 1077 | 3300046507 | Ga0495606_0061506 | Ga0495606_0061506_121_1557 | 476 |
| 1078 | 3300046512 | Ga0495610_0000020 | Ga0495610_0000020_314307_315737 | 476 |
| 1079 | 3300046512 | Ga0495610_0000071 | Ga0495610_0000071_31131_32585 | 476 |
| 1080 | 3300046512 | Ga0495610_0000478 | Ga0495610_0000478_33691_35145 | 476 |
| 1081 | 3300046512 | Ga0495610_0002395 | Ga0495610_0002395_8845_10281 | 476 |
| 1082 | 3300046513 | Ga0495616_0005214 | Ga0495616_0005214_3908_5362 | 476 |
| 1083 | 3300046513 | Ga0495616_0022892 | Ga0495616_0022892_385_1839 | 476 |
| 1084 | 3300046519 | Ga0495632_0004458 | Ga0495632_0004458_4312_5766 | 476 |
| 1085 | 3300046519 | Ga0495632_0011966 | Ga0495632_0011966_2109_3560 | 476 |
| 1086 | 3300046519 | Ga0495632_0017082 | Ga0495632_0017082_59_1489 | 476 |
| 1087 | 3300046519 | Ga0495632_0018793 | Ga0495632_0018793_1704_3140 | 476 |
| 1088 | 3300046522 | Ga0495643_0000132 | Ga0495643_0000132_101975_103405 | 476 |
| 1089 | 3300046522 | Ga0495643_0009605 | Ga0495643_0009605_1337_2773 | 476 |
| 1090 | 3300046522 | Ga0495643_0036370 | Ga0495643_0036370_359_1807 | 476 |
| 1091 | 3300046524 | Ga0495648_0000101 | Ga0495648_0000101_2227_3678 | 476 |
| 1092 | 3300046524 | Ga0495648_0000634 | Ga0495648_0000634_26112_27566 | 476 |
| 1093 | 3300046524 | Ga0495648_0012976 | Ga0495648_0012976_2766_4220 | 476 |
| 1094 | 3300046530 | Ga0495654_0000135 | Ga0495654_0000135_16587_18041 | 476 |
| 1095 | 3300046538 | Ga0495609_0005528 | Ga0495609_0005528_793_2229 | 476 |
| 1096 | 3300046542 | Ga0495597_0003528 | Ga0495597_0003528_3755_5203 | 476 |
| 1097 | 3300046660 | Ga0495625_0000676 | Ga0495625_0000676_31904_33358 | 476 |
| 1098 | 3300046660 | Ga0495625_0002176 | Ga0495625_0002176_16231_17685 | 476 |
| 1099 | 3300046660 | Ga0495625_0020518 | Ga0495625_0020518_338_1792 | 476 |
| 1100 | 3300046660 | Ga0495625_0021050 | Ga0495625_0021050_3530_4984 | 476 |
| 1101 | 3300046692 | Ga0495671_0000063 | Ga0495671_0000063_102743_104194 | 476 |
| 1102 | 3300047320 | Ga0495672_0001086 | Ga0495672_0001086_36_1490 | 476 |
| 1103 | 3300047446 | Ga0495679_004380 | Ga0495679_004380_4088_5542 | 476 |
| 1104 | 3300047469 | Ga0495673_0000170 | Ga0495673_0000170_102833_104284 | 476 |
| 1105 | 3300047469 | Ga0495673_0001300 | Ga0495673_0001300_16686_18140 | 476 |
| 1106 | 3300047470 | Ga0495681_0000008 | Ga0495681_0000008_2086_3540 | 476 |
| 1107 | 3300047470 | Ga0495681_0000094 | Ga0495681_0000094_57414_58844 | 476 |
| 1108 | 3300047472 | Ga0495686_0000201 | Ga0495686_0000201_28091_29548 | 476 |
| 1109 | 3300047472 | Ga0495686_0005965 | Ga0495686_0005965_7952_9406 | 476 |
| 1110 | 3300047472 | Ga0495686_0014688 | Ga0495686_0014688_3674_5119 | 476 |
| 1111 | 3300047472 | Ga0495686_0089886 | Ga0495686_0089886_99_1553 | 476 |
| 1112 | 3300048090 | Ga0495615_0000239 | Ga0495615_0000239_757_2193 | 476 |
| 1113 | 3300048091 | Ga0495626_0001260 | Ga0495626_0001260_4975_6405 | 476 |
| 1114 | 3300048905 | Ga0496102_0087676 | Ga0496102_0087676_1307_2761 | 476 |
| 1115 | 3300048906 | Ga0496103_0001454 | Ga0496103_0001454_619_2073 | 476 |
| 1116 | 3300048909 | Ga0496106_0017067 | Ga0496106_0017067_1877_3331 | 476 |
| 1117 | 3300048910 | Ga0496107_0000028 | Ga0496107_0000028_7499_8953 | 476 |
| 1118 | 3300048910 | Ga0496107_0031961 | Ga0496107_0031961_108_1562 | 476 |
| 1119 | 3300048911 | Ga0496108_0012717 | Ga0496108_0012717_2055_3509 | 476 |
| 1120 | 3300048913 | Ga0496110_0019550 | Ga0496110_0019550_2777_4231 | 476 |
| 1121 | 3300048918 | Ga0496115_0002063 | Ga0496115_0002063_6703_8157 | 476 |
| 1122 | 3300048919 | Ga0496116_0000028 | Ga0496116_0000028_203012_204442 | 476 |
| 1123 | 3300048919 | Ga0496116_0034323 | Ga0496116_0034323_922_2376 | 476 |
| 1124 | 3300048920 | Ga0496117_0018898 | Ga0496117_0018898_303_1757 | 476 |
| 1125 | 3300048924 | Ga0496121_0000175 | Ga0496121_0000175_2317_3771 | 476 |
| 1126 | 3300048924 | Ga0496121_0002522 | Ga0496121_0002522_12642_14072 | 476 |
| 1127 | 3300048924 | Ga0496121_0004566 | Ga0496121_0004566_9668_11098 | 476 |
| 1128 | 3300048924 | Ga0496121_0005053 | Ga0496121_0005053_11065_12519 | 476 |
| 1129 | 3300048925 | Ga0496122_0002369 | Ga0496122_0002369_15534_16964 | 476 |
| 1130 | 3300048925 | Ga0496122_0009082 | Ga0496122_0009082_9021_10457 | 476 |
| 1131 | 3300048926 | Ga0496123_0001557 | Ga0496123_0001557_24091_25521 | 476 |
| 1132 | 3300048926 | Ga0496123_0007047 | Ga0496123_0007047_9195_10631 | 476 |
| 1133 | 3300048927 | Ga0496124_0021696 | Ga0496124_0021696_1978_3432 | 476 |
| 1134 | 3300048927 | Ga0496124_0025910 | Ga0496124_0025910_698_2128 | 476 |
| 1135 | 3300048927 | Ga0496124_0028114 | Ga0496124_0028114_443_1873 | 476 |
| 1136 | 3300048928 | Ga0496125_0019436 | Ga0496125_0019436_3166_4596 | 476 |
| 1137 | 3300048928 | Ga0496125_0020409 | Ga0496125_0020409_2779_4233 | 476 |
| 1138 | 3300048928 | Ga0496125_0020819 | Ga0496125_0020819_3416_4870 | 476 |
| 1139 | 3300048928 | Ga0496125_0025844 | Ga0496125_0025844_3852_5306 | 476 |
| 1140 | 3300048928 | Ga0496125_0058805 | Ga0496125_0058805_1260_2747 | 476 |
| 1141 | 3300048929 | Ga0496126_0000079 | Ga0496126_0000079_38377_39807 | 476 |
| 1142 | 3300048929 | Ga0496126_0025071 | Ga0496126_0025071_2125_3579 | 476 |
| 1143 | 3300049459 | Ga0495678_000699 | Ga0495678_000699_10761_12215 | 476 |
| 1144 | 3300049513 | Ga0501290_000086 | Ga0501290_000086_5156_6604 | 476 |
| 1145 | 3300049515 | Ga0501292_000019 | Ga0501292_000019_48529_49977 | 476 |
| 1146 | 3300049517 | Ga0501294_000190 | Ga0501294_000190_5485_6933 | 476 |
| 1147 | 3300049523 | Ga0501300_000128 | Ga0501300_000128_3774_5222 | 476 |
| 1148 | 3300049579 | Ga0501043_0185581 | Ga0501043_0185581_76_1524 | 476 |
| 1149 | 3300049581 | Ga0501047_0003383 | Ga0501047_0003383_9223_10671 | 476 |
| 1150 | 3300049662 | Ga0501222_000788 | Ga0501222_000788_1542_2990 | 476 |
| 1151 | 3300049663 | Ga0501223_000099 | Ga0501223_000099_2126_3580 | 476 |
| 1152 | 3300049663 | Ga0501223_002457 | Ga0501223_002457_1834_3282 | 476 |
| 1153 | 3300049669 | Ga0501235_000351 | Ga0501235_000351_1928_3376 | 476 |
| 1154 | 3300049679 | Ga0501249_000162 | Ga0501249_000162_18692_20140 | 476 |
| 1155 | 3300049690 | Ga0501261_000061 | Ga0501261_000061_5681_7129 | 476 |
| 1156 | 3300049705 | Ga0501225_0000131 | Ga0501225_0000131_19475_20929 | 476 |
| 1157 | 3300049705 | Ga0501225_0002229 | Ga0501225_0002229_730_2178 | 476 |
| 1158 | 3300049775 | Ga0501279_000008 | Ga0501279_000008_78732_80180 | 476 |
| 1159 | 3300049776 | Ga0501280_000131 | Ga0501280_000131_5199_6647 | 476 |
| 1160 | 3300049777 | Ga0501281_00097 | Ga0501281_00097_5443_6891 | 476 |
| 1161 | 3300049778 | Ga0501282_000184 | Ga0501282_000184_3925_5373 | 476 |
| 1162 | 3300053086 | Ga0500578_0000159 | Ga0500578_0000159_4576_6030 | 476 |
| 1163 | 3300053087 | Ga0500643_005911 | Ga0500643_005911_1926_3380 | 476 |
| 1164 | 3300053088 | Ga0500644_0000269 | Ga0500644_0000269_16316_17770 | 476 |
| 1165 | 3300053091 | Ga0500647_0074727 | Ga0500647_0074727_107_1573 | 476 |
| 1166 | 3300053093 | Ga0500651_0011395 | Ga0500651_0011395_200_1648 | 476 |
| 1167 | 3300053104 | Ga0500556_0015464 | Ga0500556_0015464_378_1832 | 476 |
| 1168 | 3300053108 | Ga0500562_002265 | Ga0500562_002265_523_1977 | 476 |
| 1169 | 3300053111 | Ga0500572_002012 | Ga0500572_002012_1358_2824 | 476 |
| 1170 | 3300053116 | Ga0500592_000270 | Ga0500592_000270_4476_5924 | 476 |
| 1171 | 3300053118 | Ga0500594_0000312 | Ga0500594_0000312_9387_10841 | 476 |
| 1172 | 3300053122 | Ga0500608_000348 | Ga0500608_000348_62_1516 | 476 |
| 1173 | 3300053125 | Ga0500618_000570 | Ga0500618_000570_20926_22380 | 476 |
| 1174 | 3300053125 | Ga0500618_003408 | Ga0500618_003408_3334_4782 | 476 |
| 1175 | 3300053125 | Ga0500618_016467 | Ga0500618_016467_317_1747 | 476 |
| 1176 | 3300053130 | Ga0500642_0001871 | Ga0500642_0001871_3871_5319 | 476 |
| 1177 | 3300053133 | Ga0500655_001064 | Ga0500655_001064_3711_5159 | 476 |
| 1178 | 3300053136 | Ga0500559_0000147 | Ga0500559_0000147_39063_40529 | 476 |
| 1179 | 3300053138 | Ga0500564_005262 | Ga0500564_005262_3782_5236 | 476 |
| 1180 | 3300053156 | Ga0500622_0013218 | Ga0500622_0013218_2002_3450 | 476 |
| 1181 | 3300053156 | Ga0500622_0059721 | Ga0500622_0059721_478_1932 | 476 |
| 1182 | 3300053157 | Ga0500624_000024 | Ga0500624_000024_32507_33961 | 476 |
| 1183 | 3300053724 | Ga0500570_002262 | Ga0500570_002262_7889_9337 | 476 |
| 1184 | 3300053730 | Ga0500645_000996 | Ga0500645_000996_13552_15006 | 476 |
| 1185 | 3300053731 | Ga0500609_000273 | Ga0500609_000273_1458_2912 | 476 |
| 1186 | iso_pu_bacteria | 3000865235 | 3000865773 | 476 |
| 1187 | 2162886007 | SwRhRL2b_contig_1042224 | SwRhRL2b_0733.00002350 | 477 |
| 1188 | 2162886007 | SwRhRL2b_contig_1442462 | SwRhRL2b_0198.00001790 | 477 |
| 1189 | 3300003781 | Ga0055536_1000542 | Ga0055536_10005423 | 477 |
| 1190 | 3300003781 | Ga0055536_1002254 | Ga0055536_10022545 | 477 |
| 1191 | 3300003781 | Ga0055536_1013600 | Ga0055536_10136002 | 477 |
| 1192 | 3300003791 | Ga0055530_10000187 | Ga0055530_1000018734 | 477 |
| 1193 | 3300003794 | Ga0055531_10000760 | Ga0055531_1000076021 | 477 |
| 1194 | 3300003794 | Ga0055531_10005948 | Ga0055531_100059482 | 477 |
| 1195 | 3300003794 | Ga0055531_10019415 | Ga0055531_100194153 | 477 |
| 1196 | 3300005289 | Ga0065704_10070744 | Ga0065704_1007074418 | 477 |
| 1197 | 3300005289 | Ga0065704_10075395 | Ga0065704_100753956 | 477 |
| 1198 | 3300005347 | Ga0070668_100000646 | Ga0070668_1000006465 | 477 |
| 1199 | 3300005353 | Ga0070669_100001232 | Ga0070669_10000123215 | 477 |
| 1200 | 3300005367 | Ga0070667_100004083 | Ga0070667_10000408310 | 477 |
| 1201 | 3300005548 | Ga0070665_100024168 | Ga0070665_1000241683 | 477 |
| 1202 | 3300005578 | Ga0068854_100013256 | Ga0068854_1000132564 | 477 |
| 1203 | 3300005618 | Ga0068864_100005875 | Ga0068864_1000058758 | 477 |
| 1204 | 3300005841 | Ga0068863_100000063 | Ga0068863_10000006374 | 477 |
| 1205 | 3300005842 | Ga0068858_100003592 | Ga0068858_1000035928 | 477 |
| 1206 | 3300005843 | Ga0068860_100000008 | Ga0068860_100000008273 | 477 |
| 1207 | 3300005843 | Ga0068860_100107746 | Ga0068860_1001077461 | 477 |
| 1208 | 3300005844 | Ga0068862_100009581 | Ga0068862_1000095813 | 477 |
| 1209 | 3300006042 | Ga0075368_10000454 | Ga0075368_1000045411 | 477 |
| 1210 | 3300006048 | Ga0075363_100000079 | Ga0075363_1000000796 | 477 |
| 1211 | 3300006051 | Ga0075364_10017101 | Ga0075364_100171012 | 477 |
| 1212 | 3300006177 | Ga0075362_10000006 | Ga0075362_1000000642 | 477 |
| 1213 | 3300006186 | Ga0075369_10004233 | Ga0075369_100042334 | 477 |
| 1214 | 3300006186 | Ga0075369_10015793 | Ga0075369_100157933 | 477 |
| 1215 | 3300006195 | Ga0075366_10000497 | Ga0075366_100004971 | 477 |
| 1216 | 3300006353 | Ga0075370_10000005 | Ga0075370_1000000571 | 477 |
| 1217 | 3300006353 | Ga0075370_10005294 | Ga0075370_100052946 | 477 |
| 1218 | 3300006946 | Ga0079104_1009947 | Ga0079104_10099473 | 477 |
| 1219 | 3300009177 | Ga0105248_10102764 | Ga0105248_101027643 | 477 |
| 1220 | 3300025291 | Ga0209675_1000196 | Ga0209675_10001969 | 477 |
| 1221 | 3300025292 | Ga0209676_1000518 | Ga0209676_100051822 | 477 |
| 1222 | 3300025292 | Ga0209676_1000569 | Ga0209676_100056913 | 477 |
| 1223 | 3300025292 | Ga0209676_1000929 | Ga0209676_10009296 | 477 |
| 1224 | 3300025294 | Ga0209025_1006572 | Ga0209025_10065729 | 477 |
| 1225 | 3300025298 | Ga0209050_1000218 | Ga0209050_100021825 | 477 |
| 1226 | 3300025298 | Ga0209050_1012126 | Ga0209050_10121262 | 477 |
| 1227 | 3300025304 | Ga0209257_1000130 | Ga0209257_1000130133 | 477 |
| 1228 | 3300025304 | Ga0209257_1001405 | Ga0209257_10014057 | 477 |
| 1229 | 3300025304 | Ga0209257_1007291 | Ga0209257_10072913 | 477 |
| 1230 | 3300025711 | Ga0207696_1002742 | Ga0207696_10027423 | 477 |
| 1231 | 3300025923 | Ga0207681_10000259 | Ga0207681_1000025910 | 477 |
| 1232 | 3300025972 | Ga0207668_10003159 | Ga0207668_100031592 | 477 |
| 1233 | 3300025981 | Ga0207640_10009509 | Ga0207640_100095093 | 477 |
| 1234 | 3300026035 | Ga0207703_10002678 | Ga0207703_100026788 | 477 |
| 1235 | 3300026088 | Ga0207641_10000081 | Ga0207641_1000008193 | 477 |
| 1236 | 3300026095 | Ga0207676_10028473 | Ga0207676_100284733 | 477 |
| 1237 | 3300027866 | Ga0209813_10000126 | Ga0209813_1000012621 | 477 |
| 1238 | 3300027876 | Ga0209974_10022986 | Ga0209974_100229861 | 477 |
| 1239 | 3300028379 | Ga0268266_10011818 | Ga0268266_100118185 | 477 |
| 1240 | 3300028380 | Ga0268265_10006244 | Ga0268265_100062446 | 477 |
| 1241 | 3300028381 | Ga0268264_10000018 | Ga0268264_10000018261 | 477 |
| 1242 | 3300028381 | Ga0268264_10021281 | Ga0268264_100212812 | 477 |
| 1243 | 3300031616 | Ga0307508_10028051 | Ga0307508_100280512 | 477 |
| 1244 | 3300032004 | Ga0307414_10000346 | Ga0307414_100003466 | 477 |
| 1245 | 3300035242 | Ga0373962_0011746 | Ga0373962_0011746_66_1499 | 477 |
| 1246 | 3300045051 | Ga0451576_0035173 | Ga0451576_0035173_2051_3484 | 477 |
| 1247 | 3300046460 | Ga0495638_0014288 | Ga0495638_0014288_94_1527 | 477 |
| 1248 | 3300046660 | Ga0495625_0002942 | Ga0495625_0002942_9523_11004 | 477 |
| 1249 | 3300048905 | Ga0496102_0000106 | Ga0496102_0000106_66131_67594 | 477 |
| 1250 | 3300048906 | Ga0496103_0000095 | Ga0496103_0000095_36435_37898 | 477 |
| 1251 | 3300048907 | Ga0496104_0000060 | Ga0496104_0000060_21352_22815 | 477 |
| 1252 | 3300048908 | Ga0496105_0000274 | Ga0496105_0000274_15557_17020 | 477 |
| 1253 | 3300048910 | Ga0496107_0004473 | Ga0496107_0004473_383_1846 | 477 |
| 1254 | 3300048916 | Ga0496113_0003962 | Ga0496113_0003962_3977_5440 | 477 |
| 1255 | 3300048918 | Ga0496115_0039667 | Ga0496115_0039667_1271_2734 | 477 |
| 1256 | 3300048920 | Ga0496117_0000366 | Ga0496117_0000366_53381_54844 | 477 |
| 1257 | 3300048921 | Ga0496118_0003332 | Ga0496118_0003332_1219_2682 | 477 |
| 1258 | 3300048921 | Ga0496118_0037076 | Ga0496118_0037076_861_2306 | 477 |
| 1259 | 3300048922 | Ga0496119_0001213 | Ga0496119_0001213_13563_15026 | 477 |
| 1260 | 3300048923 | Ga0496120_0001109 | Ga0496120_0001109_16573_18036 | 477 |
| 1261 | 3300048924 | Ga0496121_0000509 | Ga0496121_0000509_9577_11022 | 477 |
| 1262 | 3300048924 | Ga0496121_0013959 | Ga0496121_0013959_2118_3581 | 477 |
| 1263 | 3300048925 | Ga0496122_0004287 | Ga0496122_0004287_12159_13622 | 477 |
| 1264 | 3300048926 | Ga0496123_0010484 | Ga0496123_0010484_2138_3601 | 477 |
| 1265 | 3300048927 | Ga0496124_0001819 | Ga0496124_0001819_20893_22356 | 477 |
| 1266 | 3300048928 | Ga0496125_0159591 | Ga0496125_0159591_26_1507 | 477 |
| 1267 | 3300048929 | Ga0496126_0000294 | Ga0496126_0000294_54562_56025 | 477 |
| 1268 | 3300049523 | Ga0501300_001748 | Ga0501300_001748_1519_3003 | 477 |
| 1269 | 3300049823 | Ga0501044_0011325 | Ga0501044_0011325_3191_4624 | 477 |
| 1270 | 3300050489 | nmdc:mga03683_3_c1 | nmdc:mga03683_3_c1_94741_96174 | 477 |
| 1271 | 3300050489 | nmdc:mga03683_6910_c1 | nmdc:mga03683_6910_c1_2309_3742 | 477 |
| 1272 | 3300050490 | nmdc:mga03n38_715_c1 | nmdc:mga03n38_715_c1_6069_7502 | 477 |
| 1273 | 3300050491 | nmdc:mga00v17_1761_c1 | nmdc:mga00v17_1761_c1_9388_10821 | 477 |
| 1274 | 3300050492 | nmdc:mga0yw44_71676_c1 | nmdc:mga0yw44_71676_c1_525_1958 | 477 |
| 1275 | 3300050493 | nmdc:mga0k408_20_c1 | nmdc:mga0k408_20_c1_37882_39315 | 477 |
| 1276 | 3300050493 | nmdc:mga0k408_4871_c1 | nmdc:mga0k408_4871_c1_4423_5856 | 477 |
| 1277 | 3300050493 | nmdc:mga0k408_72823_c1 | nmdc:mga0k408_72823_c1_25_1458 | 477 |
| 1278 | 3300050494 | nmdc:mga06z11_6034_c1 | nmdc:mga06z11_6034_c1_1310_2743 | 477 |
| 1279 | 3300050494 | nmdc:mga06z11_761_c1 | nmdc:mga06z11_761_c1_1353_2786 | 477 |
| 1280 | 3300050495 | nmdc:mga04h51_118_c1 | nmdc:mga04h51_118_c1_17515_18948 | 477 |
| 1281 | 3300050496 | nmdc:mga07m45_1_c1 | nmdc:mga07m45_1_c1_349584_351017 | 477 |
| 1282 | 3300050496 | nmdc:mga07m45_711_c1 | nmdc:mga07m45_711_c1_8144_9577 | 477 |
| 1283 | 3300050516 | nmdc:mga0sz30_39184_c1 | nmdc:mga0sz30_39184_c1_25_1458 | 477 |
| 1284 | 3300053121 | Ga0500607_001726 | Ga0500607_001726_9003_10436 | 477 |
| 1285 | 3300053121 | Ga0500607_002875 | Ga0500607_002875_5367_6800 | 477 |
| 1286 | 3300053136 | Ga0500559_0002377 | Ga0500559_0002377_7505_8938 | 477 |
| 1287 | 3300053156 | Ga0500622_0002660 | Ga0500622_0002660_472_1905 | 477 |
| 1288 | 3300053158 | Ga0500627_0000101 | Ga0500627_0000101_921_2405 | 477 |
| 1289 | 3300053178 | Ga0500637_0001187 | Ga0500637_0001187_398_1831 | 477 |
| 1290 | 3300053730 | Ga0500645_003145 | Ga0500645_003145_1095_2528 | 477 |
| 1291 | 3300053730 | Ga0500645_007126 | Ga0500645_007126_1771_3204 | 477 |
| 1292 | iso_pu_bacteria | 2738541275 | 2738712572 | 477 |
| 1293 | iso_pu_bacteria | 2738541301 | 2738850996 | 477 |
| 1294 | iso_pu_bacteria | 2738541304 | 2738866726 | 477 |
| 1295 | iso_pu_bacteria | 2738543022 | 2739299243 | 477 |
| 1296 | iso_pu_bacteria | 2738543033 | 2739360922 | 477 |
| 1297 | iso_pu_bacteria | 2928100450 | 2928103880 | 477 |
| 1298 | iso_pu_bacteria | 2928959182 | 2928961809 | 477 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t8s-assembly1.cif.gz_C | crystal structure of e.coli amp nucleosidase complexed with formicin 5'-monophosphate | 0.9064 | 2 | 477 |
| 1t8s-assembly1.cif.gz_C | crystal structure of e.coli amp nucleosidase complexed with formicin 5'-monophosphate | 0.9044 | 2 | 477 |
| 1t8y-assembly1.cif.gz_E | crystal structure of e.coli amp nucleosidase complexed with phosphate | 0.9004 | 2 | 477 |
| 1t8s-assembly1.cif.gz_B | crystal structure of e.coli amp nucleosidase complexed with formicin 5'-monophosphate | 0.8989 | 2 | 477 |
| 1t8y-assembly1.cif.gz_E | crystal structure of e.coli amp nucleosidase complexed with phosphate | 0.8987 | 2 | 477 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t8sB01 | Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain | 0.9301 | 2 | 142 | 3.30.1730.10 |
| af_P0AE12_1_172_3.30.1730.10 | Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain | 0.9269 | 2 | 167 | 3.30.1730.10 |
| 2guwB01 | Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain | 0.9207 | 2 | 144 | 3.30.1730.10 |
| 2guwB01 | Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain | 0.9066 | 2 | 144 | 3.30.1730.10 |
| 1t8sB01 | Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain | 0.8917 | 2 | 142 | 3.30.1730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350KUJ2-F1-model_v4 | deleted | 0.9678 | 1 | 308 |
|
| AF-J8VP58-F1-model_v4 | deleted | 0.9635 | 4 | 149 |
|
| AF-A0A3M3A0N2-F1-model_v4 | AMP nucleosidase | 0.9611 | 3 | 124 |
GO:0003824
GO:0009116 |
| AF-A0A6N3UG82-F1-model_v4 | deleted | 0.9593 | 14 | 124 |
|
| AF-A0A520JI55-F1-model_v4 | AMP nucleosidase (EC 3.2.2.4) | 0.9578 | 1 | 109 |
GO:0008714
GO:0009116 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar