F492714

General Info

Members Datasets Scaffolds Average Seq Length
1298 485 1229 482

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10000521|Ga0105247_1000052114
Length 527
Sequence LKLFHRISENLRNREGLHAGPCKAKETAGRPRAISSGGRLAYHGLMIIGSGAAAAEALTSLYTASVDSLKCAIRDHASGKPPGQDQASAKAFVYPEIAITYHGSQETPRTRRSFARLSRPGRYVTTVTRPDIFGDYLAEQIDLLIADYGVTVEIGPSEEPIPFPYVLDGFDMHSLDTVAVSELAAHFAGTDLAVLGDEIADGLFLSGPDGDRPLALFDGPRTDFSLARLRHYTGTPAEHVQRYILFTNYHRYVDEFVAWACAQLQTPGSRYDALSGAGDVYVTRDTADADRMIADSAWRKHQMPAYHLMAPDRRGISLVNIGVGPSNAKTICDHLAVLRPEAWLIIGHCAGLRPSQKIGDYVLAHAYLRDDHILDDVLPPEIPIPAIAEVQVAMARAAELVLGGDTPEFKRRLRTGTVVTTADRNWELHYSKSALRFSQSRAVAIDMESATIAAQGYRFRVPYGTLLCVSDKPLHGELKLPGQANRFYEEAIARHLRIGIETCELLRDEGERLHSRKLRAFNEPPFR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
5 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
6 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
7 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
8 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
9 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
10 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
11 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
12 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
13 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
14 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
15 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
16 2643221584 Caulobacter sp. Root656 Isolate Unclassified
17 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
18 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
19 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
20 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
21 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
22 2643221640 Caulobacter sp. Root342 Isolate Unclassified
23 2643221642 Caulobacter sp. Root343 Isolate Unclassified
24 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
25 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
26 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
27 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
28 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
29 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
30 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
31 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
32 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
33 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
34 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
35 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
36 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
37 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
38 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
39 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
40 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
41 2818991435 Caulobacter henricii 536 Isolate Unclassified
42 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
43 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
44 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
45 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
46 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
47 2849560528 Caulobacter zeae 410 Isolate Unclassified
48 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
49 2851153111 Caulobacter radicis 736 Isolate Unclassified
50 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
51 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
52 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
53 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
54 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
55 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
56 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
57 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
58 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
59 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
60 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
61 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
62 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
63 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
64 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
65 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
66 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
67 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
68 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
69 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
70 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
71 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
72 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
73 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
74 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
75 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
76 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
77 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
78 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
79 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
80 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
81 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
82 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
83 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
84 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
85 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
86 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
87 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
88 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
89 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
90 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
91 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
92 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
93 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
94 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
98 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
99 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
100 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
101 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
102 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
103 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
104 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
105 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
106 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
107 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
108 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
109 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
110 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
111 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
115 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
116 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
117 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
118 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
119 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
120 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
121 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
122 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
129 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
130 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
134 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
135 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
136 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
137 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
138 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
139 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
140 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
143 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
144 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
145 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
146 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
147 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
148 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
149 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
150 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
151 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
152 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
155 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
156 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
157 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
158 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
160 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
161 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
162 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
163 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
164 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
165 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
166 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
167 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
170 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
179 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
180 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
181 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
182 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
183 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
184 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
185 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
186 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
193 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
194 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
195 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
199 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
200 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
201 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
202 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
205 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
209 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
214 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
273 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
278 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
279 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
280 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
283 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
284 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
285 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
286 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
287 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
288 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
289 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
290 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
291 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
292 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
293 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
294 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
295 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
296 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
308 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
309 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
310 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
311 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
312 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
313 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
314 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
315 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
316 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
317 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
318 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
319 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
320 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
321 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
322 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
325 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
326 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
327 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
332 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
333 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
334 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
335 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
336 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
337 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
338 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
339 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
340 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
341 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
342 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
343 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
344 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
345 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
346 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
347 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
348 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
349 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
350 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
353 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
363 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
370 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
376 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
404 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
405 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
406 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
407 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
408 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
416 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
419 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
420 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
421 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
422 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
423 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
424 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
425 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
426 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
427 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
430 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
431 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
432 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
433 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
436 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
437 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
440 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
441 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
442 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
443 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
446 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
447 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
448 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
449 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
450 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
451 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
452 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
453 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
454 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
455 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
456 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
457 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
458 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
459 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
460 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
461 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
462 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
463 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
464 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
465 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
466 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
467 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
470 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
471 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
472 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
473 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
474 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
475 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
476 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
477 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
478 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
479 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
480 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
481 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
485 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.68
Metatranscriptomes 0
Isolates 5.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 14.56
Nodule 0.08
Rhizoplane 3.93
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1042224 2162886007 Bacteria 2268
2 SwRhRL2b_contig_1442462 2162886007 Bacteria 3064
3 JGI24736J21556_1001848 3300001904 Bacteria 3779
4 JGI24736J21556_1002453 3300001904 Bacteria 3280
5 JGI24741J21665_1000043 3300001915 Bacteria 30255
6 JGI24752J21851_1001304 3300001976 Bacteria 3379
7 JGI24740J21852_10006172 3300001979 Bacteria 4994
8 JGI24740J21852_10008136 3300001979 Bacteria 4205
9 JGI24740J21852_10008321 3300001979 Bacteria 4140
10 JGI24739J22299_10001382 3300001989 Bacteria 9114
11 JGI24739J22299_10005269 3300001989 Bacteria 4927
12 JGI24739J22299_10007274 3300001989 Bacteria 4159
13 JGI24739J22299_10013062 3300001989 Bacteria 3038
14 JGI24737J22298_10001823 3300001990 Bacteria 7628
15 JGI24737J22298_10004210 3300001990 Bacteria 5030
16 JGI24737J22298_10004820 3300001990 Bacteria 4686
17 JGI24737J22298_10020850 3300001990 Bacteria 2089
18 JGI24735J21928_10000642 3300002067 Bacteria 12313
19 JGI24735J21928_10000915 3300002067 Bacteria 10535
20 JGI24735J21928_10009418 3300002067 Bacteria 3136
21 JGI24735J21928_10015221 3300002067 Bacteria 2402
22 JGI24750J21931_1000631 3300002070 Bacteria 5290
23 JGI24748J21848_1000052 3300002074 Bacteria 50713
24 JGI24738J21930_10000424 3300002075 Bacteria 11883
25 JGI24738J21930_10001963 3300002075 Bacteria 5540
26 JGI24738J21930_10002973 3300002075 Bacteria 4330
27 JGI24749J21850_1000531 3300002076 Bacteria 5590
28 JGI24744J21845_10009416 3300002077 Bacteria 2003
29 JGI24034J26672_10000031 3300002239 Bacteria 93812
30 JGI24751J29686_10000052 3300002459 Bacteria 65492
31 JGI24751J29686_10004618 3300002459 Bacteria 2797
32 JGI25150J39212_1000046 3300002774 Bacteria 78180
33 JGI25165J46597_1000043 3300003214 Bacteria 264515
34 JGI25165J46597_1000073 3300003214 Bacteria 192140
35 JGI25153J46596_10000006 3300003215 Bacteria 447760
36 JGI25153J46596_10000124 3300003215 Bacteria 86430
37 Ga0055525_1000090 3300003759 Bacteria 141071
38 Ga0055542_1000046 3300003762 Bacteria 201922
39 Ga0055529_1000007 3300003763 Bacteria 403604
40 Ga0055529_1000109 3300003763 Bacteria 121019
41 Ga0055526_1006062 3300003771 Bacteria 6689
42 Ga0055537_1001888 3300003773 Bacteria 7521
43 Ga0055536_1000542 3300003781 Bacteria 25852
44 Ga0055536_1002254 3300003781 Bacteria 10976
45 Ga0055536_1013600 3300003781 Bacteria 2920
46 Ga0055528_1009909 3300003790 Bacteria 3933
47 Ga0055530_10000187 3300003791 Bacteria 55610
48 Ga0055530_10002060 3300003791 Bacteria 13517
49 Ga0055530_10018279 3300003791 Bacteria 2167
50 Ga0055531_10000008 3300003794 Bacteria 222269
51 Ga0055531_10000760 3300003794 Bacteria 27012
52 Ga0055531_10003005 3300003794 Bacteria 10952
53 Ga0055531_10005948 3300003794 Bacteria 7012
54 Ga0055531_10012125 3300003794 Bacteria 4082
55 Ga0055531_10019415 3300003794 Bacteria 2749
56 Ga0065165_1001443 3300005262 Bacteria 25758
57 Ga0065165_1001513 3300005262 Bacteria 24537
58 Ga0065165_1004716 3300005262 Bacteria 8188
59 Ga0065165_1006815 3300005262 Bacteria 5828
60 Ga0065704_10001757 3300005289 Bacteria 9465
61 Ga0065704_10070744 3300005289 Bacteria 16791
62 Ga0065704_10075395 3300005289 Bacteria 5604
63 Ga0065704_10081083 3300005289 Bacteria 3823
64 Ga0065715_10097503 3300005293 Bacteria 3695
65 Ga0065707_10091947 3300005295 Bacteria 3854
66 Ga0065707_10097824 3300005295 Bacteria 3137
67 Ga0070658_10000124 3300005327 Bacteria 68224
68 Ga0070658_10000227 3300005327 Bacteria 50101
69 Ga0070658_10000779 3300005327 Bacteria 27389
70 Ga0070658_10002006 3300005327 Bacteria 17101
71 Ga0070658_10002716 3300005327 Bacteria 14716
72 Ga0070658_10006118 3300005327 Bacteria 9760
73 Ga0070658_10010801 3300005327 Bacteria 7320
74 Ga0070658_10025186 3300005327 Bacteria 4768
75 Ga0070658_10032583 3300005327 Bacteria 4190
76 Ga0070658_10039940 3300005327 Bacteria 3786
77 Ga0070658_10049997 3300005327 Bacteria 3388
78 Ga0070658_10059045 3300005327 Bacteria 3123
79 Ga0070658_10072459 3300005327 Bacteria 2823
80 Ga0070676_10026726 3300005328 Bacteria 3268
81 Ga0070683_100179416 3300005329 Bacteria 2010
82 Ga0070690_100000010 3300005330 Bacteria 103492
83 Ga0070670_100000007 3300005331 Bacteria 318672
84 Ga0070670_100000024 3300005331 Bacteria 189811
85 Ga0070670_100076000 3300005331 Bacteria 2886
86 Ga0068869_100000200 3300005334 Bacteria 31213
87 Ga0068869_100037418 3300005334 Bacteria 3450
88 Ga0068869_100192549 3300005334 Bacteria 1604
89 Ga0070666_10000006 3300005335 Bacteria 319173
90 Ga0070666_10000098 3300005335 Bacteria 59878
91 Ga0070666_10007850 3300005335 Bacteria 6592
92 Ga0070666_10013559 3300005335 Bacteria 5175
93 Ga0070666_10014711 3300005335 Bacteria 4984
94 Ga0070680_100020235 3300005336 Bacteria 5281
95 Ga0068868_100000049 3300005338 Bacteria 67274
96 Ga0068868_100003120 3300005338 Bacteria 11534
97 Ga0068868_100119874 3300005338 Bacteria 2145
98 Ga0070660_100002130 3300005339 Bacteria 13657
99 Ga0070660_100010609 3300005339 Bacteria 6512
100 Ga0070660_100028758 3300005339 Bacteria 4161
101 Ga0070660_100039855 3300005339 Bacteria 3571
102 Ga0070660_100041808 3300005339 Bacteria 3495
103 Ga0070660_100065253 3300005339 Bacteria 2833
104 Ga0070660_100127423 3300005339 Bacteria 2035
105 Ga0070689_100011273 3300005340 Bacteria 6400
106 Ga0070691_10004611 3300005341 Bacteria 6262
107 Ga0070661_100000095 3300005344 Bacteria 72935
108 Ga0070661_100002364 3300005344 Bacteria 12951
109 Ga0070661_100068906 3300005344 Bacteria 2600
110 Ga0070668_100000027 3300005347 Bacteria 89913
111 Ga0070668_100000646 3300005347 Bacteria 23522
112 Ga0070668_100000835 3300005347 Bacteria 21310
113 Ga0070668_100006292 3300005347 Bacteria 8789
114 Ga0070668_100016692 3300005347 Bacteria 5487
115 Ga0070668_100019269 3300005347 Bacteria 5135
116 Ga0070668_100041954 3300005347 Bacteria 3506
117 Ga0070669_100000029 3300005353 Bacteria 163005
118 Ga0070669_100000047 3300005353 Bacteria 118892
119 Ga0070669_100000076 3300005353 Bacteria 97334
120 Ga0070669_100000433 3300005353 Bacteria 31979
121 Ga0070669_100001232 3300005353 Bacteria 18563
122 Ga0070669_100002305 3300005353 Bacteria 13824
123 Ga0070669_100003517 3300005353 Bacteria 11299
124 Ga0070675_100013925 3300005354 Bacteria 6330
125 Ga0070671_100000016 3300005355 Bacteria 156166
126 Ga0070671_100000145 3300005355 Bacteria 46029
127 Ga0070671_100009488 3300005355 Bacteria 7811
128 Ga0070671_100016202 3300005355 Bacteria 6028
129 Ga0070671_100018377 3300005355 Bacteria 5678
130 Ga0070671_100019072 3300005355 Bacteria 5579
131 Ga0070671_100058428 3300005355 Bacteria 3211
132 Ga0070671_100125969 3300005355 Bacteria 2156
133 Ga0070671_100141879 3300005355 Bacteria 2027
134 Ga0070671_100219396 3300005355 Bacteria 1613
135 Ga0070674_100017214 3300005356 Bacteria 4542
136 Ga0070673_100000006 3300005364 Bacteria 184299
137 Ga0070673_100092613 3300005364 Bacteria 2473
138 Ga0070673_100146105 3300005364 Bacteria 1999
139 Ga0070688_100002221 3300005365 Bacteria 9797
140 Ga0070659_100001710 3300005366 Bacteria 15785
141 Ga0070659_100002355 3300005366 Bacteria 13434
142 Ga0070659_100015944 3300005366 Bacteria 5635
143 Ga0070659_100050460 3300005366 Bacteria 3271
144 Ga0070659_100070320 3300005366 Bacteria 2780
145 Ga0070659_100126735 3300005366 Bacteria 2071
146 Ga0070659_100149712 3300005366 Bacteria 1903
147 Ga0070659_100154613 3300005366 Bacteria 1872
148 Ga0070667_100000017 3300005367 Bacteria 230531
149 Ga0070667_100000066 3300005367 Bacteria 134529
150 Ga0070667_100000067 3300005367 Bacteria 133023
151 Ga0070667_100000155 3300005367 Bacteria 85527
152 Ga0070667_100000459 3300005367 Bacteria 41954
153 Ga0070667_100000480 3300005367 Bacteria 40910
154 Ga0070667_100004083 3300005367 Bacteria 12350
155 Ga0070667_100045508 3300005367 Bacteria 3690
156 Ga0070705_100033162 3300005440 Bacteria 2875
157 Ga0070708_100043566 3300005445 Bacteria 3943
158 Ga0070663_100000291 3300005455 Bacteria 25597
159 Ga0070663_100050955 3300005455 Bacteria 2946
160 Ga0070663_100084044 3300005455 Bacteria 2345
161 Ga0070678_100000076 3300005456 Bacteria 37213
162 Ga0070678_100022573 3300005456 Bacteria 4174
163 Ga0070678_100027109 3300005456 Bacteria 3885
164 Ga0070678_100088021 3300005456 Bacteria 2373
165 Ga0070662_100002319 3300005457 Bacteria 11690
166 Ga0070662_100006034 3300005457 Bacteria 7776
167 Ga0070662_100012864 3300005457 Bacteria 5559
168 Ga0070662_100028476 3300005457 Bacteria 3887
169 Ga0070662_100055200 3300005457 Bacteria 2881
170 Ga0070662_100107667 3300005457 Bacteria 2119
171 Ga0070662_100131020 3300005457 Bacteria 1933
172 Ga0070681_10007565 3300005458 Bacteria 10617
173 Ga0070681_10019939 3300005458 Bacteria 6717
174 Ga0070681_10166681 3300005458 Bacteria 2126
175 Ga0068867_100000001 3300005459 Bacteria 427563
176 Ga0070685_10021094 3300005466 Bacteria 3537
177 Ga0070679_100014656 3300005530 Bacteria 7534
178 Ga0070679_100023960 3300005530 Bacteria 5981
179 Ga0070684_100123426 3300005535 Bacteria 2331
180 Ga0068853_100004158 3300005539 Bacteria 11155
181 Ga0070686_100000042 3300005544 Bacteria 103828
182 Ga0070665_100000019 3300005548 Bacteria 413972
183 Ga0070665_100000086 3300005548 Bacteria 178229
184 Ga0070665_100002155 3300005548 Bacteria 21958
185 Ga0070665_100002676 3300005548 Bacteria 19370
186 Ga0070665_100004060 3300005548 Bacteria 15401
187 Ga0070665_100005588 3300005548 Bacteria 12931
188 Ga0070665_100021024 3300005548 Bacteria 6560
189 Ga0070665_100024168 3300005548 Bacteria 6120
190 Ga0070665_100026184 3300005548 Bacteria 5873
191 Ga0070665_100033590 3300005548 Bacteria 5162
192 Ga0070665_100055792 3300005548 Bacteria 3962
193 Ga0070665_100059894 3300005548 Bacteria 3816
194 Ga0070665_100068272 3300005548 Bacteria 3565
195 Ga0068855_100000023 3300005563 Bacteria 190440
196 Ga0068855_100010626 3300005563 Bacteria 11098
197 Ga0068855_100085239 3300005563 Bacteria 3656
198 Ga0068855_100115866 3300005563 Bacteria 3071
199 Ga0068855_100123321 3300005563 Bacteria 2964
200 Ga0068855_100205581 3300005563 Bacteria 2215
201 Ga0070664_100015334 3300005564 Bacteria 6266
202 Ga0070664_100077301 3300005564 Bacteria 2862
203 Ga0068857_100006583 3300005577 Bacteria 9973
204 Ga0068857_100025477 3300005577 Bacteria 5208
205 Ga0068857_100091382 3300005577 Bacteria 2725
206 Ga0068854_100000224 3300005578 Bacteria 38449
207 Ga0068854_100001591 3300005578 Bacteria 13812
208 Ga0068854_100013256 3300005578 Bacteria 5404
209 Ga0068854_100039985 3300005578 Bacteria 3306
210 Ga0068854_100067457 3300005578 Bacteria 2606
211 Ga0068854_100102845 3300005578 Bacteria 2144
212 Ga0068856_100026950 3300005614 Bacteria 5606
213 Ga0068856_100149157 3300005614 Bacteria 2347
214 Ga0068856_100228905 3300005614 Bacteria 1874
215 Ga0068852_100000996 3300005616 Bacteria 18697
216 Ga0068852_100001336 3300005616 Bacteria 16535
217 Ga0068852_100003424 3300005616 Bacteria 11081
218 Ga0068852_100007968 3300005616 Bacteria 7767
219 Ga0068852_100010220 3300005616 Bacteria 6996
220 Ga0068852_100071029 3300005616 Bacteria 3056
221 Ga0068859_100001618 3300005617 Bacteria 23030
222 Ga0068859_100003218 3300005617 Bacteria 16624
223 Ga0068859_100004889 3300005617 Bacteria 13646
224 Ga0068859_100006146 3300005617 Bacteria 12204
225 Ga0068859_100031085 3300005617 Bacteria 5360
226 Ga0068864_100000036 3300005618 Bacteria 189811
227 Ga0068864_100000128 3300005618 Bacteria 73813
228 Ga0068864_100001646 3300005618 Bacteria 18401
229 Ga0068864_100005875 3300005618 Bacteria 10056
230 Ga0068864_100011026 3300005618 Bacteria 7471
231 Ga0068864_100022005 3300005618 Bacteria 5344
232 Ga0068864_100030737 3300005618 Bacteria 4554
233 Ga0068864_100030978 3300005618 Bacteria 4536
234 Ga0068861_100000005 3300005719 Bacteria 101677
235 Ga0068861_100025695 3300005719 Bacteria 4274
236 Ga0068861_100032053 3300005719 Bacteria 3866
237 Ga0068861_100109813 3300005719 Bacteria 2208
238 Ga0068851_10005214 3300005834 Bacteria 5897
239 Ga0068863_100000038 3300005841 Bacteria 161477
240 Ga0068863_100000063 3300005841 Bacteria 118269
241 Ga0068863_100000069 3300005841 Bacteria 116525
242 Ga0068863_100000360 3300005841 Bacteria 46300
243 Ga0068863_100000603 3300005841 Bacteria 36544
244 Ga0068863_100013726 3300005841 Bacteria 7809
245 Ga0068863_100015575 3300005841 Bacteria 7306
246 Ga0068863_100027645 3300005841 Bacteria 5412
247 Ga0068863_100034947 3300005841 Bacteria 4787
248 Ga0068863_100066924 3300005841 Bacteria 3398
249 Ga0068863_100068959 3300005841 Bacteria 3345
250 Ga0068858_100000103 3300005842 Bacteria 88754
251 Ga0068858_100000777 3300005842 Bacteria 33348
252 Ga0068858_100003592 3300005842 Bacteria 15350
253 Ga0068858_100023998 3300005842 Bacteria 5682
254 Ga0068858_100030505 3300005842 Bacteria 5006
255 Ga0068858_100031104 3300005842 Bacteria 4957
256 Ga0068858_100062004 3300005842 Bacteria 3457
257 Ga0068860_100000008 3300005843 Bacteria 427367
258 Ga0068860_100000013 3300005843 Bacteria 323055
259 Ga0068860_100000014 3300005843 Bacteria 319437
260 Ga0068860_100000047 3300005843 Bacteria 213287
261 Ga0068860_100000056 3300005843 Bacteria 202751
262 Ga0068860_100004284 3300005843 Bacteria 14590
263 Ga0068860_100007191 3300005843 Bacteria 11131
264 Ga0068860_100107746 3300005843 Bacteria 2663
265 Ga0068862_100000033 3300005844 Bacteria 176515
266 Ga0068862_100000485 3300005844 Bacteria 42458
267 Ga0068862_100000606 3300005844 Bacteria 37254
268 Ga0068862_100001031 3300005844 Bacteria 26791
269 Ga0068862_100002295 3300005844 Bacteria 17093
270 Ga0068862_100005376 3300005844 Bacteria 10718
271 Ga0068862_100009581 3300005844 Bacteria 8007
272 Ga0081538_10009804 3300005981 Bacteria 7925
273 Ga0081539_10007513 3300005985 Bacteria 9896
274 Ga0070717_10008928 3300006028 Bacteria 7511
275 Ga0075368_10000454 3300006042 Bacteria 12096
276 Ga0075368_10000704 3300006042 Bacteria 10189
277 Ga0075368_10004849 3300006042 Bacteria 4586
278 Ga0075363_100000079 3300006048 Bacteria 20652
279 Ga0075364_10000499 3300006051 Bacteria 19964
280 Ga0075364_10017101 3300006051 Bacteria 4525
281 Ga0075362_10000006 3300006177 Bacteria 123313
282 Ga0075367_10000042 3300006178 Bacteria 28460
283 Ga0075369_10004233 3300006186 Bacteria 5287
284 Ga0075369_10015793 3300006186 Bacteria 3036
285 Ga0075366_10000497 3300006195 Bacteria 18210
286 Ga0075366_10019123 3300006195 Bacteria 3958
287 Ga0097621_100006540 3300006237 Bacteria 8279
288 Ga0075370_10000005 3300006353 Bacteria 112202
289 Ga0075370_10005294 3300006353 Bacteria 6391
290 Ga0075370_10040975 3300006353 Bacteria 2614
291 Ga0075370_10042569 3300006353 Bacteria 2565
292 Ga0068871_100024993 3300006358 Bacteria 4641
293 Ga0075430_100161703 3300006846 Bacteria 1864
294 Ga0068865_100000003 3300006881 Bacteria 231761
295 Ga0068865_100009151 3300006881 Bacteria 6129
296 Ga0068865_100048234 3300006881 Bacteria 2930
297 Ga0097620_100001618 3300006931 Bacteria 23030
298 Ga0097620_100003218 3300006931 Bacteria 16624
299 Ga0097620_100006146 3300006931 Bacteria 12204
300 Ga0097620_100031087 3300006931 Bacteria 5360
301 Ga0079104_1009947 3300006946 Bacteria 3175
302 Ga0105240_10008624 3300009093 Bacteria 14565
303 Ga0105240_10012012 3300009093 Bacteria 12003
304 Ga0105240_10111858 3300009093 Bacteria 3302
305 Ga0105240_10144090 3300009093 Bacteria 2845
306 Ga0105240_10220846 3300009093 Bacteria 2208
307 Ga0105245_10000113 3300009098 Bacteria 78545
308 Ga0105245_10002260 3300009098 Bacteria 17440
309 Ga0105245_10013994 3300009098 Bacteria 6988
310 Ga0105245_10047951 3300009098 Bacteria 3820
311 Ga0105247_10000521 3300009101 Bacteria 31494
312 Ga0105243_10000224 3300009148 Bacteria 65196
313 Ga0105243_10000938 3300009148 Bacteria 27317
314 Ga0105241_10004099 3300009174 Bacteria 10761
315 Ga0105241_10025975 3300009174 Bacteria 4355
316 Ga0105242_10000165 3300009176 Bacteria 49974
317 Ga0105248_10000091 3300009177 Bacteria 101191
318 Ga0105248_10003098 3300009177 Bacteria 18437
319 Ga0105248_10008150 3300009177 Bacteria 11507
320 Ga0105248_10010014 3300009177 Bacteria 10436
321 Ga0105248_10102764 3300009177 Bacteria 3221
322 Ga0105248_10318656 3300009177 Bacteria 1751
323 Ga0105248_10329014 3300009177 Bacteria 1721
324 Ga0105237_10095892 3300009545 Bacteria 2956
325 Ga0105238_10007800 3300009551 Bacteria 10707
326 Ga0105238_10020144 3300009551 Bacteria 6788
327 Ga0105238_10054955 3300009551 Bacteria 3998
328 Ga0105249_10000035 3300009553 Bacteria 201325
329 Ga0105249_10000567 3300009553 Bacteria 33975
330 Ga0105249_10001611 3300009553 Bacteria 19752
331 Ga0105249_10009549 3300009553 Bacteria 8500
332 Ga0105249_10034291 3300009553 Bacteria 4599
333 Ga0105249_10047506 3300009553 Bacteria 3912
334 Ga0105249_10122737 3300009553 Bacteria 2471
335 Ga0105148_100444 3300009978 Bacteria 3979
336 Ga0105239_10144329 3300010375 Bacteria 2654
337 Ga0105239_10162022 3300010375 Bacteria 2499
338 Ga0105246_10012042 3300011119 Bacteria 5388
339 Ga0105246_10039544 3300011119 Bacteria 3178
340 Ga0157326_1000068 3300012513 Bacteria 10055
341 Ga0157373_10009105 3300013100 Bacteria 7344
342 Ga0157373_10010652 3300013100 Bacteria 6767
343 Ga0157373_10026321 3300013100 Bacteria 4202
344 Ga0157373_10058420 3300013100 Bacteria 2735
345 Ga0157373_10065747 3300013100 Bacteria 2566
346 Ga0157371_10000097 3300013102 Bacteria 134150
347 Ga0157371_10012865 3300013102 Bacteria 6372
348 Ga0157371_10040150 3300013102 Bacteria 3345
349 Ga0157370_10000069 3300013104 Bacteria 112889
350 Ga0157370_10060808 3300013104 Bacteria 3585
351 Ga0157370_10107590 3300013104 Bacteria 2608
352 Ga0157369_10191142 3300013105 Bacteria 2151
353 Ga0157369_10332956 3300013105 Bacteria 1577
354 Ga0157374_10001016 3300013296 Bacteria 24345
355 Ga0157374_10112266 3300013296 Bacteria 2622
356 Ga0157378_10001151 3300013297 Bacteria 24035
357 Ga0157378_10008397 3300013297 Bacteria 8997
358 Ga0157378_10020678 3300013297 Bacteria 5789
359 Ga0157378_10062593 3300013297 Bacteria 3323
360 Ga0163162_10003018 3300013306 Bacteria 16081
361 Ga0163162_10011232 3300013306 Bacteria 8731
362 Ga0163162_10032482 3300013306 Bacteria 5185
363 Ga0157372_10000605 3300013307 Bacteria 39162
364 Ga0157372_10006096 3300013307 Bacteria 12807
365 Ga0157372_10019824 3300013307 Bacteria 7247
366 Ga0157372_10119158 3300013307 Bacteria 3029
367 Ga0163163_10000123 3300014325 Bacteria 82366
368 Ga0163163_10054955 3300014325 Bacteria 3935
369 Ga0157380_10000217 3300014326 Bacteria 34251
370 Ga0157380_10014535 3300014326 Bacteria 5760
371 Ga0157380_10051590 3300014326 Bacteria 3254
372 Ga0157377_10087013 3300014745 Bacteria 1838
373 Ga0157379_10003874 3300014968 Bacteria 12752
374 Ga0157379_10029120 3300014968 Bacteria 4911
375 Ga0157379_10186217 3300014968 Bacteria 1876
376 Ga0157379_10223187 3300014968 Bacteria 1707
377 Ga0157376_10000089 3300014969 Bacteria 69351
378 Ga0183363_1001 3300015690 Bacteria 611534
379 Ga0163161_10058287 3300017792 Bacteria 2807
380 Ga0213876_10000791 3300021384 Bacteria 21470
381 Ga0207672_1001086 3300025223 Bacteria 2482
382 Ga0209147_100321 3300025229 Bacteria 36587
383 Ga0209563_100111 3300025230 Bacteria 141123
384 Ga0207427_100541 3300025231 Bacteria 19607
385 Ga0207425_1000020 3300025245 Bacteria 372623
386 Ga0209646_1007217 3300025246 Bacteria 1824
387 Ga0209026_1001356 3300025250 Bacteria 10921
388 Ga0209677_109735 3300025253 Bacteria 1685
389 Ga0209148_1000026 3300025254 Bacteria 629213
390 Ga0209148_1000238 3300025254 Bacteria 87836
391 Ga0209233_1000079 3300025261 Bacteria 346944
392 Ga0209233_1000142 3300025261 Bacteria 192193
393 Ga0209565_1000179 3300025263 Bacteria 79300
394 Ga0209565_1000210 3300025263 Bacteria 67800
395 Ga0209455_1000005 3300025272 Bacteria 1416756
396 Ga0209673_1001240 3300025273 Bacteria 26584
397 Ga0209673_1007764 3300025273 Bacteria 4876
398 Ga0207673_1001768 3300025290 Bacteria 2398
399 Ga0209675_1000196 3300025291 Bacteria 65422
400 Ga0209676_1000253 3300025292 Bacteria 113412
401 Ga0209676_1000518 3300025292 Bacteria 60512
402 Ga0209676_1000569 3300025292 Bacteria 55557
403 Ga0209676_1000929 3300025292 Bacteria 36184
404 Ga0209676_1002091 3300025292 Bacteria 15424
405 Ga0209676_1016025 3300025292 Bacteria 2729
406 Ga0209025_1000326 3300025294 Bacteria 106087
407 Ga0209025_1006572 3300025294 Bacteria 8964
408 Ga0209564_1001114 3300025295 Bacteria 31654
409 Ga0209564_1003913 3300025295 Bacteria 9537
410 Ga0209564_1015718 3300025295 Bacteria 3060
411 Ga0209564_1023739 3300025295 Bacteria 2119
412 Ga0209758_1000001 3300025297 Bacteria 1981790
413 Ga0209758_1000004 3300025297 Bacteria 1375322
414 Ga0209758_1000562 3300025297 Bacteria 58446
415 Ga0209758_1000894 3300025297 Bacteria 40579
416 Ga0209758_1003287 3300025297 Bacteria 14980
417 Ga0209050_1000001 3300025298 Bacteria 3563507
418 Ga0209050_1000026 3300025298 Bacteria 499134
419 Ga0209050_1000173 3300025298 Bacteria 149800
420 Ga0209050_1000218 3300025298 Bacteria 128776
421 Ga0209050_1000649 3300025298 Bacteria 53856
422 Ga0209050_1001834 3300025298 Bacteria 20662
423 Ga0209050_1002610 3300025298 Bacteria 14895
424 Ga0209050_1012126 3300025298 Bacteria 3993
425 Ga0209256_1005813 3300025299 Bacteria 6875
426 Ga0209051_1000476 3300025303 Bacteria 51944
427 Ga0209051_1002693 3300025303 Bacteria 12365
428 Ga0209257_1000009 3300025304 Bacteria 1205047
429 Ga0209257_1000130 3300025304 Bacteria 212188
430 Ga0209257_1000196 3300025304 Bacteria 149656
431 Ga0209257_1001405 3300025304 Bacteria 28723
432 Ga0209257_1002800 3300025304 Bacteria 16403
433 Ga0209257_1002949 3300025304 Bacteria 15613
434 Ga0209257_1005712 3300025304 Bacteria 8542
435 Ga0209257_1007291 3300025304 Bacteria 6733
436 Ga0207697_10000164 3300025315 Bacteria 33417
437 Ga0207656_10018821 3300025321 Bacteria 2723
438 Ga0207696_1002742 3300025711 Bacteria 8384
439 Ga0207710_10001431 3300025900 Bacteria 11928
440 Ga0207680_10000011 3300025903 Bacteria 391225
441 Ga0207680_10000130 3300025903 Bacteria 35102
442 Ga0207680_10002989 3300025903 Bacteria 7926
443 Ga0207680_10003644 3300025903 Bacteria 7242
444 Ga0207680_10010937 3300025903 Bacteria 4562
445 Ga0207647_10000832 3300025904 Bacteria 23993
446 Ga0207647_10001216 3300025904 Bacteria 19802
447 Ga0207647_10001683 3300025904 Bacteria 17030
448 Ga0207647_10004249 3300025904 Bacteria 10616
449 Ga0207647_10004936 3300025904 Bacteria 9836
450 Ga0207647_10015278 3300025904 Bacteria 5269
451 Ga0207647_10017008 3300025904 Bacteria 4951
452 Ga0207647_10018508 3300025904 Bacteria 4708
453 Ga0207647_10041598 3300025904 Bacteria 2888
454 Ga0207645_10036749 3300025907 Bacteria 3145
455 Ga0207645_10094666 3300025907 Bacteria 1923
456 Ga0207645_10132882 3300025907 Bacteria 1620
457 Ga0207705_10000009 3300025909 Bacteria 576128
458 Ga0207705_10000121 3300025909 Bacteria 86649
459 Ga0207705_10000450 3300025909 Bacteria 35404
460 Ga0207705_10001242 3300025909 Bacteria 20522
461 Ga0207705_10001784 3300025909 Bacteria 16963
462 Ga0207705_10016359 3300025909 Bacteria 5319
463 Ga0207705_10021229 3300025909 Bacteria 4632
464 Ga0207705_10038257 3300025909 Bacteria 3434
465 Ga0207705_10061213 3300025909 Bacteria 2719
466 Ga0207705_10089686 3300025909 Bacteria 2250
467 Ga0207654_10004079 3300025911 Bacteria 7359
468 Ga0207654_10008188 3300025911 Bacteria 5272
469 Ga0207707_10034926 3300025912 Bacteria 4397
470 Ga0207695_10001288 3300025913 Bacteria 42577
471 Ga0207695_10002305 3300025913 Bacteria 28454
472 Ga0207695_10008440 3300025913 Bacteria 12898
473 Ga0207695_10015037 3300025913 Bacteria 9132
474 Ga0207695_10104874 3300025913 Bacteria 2815
475 Ga0207695_10217672 3300025913 Bacteria 1818
476 Ga0207671_10011321 3300025914 Bacteria 7269
477 Ga0207671_10012661 3300025914 Bacteria 6770
478 Ga0207660_10000681 3300025917 Bacteria 22727
479 Ga0207660_10025154 3300025917 Bacteria 4039
480 Ga0207657_10001673 3300025919 Bacteria 23919
481 Ga0207657_10005111 3300025919 Bacteria 13744
482 Ga0207657_10006366 3300025919 Bacteria 12264
483 Ga0207657_10006851 3300025919 Bacteria 11753
484 Ga0207657_10009905 3300025919 Bacteria 9540
485 Ga0207657_10016359 3300025919 Bacteria 7156
486 Ga0207657_10078521 3300025919 Bacteria 2779
487 Ga0207657_10105585 3300025919 Bacteria 2331
488 Ga0207657_10127378 3300025919 Bacteria 2090
489 Ga0207649_10000093 3300025920 Bacteria 74490
490 Ga0207649_10002255 3300025920 Bacteria 10883
491 Ga0207649_10015823 3300025920 Bacteria 4240
492 Ga0207649_10017766 3300025920 Bacteria 4033
493 Ga0207649_10107492 3300025920 Bacteria 1858
494 Ga0207652_10004669 3300025921 Bacteria 11109
495 Ga0207681_10000014 3300025923 Bacteria 353422
496 Ga0207681_10000040 3300025923 Bacteria 147547
497 Ga0207681_10000088 3300025923 Bacteria 80059
498 Ga0207681_10000153 3300025923 Bacteria 57579
499 Ga0207681_10000259 3300025923 Bacteria 40452
500 Ga0207681_10001688 3300025923 Bacteria 14203
501 Ga0207681_10070849 3300025923 Bacteria 2429
502 Ga0207694_10000776 3300025924 Bacteria 28653
503 Ga0207694_10015899 3300025924 Bacteria 5677
504 Ga0207694_10047916 3300025924 Bacteria 3305
505 Ga0207694_10121220 3300025924 Bacteria 2088
506 Ga0207650_10000015 3300025925 Bacteria 369173
507 Ga0207650_10000030 3300025925 Bacteria 235824
508 Ga0207650_10008442 3300025925 Bacteria 7032
509 Ga0207650_10030386 3300025925 Bacteria 3891
510 Ga0207650_10035362 3300025925 Bacteria 3626
511 Ga0207650_10060553 3300025925 Bacteria 2825
512 Ga0207659_10010577 3300025926 Bacteria 5801
513 Ga0207687_10000225 3300025927 Bacteria 38523
514 Ga0207687_10001763 3300025927 Bacteria 14882
515 Ga0207687_10146661 3300025927 Bacteria 1796
516 Ga0207664_10151664 3300025929 Bacteria 1969
517 Ga0207644_10000023 3300025931 Bacteria 156180
518 Ga0207644_10000060 3300025931 Bacteria 79209
519 Ga0207644_10000230 3300025931 Bacteria 38307
520 Ga0207644_10000574 3300025931 Bacteria 23595
521 Ga0207644_10001257 3300025931 Bacteria 16312
522 Ga0207644_10004362 3300025931 Bacteria 9175
523 Ga0207644_10010449 3300025931 Bacteria 6118
524 Ga0207644_10016847 3300025931 Bacteria 4923
525 Ga0207644_10037750 3300025931 Bacteria 3400
526 Ga0207644_10072793 3300025931 Bacteria 2518
527 Ga0207644_10093402 3300025931 Bacteria 2246
528 Ga0207644_10098658 3300025931 Bacteria 2190
529 Ga0207644_10152169 3300025931 Bacteria 1791
530 Ga0207644_10160184 3300025931 Bacteria 1749
531 Ga0207690_10000116 3300025932 Bacteria 65776
532 Ga0207690_10005830 3300025932 Bacteria 7286
533 Ga0207690_10035337 3300025932 Bacteria 3227
534 Ga0207706_10000791 3300025933 Bacteria 32709
535 Ga0207706_10002854 3300025933 Bacteria 16774
536 Ga0207706_10009488 3300025933 Bacteria 8937
537 Ga0207706_10011772 3300025933 Bacteria 7966
538 Ga0207706_10022097 3300025933 Bacteria 5709
539 Ga0207706_10025811 3300025933 Bacteria 5263
540 Ga0207706_10028678 3300025933 Bacteria 4969
541 Ga0207706_10031534 3300025933 Bacteria 4721
542 Ga0207706_10034999 3300025933 Bacteria 4467
543 Ga0207686_10002854 3300025934 Bacteria 9320
544 Ga0207709_10000173 3300025935 Bacteria 86350
545 Ga0207709_10000519 3300025935 Bacteria 33581
546 Ga0207669_10000161 3300025937 Bacteria 32114
547 Ga0207704_10000001 3300025938 Bacteria 716296
548 Ga0207704_10010909 3300025938 Bacteria 4454
549 Ga0207691_10002685 3300025940 Bacteria 17397
550 Ga0207691_10073318 3300025940 Bacteria 3087
551 Ga0207691_10150950 3300025940 Bacteria 2043
552 Ga0207711_10000107 3300025941 Bacteria 87146
553 Ga0207711_10000252 3300025941 Bacteria 57840
554 Ga0207711_10000464 3300025941 Bacteria 42035
555 Ga0207711_10001704 3300025941 Bacteria 20237
556 Ga0207711_10003251 3300025941 Bacteria 14161
557 Ga0207711_10005998 3300025941 Bacteria 10272
558 Ga0207711_10006796 3300025941 Bacteria 9613
559 Ga0207711_10013203 3300025941 Bacteria 6860
560 Ga0207711_10022921 3300025941 Bacteria 5226
561 Ga0207711_10033348 3300025941 Bacteria 4356
562 Ga0207711_10102334 3300025941 Bacteria 2535
563 Ga0207711_10245817 3300025941 Bacteria 1641
564 Ga0207689_10000744 3300025942 Bacteria 31242
565 Ga0207689_10032872 3300025942 Bacteria 4312
566 Ga0207661_10089743 3300025944 Bacteria 2558
567 Ga0207679_10009675 3300025945 Bacteria 6179
568 Ga0207679_10070227 3300025945 Bacteria 2638
569 Ga0207667_10000010 3300025949 Bacteria 477432
570 Ga0207667_10000016 3300025949 Bacteria 391466
571 Ga0207667_10003106 3300025949 Bacteria 20551
572 Ga0207667_10032150 3300025949 Bacteria 5657
573 Ga0207667_10040012 3300025949 Bacteria 4991
574 Ga0207667_10047794 3300025949 Bacteria 4527
575 Ga0207667_10122692 3300025949 Bacteria 2677
576 Ga0207667_10138977 3300025949 Bacteria 2501
577 Ga0207667_10162948 3300025949 Bacteria 2293
578 Ga0207651_10000002 3300025960 Bacteria 427663
579 Ga0207651_10001783 3300025960 Bacteria 9995
580 Ga0207651_10011173 3300025960 Bacteria 5013
581 Ga0207651_10050724 3300025960 Bacteria 2819
582 Ga0207712_10000008 3300025961 Bacteria 527957
583 Ga0207712_10000013 3300025961 Bacteria 391208
584 Ga0207712_10009432 3300025961 Bacteria 6175
585 Ga0207712_10017704 3300025961 Bacteria 4631
586 Ga0207668_10000010 3300025972 Bacteria 185249
587 Ga0207668_10000012 3300025972 Bacteria 182541
588 Ga0207668_10000230 3300025972 Bacteria 37555
589 Ga0207668_10000629 3300025972 Bacteria 21816
590 Ga0207668_10000754 3300025972 Bacteria 19803
591 Ga0207668_10003159 3300025972 Bacteria 9645
592 Ga0207668_10007271 3300025972 Bacteria 6574
593 Ga0207668_10053205 3300025972 Bacteria 2804
594 Ga0207640_10000063 3300025981 Bacteria 87065
595 Ga0207640_10008882 3300025981 Bacteria 5598
596 Ga0207640_10009509 3300025981 Bacteria 5445
597 Ga0207640_10026537 3300025981 Bacteria 3518
598 Ga0207640_10093007 3300025981 Bacteria 2094
599 Ga0207658_10000011 3300025986 Bacteria 239620
600 Ga0207658_10000089 3300025986 Bacteria 100308
601 Ga0207658_10000132 3300025986 Bacteria 80078
602 Ga0207658_10000265 3300025986 Bacteria 55108
603 Ga0207658_10000291 3300025986 Bacteria 52585
604 Ga0207658_10002473 3300025986 Bacteria 13492
605 Ga0207658_10002799 3300025986 Bacteria 12544
606 Ga0207658_10006048 3300025986 Bacteria 8262
607 Ga0207658_10024878 3300025986 Bacteria 4188
608 Ga0207658_10045530 3300025986 Bacteria 3199
609 Ga0207658_10082985 3300025986 Bacteria 2462
610 Ga0207677_10000030 3300026023 Bacteria 120692
611 Ga0207677_10002440 3300026023 Bacteria 9762
612 Ga0207677_10003169 3300026023 Bacteria 8684
613 Ga0207703_10000691 3300026035 Bacteria 33391
614 Ga0207703_10000959 3300026035 Bacteria 27891
615 Ga0207703_10001013 3300026035 Bacteria 27010
616 Ga0207703_10002678 3300026035 Bacteria 15293
617 Ga0207703_10007167 3300026035 Bacteria 8871
618 Ga0207703_10013579 3300026035 Bacteria 6346
619 Ga0207703_10015240 3300026035 Bacteria 5997
620 Ga0207703_10024463 3300026035 Bacteria 4751
621 Ga0207703_10129812 3300026035 Bacteria 2175
622 Ga0207639_10000554 3300026041 Bacteria 25675
623 Ga0207639_10007537 3300026041 Bacteria 7421
624 Ga0207639_10093024 3300026041 Bacteria 2417
625 Ga0207678_10000622 3300026067 Bacteria 32445
626 Ga0207678_10001173 3300026067 Bacteria 23989
627 Ga0207678_10099449 3300026067 Bacteria 2484
628 Ga0207678_10175246 3300026067 Bacteria 1831
629 Ga0207702_10005143 3300026078 Bacteria 11511
630 Ga0207702_10014674 3300026078 Bacteria 6501
631 Ga0207702_10015232 3300026078 Bacteria 6375
632 Ga0207702_10018383 3300026078 Bacteria 5784
633 Ga0207702_10040115 3300026078 Bacteria 3924
634 Ga0207641_10000060 3300026088 Bacteria 161514
635 Ga0207641_10000081 3300026088 Bacteria 139770
636 Ga0207641_10000112 3300026088 Bacteria 120365
637 Ga0207641_10001074 3300026088 Bacteria 27484
638 Ga0207641_10002092 3300026088 Bacteria 18889
639 Ga0207641_10003106 3300026088 Bacteria 14934
640 Ga0207641_10006239 3300026088 Bacteria 10085
641 Ga0207641_10022545 3300026088 Bacteria 5182
642 Ga0207641_10052963 3300026088 Bacteria 3438
643 Ga0207648_10000001 3300026089 Bacteria 427499
644 Ga0207648_10005659 3300026089 Bacteria 12549
645 Ga0207676_10000021 3300026095 Bacteria 296572
646 Ga0207676_10000183 3300026095 Bacteria 55220
647 Ga0207676_10002294 3300026095 Bacteria 13722
648 Ga0207676_10002964 3300026095 Bacteria 12109
649 Ga0207676_10004432 3300026095 Bacteria 9925
650 Ga0207676_10024910 3300026095 Bacteria 4434
651 Ga0207676_10028473 3300026095 Bacteria 4173
652 Ga0207676_10071028 3300026095 Bacteria 2793
653 Ga0207676_10174334 3300026095 Bacteria 1877
654 Ga0207674_10009434 3300026116 Bacteria 11149
655 Ga0207674_10030042 3300026116 Bacteria 5717
656 Ga0207675_100000020 3300026118 Bacteria 117374
657 Ga0207675_100000582 3300026118 Bacteria 35705
658 Ga0207675_100004785 3300026118 Bacteria 13038
659 Ga0207675_100120006 3300026118 Bacteria 2487
660 Ga0207683_10000655 3300026121 Bacteria 31727
661 Ga0207683_10031600 3300026121 Bacteria 4594
662 Ga0207683_10043198 3300026121 Bacteria 3938
663 Ga0207698_10000111 3300026142 Bacteria 50675
664 Ga0207698_10000901 3300026142 Bacteria 17299
665 Ga0207698_10004991 3300026142 Bacteria 8136
666 Ga0207698_10079100 3300026142 Bacteria 2643
667 Ga0207698_10162483 3300026142 Bacteria 1955
668 Ga0209981_1000450 3300027378 Bacteria 5205
669 Ga0209999_1001309 3300027543 Bacteria 4268
670 Ga0209813_10000042 3300027866 Bacteria 53213
671 Ga0209813_10000126 3300027866 Bacteria 27944
672 Ga0209974_10000935 3300027876 Bacteria 10190
673 Ga0209974_10022986 3300027876 Bacteria 2064
674 Ga0268266_10000002 3300028379 Bacteria 3059047
675 Ga0268266_10000003 3300028379 Bacteria 1701703
676 Ga0268266_10000025 3300028379 Bacteria 477143
677 Ga0268266_10000656 3300028379 Bacteria 46813
678 Ga0268266_10001270 3300028379 Bacteria 30813
679 Ga0268266_10005609 3300028379 Bacteria 11655
680 Ga0268266_10008036 3300028379 Bacteria 9426
681 Ga0268266_10011818 3300028379 Bacteria 7568
682 Ga0268266_10065129 3300028379 Bacteria 3150
683 Ga0268266_10187890 3300028379 Bacteria 1885
684 Ga0268265_10000013 3300028380 Bacteria 341536
685 Ga0268265_10000082 3300028380 Bacteria 120835
686 Ga0268265_10000096 3300028380 Bacteria 111507
687 Ga0268265_10000098 3300028380 Bacteria 110108
688 Ga0268265_10000958 3300028380 Bacteria 26520
689 Ga0268265_10001171 3300028380 Bacteria 22981
690 Ga0268265_10006244 3300028380 Bacteria 8075
691 Ga0268264_10000018 3300028381 Bacteria 495324
692 Ga0268264_10000037 3300028381 Bacteria 391116
693 Ga0268264_10000039 3300028381 Bacteria 376641
694 Ga0268264_10000089 3300028381 Bacteria 234760
695 Ga0268264_10000125 3300028381 Bacteria 186416
696 Ga0268264_10000141 3300028381 Bacteria 170966
697 Ga0268264_10000933 3300028381 Bacteria 30321
698 Ga0268264_10000935 3300028381 Bacteria 30301
699 Ga0268264_10021281 3300028381 Bacteria 5297
700 Ga0268264_10030502 3300028381 Bacteria 4420
701 Ga0307517_10003203 3300028786 Bacteria 25702
702 Ga0307517_10028536 3300028786 Bacteria 6645
703 Ga0307517_10031733 3300028786 Bacteria 6136
704 Ga0307517_10122409 3300028786 Bacteria 1916
705 Ga0265338_10012923 3300028800 Bacteria 9481
706 Ga0265338_10103029 3300028800 Bacteria 2319
707 Ga0265327_10009725 3300031251 Bacteria 6884
708 Ga0307513_10000077 3300031456 Bacteria 134167
709 Ga0307513_10003660 3300031456 Bacteria 20800
710 Ga0307513_10007104 3300031456 Bacteria 14560
711 Ga0307513_10008325 3300031456 Bacteria 13279
712 Ga0307513_10036337 3300031456 Bacteria 5496
713 Ga0307408_100034134 3300031548 Bacteria 3560
714 Ga0307408_100060171 3300031548 Bacteria 2768
715 Ga0307408_100064942 3300031548 Bacteria 2675
716 Ga0307408_100154617 3300031548 Bacteria 1814
717 Ga0307508_10013919 3300031616 Bacteria 7342
718 Ga0307508_10028051 3300031616 Bacteria 5094
719 Ga0265314_10025857 3300031711 Bacteria 4420
720 Ga0307405_10011985 3300031731 Bacteria 4568
721 Ga0307413_10003794 3300031824 Bacteria 6441
722 Ga0307413_10011429 3300031824 Bacteria 4365
723 Ga0307413_10016574 3300031824 Bacteria 3811
724 Ga0307413_10024251 3300031824 Bacteria 3304
725 Ga0307413_10025760 3300031824 Bacteria 3230
726 Ga0307413_10060505 3300031824 Bacteria 2332
727 Ga0307410_10000171 3300031852 Bacteria 23683
728 Ga0307410_10002446 3300031852 Bacteria 8971
729 Ga0307410_10003744 3300031852 Bacteria 7698
730 Ga0307410_10009876 3300031852 Bacteria 5378
731 Ga0307410_10036364 3300031852 Bacteria 3206
732 Ga0307410_10125035 3300031852 Bacteria 1881
733 Ga0307406_10007470 3300031901 Bacteria 6061
734 Ga0307406_10029628 3300031901 Bacteria 3316
735 Ga0307406_10090504 3300031901 Bacteria 2059
736 Ga0307407_10001776 3300031903 Bacteria 8057
737 Ga0307407_10077426 3300031903 Bacteria 2000
738 Ga0307412_10010645 3300031911 Bacteria 5301
739 Ga0307412_10023286 3300031911 Bacteria 3809
740 Ga0307412_10041749 3300031911 Bacteria 2975
741 Ga0307409_100005102 3300031995 Bacteria 7495
742 Ga0307409_100023720 3300031995 Bacteria 4260
743 Ga0307409_100033235 3300031995 Bacteria 3751
744 Ga0307409_100043149 3300031995 Bacteria 3383
745 Ga0307409_100071255 3300031995 Bacteria 2763
746 Ga0307409_100109535 3300031995 Bacteria 2312
747 Ga0307416_100000451 3300032002 Bacteria 21079
748 Ga0307416_100092614 3300032002 Bacteria 2600
749 Ga0307416_100204353 3300032002 Bacteria 1877
750 Ga0307414_10000346 3300032004 Bacteria 26022
751 Ga0307414_10000914 3300032004 Bacteria 15107
752 Ga0307414_10005824 3300032004 Bacteria 6815
753 Ga0307414_10008577 3300032004 Bacteria 5809
754 Ga0307414_10012599 3300032004 Bacteria 5007
755 Ga0307414_10016703 3300032004 Bacteria 4470
756 Ga0307414_10027143 3300032004 Bacteria 3696
757 Ga0307414_10045572 3300032004 Bacteria 3004
758 Ga0307414_10070467 3300032004 Bacteria 2518
759 Ga0307414_10125643 3300032004 Bacteria 1981
760 Ga0307411_10003505 3300032005 Bacteria 7291
761 Ga0307411_10061254 3300032005 Bacteria 2504
762 Ga0307411_10085085 3300032005 Bacteria 2189
763 Ga0307411_10093961 3300032005 Bacteria 2101
764 Ga0307415_100070909 3300032126 Bacteria 2448
765 Ga0307415_100091584 3300032126 Bacteria 2202
766 Ga0307510_10043919 3300033180 Bacteria 4849
767 Ga0373936_0015112 3300035113 Bacteria 2957
768 Ga0373946_0035131 3300035171 Bacteria 2027
769 Ga0373955_0005549 3300035172 Bacteria 5673
770 Ga0373962_0011746 3300035242 Bacteria 2198
771 Ga0373935_0065252 3300035692 Bacteria 2336
772 Ga0373927_0000831 3300035695 Bacteria 23649
773 Ga0373937_0058132 3300036401 Bacteria 3553
774 Ga0373925_0000984 3300037068 Bacteria 25954
775 Ga0395899_0000018 3300037312 Bacteria 423194
776 Ga0395899_0000395 3300037312 Bacteria 51851
777 Ga0395899_0002657 3300037312 Bacteria 14408
778 Ga0395899_0009522 3300037312 Bacteria 7456
779 Ga0395899_0011904 3300037312 Bacteria 6661
780 Ga0395899_0031785 3300037312 Bacteria 3966
781 Ga0395899_0060292 3300037312 Bacteria 2795
782 Ga0395899_0088690 3300037312 Bacteria 2243
783 Ga0395899_0139280 3300037312 Bacteria 1727
784 Ga0395899_0139426 3300037312 Bacteria 1726
785 Ga0395900_0000008 3300037418 Bacteria 480459
786 Ga0395900_0044693 3300037418 Bacteria 4563
787 Ga0395900_0049269 3300037418 Bacteria 4339
788 Ga0395900_0150494 3300037418 Bacteria 2377
789 Ga0395900_0261901 3300037418 Bacteria 1726
790 Ga0395898_0007219 3300037466 Bacteria 11790
791 Ga0395898_0019791 3300037466 Bacteria 6845
792 Ga0395898_0039258 3300037466 Bacteria 4686
793 Ga0395898_0137636 3300037466 Bacteria 2338
794 Ga0395898_0218803 3300037466 Bacteria 1817
795 Ga0395898_0219438 3300037466 Bacteria 1814
796 Ga0395898_0240278 3300037466 Bacteria 1727
797 Ga0395905_0002515 3300037471 Bacteria 20250
798 Ga0395905_0003251 3300037471 Bacteria 17474
799 Ga0395905_0011963 3300037471 Bacteria 8366
800 Ga0395905_0017528 3300037471 Bacteria 6798
801 Ga0395905_0062605 3300037471 Bacteria 3480
802 Ga0395905_0074477 3300037471 Bacteria 3181
803 Ga0395905_0074500 3300037471 Bacteria 3181
804 Ga0395905_0103227 3300037471 Bacteria 2677
805 Ga0395905_0386055 3300037471 Bacteria 1295
806 Ga0395901_0000008 3300038443 Bacteria 495962
807 Ga0395901_0014093 3300038443 Bacteria 8139
808 Ga0395901_0119948 3300038443 Bacteria 2763
809 Ga0395901_0219488 3300038443 Bacteria 1988
810 Ga0395901_0249534 3300038443 Bacteria 1849
811 Ga0395901_0271819 3300038443 Bacteria 1762
812 Ga0237819_00846 3300038705 Bacteria 9641
813 Ga0436365_0480987 3300039437 Bacteria 6783
814 Ga0436365_1342500 3300039437 Bacteria 41382
815 Ga0439461_0000297 3300041410 Bacteria 7073
816 Ga0439465_0000420 3300041413 Bacteria 12395
817 Ga0451806_680459 3300041462 Bacteria 4338
818 Ga0439431_0000645 3300041997 Bacteria 7421
819 Ga0439431_0000807 3300041997 Bacteria 6766
820 Ga0439445_0008249 3300042004 Bacteria 2433
821 Ga0439448_0000252 3300042005 Bacteria 11561
822 Ga0439448_0002085 3300042005 Bacteria 5366
823 Ga0439455_0006627 3300042012 Bacteria 2413
824 Ga0439462_0000249 3300042015 Bacteria 9622
825 Ga0439458_0000528 3300042157 Bacteria 9833
826 Ga0439458_0000550 3300042157 Bacteria 9644
827 Ga0439458_0002113 3300042157 Bacteria 4922
828 Ga0439434_0000823 3300042435 Bacteria 8928
829 Ga0466961_0011905 3300044693 Bacteria 5560
830 Ga0466961_0091701 3300044693 Bacteria 1918
831 Ga0466963_0026776 3300044694 Bacteria 3689
832 Ga0466971_0003958 3300044719 Bacteria 6369
833 Ga0466968_0022779 3300044735 Bacteria 2548
834 Ga0466968_0026553 3300044735 Bacteria 2377
835 Ga0466957_0000560 3300044842 Bacteria 18785
836 Ga0466957_0031342 3300044842 Bacteria 3177
837 Ga0466957_0033408 3300044842 Bacteria 3087
838 Ga0466960_0004332 3300044901 Bacteria 5537
839 Ga0466959_0059099 3300045049 Bacteria 2792
840 Ga0451576_0035173 3300045051 Bacteria 5316
841 Ga0451576_0112747 3300045051 Bacteria 2830
842 Ga0466958_0001653 3300045836 Bacteria 10750
843 Ga0466958_0070759 3300045836 Bacteria 2135
844 Ga0466967_0003617 3300045976 Bacteria 10151
845 Ga0466967_0004762 3300045976 Bacteria 9239
846 Ga0466967_0060899 3300045976 Bacteria 3347
847 Ga0466967_0071267 3300045976 Bacteria 3111
848 Ga0495627_000158 3300046453 Bacteria 77210
849 Ga0495627_000511 3300046453 Bacteria 32184
850 Ga0495627_000636 3300046453 Bacteria 27717
851 Ga0495627_001522 3300046453 Bacteria 13320
852 Ga0495590_0004507 3300046457 Bacteria 5619
853 Ga0495638_0000016 3300046460 Bacteria 396505
854 Ga0495638_0001235 3300046460 Bacteria 24108
855 Ga0495638_0002237 3300046460 Bacteria 16075
856 Ga0495638_0009533 3300046460 Bacteria 6805
857 Ga0495638_0014288 3300046460 Bacteria 5374
858 Ga0495650_0000024 3300046471 Bacteria 496674
859 Ga0495650_0000492 3300046471 Bacteria 59983
860 Ga0495650_0005540 3300046471 Bacteria 8155
861 Ga0495650_0034765 3300046471 Bacteria 2226
862 Ga0495584_0006800 3300046491 Bacteria 5973
863 Ga0495585_0003684 3300046492 Bacteria 10241
864 Ga0495594_0063695 3300046499 Bacteria 2043
865 Ga0495596_0000141 3300046500 Bacteria 49474
866 Ga0495596_0007358 3300046500 Bacteria 4971
867 Ga0495596_0007523 3300046500 Bacteria 4910
868 Ga0495607_0019591 3300046501 Bacteria 4296
869 Ga0495583_0000025 3300046506 Bacteria 263775
870 Ga0495583_0002564 3300046506 Bacteria 15303
871 Ga0495583_0011021 3300046506 Bacteria 5213
872 Ga0495583_0011071 3300046506 Bacteria 5198
873 Ga0495583_0029586 3300046506 Bacteria 2678
874 Ga0495606_0000434 3300046507 Bacteria 69495
875 Ga0495606_0006495 3300046507 Bacteria 10756
876 Ga0495606_0061506 3300046507 Bacteria 2401
877 Ga0495610_0000020 3300046512 Bacteria 344007
878 Ga0495610_0000071 3300046512 Bacteria 121210
879 Ga0495610_0000478 3300046512 Bacteria 41250
880 Ga0495610_0002395 3300046512 Bacteria 15792
881 Ga0495616_0000007 3300046513 Bacteria 227689
882 Ga0495616_0005214 3300046513 Bacteria 8035
883 Ga0495616_0022892 3300046513 Bacteria 3368
884 Ga0495632_0000211 3300046519 Bacteria 59066
885 Ga0495632_0004458 3300046519 Bacteria 9510
886 Ga0495632_0011966 3300046519 Bacteria 5032
887 Ga0495632_0017082 3300046519 Bacteria 4016
888 Ga0495632_0018793 3300046519 Bacteria 3783
889 Ga0495637_0025747 3300046520 Bacteria 2649
890 Ga0495643_0000053 3300046522 Bacteria 202031
891 Ga0495643_0000132 3300046522 Bacteria 121567
892 Ga0495643_0004044 3300046522 Bacteria 10460
893 Ga0495643_0004426 3300046522 Bacteria 9829
894 Ga0495643_0009605 3300046522 Bacteria 6000
895 Ga0495643_0036370 3300046522 Bacteria 2705
896 Ga0495648_0000101 3300046524 Bacteria 107124
897 Ga0495648_0000256 3300046524 Bacteria 60519
898 Ga0495648_0000634 3300046524 Bacteria 37553
899 Ga0495648_0012976 3300046524 Bacteria 6184
900 Ga0495648_0028854 3300046524 Bacteria 3690
901 Ga0495663_0000020 3300046525 Bacteria 124560
902 Ga0495663_0001269 3300046525 Bacteria 8015
903 Ga0495663_0005529 3300046525 Bacteria 3507
904 Ga0495663_0028431 3300046525 Bacteria 1646
905 Ga0495642_0012414 3300046528 Bacteria 3284
906 Ga0495654_0000135 3300046530 Bacteria 77516
907 Ga0495587_0043433 3300046536 Bacteria 2677
908 Ga0495609_0005528 3300046538 Bacteria 6604
909 Ga0495621_0000349 3300046539 Bacteria 11275
910 Ga0495621_0000432 3300046539 Bacteria 10366
911 Ga0495621_0032968 3300046539 Bacteria 1783
912 Ga0495597_0003528 3300046542 Bacteria 9046
913 Ga0495622_0007231 3300046557 Bacteria 5154
914 Ga0495633_0000983 3300046558 Bacteria 23405
915 Ga0495633_0001072 3300046558 Bacteria 22116
916 Ga0495633_0002904 3300046558 Bacteria 11752
917 Ga0495668_0000004 3300046616 Bacteria 574236
918 Ga0495668_0000163 3300046616 Bacteria 99607
919 Ga0495668_0000291 3300046616 Bacteria 68802
920 Ga0495668_0004834 3300046616 Bacteria 9372
921 Ga0495668_0014658 3300046616 Bacteria 4591
922 Ga0495668_0069472 3300046616 Bacteria 1937
923 Ga0495625_0000332 3300046660 Bacteria 71947
924 Ga0495625_0000546 3300046660 Bacteria 55126
925 Ga0495625_0000676 3300046660 Bacteria 48679
926 Ga0495625_0002176 3300046660 Bacteria 21762
927 Ga0495625_0002942 3300046660 Bacteria 17765
928 Ga0495625_0018991 3300046660 Bacteria 5349
929 Ga0495625_0020518 3300046660 Bacteria 5099
930 Ga0495625_0021050 3300046660 Bacteria 5027
931 Ga0495625_0021743 3300046660 Bacteria 4931
932 Ga0495625_0046856 3300046660 Bacteria 3118
933 Ga0495625_0063896 3300046660 Bacteria 2598
934 Ga0495661_0083784 3300046665 Bacteria 1832
935 Ga0495623_0004939 3300046679 Bacteria 8745
936 Ga0495669_0000044 3300046684 Bacteria 85633
937 Ga0495669_0000629 3300046684 Bacteria 15335
938 Ga0495670_0004421 3300046691 Bacteria 6897
939 Ga0495670_0027463 3300046691 Bacteria 2820
940 Ga0495670_0088067 3300046691 Bacteria 1587
941 Ga0495671_0000031 3300046692 Bacteria 202030
942 Ga0495671_0000063 3300046692 Bacteria 106655
943 Ga0495671_0050737 3300046692 Bacteria 2065
944 Ga0495589_0047849 3300046794 Bacteria 2118
945 Ga0495600_0000914 3300046809 Bacteria 15826
946 Ga0495672_0001086 3300047320 Bacteria 27612
947 Ga0495672_0017193 3300047320 Bacteria 4842
948 Ga0495683_0030185 3300047323 Bacteria 2766
949 Ga0495687_001516 3300047443 Bacteria 21182
950 Ga0495687_001938 3300047443 Bacteria 17742
951 Ga0495677_0009768 3300047445 Bacteria 3536
952 Ga0495677_0017382 3300047445 Bacteria 2608
953 Ga0495677_0020464 3300047445 Bacteria 2399
954 Ga0495677_0044726 3300047445 Bacteria 1623
955 Ga0495677_0046206 3300047445 Bacteria 1598
956 Ga0495679_004380 3300047446 Bacteria 6535
957 Ga0495673_0000170 3300047469 Bacteria 106688
958 Ga0495673_0001300 3300047469 Bacteria 20332
959 Ga0495673_0001684 3300047469 Bacteria 16985
960 Ga0495681_0000008 3300047470 Bacteria 215295
961 Ga0495681_0000094 3300047470 Bacteria 77400
962 Ga0495681_0003826 3300047470 Bacteria 10415
963 Ga0495681_0012889 3300047470 Bacteria 4886
964 Ga0495686_0000013 3300047472 Bacteria 489656
965 Ga0495686_0000201 3300047472 Bacteria 110982
966 Ga0495686_0005293 3300047472 Bacteria 10228
967 Ga0495686_0005596 3300047472 Bacteria 9871
968 Ga0495686_0005965 3300047472 Bacteria 9483
969 Ga0495686_0014688 3300047472 Bacteria 5383
970 Ga0495686_0089886 3300047472 Bacteria 1865
971 Ga0495686_0104624 3300047472 Bacteria 1704
972 Ga0495602_0031175 3300048088 Bacteria 5045
973 Ga0495615_0000239 3300048090 Bacteria 11254
974 Ga0495626_0001260 3300048091 Bacteria 20761
975 Ga0496100_0129311 3300048903 Bacteria 1777
976 Ga0496102_0000106 3300048905 Bacteria 118841
977 Ga0496102_0002374 3300048905 Bacteria 16067
978 Ga0496102_0018995 3300048905 Bacteria 6048
979 Ga0496102_0087676 3300048905 Bacteria 2876
980 Ga0496102_0095343 3300048905 Bacteria 2758
981 Ga0496102_0129581 3300048905 Bacteria 2360
982 Ga0496102_0162071 3300048905 Bacteria 2104
983 Ga0496103_0000095 3300048906 Bacteria 98260
984 Ga0496103_0001305 3300048906 Bacteria 16975
985 Ga0496103_0001454 3300048906 Bacteria 15856
986 Ga0496103_0072439 3300048906 Bacteria 2158
987 Ga0496104_0000060 3300048907 Bacteria 117966
988 Ga0496105_0000274 3300048908 Bacteria 34048
989 Ga0496105_0009547 3300048908 Bacteria 7594
990 Ga0496106_0000338 3300048909 Bacteria 32910
991 Ga0496106_0017067 3300048909 Bacteria 5373
992 Ga0496106_0113377 3300048909 Bacteria 2113
993 Ga0496107_0000028 3300048910 Bacteria 105641
994 Ga0496107_0004473 3300048910 Bacteria 9480
995 Ga0496107_0015199 3300048910 Bacteria 5392
996 Ga0496107_0031961 3300048910 Bacteria 3759
997 Ga0496108_0001094 3300048911 Bacteria 21158
998 Ga0496108_0012717 3300048911 Bacteria 6854
999 Ga0496108_0109446 3300048911 Bacteria 2361
1000 Ga0496109_0108966 3300048912 Bacteria 2574
1001 Ga0496109_0152687 3300048912 Bacteria 2162
1002 Ga0496110_0000347 3300048913 Bacteria 30884
1003 Ga0496110_0008273 3300048913 Bacteria 8364
1004 Ga0496110_0019550 3300048913 Bacteria 5703
1005 Ga0496110_0036585 3300048913 Bacteria 4263
1006 Ga0496111_0002388 3300048914 Bacteria 11319
1007 Ga0496111_0020528 3300048914 Bacteria 4600
1008 Ga0496112_0001900 3300048915 Bacteria 16480
1009 Ga0496112_0004060 3300048915 Bacteria 12286
1010 Ga0496112_0014185 3300048915 Bacteria 7385
1011 Ga0496112_0115844 3300048915 Bacteria 2650
1012 Ga0496113_0000377 3300048916 Bacteria 21522
1013 Ga0496113_0001402 3300048916 Bacteria 13411
1014 Ga0496113_0003962 3300048916 Bacteria 8994
1015 Ga0496113_0094249 3300048916 Bacteria 2313
1016 Ga0496114_0046477 3300048917 Bacteria 3608
1017 Ga0496115_0000134 3300048918 Bacteria 67910
1018 Ga0496115_0000172 3300048918 Bacteria 59971
1019 Ga0496115_0000954 3300048918 Bacteria 20988
1020 Ga0496115_0001701 3300048918 Bacteria 15773
1021 Ga0496115_0002063 3300048918 Bacteria 14389
1022 Ga0496115_0039667 3300048918 Bacteria 3741
1023 Ga0496115_0056899 3300048918 Bacteria 3144
1024 Ga0496116_0000028 3300048919 Bacteria 424086
1025 Ga0496116_0014370 3300048919 Bacteria 6328
1026 Ga0496116_0034323 3300048919 Bacteria 3582
1027 Ga0496117_0000366 3300048920 Bacteria 78816
1028 Ga0496117_0000582 3300048920 Bacteria 60157
1029 Ga0496117_0017388 3300048920 Bacteria 6005
1030 Ga0496117_0018898 3300048920 Bacteria 5685
1031 Ga0496118_0000392 3300048921 Bacteria 74074
1032 Ga0496118_0003332 3300048921 Bacteria 20326
1033 Ga0496118_0037076 3300048921 Bacteria 3930
1034 Ga0496119_0001213 3300048922 Bacteria 32201
1035 Ga0496119_0094698 3300048922 Bacteria 1689
1036 Ga0496120_0001109 3300048923 Bacteria 35064
1037 Ga0496120_0038397 3300048923 Bacteria 2832
1038 Ga0496121_0000175 3300048924 Bacteria 142910
1039 Ga0496121_0000509 3300048924 Bacteria 74211
1040 Ga0496121_0002522 3300048924 Bacteria 27770
1041 Ga0496121_0002895 3300048924 Bacteria 25241
1042 Ga0496121_0004566 3300048924 Bacteria 18476
1043 Ga0496121_0005053 3300048924 Bacteria 17236
1044 Ga0496121_0005396 3300048924 Bacteria 16416
1045 Ga0496121_0012664 3300048924 Bacteria 9158
1046 Ga0496121_0013959 3300048924 Bacteria 8580
1047 Ga0496121_0127269 3300048924 Bacteria 1913
1048 Ga0496122_0002369 3300048925 Bacteria 26990
1049 Ga0496122_0002582 3300048925 Bacteria 25400
1050 Ga0496122_0004287 3300048925 Bacteria 17866
1051 Ga0496122_0005688 3300048925 Bacteria 14715
1052 Ga0496122_0006401 3300048925 Bacteria 13531
1053 Ga0496122_0009082 3300048925 Bacteria 10542
1054 Ga0496123_0000155 3300048926 Bacteria 139646
1055 Ga0496123_0000577 3300048926 Bacteria 62448
1056 Ga0496123_0001557 3300048926 Bacteria 31501
1057 Ga0496123_0007047 3300048926 Bacteria 10696
1058 Ga0496123_0010484 3300048926 Bacteria 8185
1059 Ga0496124_0000606 3300048927 Bacteria 60251
1060 Ga0496124_0001819 3300048927 Bacteria 29505
1061 Ga0496124_0021696 3300048927 Bacteria 5913
1062 Ga0496124_0025910 3300048927 Bacteria 5298
1063 Ga0496124_0028114 3300048927 Bacteria 5033
1064 Ga0496125_0000666 3300048928 Bacteria 57200
1065 Ga0496125_0004173 3300048928 Bacteria 16846
1066 Ga0496125_0019436 3300048928 Bacteria 6406
1067 Ga0496125_0020409 3300048928 Bacteria 6218
1068 Ga0496125_0020819 3300048928 Bacteria 6142
1069 Ga0496125_0025122 3300048928 Bacteria 5464
1070 Ga0496125_0025348 3300048928 Bacteria 5432
1071 Ga0496125_0025844 3300048928 Bacteria 5367
1072 Ga0496125_0058805 3300048928 Bacteria 3102
1073 Ga0496125_0061058 3300048928 Bacteria 3026
1074 Ga0496125_0159591 3300048928 Bacteria 1534
1075 Ga0496126_0000079 3300048929 Bacteria 222463
1076 Ga0496126_0000294 3300048929 Bacteria 106327
1077 Ga0496126_0004606 3300048929 Bacteria 16354
1078 Ga0496126_0005782 3300048929 Bacteria 13983
1079 Ga0496126_0007586 3300048929 Bacteria 11855
1080 Ga0496126_0025071 3300048929 Bacteria 5747
1081 Ga0495678_000699 3300049459 Bacteria 30520
1082 Ga0501290_000086 3300049513 Bacteria 13288
1083 Ga0501292_000019 3300049515 Bacteria 55694
1084 Ga0501294_000190 3300049517 Bacteria 7585
1085 Ga0501300_000128 3300049523 Bacteria 11180
1086 Ga0501300_001748 3300049523 Bacteria 3253
1087 Ga0501032_0002828 3300049569 Bacteria 13502
1088 Ga0501032_0046399 3300049569 Bacteria 2937
1089 Ga0501036_0098438 3300049572 Bacteria 2472
1090 Ga0501036_0114026 3300049572 Bacteria 2284
1091 Ga0501037_0018728 3300049573 Bacteria 5102
1092 Ga0501037_0045975 3300049573 Bacteria 3203
1093 Ga0501038_0024614 3300049574 Bacteria 5369
1094 Ga0501043_0185581 3300049579 Bacteria 1619
1095 Ga0501046_0098342 3300049580 Bacteria 2247
1096 Ga0501047_0002252 3300049581 Bacteria 18471
1097 Ga0501047_0003383 3300049581 Bacteria 15102
1098 Ga0501047_0013163 3300049581 Bacteria 7835
1099 Ga0501047_0016166 3300049581 Bacteria 7119
1100 Ga0501047_0054093 3300049581 Bacteria 3883
1101 Ga0501047_0159386 3300049581 Bacteria 2128
1102 Ga0501047_0240044 3300049581 Bacteria 1663
1103 Ga0501067_0002981 3300049583 Bacteria 9340
1104 Ga0501067_0081413 3300049583 Bacteria 1795
1105 Ga0501068_0001660 3300049584 Bacteria 11890
1106 Ga0501073_0000141 3300049589 Bacteria 47264
1107 Ga0501073_0000761 3300049589 Bacteria 22878
1108 Ga0501077_0000007 3300049593 Bacteria 110582
1109 Ga0501222_000788 3300049662 Bacteria 4564
1110 Ga0501223_000099 3300049663 Bacteria 25017
1111 Ga0501223_000193 3300049663 Bacteria 16020
1112 Ga0501223_002457 3300049663 Bacteria 4113
1113 Ga0501224_000015 3300049664 Bacteria 90971
1114 Ga0501233_001277 3300049668 Bacteria 4302
1115 Ga0501235_000351 3300049669 Bacteria 8794
1116 Ga0501249_000162 3300049679 Bacteria 20650
1117 Ga0501261_000061 3300049690 Bacteria 19269
1118 Ga0501225_0000038 3300049705 Bacteria 45168
1119 Ga0501225_0000131 3300049705 Bacteria 22852
1120 Ga0501225_0002229 3300049705 Bacteria 5993
1121 Ga0501234_000254 3300049707 Bacteria 7749
1122 Ga0501080_0001234 3300049742 Bacteria 21266
1123 Ga0501080_0003465 3300049742 Bacteria 13915
1124 Ga0501080_0056978 3300049742 Bacteria 3639
1125 Ga0501083_0005151 3300049744 Bacteria 9254
1126 Ga0501083_0051504 3300049744 Bacteria 2768
1127 Ga0501279_000008 3300049775 Bacteria 125267
1128 Ga0501280_000131 3300049776 Bacteria 19531
1129 Ga0501281_00097 3300049777 Bacteria 10413
1130 Ga0501282_000184 3300049778 Bacteria 7616
1131 Ga0501044_0010820 3300049823 Bacteria 9898
1132 Ga0501044_0011325 3300049823 Bacteria 9664
1133 Ga0501044_0027513 3300049823 Bacteria 6008
1134 Ga0501226_000122 3300049853 Bacteria 16163
1135 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
1136 nmdc:mga03683_6910_c1 3300050489 Bacteria 3911
1137 nmdc:mga03n38_715_c1 3300050490 Bacteria 8716
1138 nmdc:mga00v17_1761_c1 3300050491 Bacteria 11247
1139 nmdc:mga00v17_599_c1 3300050491 Bacteria 19989
1140 nmdc:mga0yw44_71676_c1 3300050492 Bacteria 2152
1141 nmdc:mga0k408_20_c1 3300050493 Bacteria 109563
1142 nmdc:mga0k408_4871_c1 3300050493 Bacteria 7118
1143 nmdc:mga0k408_72823_c1 3300050493 Bacteria 2007
1144 nmdc:mga06z11_26_c1 3300050494 Bacteria 64283
1145 nmdc:mga06z11_6034_c1 3300050494 Bacteria 4901
1146 nmdc:mga06z11_62412_c1 3300050494 Bacteria 1947
1147 nmdc:mga06z11_761_c1 3300050494 Bacteria 11746
1148 nmdc:mga04h51_118_c1 3300050495 Bacteria 23239
1149 nmdc:mga04h51_22_c1 3300050495 Bacteria 64371
1150 nmdc:mga04h51_5130_c1 3300050495 Bacteria 3319
1151 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
1152 nmdc:mga07m45_711_c1 3300050496 Bacteria 14140
1153 nmdc:mga07m45_95776_c1 3300050496 Bacteria 1703
1154 nmdc:mga0sz30_39184_c1 3300050516 Bacteria 1988
1155 Ga0500610_0000385 3300053079 Bacteria 13390
1156 Ga0500578_0000159 3300053086 Bacteria 79246
1157 Ga0500643_001071 3300053087 Bacteria 16543
1158 Ga0500643_002494 3300053087 Bacteria 9443
1159 Ga0500643_003004 3300053087 Bacteria 8354
1160 Ga0500643_004784 3300053087 Bacteria 5991
1161 Ga0500643_005712 3300053087 Bacteria 5306
1162 Ga0500643_005911 3300053087 Bacteria 5190
1163 Ga0500643_006277 3300053087 Bacteria 4987
1164 Ga0500644_0000269 3300053088 Bacteria 29380
1165 Ga0500647_0074727 3300053091 Bacteria 1626
1166 Ga0500651_0011395 3300053093 Bacteria 5358
1167 Ga0500641_0003922 3300053096 Bacteria 5260
1168 Ga0500641_0029798 3300053096 Bacteria 2140
1169 Ga0500650_0064011 3300053098 Bacteria 1718
1170 Ga0500555_006371 3300053103 Bacteria 3352
1171 Ga0500556_0000031 3300053104 Bacteria 156000
1172 Ga0500556_0014060 3300053104 Bacteria 2437
1173 Ga0500556_0015464 3300053104 Bacteria 2354
1174 Ga0500562_002265 3300053108 Bacteria 4813
1175 Ga0500562_004945 3300053108 Bacteria 3360
1176 Ga0500562_014739 3300053108 Bacteria 2003
1177 Ga0500572_002012 3300053111 Bacteria 5066
1178 Ga0500592_000270 3300053116 Bacteria 9225
1179 Ga0500594_0000312 3300053118 Bacteria 10863
1180 Ga0500594_0003663 3300053118 Bacteria 3387
1181 Ga0500595_001337 3300053119 Bacteria 13334
1182 Ga0500607_001726 3300053121 Bacteria 18994
1183 Ga0500607_002875 3300053121 Bacteria 13266
1184 Ga0500608_000348 3300053122 Bacteria 17856
1185 Ga0500617_020891 3300053124 Bacteria 2875
1186 Ga0500618_000570 3300053125 Bacteria 22812
1187 Ga0500618_003408 3300053125 Bacteria 5472
1188 Ga0500618_016467 3300053125 Bacteria 1850
1189 Ga0500642_0000003 3300053130 Bacteria 544899
1190 Ga0500642_0000337 3300053130 Bacteria 16075
1191 Ga0500642_0001871 3300053130 Bacteria 6079
1192 Ga0500642_0048665 3300053130 Bacteria 1863
1193 Ga0500655_001064 3300053133 Bacteria 5273
1194 Ga0500559_0000098 3300053136 Bacteria 69305
1195 Ga0500559_0000147 3300053136 Bacteria 55307
1196 Ga0500559_0002377 3300053136 Bacteria 9801
1197 Ga0500559_0017612 3300053136 Bacteria 3018
1198 Ga0500564_005262 3300053138 Bacteria 5276
1199 Ga0500568_0014770 3300053139 Bacteria 3514
1200 Ga0500573_0000034 3300053140 Bacteria 113547
1201 Ga0500616_0014001 3300053153 Bacteria 4625
1202 Ga0500622_0002660 3300053156 Bacteria 12677
1203 Ga0500622_0003893 3300053156 Bacteria 9667
1204 Ga0500622_0007480 3300053156 Bacteria 6200
1205 Ga0500622_0013218 3300053156 Bacteria 4456
1206 Ga0500622_0059721 3300053156 Bacteria 1946
1207 Ga0500624_000022 3300053157 Bacteria 116892
1208 Ga0500624_000024 3300053157 Bacteria 114404
1209 Ga0500627_0000101 3300053158 Bacteria 28527
1210 Ga0500627_0000489 3300053158 Bacteria 10672
1211 Ga0500637_0000095 3300053178 Bacteria 31675
1212 Ga0500637_0001187 3300053178 Bacteria 10847
1213 Ga0500567_000103 3300053723 Bacteria 21300
1214 Ga0500570_002262 3300053724 Bacteria 9442
1215 Ga0500625_000029 3300053729 Bacteria 54479
1216 Ga0500645_000300 3300053730 Bacteria 35408
1217 Ga0500645_000452 3300053730 Bacteria 28126
1218 Ga0500645_000996 3300053730 Bacteria 15975
1219 Ga0500645_003145 3300053730 Bacteria 6866
1220 Ga0500645_003367 3300053730 Bacteria 6543
1221 Ga0500645_003519 3300053730 Bacteria 6328
1222 Ga0500645_007126 3300053730 Bacteria 3927
1223 Ga0500645_013667 3300053730 Bacteria 2601
1224 Ga0500609_000273 3300053731 Bacteria 7534
1225 Ga0500596_001261 3300053735 Bacteria 5117
1226 Ga0500661_002227 3300055283 Bacteria 3664
1227 Ga0501082_0016306 3300060353 Bacteria 6395
1228 Ga0466962_0007859 3300061719 Bacteria 5117
1229 Ga0466962_0015235 3300061719 Bacteria 3707

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0059099 Ga0466959_0059099_1573_2751 390
2 3300049581 Ga0501047_0159386 Ga0501047_0159386_27_1274 410
3 3300013297 Ga0157378_10008397 Ga0157378_100083975 412
4 3300037471 Ga0395905_0386055 Ga0395905_0386055_10_1281 414
5 3300009553 Ga0105249_10001611 Ga0105249_1000161117 425
6 3300037466 Ga0395898_0137636 Ga0395898_0137636_1009_2319 431
7 3300048916 Ga0496113_0094249 Ga0496113_0094249_573_1976 443
8 3300025940 Ga0207691_10150950 Ga0207691_101509503 445
9 3300049581 Ga0501047_0240044 Ga0501047_0240044_219_1634 449
10 3300005347 Ga0070668_100041954 Ga0070668_1000419542 451
11 3300005353 Ga0070669_100002305 Ga0070669_1000023054 451
12 3300005355 Ga0070671_100016202 Ga0070671_1000162027 451
13 3300005367 Ga0070667_100045508 Ga0070667_1000455081 451
14 3300005617 Ga0068859_100001618 Ga0068859_10000161812 451
15 3300005841 Ga0068863_100015575 Ga0068863_1000155752 451
16 3300005842 Ga0068858_100023998 Ga0068858_1000239983 451
17 3300006931 Ga0097620_100001618 Ga0097620_10000161813 451
18 3300009177 Ga0105248_10010014 Ga0105248_100100143 451
19 3300014968 Ga0157379_10003874 Ga0157379_100038748 451
20 3300025923 Ga0207681_10001688 Ga0207681_100016888 451
21 3300025931 Ga0207644_10004362 Ga0207644_1000436210 451
22 3300025941 Ga0207711_10102334 Ga0207711_101023342 451
23 3300025972 Ga0207668_10053205 Ga0207668_100532052 451
24 3300037471 Ga0395905_0017528 Ga0395905_0017528_3907_5355 452
25 3300035692 Ga0373935_0065252 Ga0373935_0065252_443_1954 457
26 3300037471 Ga0395905_0003251 Ga0395905_0003251_4824_6320 457
27 3300003794 Ga0055531_10012125 Ga0055531_100121253 459
28 3300005843 Ga0068860_100004284 Ga0068860_1000042844 459
29 3300005844 Ga0068862_100000485 Ga0068862_10000048512 459
30 3300009553 Ga0105249_10000567 Ga0105249_100005678 459
31 3300025292 Ga0209676_1002091 Ga0209676_10020912 459
32 3300025298 Ga0209050_1001834 Ga0209050_10018343 459
33 3300025304 Ga0209257_1002800 Ga0209257_10028002 459
34 3300025961 Ga0207712_10000008 Ga0207712_100000087 459
35 3300028380 Ga0268265_10000082 Ga0268265_1000008276 459
36 3300028381 Ga0268264_10000933 Ga0268264_1000093317 459
37 3300028381 Ga0268264_10000935 Ga0268264_100009358 459
38 3300046453 Ga0495627_000511 Ga0495627_000511_23419_24873 459
39 3300046616 Ga0495668_0000291 Ga0495668_0000291_3788_5242 459
40 3300046794 Ga0495589_0047849 Ga0495589_0047849_481_1935 459
41 3300047469 Ga0495673_0001684 Ga0495673_0001684_323_1777 459
42 3300053136 Ga0500559_0000098 Ga0500559_0000098_21259_22713 460
43 3300048928 Ga0496125_0025122 Ga0496125_0025122_1989_3443 461
44 3300048929 Ga0496126_0007586 Ga0496126_0007586_8371_9825 461
45 3300005327 Ga0070658_10039940 Ga0070658_100399402 462
46 3300005327 Ga0070658_10072459 Ga0070658_100724592 462
47 3300005364 Ga0070673_100146105 Ga0070673_1001461052 462
48 3300005457 Ga0070662_100006034 Ga0070662_1000060347 462
49 3300005457 Ga0070662_100107667 Ga0070662_1001076672 462
50 3300005535 Ga0070684_100123426 Ga0070684_1001234262 462
51 3300005563 Ga0068855_100205581 Ga0068855_1002055812 462
52 3300005616 Ga0068852_100000996 Ga0068852_10000099614 462
53 3300011119 Ga0105246_10039544 Ga0105246_100395444 462
54 3300013102 Ga0157371_10012865 Ga0157371_100128653 462
55 3300013102 Ga0157371_10040150 Ga0157371_100401502 462
56 3300013105 Ga0157369_10332956 Ga0157369_103329561 462
57 3300014745 Ga0157377_10087013 Ga0157377_100870132 462
58 3300025909 Ga0207705_10061213 Ga0207705_100612133 462
59 3300025917 Ga0207660_10025154 Ga0207660_100251542 462
60 3300025931 Ga0207644_10072793 Ga0207644_100727932 462
61 3300025933 Ga0207706_10022097 Ga0207706_100220972 462
62 3300025949 Ga0207667_10032150 Ga0207667_100321505 462
63 3300025949 Ga0207667_10162948 Ga0207667_101629482 462
64 3300026142 Ga0207698_10000901 Ga0207698_100009015 462
65 iso_pu_bacteria 2895880812 2895882643 462
66 iso_pu_bacteria 2896184354 2896187040 462
67 3300005335 Ga0070666_10014711 Ga0070666_100147112 463
68 3300005347 Ga0070668_100019269 Ga0070668_1000192694 463
69 3300005367 Ga0070667_100000067 Ga0070667_10000006777 463
70 3300005564 Ga0070664_100077301 Ga0070664_1000773012 463
71 3300005841 Ga0068863_100000038 Ga0068863_10000003875 463
72 3300025903 Ga0207680_10002989 Ga0207680_100029895 463
73 3300025945 Ga0207679_10070227 Ga0207679_100702272 463
74 3300025972 Ga0207668_10000629 Ga0207668_1000062910 463
75 3300025986 Ga0207658_10000089 Ga0207658_1000008956 463
76 3300026088 Ga0207641_10000060 Ga0207641_1000006086 463
77 3300046471 Ga0495650_0034765 Ga0495650_0034765_742_2190 463
78 3300046513 Ga0495616_0000007 Ga0495616_0000007_122079_123590 463
79 3300046616 Ga0495668_0004834 Ga0495668_0004834_2315_3766 463
80 3300053158 Ga0500627_0000489 Ga0500627_0000489_3928_5439 463
81 iso_pu_bacteria 2848297114 2848297701 463
82 3300005262 Ga0065165_1001513 Ga0065165_10015133 464
83 3300005327 Ga0070658_10032583 Ga0070658_100325833 464
84 3300005339 Ga0070660_100041808 Ga0070660_1000418082 464
85 3300005366 Ga0070659_100015944 Ga0070659_1000159447 464
86 3300005458 Ga0070681_10019939 Ga0070681_100199393 464
87 3300005577 Ga0068857_100006583 Ga0068857_1000065833 464
88 3300005616 Ga0068852_100003424 Ga0068852_1000034243 464
89 3300009093 Ga0105240_10012012 Ga0105240_100120124 464
90 3300009551 Ga0105238_10054955 Ga0105238_100549552 464
91 3300010375 Ga0105239_10144329 Ga0105239_101443291 464
92 3300013100 Ga0157373_10026321 Ga0157373_100263213 464
93 3300013307 Ga0157372_10006096 Ga0157372_100060966 464
94 3300025904 Ga0207647_10000832 Ga0207647_100008323 464
95 3300025919 Ga0207657_10009905 Ga0207657_100099053 464
96 3300025920 Ga0207649_10017766 Ga0207649_100177663 464
97 3300025924 Ga0207694_10000776 Ga0207694_100007768 464
98 3300025944 Ga0207661_10089743 Ga0207661_100897432 464
99 3300026041 Ga0207639_10000554 Ga0207639_1000055416 464
100 3300026116 Ga0207674_10009434 Ga0207674_100094346 464
101 3300053087 Ga0500643_006277 Ga0500643_006277_2988_4442 464
102 3300053104 Ga0500556_0014060 Ga0500556_0014060_859_2313 464
103 3300053153 Ga0500616_0014001 Ga0500616_0014001_1833_3287 464
104 3300053156 Ga0500622_0007480 Ga0500622_0007480_119_1573 464
105 3300053730 Ga0500645_003519 Ga0500645_003519_3409_4863 464
106 3300025949 Ga0207667_10003106 Ga0207667_1000310614 465
107 3300031456 Ga0307513_10003660 Ga0307513_1000366012 465
108 3300046491 Ga0495584_0006800 Ga0495584_0006800_2077_3531 465
109 3300046519 Ga0495632_0000211 Ga0495632_0000211_5059_6513 465
110 3300046522 Ga0495643_0000053 Ga0495643_0000053_130401_131855 465
111 3300046525 Ga0495663_0000020 Ga0495663_0000020_70553_72007 465
112 3300046558 Ga0495633_0000983 Ga0495633_0000983_10413_11867 465
113 3300046692 Ga0495671_0000031 Ga0495671_0000031_70176_71630 465
114 3300047470 Ga0495681_0012889 Ga0495681_0012889_2268_3722 465
115 3300005842 Ga0068858_100030505 Ga0068858_1000305052 466
116 3300026035 Ga0207703_10015240 Ga0207703_100152402 466
117 3300046616 Ga0495668_0000004 Ga0495668_0000004_462411_463985 466
118 3300048929 Ga0496126_0005782 Ga0496126_0005782_10540_11970 466
119 3300005355 Ga0070671_100018377 Ga0070671_1000183775 467
120 3300025931 Ga0207644_10010449 Ga0207644_100104493 467
121 3300031995 Ga0307409_100071255 Ga0307409_1000712552 467
122 3300037312 Ga0395899_0000018 Ga0395899_0000018_274294_275754 468
123 3300046558 Ga0495633_0001072 Ga0495633_0001072_10362_11816 468
124 3300049572 Ga0501036_0114026 Ga0501036_0114026_512_1951 468
125 3300049581 Ga0501047_0013163 Ga0501047_0013163_3732_5171 468
126 iso_pu_bacteria 8057101203 8057103307 468
127 3300006042 Ga0075368_10000704 Ga0075368_100007047 469
128 3300006178 Ga0075367_10000042 Ga0075367_100000429 469
129 3300006353 Ga0075370_10040975 Ga0075370_100409752 469
130 3300027866 Ga0209813_10000042 Ga0209813_1000004233 469
131 3300050494 nmdc:mga06z11_26_c1 nmdc:mga06z11_26_c1_45139_46593 469
132 3300050495 nmdc:mga04h51_22_c1 nmdc:mga04h51_22_c1_17821_19275 469
133 3300050496 nmdc:mga07m45_95776_c1 nmdc:mga07m45_95776_c1_225_1679 469
134 3300053087 Ga0500643_002494 Ga0500643_002494_4431_5852 469
135 iso_pu_bacteria 2830075706 2830077117 469
136 iso_pu_bacteria 2739367664 2739650371 470
137 iso_pu_bacteria 2739367865 2740028844 470
138 iso_pu_bacteria 2885429604 2885429714 470
139 iso_pu_bacteria 2946787523 2946788829 470
140 iso_pu_bacteria 2990265787 2990269329 470
141 iso_pu_bacteria 2993693658 2993694336 470
142 3300031548 Ga0307408_100060171 Ga0307408_1000601712 471
143 3300047472 Ga0495686_0000013 Ga0495686_0000013_401102_402568 471
144 3300049569 Ga0501032_0002828 Ga0501032_0002828_9960_11429 471
145 3300049569 Ga0501032_0046399 Ga0501032_0046399_649_2103 471
146 3300049572 Ga0501036_0098438 Ga0501036_0098438_845_2314 471
147 3300049573 Ga0501037_0018728 Ga0501037_0018728_1630_3099 471
148 3300049573 Ga0501037_0045975 Ga0501037_0045975_1725_3179 471
149 3300049574 Ga0501038_0024614 Ga0501038_0024614_1198_2652 471
150 3300049580 Ga0501046_0098342 Ga0501046_0098342_74_1528 471
151 3300049581 Ga0501047_0016166 Ga0501047_0016166_1833_3287 471
152 3300049583 Ga0501067_0002981 Ga0501067_0002981_1638_3107 471
153 3300049583 Ga0501067_0081413 Ga0501067_0081413_178_1632 471
154 3300049584 Ga0501068_0001660 Ga0501068_0001660_5873_7342 471
155 3300049589 Ga0501073_0000141 Ga0501073_0000141_36976_38445 471
156 3300049589 Ga0501073_0000761 Ga0501073_0000761_18574_20028 471
157 3300049593 Ga0501077_0000007 Ga0501077_0000007_56922_58391 471
158 3300049742 Ga0501080_0001234 Ga0501080_0001234_5709_7178 471
159 3300049742 Ga0501080_0003465 Ga0501080_0003465_775_2229 471
160 3300049744 Ga0501083_0005151 Ga0501083_0005151_3124_4578 471
161 3300049744 Ga0501083_0051504 Ga0501083_0051504_435_1904 471
162 3300049823 Ga0501044_0010820 Ga0501044_0010820_2706_4175 471
163 3300049823 Ga0501044_0027513 Ga0501044_0027513_3414_4868 471
164 3300060353 Ga0501082_0016306 Ga0501082_0016306_1670_3124 471
165 iso_pu_bacteria 2643221614 2644087988 471
166 iso_pu_bacteria 2643221661 2644344125 471
167 iso_pu_bacteria 2643221666 2644367345 471
168 iso_pu_bacteria 2919138771 2919141387 471
169 3300001979 JGI24740J21852_10008136 JGI24740J21852_100081361 472
170 3300001989 JGI24739J22299_10007274 JGI24739J22299_100072741 472
171 3300001990 JGI24737J22298_10004820 JGI24737J22298_100048202 472
172 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006350 472
173 3300003759 Ga0055525_1000090 Ga0055525_1000090146 472
174 3300003762 Ga0055542_1000046 Ga0055542_1000046185 472
175 3300003763 Ga0055529_1000007 Ga0055529_100000744 472
176 3300003763 Ga0055529_1000109 Ga0055529_100010927 472
177 3300005327 Ga0070658_10000227 Ga0070658_1000022717 472
178 3300005344 Ga0070661_100002364 Ga0070661_1000023644 472
179 3300005456 Ga0070678_100000076 Ga0070678_10000007623 472
180 3300005457 Ga0070662_100131020 Ga0070662_1001310201 472
181 3300005548 Ga0070665_100000086 Ga0070665_100000086175 472
182 3300005578 Ga0068854_100039985 Ga0068854_1000399852 472
183 3300006042 Ga0075368_10004849 Ga0075368_100048492 472
184 3300006051 Ga0075364_10000499 Ga0075364_100004993 472
185 3300009148 Ga0105243_10000224 Ga0105243_1000022410 472
186 3300009177 Ga0105248_10000091 Ga0105248_1000009190 472
187 3300013102 Ga0157371_10000097 Ga0157371_10000097100 472
188 3300014326 Ga0157380_10000217 Ga0157380_1000021718 472
189 3300025230 Ga0209563_100111 Ga0209563_10011110 472
190 3300025246 Ga0209646_1007217 Ga0209646_10072172 472
191 3300025253 Ga0209677_109735 Ga0209677_1097352 472
192 3300025254 Ga0209148_1000026 Ga0209148_1000026341 472
193 3300025272 Ga0209455_1000005 Ga0209455_10000051088 472
194 3300025297 Ga0209758_1000001 Ga0209758_10000011476 472
195 3300025904 Ga0207647_10041598 Ga0207647_100415982 472
196 3300025909 Ga0207705_10000450 Ga0207705_1000045018 472
197 3300025911 Ga0207654_10004079 Ga0207654_100040796 472
198 3300025913 Ga0207695_10015037 Ga0207695_100150373 472
199 3300025914 Ga0207671_10012661 Ga0207671_100126617 472
200 3300025920 Ga0207649_10002255 Ga0207649_100022555 472
201 3300025933 Ga0207706_10011772 Ga0207706_100117723 472
202 3300025935 Ga0207709_10000519 Ga0207709_100005199 472
203 3300025937 Ga0207669_10000161 Ga0207669_1000016124 472
204 3300025949 Ga0207667_10000010 Ga0207667_10000010347 472
205 3300025986 Ga0207658_10082985 Ga0207658_100829853 472
206 3300026121 Ga0207683_10000655 Ga0207683_1000065523 472
207 3300028379 Ga0268266_10000002 Ga0268266_100000022385 472
208 3300028786 Ga0307517_10028536 Ga0307517_100285367 472
209 3300028786 Ga0307517_10031733 Ga0307517_100317333 472
210 3300031456 Ga0307513_10036337 Ga0307513_100363376 472
211 3300031911 Ga0307412_10041749 Ga0307412_100417494 472
212 3300032004 Ga0307414_10008577 Ga0307414_100085776 472
213 3300037471 Ga0395905_0103227 Ga0395905_0103227_129_1574 472
214 3300046471 Ga0495650_0000492 Ga0495650_0000492_728_2164 472
215 3300046492 Ga0495585_0003684 Ga0495585_0003684_3241_4677 472
216 3300046500 Ga0495596_0007358 Ga0495596_0007358_968_2404 472
217 3300046506 Ga0495583_0002564 Ga0495583_0002564_9470_10906 472
218 3300046506 Ga0495583_0029586 Ga0495583_0029586_651_2087 472
219 3300046507 Ga0495606_0000434 Ga0495606_0000434_29549_30985 472
220 3300046520 Ga0495637_0025747 Ga0495637_0025747_576_2012 472
221 3300046522 Ga0495643_0004426 Ga0495643_0004426_699_2135 472
222 3300046524 Ga0495648_0000256 Ga0495648_0000256_5876_7312 472
223 3300046525 Ga0495663_0001269 Ga0495663_0001269_6129_7565 472
224 3300046536 Ga0495587_0043433 Ga0495587_0043433_435_1871 472
225 3300046557 Ga0495622_0007231 Ga0495622_0007231_2980_4416 472
226 3300046558 Ga0495633_0002904 Ga0495633_0002904_3381_4817 472
227 3300046616 Ga0495668_0000163 Ga0495668_0000163_82743_84179 472
228 3300046660 Ga0495625_0000546 Ga0495625_0000546_3537_4973 472
229 3300046660 Ga0495625_0021743 Ga0495625_0021743_3024_4460 472
230 3300046660 Ga0495625_0063896 Ga0495625_0063896_517_1953 472
231 3300046665 Ga0495661_0083784 Ga0495661_0083784_338_1774 472
232 3300046684 Ga0495669_0000629 Ga0495669_0000629_4867_6303 472
233 3300046809 Ga0495600_0000914 Ga0495600_0000914_4864_6300 472
234 3300047323 Ga0495683_0030185 Ga0495683_0030185_750_2186 472
235 3300047443 Ga0495687_001516 Ga0495687_001516_15400_16836 472
236 3300047443 Ga0495687_001938 Ga0495687_001938_7266_8702 472
237 3300047470 Ga0495681_0003826 Ga0495681_0003826_2416_3852 472
238 3300047472 Ga0495686_0005293 Ga0495686_0005293_8681_10117 472
239 3300047472 Ga0495686_0104624 Ga0495686_0104624_196_1656 472
240 3300048905 Ga0496102_0002374 Ga0496102_0002374_5493_6929 472
241 3300048906 Ga0496103_0001305 Ga0496103_0001305_6586_8022 472
242 3300048908 Ga0496105_0009547 Ga0496105_0009547_4323_5759 472
243 3300048913 Ga0496110_0008273 Ga0496110_0008273_6122_7558 472
244 3300048917 Ga0496114_0046477 Ga0496114_0046477_1051_2487 472
245 3300048918 Ga0496115_0000172 Ga0496115_0000172_8992_10428 472
246 3300048919 Ga0496116_0014370 Ga0496116_0014370_4537_5973 472
247 3300048920 Ga0496117_0000582 Ga0496117_0000582_9149_10585 472
248 3300048921 Ga0496118_0000392 Ga0496118_0000392_26910_28346 472
249 3300048923 Ga0496120_0038397 Ga0496120_0038397_901_2337 472
250 3300048924 Ga0496121_0002895 Ga0496121_0002895_1451_2884 472
251 3300048924 Ga0496121_0005396 Ga0496121_0005396_9230_10666 472
252 3300048927 Ga0496124_0000606 Ga0496124_0000606_49621_51057 472
253 3300048928 Ga0496125_0000666 Ga0496125_0000666_9358_10794 472
254 3300048929 Ga0496126_0004606 Ga0496126_0004606_9152_10588 472
255 3300053079 Ga0500610_0000385 Ga0500610_0000385_11366_12802 472
256 3300053119 Ga0500595_001337 Ga0500595_001337_2560_3996 472
257 3300053130 Ga0500642_0000337 Ga0500642_0000337_13919_15355 472
258 3300053140 Ga0500573_0000034 Ga0500573_0000034_13858_15294 472
259 3300053156 Ga0500622_0003893 Ga0500622_0003893_1702_3156 472
260 3300053730 Ga0500645_000300 Ga0500645_000300_8909_10345 472
261 3300053735 Ga0500596_001261 Ga0500596_001261_2290_3726 472
262 iso_pu_bacteria 2599185354 2600200589 472
263 iso_pu_bacteria 2643221598 2644001584 472
264 iso_pu_bacteria 2751185897 2753763632 472
265 iso_pu_bacteria 2818991438 2819553161 472
266 3300002075 JGI24738J21930_10002973 JGI24738J21930_100029733 473
267 3300002774 JGI25150J39212_1000046 JGI25150J39212_10000461 473
268 3300003214 JGI25165J46597_1000073 JGI25165J46597_100007362 473
269 3300003215 JGI25153J46596_10000124 JGI25153J46596_1000012464 473
270 3300003771 Ga0055526_1006062 Ga0055526_10060623 473
271 3300003791 Ga0055530_10002060 Ga0055530_100020605 473
272 3300003791 Ga0055530_10018279 Ga0055530_100182791 473
273 3300003794 Ga0055531_10000008 Ga0055531_10000008121 473
274 3300003794 Ga0055531_10003005 Ga0055531_100030052 473
275 3300005262 Ga0065165_1001443 Ga0065165_100144317 473
276 3300005327 Ga0070658_10000124 Ga0070658_1000012439 473
277 3300005329 Ga0070683_100179416 Ga0070683_1001794162 473
278 3300005334 Ga0068869_100192549 Ga0068869_1001925491 473
279 3300005366 Ga0070659_100050460 Ga0070659_1000504603 473
280 3300005366 Ga0070659_100070320 Ga0070659_1000703203 473
281 3300005455 Ga0070663_100084044 Ga0070663_1000840443 473
282 3300005548 Ga0070665_100068272 Ga0070665_1000682723 473
283 3300005563 Ga0068855_100085239 Ga0068855_1000852395 473
284 3300005614 Ga0068856_100026950 Ga0068856_1000269501 473
285 3300005616 Ga0068852_100001336 Ga0068852_10000133613 473
286 3300005616 Ga0068852_100010220 Ga0068852_1000102207 473
287 3300005617 Ga0068859_100004889 Ga0068859_1000048897 473
288 3300005618 Ga0068864_100022005 Ga0068864_1000220058 473
289 3300005618 Ga0068864_100030978 Ga0068864_1000309784 473
290 3300005719 Ga0068861_100000005 Ga0068861_10000000524 473
291 3300005842 Ga0068858_100000777 Ga0068858_10000077721 473
292 3300005842 Ga0068858_100031104 Ga0068858_1000311045 473
293 3300006353 Ga0075370_10042569 Ga0075370_100425692 473
294 3300009093 Ga0105240_10008624 Ga0105240_100086249 473
295 3300009098 Ga0105245_10002260 Ga0105245_1000226011 473
296 3300009177 Ga0105248_10003098 Ga0105248_1000309812 473
297 3300009551 Ga0105238_10020144 Ga0105238_100201446 473
298 3300013104 Ga0157370_10060808 Ga0157370_100608082 473
299 3300013296 Ga0157374_10112266 Ga0157374_101122663 473
300 3300013297 Ga0157378_10062593 Ga0157378_100625934 473
301 3300014325 Ga0163163_10000123 Ga0163163_1000012344 473
302 3300015690 Ga0183363_1001 Ga0183363_1001144 473
303 3300025245 Ga0207425_1000020 Ga0207425_1000020350 473
304 3300025261 Ga0209233_1000142 Ga0209233_1000142119 473
305 3300025263 Ga0209565_1000210 Ga0209565_100021014 473
306 3300025273 Ga0209673_1007764 Ga0209673_10077645 473
307 3300025292 Ga0209676_1016025 Ga0209676_10160251 473
308 3300025294 Ga0209025_1000326 Ga0209025_100032666 473
309 3300025295 Ga0209564_1001114 Ga0209564_100111435 473
310 3300025295 Ga0209564_1015718 Ga0209564_10157184 473
311 3300025297 Ga0209758_1000004 Ga0209758_1000004614 473
312 3300025297 Ga0209758_1000894 Ga0209758_100089443 473
313 3300025298 Ga0209050_1000001 Ga0209050_10000012577 473
314 3300025298 Ga0209050_1000026 Ga0209050_100002662 473
315 3300025298 Ga0209050_1000173 Ga0209050_100017335 473
316 3300025303 Ga0209051_1000476 Ga0209051_100047660 473
317 3300025304 Ga0209257_1000009 Ga0209257_100000962 473
318 3300025304 Ga0209257_1000196 Ga0209257_100019635 473
319 3300025304 Ga0209257_1002949 Ga0209257_10029493 473
320 3300025904 Ga0207647_10015278 Ga0207647_100152783 473
321 3300025909 Ga0207705_10000009 Ga0207705_10000009526 473
322 3300025913 Ga0207695_10008440 Ga0207695_1000844010 473
323 3300025924 Ga0207694_10047916 Ga0207694_100479162 473
324 3300025927 Ga0207687_10001763 Ga0207687_1000176311 473
325 3300025929 Ga0207664_10151664 Ga0207664_101516642 473
326 3300025932 Ga0207690_10035337 Ga0207690_100353373 473
327 3300025941 Ga0207711_10003251 Ga0207711_100032515 473
328 3300025949 Ga0207667_10122692 Ga0207667_101226921 473
329 3300025981 Ga0207640_10008882 Ga0207640_100088825 473
330 3300025986 Ga0207658_10000291 Ga0207658_1000029129 473
331 3300026035 Ga0207703_10001013 Ga0207703_1000101315 473
332 3300026035 Ga0207703_10024463 Ga0207703_100244634 473
333 3300026067 Ga0207678_10175246 Ga0207678_101752462 473
334 3300026078 Ga0207702_10014674 Ga0207702_100146747 473
335 3300026118 Ga0207675_100000020 Ga0207675_10000002044 473
336 3300026142 Ga0207698_10000111 Ga0207698_1000011124 473
337 3300026142 Ga0207698_10079100 Ga0207698_100791003 473
338 3300028379 Ga0268266_10008036 Ga0268266_100080363 473
339 3300028379 Ga0268266_10187890 Ga0268266_101878901 473
340 3300028800 Ga0265338_10012923 Ga0265338_100129232 473
341 3300031616 Ga0307508_10013919 Ga0307508_100139192 473
342 3300032004 Ga0307414_10125643 Ga0307414_101256432 473
343 3300035172 Ga0373955_0005549 Ga0373955_0005549_2022_3467 473
344 3300036401 Ga0373937_0058132 Ga0373937_0058132_414_1859 473
345 3300037312 Ga0395899_0002657 Ga0395899_0002657_11578_13026 473
346 3300037312 Ga0395899_0011904 Ga0395899_0011904_2252_3712 473
347 3300037466 Ga0395898_0019791 Ga0395898_0019791_3410_4858 473
348 3300037466 Ga0395898_0219438 Ga0395898_0219438_250_1695 473
349 3300041410 Ga0439461_0000297 Ga0439461_0000297_279_1715 473
350 3300041413 Ga0439465_0000420 Ga0439465_0000420_2625_4061 473
351 3300041997 Ga0439431_0000645 Ga0439431_0000645_4540_5976 473
352 3300041997 Ga0439431_0000807 Ga0439431_0000807_4902_6347 473
353 3300042004 Ga0439445_0008249 Ga0439445_0008249_458_1894 473
354 3300042015 Ga0439462_0000249 Ga0439462_0000249_3444_4880 473
355 3300042435 Ga0439434_0000823 Ga0439434_0000823_1776_3212 473
356 3300044694 Ga0466963_0026776 Ga0466963_0026776_32_1477 473
357 3300044842 Ga0466957_0000560 Ga0466957_0000560_16655_18100 473
358 3300044842 Ga0466957_0031342 Ga0466957_0031342_636_2081 473
359 3300045836 Ga0466958_0001653 Ga0466958_0001653_2078_3523 473
360 3300045976 Ga0466967_0003617 Ga0466967_0003617_460_1905 473
361 3300045976 Ga0466967_0071267 Ga0466967_0071267_216_1661 473
362 3300046460 Ga0495638_0002237 Ga0495638_0002237_6447_7901 473
363 3300046506 Ga0495583_0011071 Ga0495583_0011071_1824_3263 473
364 3300046522 Ga0495643_0004044 Ga0495643_0004044_8010_9461 473
365 3300046524 Ga0495648_0028854 Ga0495648_0028854_2092_3543 473
366 3300046616 Ga0495668_0014658 Ga0495668_0014658_283_1728 473
367 3300046616 Ga0495668_0069472 Ga0495668_0069472_62_1504 473
368 3300046660 Ga0495625_0000332 Ga0495625_0000332_65811_67250 473
369 3300046660 Ga0495625_0018991 Ga0495625_0018991_3052_4494 473
370 3300046679 Ga0495623_0004939 Ga0495623_0004939_2410_3855 473
371 3300047445 Ga0495677_0044726 Ga0495677_0044726_161_1612 473
372 3300047445 Ga0495677_0046206 Ga0495677_0046206_27_1466 473
373 3300047472 Ga0495686_0005596 Ga0495686_0005596_6305_7759 473
374 3300048088 Ga0495602_0031175 Ga0495602_0031175_3257_4702 473
375 3300048918 Ga0496115_0000134 Ga0496115_0000134_6418_7863 473
376 3300048924 Ga0496121_0127269 Ga0496121_0127269_135_1571 473
377 3300049742 Ga0501080_0056978 Ga0501080_0056978_602_2047 473
378 3300053087 Ga0500643_004784 Ga0500643_004784_4451_5890 473
379 3300053096 Ga0500641_0029798 Ga0500641_0029798_487_1941 473
380 3300053098 Ga0500650_0064011 Ga0500650_0064011_52_1494 473
381 3300053104 Ga0500556_0000031 Ga0500556_0000031_2992_4434 473
382 3300053124 Ga0500617_020891 Ga0500617_020891_1065_2507 473
383 3300053130 Ga0500642_0000003 Ga0500642_0000003_124305_125747 473
384 3300053139 Ga0500568_0014770 Ga0500568_0014770_54_1490 473
385 3300053730 Ga0500645_000452 Ga0500645_000452_7319_8758 473
386 3300053730 Ga0500645_003367 Ga0500645_003367_2677_4155 473
387 3300053730 Ga0500645_013667 Ga0500645_013667_300_1745 473
388 iso_pu_bacteria 2510917020 2511121040 473
389 iso_pu_bacteria 2512564014 2512642124 473
390 iso_pu_bacteria 2582581279 2585148172 473
391 iso_pu_bacteria 2582581280 2585155153 473
392 iso_pu_bacteria 2582581293 2585194834 473
393 iso_pu_bacteria 2582581305 2585260016 473
394 iso_pu_bacteria 2585428106 2587917077 473
395 iso_pu_bacteria 2643221541 2643726849 473
396 iso_pu_bacteria 2643221545 2643747368 473
397 iso_pu_bacteria 2643221552 2643782339 473
398 iso_pu_bacteria 2643221584 2643929848 473
399 iso_pu_bacteria 2643221605 2644040746 473
400 iso_pu_bacteria 2643221606 2644046110 473
401 iso_pu_bacteria 2643221640 2644223718 473
402 iso_pu_bacteria 2643221642 2644236194 473
403 iso_pu_bacteria 2643221671 2644393079 473
404 iso_pu_bacteria 2643221691 2644507433 473
405 iso_pu_bacteria 2775507255 2778123980 473
406 iso_pu_bacteria 2791355048 2792461738 473
407 iso_pu_bacteria 2808606401 2809063649 473
408 iso_pu_bacteria 2808606404 2809079733 473
409 iso_pu_bacteria 2808606405 2809084098 473
410 iso_pu_bacteria 2818991435 2819538484 473
411 iso_pu_bacteria 2818991454 2819648071 473
412 iso_pu_bacteria 2843744320 2843745899 473
413 iso_pu_bacteria 2849560528 2849561741 473
414 iso_pu_bacteria 2849573788 2849577759 473
415 iso_pu_bacteria 2851153111 2851156679 473
416 iso_pu_bacteria 2857504554 2857506112 473
417 iso_pu_bacteria 2880518877 2880519422 473
418 iso_pu_bacteria 2882806704 2882808367 473
419 iso_pu_bacteria 2884960567 2884963470 473
420 iso_pu_bacteria 2898329390 2898330692 473
421 iso_pu_bacteria 2919709256 2919711160 473
422 iso_pu_bacteria 2928531327 2928534608 473
423 3300005262 Ga0065165_1004716 Ga0065165_10047167 474
424 3300005293 Ga0065715_10097503 Ga0065715_100975033 474
425 3300005364 Ga0070673_100092613 Ga0070673_1000926132 474
426 3300005548 Ga0070665_100026184 Ga0070665_1000261845 474
427 3300005618 Ga0068864_100011026 Ga0068864_1000110265 474
428 3300005841 Ga0068863_100068959 Ga0068863_1000689592 474
429 3300009177 Ga0105248_10329014 Ga0105248_103290142 474
430 3300014325 Ga0163163_10054955 Ga0163163_100549552 474
431 3300025907 Ga0207645_10132882 Ga0207645_101328821 474
432 3300025931 Ga0207644_10016847 Ga0207644_100168474 474
433 3300025931 Ga0207644_10098658 Ga0207644_100986582 474
434 3300025931 Ga0207644_10160184 Ga0207644_101601842 474
435 3300025941 Ga0207711_10005998 Ga0207711_100059987 474
436 3300025960 Ga0207651_10011173 Ga0207651_100111732 474
437 3300026088 Ga0207641_10052963 Ga0207641_100529632 474
438 3300026095 Ga0207676_10024910 Ga0207676_100249102 474
439 3300027876 Ga0209974_10000935 Ga0209974_100009354 474
440 3300028786 Ga0307517_10003203 Ga0307517_1000320317 474
441 3300028786 Ga0307517_10122409 Ga0307517_101224091 474
442 3300031456 Ga0307513_10007104 Ga0307513_1000710414 474
443 3300031548 Ga0307408_100034134 Ga0307408_1000341342 474
444 3300031548 Ga0307408_100064942 Ga0307408_1000649421 474
445 3300031824 Ga0307413_10003794 Ga0307413_100037941 474
446 3300031824 Ga0307413_10025760 Ga0307413_100257602 474
447 3300031852 Ga0307410_10002446 Ga0307410_100024469 474
448 3300031852 Ga0307410_10003744 Ga0307410_100037442 474
449 3300031852 Ga0307410_10009876 Ga0307410_100098765 474
450 3300031852 Ga0307410_10036364 Ga0307410_100363642 474
451 3300031901 Ga0307406_10007470 Ga0307406_100074702 474
452 3300031901 Ga0307406_10090504 Ga0307406_100905042 474
453 3300031903 Ga0307407_10077426 Ga0307407_100774262 474
454 3300031911 Ga0307412_10010645 Ga0307412_100106454 474
455 3300031911 Ga0307412_10023286 Ga0307412_100232863 474
456 3300031995 Ga0307409_100005102 Ga0307409_1000051027 474
457 3300031995 Ga0307409_100033235 Ga0307409_1000332352 474
458 3300031995 Ga0307409_100043149 Ga0307409_1000431492 474
459 3300031995 Ga0307409_100109535 Ga0307409_1001095352 474
460 3300032002 Ga0307416_100092614 Ga0307416_1000926143 474
461 3300032002 Ga0307416_100204353 Ga0307416_1002043531 474
462 3300032004 Ga0307414_10016703 Ga0307414_100167033 474
463 3300032004 Ga0307414_10027143 Ga0307414_100271434 474
464 3300032004 Ga0307414_10045572 Ga0307414_100455723 474
465 3300032004 Ga0307414_10070467 Ga0307414_100704673 474
466 3300032005 Ga0307411_10003505 Ga0307411_1000350510 474
467 3300032005 Ga0307411_10061254 Ga0307411_100612541 474
468 3300032126 Ga0307415_100070909 Ga0307415_1000709093 474
469 3300033180 Ga0307510_10043919 Ga0307510_100439192 474
470 3300037418 Ga0395900_0044693 Ga0395900_0044693_3034_4482 474
471 3300037471 Ga0395905_0002515 Ga0395905_0002515_7369_8817 474
472 3300037471 Ga0395905_0074500 Ga0395905_0074500_642_2087 474
473 3300046525 Ga0495663_0028431 Ga0495663_0028431_132_1580 474
474 3300046528 Ga0495642_0012414 Ga0495642_0012414_1776_3224 474
475 3300046660 Ga0495625_0046856 Ga0495625_0046856_10_1458 474
476 3300046684 Ga0495669_0000044 Ga0495669_0000044_42605_44053 474
477 3300046691 Ga0495670_0027463 Ga0495670_0027463_342_1793 474
478 3300046691 Ga0495670_0088067 Ga0495670_0088067_34_1482 474
479 3300047320 Ga0495672_0017193 Ga0495672_0017193_1135_2583 474
480 3300047445 Ga0495677_0009768 Ga0495677_0009768_807_2255 474
481 3300047445 Ga0495677_0017382 Ga0495677_0017382_438_1886 474
482 3300047445 Ga0495677_0020464 Ga0495677_0020464_305_1753 474
483 3300048903 Ga0496100_0129311 Ga0496100_0129311_198_1646 474
484 3300048905 Ga0496102_0095343 Ga0496102_0095343_172_1620 474
485 3300048909 Ga0496106_0113377 Ga0496106_0113377_451_1899 474
486 3300048913 Ga0496110_0036585 Ga0496110_0036585_1568_3016 474
487 3300048915 Ga0496112_0014185 Ga0496112_0014185_1113_2561 474
488 3300048928 Ga0496125_0061058 Ga0496125_0061058_558_2003 474
489 3300049581 Ga0501047_0054093 Ga0501047_0054093_1184_2632 474
490 3300053108 Ga0500562_004945 Ga0500562_004945_1597_3078 474
491 3300053136 Ga0500559_0017612 Ga0500559_0017612_339_1778 474
492 3300053723 Ga0500567_000103 Ga0500567_000103_15422_16861 474
493 3300053729 Ga0500625_000029 Ga0500625_000029_9773_11212 474
494 iso_pu_bacteria 2510917021 2511130120 474
495 iso_pu_bacteria 2643221560 2643820558 474
496 iso_pu_bacteria 2643221563 2643836393 474
497 iso_pu_bacteria 2643221608 2644052869 474
498 iso_pu_bacteria 2852653556 2852653992 474
499 iso_pu_bacteria 2852680915 2852682844 474
500 iso_pu_bacteria 8054302542 8054304790 474
501 3300001904 JGI24736J21556_1002453 JGI24736J21556_10024532 475
502 3300001976 JGI24752J21851_1001304 JGI24752J21851_10013042 475
503 3300001989 JGI24739J22299_10005269 JGI24739J22299_100052695 475
504 3300001989 JGI24739J22299_10013062 JGI24739J22299_100130622 475
505 3300001990 JGI24737J22298_10004210 JGI24737J22298_100042102 475
506 3300001990 JGI24737J22298_10020850 JGI24737J22298_100208502 475
507 3300002067 JGI24735J21928_10000915 JGI24735J21928_100009153 475
508 3300002067 JGI24735J21928_10009418 JGI24735J21928_100094182 475
509 3300002067 JGI24735J21928_10015221 JGI24735J21928_100152212 475
510 3300002075 JGI24738J21930_10000424 JGI24738J21930_1000042411 475
511 3300002077 JGI24744J21845_10009416 JGI24744J21845_100094162 475
512 3300002459 JGI24751J29686_10004618 JGI24751J29686_100046183 475
513 3300003214 JGI25165J46597_1000043 JGI25165J46597_1000043195 475
514 3300005327 Ga0070658_10000779 Ga0070658_1000077910 475
515 3300005327 Ga0070658_10002006 Ga0070658_100020069 475
516 3300005327 Ga0070658_10002716 Ga0070658_100027162 475
517 3300005327 Ga0070658_10006118 Ga0070658_100061184 475
518 3300005327 Ga0070658_10010801 Ga0070658_100108014 475
519 3300005327 Ga0070658_10025186 Ga0070658_100251864 475
520 3300005327 Ga0070658_10059045 Ga0070658_100590453 475
521 3300005328 Ga0070676_10026726 Ga0070676_100267263 475
522 3300005331 Ga0070670_100000007 Ga0070670_100000007167 475
523 3300005331 Ga0070670_100076000 Ga0070670_1000760003 475
524 3300005334 Ga0068869_100000200 Ga0068869_1000002005 475
525 3300005334 Ga0068869_100037418 Ga0068869_1000374182 475
526 3300005335 Ga0070666_10000098 Ga0070666_1000009817 475
527 3300005335 Ga0070666_10007850 Ga0070666_100078507 475
528 3300005335 Ga0070666_10013559 Ga0070666_100135595 475
529 3300005336 Ga0070680_100020235 Ga0070680_1000202352 475
530 3300005338 Ga0068868_100000049 Ga0068868_10000004963 475
531 3300005338 Ga0068868_100003120 Ga0068868_1000031207 475
532 3300005338 Ga0068868_100119874 Ga0068868_1001198742 475
533 3300005339 Ga0070660_100002130 Ga0070660_10000213011 475
534 3300005339 Ga0070660_100010609 Ga0070660_1000106093 475
535 3300005339 Ga0070660_100028758 Ga0070660_1000287582 475
536 3300005339 Ga0070660_100065253 Ga0070660_1000652532 475
537 3300005339 Ga0070660_100127423 Ga0070660_1001274232 475
538 3300005341 Ga0070691_10004611 Ga0070691_100046112 475
539 3300005344 Ga0070661_100068906 Ga0070661_1000689063 475
540 3300005347 Ga0070668_100000835 Ga0070668_1000008353 475
541 3300005347 Ga0070668_100006292 Ga0070668_1000062928 475
542 3300005353 Ga0070669_100000029 Ga0070669_10000002991 475
543 3300005353 Ga0070669_100000433 Ga0070669_10000043312 475
544 3300005353 Ga0070669_100003517 Ga0070669_1000035174 475
545 3300005354 Ga0070675_100013925 Ga0070675_1000139252 475
546 3300005355 Ga0070671_100000016 Ga0070671_10000001665 475
547 3300005355 Ga0070671_100000145 Ga0070671_1000001456 475
548 3300005355 Ga0070671_100009488 Ga0070671_1000094887 475
549 3300005355 Ga0070671_100019072 Ga0070671_1000190726 475
550 3300005355 Ga0070671_100125969 Ga0070671_1001259692 475
551 3300005355 Ga0070671_100141879 Ga0070671_1001418792 475
552 3300005355 Ga0070671_100219396 Ga0070671_1002193961 475
553 3300005356 Ga0070674_100017214 Ga0070674_1000172143 475
554 3300005364 Ga0070673_100000006 Ga0070673_100000006145 475
555 3300005366 Ga0070659_100001710 Ga0070659_10000171014 475
556 3300005366 Ga0070659_100002355 Ga0070659_1000023559 475
557 3300005366 Ga0070659_100126735 Ga0070659_1001267351 475
558 3300005366 Ga0070659_100149712 Ga0070659_1001497122 475
559 3300005367 Ga0070667_100000155 Ga0070667_10000015567 475
560 3300005440 Ga0070705_100033162 Ga0070705_1000331622 475
561 3300005445 Ga0070708_100043566 Ga0070708_1000435662 475
562 3300005455 Ga0070663_100000291 Ga0070663_1000002916 475
563 3300005456 Ga0070678_100022573 Ga0070678_1000225733 475
564 3300005456 Ga0070678_100027109 Ga0070678_1000271094 475
565 3300005456 Ga0070678_100088021 Ga0070678_1000880213 475
566 3300005457 Ga0070662_100002319 Ga0070662_1000023192 475
567 3300005457 Ga0070662_100012864 Ga0070662_1000128645 475
568 3300005457 Ga0070662_100028476 Ga0070662_1000284764 475
569 3300005457 Ga0070662_100055200 Ga0070662_1000552003 475
570 3300005458 Ga0070681_10007565 Ga0070681_100075655 475
571 3300005458 Ga0070681_10166681 Ga0070681_101666812 475
572 3300005459 Ga0068867_100000001 Ga0068867_100000001390 475
573 3300005530 Ga0070679_100014656 Ga0070679_1000146565 475
574 3300005530 Ga0070679_100023960 Ga0070679_1000239602 475
575 3300005539 Ga0068853_100004158 Ga0068853_10000415810 475
576 3300005548 Ga0070665_100002155 Ga0070665_1000021558 475
577 3300005548 Ga0070665_100002676 Ga0070665_1000026768 475
578 3300005548 Ga0070665_100005588 Ga0070665_1000055883 475
579 3300005548 Ga0070665_100021024 Ga0070665_1000210247 475
580 3300005548 Ga0070665_100055792 Ga0070665_1000557922 475
581 3300005548 Ga0070665_100059894 Ga0070665_1000598944 475
582 3300005563 Ga0068855_100000023 Ga0068855_10000002349 475
583 3300005563 Ga0068855_100010626 Ga0068855_1000106266 475
584 3300005563 Ga0068855_100115866 Ga0068855_1001158662 475
585 3300005563 Ga0068855_100123321 Ga0068855_1001233213 475
586 3300005564 Ga0070664_100015334 Ga0070664_1000153342 475
587 3300005578 Ga0068854_100000224 Ga0068854_10000022430 475
588 3300005578 Ga0068854_100067457 Ga0068854_1000674572 475
589 3300005578 Ga0068854_100102845 Ga0068854_1001028452 475
590 3300005614 Ga0068856_100149157 Ga0068856_1001491572 475
591 3300005616 Ga0068852_100007968 Ga0068852_1000079683 475
592 3300005617 Ga0068859_100003218 Ga0068859_10000321815 475
593 3300005618 Ga0068864_100000128 Ga0068864_10000012838 475
594 3300005618 Ga0068864_100030737 Ga0068864_1000307372 475
595 3300005719 Ga0068861_100109813 Ga0068861_1001098132 475
596 3300005834 Ga0068851_10005214 Ga0068851_100052144 475
597 3300005841 Ga0068863_100000360 Ga0068863_10000036040 475
598 3300005841 Ga0068863_100027645 Ga0068863_1000276456 475
599 3300005841 Ga0068863_100034947 Ga0068863_1000349473 475
600 3300005841 Ga0068863_100066924 Ga0068863_1000669242 475
601 3300005842 Ga0068858_100062004 Ga0068858_1000620043 475
602 3300005843 Ga0068860_100000047 Ga0068860_100000047168 475
603 3300005843 Ga0068860_100007191 Ga0068860_1000071915 475
604 3300005844 Ga0068862_100000606 Ga0068862_10000060625 475
605 3300005844 Ga0068862_100001031 Ga0068862_10000103126 475
606 3300005981 Ga0081538_10009804 Ga0081538_100098044 475
607 3300005985 Ga0081539_10007513 Ga0081539_100075133 475
608 3300006028 Ga0070717_10008928 Ga0070717_100089282 475
609 3300006237 Ga0097621_100006540 Ga0097621_1000065405 475
610 3300006358 Ga0068871_100024993 Ga0068871_1000249935 475
611 3300006846 Ga0075430_100161703 Ga0075430_1001617031 475
612 3300006881 Ga0068865_100000003 Ga0068865_100000003221 475
613 3300006881 Ga0068865_100009151 Ga0068865_1000091512 475
614 3300006881 Ga0068865_100048234 Ga0068865_1000482343 475
615 3300006931 Ga0097620_100003218 Ga0097620_10000321815 475
616 3300009093 Ga0105240_10111858 Ga0105240_101118582 475
617 3300009093 Ga0105240_10144090 Ga0105240_101440903 475
618 3300009098 Ga0105245_10000113 Ga0105245_1000011373 475
619 3300009098 Ga0105245_10013994 Ga0105245_100139944 475
620 3300009098 Ga0105245_10047951 Ga0105245_100479512 475
621 3300009101 Ga0105247_10000521 Ga0105247_1000052114 475
622 3300009148 Ga0105243_10000938 Ga0105243_1000093822 475
623 3300009174 Ga0105241_10025975 Ga0105241_100259753 475
624 3300009176 Ga0105242_10000165 Ga0105242_1000016526 475
625 3300009177 Ga0105248_10318656 Ga0105248_103186561 475
626 3300009551 Ga0105238_10007800 Ga0105238_100078002 475
627 3300009553 Ga0105249_10009549 Ga0105249_100095498 475
628 3300009553 Ga0105249_10034291 Ga0105249_100342913 475
629 3300009553 Ga0105249_10047506 Ga0105249_100475064 475
630 3300011119 Ga0105246_10012042 Ga0105246_100120422 475
631 3300013100 Ga0157373_10009105 Ga0157373_100091053 475
632 3300013100 Ga0157373_10058420 Ga0157373_100584202 475
633 3300013100 Ga0157373_10065747 Ga0157373_100657472 475
634 3300013104 Ga0157370_10000069 Ga0157370_1000006987 475
635 3300013105 Ga0157369_10191142 Ga0157369_101911422 475
636 3300013296 Ga0157374_10001016 Ga0157374_100010168 475
637 3300013297 Ga0157378_10001151 Ga0157378_100011518 475
638 3300013297 Ga0157378_10020678 Ga0157378_100206783 475
639 3300013306 Ga0163162_10003018 Ga0163162_100030186 475
640 3300013306 Ga0163162_10011232 Ga0163162_100112325 475
641 3300013306 Ga0163162_10032482 Ga0163162_100324824 475
642 3300013307 Ga0157372_10000605 Ga0157372_100006056 475
643 3300013307 Ga0157372_10019824 Ga0157372_100198247 475
644 3300013307 Ga0157372_10119158 Ga0157372_101191582 475
645 3300014326 Ga0157380_10014535 Ga0157380_100145355 475
646 3300014968 Ga0157379_10029120 Ga0157379_100291203 475
647 3300014968 Ga0157379_10223187 Ga0157379_102231871 475
648 3300014969 Ga0157376_10000089 Ga0157376_1000008974 475
649 3300017792 Ga0163161_10058287 Ga0163161_100582872 475
650 3300021384 Ga0213876_10000791 Ga0213876_1000079111 475
651 3300025231 Ga0207427_100541 Ga0207427_1005415 475
652 3300025250 Ga0209026_1001356 Ga0209026_10013562 475
653 3300025254 Ga0209148_1000238 Ga0209148_100023887 475
654 3300025261 Ga0209233_1000079 Ga0209233_100007975 475
655 3300025290 Ga0207673_1001768 Ga0207673_10017682 475
656 3300025315 Ga0207697_10000164 Ga0207697_1000016429 475
657 3300025321 Ga0207656_10018821 Ga0207656_100188212 475
658 3300025900 Ga0207710_10001431 Ga0207710_100014311 475
659 3300025903 Ga0207680_10000130 Ga0207680_1000013020 475
660 3300025903 Ga0207680_10003644 Ga0207680_100036443 475
661 3300025903 Ga0207680_10010937 Ga0207680_100109373 475
662 3300025904 Ga0207647_10001216 Ga0207647_100012164 475
663 3300025904 Ga0207647_10001683 Ga0207647_100016839 475
664 3300025904 Ga0207647_10004249 Ga0207647_100042499 475
665 3300025904 Ga0207647_10018508 Ga0207647_100185086 475
666 3300025907 Ga0207645_10036749 Ga0207645_100367493 475
667 3300025907 Ga0207645_10094666 Ga0207645_100946661 475
668 3300025909 Ga0207705_10000121 Ga0207705_1000012148 475
669 3300025909 Ga0207705_10001242 Ga0207705_1000124216 475
670 3300025909 Ga0207705_10001784 Ga0207705_1000178412 475
671 3300025909 Ga0207705_10016359 Ga0207705_100163595 475
672 3300025909 Ga0207705_10021229 Ga0207705_100212293 475
673 3300025909 Ga0207705_10038257 Ga0207705_100382573 475
674 3300025909 Ga0207705_10089686 Ga0207705_100896861 475
675 3300025912 Ga0207707_10034926 Ga0207707_100349262 475
676 3300025913 Ga0207695_10001288 Ga0207695_1000128826 475
677 3300025913 Ga0207695_10002305 Ga0207695_1000230516 475
678 3300025913 Ga0207695_10217672 Ga0207695_102176722 475
679 3300025917 Ga0207660_10000681 Ga0207660_100006816 475
680 3300025919 Ga0207657_10001673 Ga0207657_1000167321 475
681 3300025919 Ga0207657_10005111 Ga0207657_100051112 475
682 3300025919 Ga0207657_10006851 Ga0207657_100068513 475
683 3300025919 Ga0207657_10016359 Ga0207657_100163593 475
684 3300025919 Ga0207657_10078521 Ga0207657_100785212 475
685 3300025919 Ga0207657_10105585 Ga0207657_101055852 475
686 3300025919 Ga0207657_10127378 Ga0207657_101273781 475
687 3300025920 Ga0207649_10015823 Ga0207649_100158233 475
688 3300025920 Ga0207649_10107492 Ga0207649_101074922 475
689 3300025921 Ga0207652_10004669 Ga0207652_100046697 475
690 3300025923 Ga0207681_10000040 Ga0207681_1000004090 475
691 3300025923 Ga0207681_10000153 Ga0207681_1000015321 475
692 3300025924 Ga0207694_10015899 Ga0207694_100158992 475
693 3300025925 Ga0207650_10000030 Ga0207650_10000030184 475
694 3300025925 Ga0207650_10030386 Ga0207650_100303865 475
695 3300025926 Ga0207659_10010577 Ga0207659_100105774 475
696 3300025927 Ga0207687_10000225 Ga0207687_1000022544 475
697 3300025927 Ga0207687_10146661 Ga0207687_101466612 475
698 3300025931 Ga0207644_10000023 Ga0207644_1000002365 475
699 3300025931 Ga0207644_10000060 Ga0207644_1000006038 475
700 3300025931 Ga0207644_10000230 Ga0207644_1000023024 475
701 3300025931 Ga0207644_10001257 Ga0207644_100012575 475
702 3300025931 Ga0207644_10037750 Ga0207644_100377502 475
703 3300025931 Ga0207644_10093402 Ga0207644_100934022 475
704 3300025931 Ga0207644_10152169 Ga0207644_101521692 475
705 3300025932 Ga0207690_10000116 Ga0207690_1000011652 475
706 3300025932 Ga0207690_10005830 Ga0207690_100058303 475
707 3300025933 Ga0207706_10000791 Ga0207706_1000079135 475
708 3300025933 Ga0207706_10002854 Ga0207706_1000285412 475
709 3300025933 Ga0207706_10009488 Ga0207706_1000948811 475
710 3300025933 Ga0207706_10025811 Ga0207706_100258115 475
711 3300025933 Ga0207706_10034999 Ga0207706_100349992 475
712 3300025934 Ga0207686_10002854 Ga0207686_100028542 475
713 3300025935 Ga0207709_10000173 Ga0207709_1000017370 475
714 3300025938 Ga0207704_10000001 Ga0207704_10000001298 475
715 3300025938 Ga0207704_10010909 Ga0207704_100109094 475
716 3300025940 Ga0207691_10002685 Ga0207691_1000268516 475
717 3300025940 Ga0207691_10073318 Ga0207691_100733182 475
718 3300025941 Ga0207711_10000107 Ga0207711_1000010770 475
719 3300025941 Ga0207711_10000464 Ga0207711_1000046422 475
720 3300025941 Ga0207711_10001704 Ga0207711_1000170415 475
721 3300025941 Ga0207711_10006796 Ga0207711_100067962 475
722 3300025941 Ga0207711_10022921 Ga0207711_100229214 475
723 3300025941 Ga0207711_10033348 Ga0207711_100333483 475
724 3300025941 Ga0207711_10245817 Ga0207711_102458171 475
725 3300025942 Ga0207689_10000744 Ga0207689_100007445 475
726 3300025942 Ga0207689_10032872 Ga0207689_100328723 475
727 3300025945 Ga0207679_10009675 Ga0207679_100096756 475
728 3300025949 Ga0207667_10000016 Ga0207667_1000001658 475
729 3300025949 Ga0207667_10040012 Ga0207667_100400122 475
730 3300025949 Ga0207667_10138977 Ga0207667_101389773 475
731 3300025960 Ga0207651_10000002 Ga0207651_1000000259 475
732 3300025960 Ga0207651_10001783 Ga0207651_100017839 475
733 3300025960 Ga0207651_10050724 Ga0207651_100507241 475
734 3300025961 Ga0207712_10017704 Ga0207712_100177043 475
735 3300025972 Ga0207668_10000010 Ga0207668_1000001029 475
736 3300025972 Ga0207668_10000230 Ga0207668_1000023026 475
737 3300025972 Ga0207668_10000754 Ga0207668_1000075410 475
738 3300025981 Ga0207640_10000063 Ga0207640_100000636 475
739 3300025981 Ga0207640_10093007 Ga0207640_100930071 475
740 3300025986 Ga0207658_10000265 Ga0207658_1000026539 475
741 3300025986 Ga0207658_10002799 Ga0207658_1000279912 475
742 3300025986 Ga0207658_10024878 Ga0207658_100248784 475
743 3300025986 Ga0207658_10045530 Ga0207658_100455302 475
744 3300026023 Ga0207677_10000030 Ga0207677_1000003078 475
745 3300026023 Ga0207677_10002440 Ga0207677_100024401 475
746 3300026023 Ga0207677_10003169 Ga0207677_100031695 475
747 3300026035 Ga0207703_10000959 Ga0207703_100009592 475
748 3300026035 Ga0207703_10007167 Ga0207703_100071678 475
749 3300026035 Ga0207703_10013579 Ga0207703_100135793 475
750 3300026041 Ga0207639_10093024 Ga0207639_100930242 475
751 3300026067 Ga0207678_10001173 Ga0207678_100011739 475
752 3300026067 Ga0207678_10099449 Ga0207678_100994491 475
753 3300026078 Ga0207702_10005143 Ga0207702_1000514311 475
754 3300026078 Ga0207702_10040115 Ga0207702_100401153 475
755 3300026088 Ga0207641_10003106 Ga0207641_1000310611 475
756 3300026088 Ga0207641_10006239 Ga0207641_100062397 475
757 3300026088 Ga0207641_10022545 Ga0207641_100225455 475
758 3300026089 Ga0207648_10000001 Ga0207648_1000000159 475
759 3300026089 Ga0207648_10005659 Ga0207648_1000565914 475
760 3300026095 Ga0207676_10000183 Ga0207676_1000018316 475
761 3300026095 Ga0207676_10002964 Ga0207676_100029644 475
762 3300026095 Ga0207676_10004432 Ga0207676_100044324 475
763 3300026118 Ga0207675_100000582 Ga0207675_10000058231 475
764 3300026121 Ga0207683_10031600 Ga0207683_100316003 475
765 3300026121 Ga0207683_10043198 Ga0207683_100431984 475
766 3300026142 Ga0207698_10004991 Ga0207698_100049913 475
767 3300027378 Ga0209981_1000450 Ga0209981_10004504 475
768 3300027543 Ga0209999_1001309 Ga0209999_10013094 475
769 3300028379 Ga0268266_10000003 Ga0268266_10000003901 475
770 3300028379 Ga0268266_10000656 Ga0268266_1000065628 475
771 3300028379 Ga0268266_10005609 Ga0268266_100056095 475
772 3300028379 Ga0268266_10065129 Ga0268266_100651292 475
773 3300028380 Ga0268265_10000098 Ga0268265_1000009851 475
774 3300028380 Ga0268265_10001171 Ga0268265_1000117116 475
775 3300028381 Ga0268264_10000125 Ga0268264_1000012517 475
776 3300028381 Ga0268264_10000141 Ga0268264_1000014189 475
777 3300028800 Ga0265338_10103029 Ga0265338_101030292 475
778 3300031456 Ga0307513_10000077 Ga0307513_1000007715 475
779 3300031456 Ga0307513_10008325 Ga0307513_1000832510 475
780 3300031824 Ga0307413_10011429 Ga0307413_100114292 475
781 3300031824 Ga0307413_10024251 Ga0307413_100242512 475
782 3300031852 Ga0307410_10000171 Ga0307410_100001717 475
783 3300031852 Ga0307410_10125035 Ga0307410_101250352 475
784 3300031901 Ga0307406_10029628 Ga0307406_100296281 475
785 3300031903 Ga0307407_10001776 Ga0307407_100017762 475
786 3300031995 Ga0307409_100023720 Ga0307409_1000237202 475
787 3300032002 Ga0307416_100000451 Ga0307416_10000045116 475
788 3300032004 Ga0307414_10000914 Ga0307414_1000091414 475
789 3300032004 Ga0307414_10005824 Ga0307414_100058242 475
790 3300032005 Ga0307411_10085085 Ga0307411_100850852 475
791 3300032005 Ga0307411_10093961 Ga0307411_100939612 475
792 3300032126 Ga0307415_100091584 Ga0307415_1000915842 475
793 3300035113 Ga0373936_0015112 Ga0373936_0015112_926_2377 475
794 3300035171 Ga0373946_0035131 Ga0373946_0035131_26_1477 475
795 3300035695 Ga0373927_0000831 Ga0373927_0000831_14189_15640 475
796 3300037068 Ga0373925_0000984 Ga0373925_0000984_16272_17723 475
797 3300037312 Ga0395899_0000395 Ga0395899_0000395_29486_30925 475
798 3300037312 Ga0395899_0009522 Ga0395899_0009522_2688_4136 475
799 3300037312 Ga0395899_0031785 Ga0395899_0031785_1182_2633 475
800 3300037312 Ga0395899_0060292 Ga0395899_0060292_488_1939 475
801 3300037312 Ga0395899_0088690 Ga0395899_0088690_305_1756 475
802 3300037312 Ga0395899_0139280 Ga0395899_0139280_14_1465 475
803 3300037312 Ga0395899_0139426 Ga0395899_0139426_14_1465 475
804 3300037418 Ga0395900_0000008 Ga0395900_0000008_46974_48422 475
805 3300037418 Ga0395900_0049269 Ga0395900_0049269_1695_3146 475
806 3300037418 Ga0395900_0150494 Ga0395900_0150494_97_1548 475
807 3300037418 Ga0395900_0261901 Ga0395900_0261901_14_1465 475
808 3300037466 Ga0395898_0007219 Ga0395898_0007219_2376_3824 475
809 3300037466 Ga0395898_0039258 Ga0395898_0039258_2916_4367 475
810 3300037466 Ga0395898_0240278 Ga0395898_0240278_263_1714 475
811 3300037471 Ga0395905_0011963 Ga0395905_0011963_892_2340 475
812 3300037471 Ga0395905_0062605 Ga0395905_0062605_1212_2663 475
813 3300037471 Ga0395905_0074477 Ga0395905_0074477_901_2352 475
814 3300038443 Ga0395901_0000008 Ga0395901_0000008_432044_433492 475
815 3300038443 Ga0395901_0014093 Ga0395901_0014093_4214_5665 475
816 3300038443 Ga0395901_0119948 Ga0395901_0119948_97_1548 475
817 3300038443 Ga0395901_0219488 Ga0395901_0219488_453_1919 475
818 3300038443 Ga0395901_0271819 Ga0395901_0271819_26_1477 475
819 3300038705 Ga0237819_00846 Ga0237819_00846_3976_5418 475
820 3300039437 Ga0436365_0480987 Ga0436365_0480987_2314_3765 475
821 3300039437 Ga0436365_1342500 Ga0436365_1342500_31687_33138 475
822 3300041462 Ga0451806_680459 Ga0451806_680459_1371_2810 475
823 3300042005 Ga0439448_0000252 Ga0439448_0000252_5787_7226 475
824 3300042005 Ga0439448_0002085 Ga0439448_0002085_977_2416 475
825 3300042012 Ga0439455_0006627 Ga0439455_0006627_272_1711 475
826 3300042157 Ga0439458_0000528 Ga0439458_0000528_2589_4028 475
827 3300042157 Ga0439458_0000550 Ga0439458_0000550_7458_8897 475
828 3300042157 Ga0439458_0002113 Ga0439458_0002113_1547_2986 475
829 3300044693 Ga0466961_0011905 Ga0466961_0011905_3733_5172 475
830 3300044693 Ga0466961_0091701 Ga0466961_0091701_401_1852 475
831 3300044719 Ga0466971_0003958 Ga0466971_0003958_2231_3670 475
832 3300044735 Ga0466968_0022779 Ga0466968_0022779_510_1949 475
833 3300044842 Ga0466957_0033408 Ga0466957_0033408_172_1623 475
834 3300044901 Ga0466960_0004332 Ga0466960_0004332_1840_3279 475
835 3300045051 Ga0451576_0112747 Ga0451576_0112747_1332_2780 475
836 3300045836 Ga0466958_0070759 Ga0466958_0070759_474_1991 475
837 3300045976 Ga0466967_0004762 Ga0466967_0004762_5541_6992 475
838 3300045976 Ga0466967_0060899 Ga0466967_0060899_127_1566 475
839 3300046499 Ga0495594_0063695 Ga0495594_0063695_478_1986 475
840 3300046525 Ga0495663_0005529 Ga0495663_0005529_870_2321 475
841 3300046539 Ga0495621_0000349 Ga0495621_0000349_2365_3816 475
842 3300046539 Ga0495621_0000432 Ga0495621_0000432_5195_6646 475
843 3300046539 Ga0495621_0032968 Ga0495621_0032968_244_1695 475
844 3300046691 Ga0495670_0004421 Ga0495670_0004421_3203_4654 475
845 3300046692 Ga0495671_0050737 Ga0495671_0050737_474_1928 475
846 3300048905 Ga0496102_0018995 Ga0496102_0018995_4327_5778 475
847 3300048905 Ga0496102_0129581 Ga0496102_0129581_68_1519 475
848 3300048905 Ga0496102_0162071 Ga0496102_0162071_40_1488 475
849 3300048906 Ga0496103_0072439 Ga0496103_0072439_77_1528 475
850 3300048909 Ga0496106_0000338 Ga0496106_0000338_18829_20343 475
851 3300048910 Ga0496107_0015199 Ga0496107_0015199_2386_3900 475
852 3300048911 Ga0496108_0001094 Ga0496108_0001094_10603_12054 475
853 3300048911 Ga0496108_0109446 Ga0496108_0109446_153_1604 475
854 3300048912 Ga0496109_0108966 Ga0496109_0108966_691_2202 475
855 3300048912 Ga0496109_0152687 Ga0496109_0152687_309_1760 475
856 3300048913 Ga0496110_0000347 Ga0496110_0000347_7259_8710 475
857 3300048914 Ga0496111_0002388 Ga0496111_0002388_5293_6744 475
858 3300048914 Ga0496111_0020528 Ga0496111_0020528_3158_4585 475
859 3300048915 Ga0496112_0001900 Ga0496112_0001900_10603_12054 475
860 3300048915 Ga0496112_0004060 Ga0496112_0004060_2060_3511 475
861 3300048915 Ga0496112_0115844 Ga0496112_0115844_487_1938 475
862 3300048916 Ga0496113_0000377 Ga0496113_0000377_18944_20455 475
863 3300048916 Ga0496113_0001402 Ga0496113_0001402_5284_6735 475
864 3300048918 Ga0496115_0000954 Ga0496115_0000954_8669_10120 475
865 3300048918 Ga0496115_0001701 Ga0496115_0001701_13278_14729 475
866 3300048918 Ga0496115_0056899 Ga0496115_0056899_954_2405 475
867 3300048920 Ga0496117_0017388 Ga0496117_0017388_2079_3518 475
868 3300048922 Ga0496119_0094698 Ga0496119_0094698_79_1518 475
869 3300048924 Ga0496121_0012664 Ga0496121_0012664_1895_3334 475
870 3300048925 Ga0496122_0002582 Ga0496122_0002582_6762_8204 475
871 3300048925 Ga0496122_0005688 Ga0496122_0005688_9780_11234 475
872 3300048925 Ga0496122_0006401 Ga0496122_0006401_6022_7461 475
873 3300048926 Ga0496123_0000155 Ga0496123_0000155_3550_5004 475
874 3300048926 Ga0496123_0000577 Ga0496123_0000577_37277_38719 475
875 3300048928 Ga0496125_0004173 Ga0496125_0004173_8313_9752 475
876 3300048928 Ga0496125_0025348 Ga0496125_0025348_1289_2737 475
877 3300049581 Ga0501047_0002252 Ga0501047_0002252_4345_5799 475
878 3300049663 Ga0501223_000193 Ga0501223_000193_13246_14763 475
879 3300049664 Ga0501224_000015 Ga0501224_000015_13246_14763 475
880 3300049668 Ga0501233_001277 Ga0501233_001277_2199_3650 475
881 3300049705 Ga0501225_0000038 Ga0501225_0000038_38075_39592 475
882 3300049707 Ga0501234_000254 Ga0501234_000254_1483_3000 475
883 3300049853 Ga0501226_000122 Ga0501226_000122_13246_14763 475
884 3300050491 nmdc:mga00v17_599_c1 nmdc:mga00v17_599_c1_3004_4455 475
885 3300050494 nmdc:mga06z11_62412_c1 nmdc:mga06z11_62412_c1_490_1932 475
886 3300050495 nmdc:mga04h51_5130_c1 nmdc:mga04h51_5130_c1_1124_2575 475
887 3300053087 Ga0500643_001071 Ga0500643_001071_14934_16376 475
888 3300053087 Ga0500643_003004 Ga0500643_003004_4633_6108 475
889 3300053087 Ga0500643_005712 Ga0500643_005712_3576_5024 475
890 3300053096 Ga0500641_0003922 Ga0500641_0003922_1144_2595 475
891 3300053103 Ga0500555_006371 Ga0500555_006371_1624_3075 475
892 3300053108 Ga0500562_014739 Ga0500562_014739_260_1711 475
893 3300053118 Ga0500594_0003663 Ga0500594_0003663_1731_3185 475
894 3300053130 Ga0500642_0048665 Ga0500642_0048665_117_1568 475
895 3300053157 Ga0500624_000022 Ga0500624_000022_100333_101775 475
896 3300053178 Ga0500637_0000095 Ga0500637_0000095_15116_16558 475
897 3300055283 Ga0500661_002227 Ga0500661_002227_1743_3218 475
898 3300061719 Ga0466962_0007859 Ga0466962_0007859_3381_4820 475
899 3300061719 Ga0466962_0015235 Ga0466962_0015235_254_1705 475
900 3300001904 JGI24736J21556_1001848 JGI24736J21556_10018483 476
901 3300001915 JGI24741J21665_1000043 JGI24741J21665_10000433 476
902 3300001979 JGI24740J21852_10006172 JGI24740J21852_100061722 476
903 3300001979 JGI24740J21852_10008321 JGI24740J21852_100083213 476
904 3300001989 JGI24739J22299_10001382 JGI24739J22299_100013826 476
905 3300001990 JGI24737J22298_10001823 JGI24737J22298_100018233 476
906 3300002067 JGI24735J21928_10000642 JGI24735J21928_100006424 476
907 3300002070 JGI24750J21931_1000631 JGI24750J21931_10006312 476
908 3300002074 JGI24748J21848_1000052 JGI24748J21848_100005259 476
909 3300002075 JGI24738J21930_10001963 JGI24738J21930_100019636 476
910 3300002076 JGI24749J21850_1000531 JGI24749J21850_10005314 476
911 3300002239 JGI24034J26672_10000031 JGI24034J26672_1000003135 476
912 3300002459 JGI24751J29686_10000052 JGI24751J29686_1000005227 476
913 3300003773 Ga0055537_1001888 Ga0055537_10018885 476
914 3300003790 Ga0055528_1009909 Ga0055528_10099094 476
915 3300005262 Ga0065165_1006815 Ga0065165_10068151 476
916 3300005289 Ga0065704_10001757 Ga0065704_100017575 476
917 3300005289 Ga0065704_10081083 Ga0065704_100810833 476
918 3300005295 Ga0065707_10091947 Ga0065707_100919474 476
919 3300005295 Ga0065707_10097824 Ga0065707_100978243 476
920 3300005327 Ga0070658_10049997 Ga0070658_100499974 476
921 3300005330 Ga0070690_100000010 Ga0070690_10000001070 476
922 3300005331 Ga0070670_100000024 Ga0070670_10000002489 476
923 3300005335 Ga0070666_10000006 Ga0070666_10000006267 476
924 3300005339 Ga0070660_100039855 Ga0070660_1000398553 476
925 3300005340 Ga0070689_100011273 Ga0070689_1000112734 476
926 3300005344 Ga0070661_100000095 Ga0070661_10000009523 476
927 3300005347 Ga0070668_100000027 Ga0070668_10000002733 476
928 3300005347 Ga0070668_100016692 Ga0070668_1000166924 476
929 3300005353 Ga0070669_100000047 Ga0070669_10000004793 476
930 3300005353 Ga0070669_100000076 Ga0070669_10000007618 476
931 3300005355 Ga0070671_100058428 Ga0070671_1000584283 476
932 3300005365 Ga0070688_100002221 Ga0070688_1000022214 476
933 3300005366 Ga0070659_100154613 Ga0070659_1001546131 476
934 3300005367 Ga0070667_100000017 Ga0070667_100000017210 476
935 3300005367 Ga0070667_100000066 Ga0070667_10000006695 476
936 3300005367 Ga0070667_100000459 Ga0070667_10000045922 476
937 3300005367 Ga0070667_100000480 Ga0070667_10000048014 476
938 3300005455 Ga0070663_100050955 Ga0070663_1000509553 476
939 3300005466 Ga0070685_10021094 Ga0070685_100210943 476
940 3300005544 Ga0070686_100000042 Ga0070686_10000004270 476
941 3300005548 Ga0070665_100000019 Ga0070665_10000001971 476
942 3300005548 Ga0070665_100004060 Ga0070665_10000406019 476
943 3300005548 Ga0070665_100033590 Ga0070665_1000335904 476
944 3300005577 Ga0068857_100025477 Ga0068857_1000254774 476
945 3300005577 Ga0068857_100091382 Ga0068857_1000913822 476
946 3300005578 Ga0068854_100001591 Ga0068854_1000015912 476
947 3300005614 Ga0068856_100228905 Ga0068856_1002289051 476
948 3300005616 Ga0068852_100071029 Ga0068852_1000710293 476
949 3300005617 Ga0068859_100006146 Ga0068859_1000061467 476
950 3300005617 Ga0068859_100031085 Ga0068859_1000310854 476
951 3300005618 Ga0068864_100000036 Ga0068864_10000003690 476
952 3300005618 Ga0068864_100001646 Ga0068864_10000164612 476
953 3300005719 Ga0068861_100025695 Ga0068861_1000256954 476
954 3300005719 Ga0068861_100032053 Ga0068861_1000320533 476
955 3300005841 Ga0068863_100000069 Ga0068863_100000069108 476
956 3300005841 Ga0068863_100000603 Ga0068863_10000060319 476
957 3300005841 Ga0068863_100013726 Ga0068863_1000137267 476
958 3300005842 Ga0068858_100000103 Ga0068858_10000010357 476
959 3300005843 Ga0068860_100000013 Ga0068860_100000013214 476
960 3300005843 Ga0068860_100000014 Ga0068860_100000014267 476
961 3300005843 Ga0068860_100000056 Ga0068860_10000005634 476
962 3300005844 Ga0068862_100000033 Ga0068862_10000003315 476
963 3300005844 Ga0068862_100002295 Ga0068862_10000229510 476
964 3300005844 Ga0068862_100005376 Ga0068862_1000053767 476
965 3300006195 Ga0075366_10019123 Ga0075366_100191232 476
966 3300006931 Ga0097620_100006146 Ga0097620_1000061465 476
967 3300006931 Ga0097620_100031087 Ga0097620_1000310874 476
968 3300009093 Ga0105240_10220846 Ga0105240_102208462 476
969 3300009174 Ga0105241_10004099 Ga0105241_100040993 476
970 3300009177 Ga0105248_10008150 Ga0105248_100081503 476
971 3300009545 Ga0105237_10095892 Ga0105237_100958922 476
972 3300009553 Ga0105249_10000035 Ga0105249_1000003565 476
973 3300009553 Ga0105249_10122737 Ga0105249_101227372 476
974 3300009978 Ga0105148_100444 Ga0105148_1004444 476
975 3300010375 Ga0105239_10162022 Ga0105239_101620222 476
976 3300012513 Ga0157326_1000068 Ga0157326_10000687 476
977 3300013100 Ga0157373_10010652 Ga0157373_100106523 476
978 3300013104 Ga0157370_10107590 Ga0157370_101075903 476
979 3300014326 Ga0157380_10051590 Ga0157380_100515903 476
980 3300014968 Ga0157379_10186217 Ga0157379_101862171 476
981 3300025223 Ga0207672_1001086 Ga0207672_10010862 476
982 3300025229 Ga0209147_100321 Ga0209147_10032112 476
983 3300025263 Ga0209565_1000179 Ga0209565_100017923 476
984 3300025273 Ga0209673_1001240 Ga0209673_100124016 476
985 3300025292 Ga0209676_1000253 Ga0209676_100025324 476
986 3300025295 Ga0209564_1003913 Ga0209564_10039135 476
987 3300025295 Ga0209564_1023739 Ga0209564_10237392 476
988 3300025297 Ga0209758_1000562 Ga0209758_100056259 476
989 3300025297 Ga0209758_1003287 Ga0209758_10032871 476
990 3300025298 Ga0209050_1000649 Ga0209050_100064929 476
991 3300025298 Ga0209050_1002610 Ga0209050_10026108 476
992 3300025299 Ga0209256_1005813 Ga0209256_10058136 476
993 3300025303 Ga0209051_1002693 Ga0209051_100269312 476
994 3300025304 Ga0209257_1005712 Ga0209257_10057121 476
995 3300025903 Ga0207680_10000011 Ga0207680_10000011264 476
996 3300025904 Ga0207647_10004936 Ga0207647_100049367 476
997 3300025904 Ga0207647_10017008 Ga0207647_100170083 476
998 3300025911 Ga0207654_10008188 Ga0207654_100081884 476
999 3300025913 Ga0207695_10104874 Ga0207695_101048743 476
1000 3300025914 Ga0207671_10011321 Ga0207671_100113211 476
1001 3300025919 Ga0207657_10006366 Ga0207657_1000636611 476
1002 3300025920 Ga0207649_10000093 Ga0207649_1000009323 476
1003 3300025923 Ga0207681_10000014 Ga0207681_10000014175 476
1004 3300025923 Ga0207681_10000088 Ga0207681_1000008816 476
1005 3300025923 Ga0207681_10070849 Ga0207681_100708492 476
1006 3300025924 Ga0207694_10121220 Ga0207694_101212202 476
1007 3300025925 Ga0207650_10000015 Ga0207650_10000015190 476
1008 3300025925 Ga0207650_10008442 Ga0207650_100084426 476
1009 3300025925 Ga0207650_10035362 Ga0207650_100353624 476
1010 3300025925 Ga0207650_10060553 Ga0207650_100605532 476
1011 3300025931 Ga0207644_10000574 Ga0207644_1000057412 476
1012 3300025933 Ga0207706_10028678 Ga0207706_100286783 476
1013 3300025933 Ga0207706_10031534 Ga0207706_100315344 476
1014 3300025941 Ga0207711_10000252 Ga0207711_1000025233 476
1015 3300025941 Ga0207711_10013203 Ga0207711_100132032 476
1016 3300025949 Ga0207667_10047794 Ga0207667_100477943 476
1017 3300025961 Ga0207712_10000013 Ga0207712_10000013264 476
1018 3300025961 Ga0207712_10009432 Ga0207712_100094324 476
1019 3300025972 Ga0207668_10000012 Ga0207668_1000001232 476
1020 3300025972 Ga0207668_10007271 Ga0207668_100072714 476
1021 3300025981 Ga0207640_10026537 Ga0207640_100265373 476
1022 3300025986 Ga0207658_10000011 Ga0207658_1000001133 476
1023 3300025986 Ga0207658_10000132 Ga0207658_1000013214 476
1024 3300025986 Ga0207658_10002473 Ga0207658_100024737 476
1025 3300025986 Ga0207658_10006048 Ga0207658_100060483 476
1026 3300026035 Ga0207703_10000691 Ga0207703_100006916 476
1027 3300026035 Ga0207703_10129812 Ga0207703_101298122 476
1028 3300026041 Ga0207639_10007537 Ga0207639_100075374 476
1029 3300026067 Ga0207678_10000622 Ga0207678_1000062218 476
1030 3300026078 Ga0207702_10015232 Ga0207702_100152323 476
1031 3300026078 Ga0207702_10018383 Ga0207702_100183834 476
1032 3300026088 Ga0207641_10000112 Ga0207641_1000011231 476
1033 3300026088 Ga0207641_10001074 Ga0207641_1000107410 476
1034 3300026088 Ga0207641_10002092 Ga0207641_1000209210 476
1035 3300026095 Ga0207676_10000021 Ga0207676_10000021212 476
1036 3300026095 Ga0207676_10002294 Ga0207676_100022946 476
1037 3300026095 Ga0207676_10071028 Ga0207676_100710281 476
1038 3300026095 Ga0207676_10174334 Ga0207676_101743341 476
1039 3300026116 Ga0207674_10030042 Ga0207674_100300424 476
1040 3300026118 Ga0207675_100004785 Ga0207675_1000047858 476
1041 3300026118 Ga0207675_100120006 Ga0207675_1001200062 476
1042 3300026142 Ga0207698_10162483 Ga0207698_101624831 476
1043 3300028379 Ga0268266_10000025 Ga0268266_10000025418 476
1044 3300028379 Ga0268266_10001270 Ga0268266_1000127040 476
1045 3300028380 Ga0268265_10000013 Ga0268265_10000013183 476
1046 3300028380 Ga0268265_10000096 Ga0268265_1000009654 476
1047 3300028380 Ga0268265_10000958 Ga0268265_100009587 476
1048 3300028381 Ga0268264_10000037 Ga0268264_10000037264 476
1049 3300028381 Ga0268264_10000039 Ga0268264_10000039212 476
1050 3300028381 Ga0268264_10000089 Ga0268264_10000089217 476
1051 3300028381 Ga0268264_10030502 Ga0268264_100305023 476
1052 3300031251 Ga0265327_10009725 Ga0265327_100097252 476
1053 3300031548 Ga0307408_100154617 Ga0307408_1001546172 476
1054 3300031711 Ga0265314_10025857 Ga0265314_100258572 476
1055 3300031731 Ga0307405_10011985 Ga0307405_100119854 476
1056 3300031824 Ga0307413_10016574 Ga0307413_100165743 476
1057 3300031824 Ga0307413_10060505 Ga0307413_100605052 476
1058 3300032004 Ga0307414_10012599 Ga0307414_100125995 476
1059 3300037466 Ga0395898_0218803 Ga0395898_0218803_29_1495 476
1060 3300038443 Ga0395901_0249534 Ga0395901_0249534_54_1520 476
1061 3300044735 Ga0466968_0026553 Ga0466968_0026553_154_1611 476
1062 3300046453 Ga0495627_000158 Ga0495627_000158_57224_58654 476
1063 3300046453 Ga0495627_000636 Ga0495627_000636_24074_25528 476
1064 3300046453 Ga0495627_001522 Ga0495627_001522_3844_5298 476
1065 3300046457 Ga0495590_0004507 Ga0495590_0004507_40_1494 476
1066 3300046460 Ga0495638_0000016 Ga0495638_0000016_2481_3932 476
1067 3300046460 Ga0495638_0001235 Ga0495638_0001235_18429_19883 476
1068 3300046460 Ga0495638_0009533 Ga0495638_0009533_4310_5764 476
1069 3300046471 Ga0495650_0000024 Ga0495650_0000024_84914_86368 476
1070 3300046471 Ga0495650_0005540 Ga0495650_0005540_1502_2932 476
1071 3300046500 Ga0495596_0000141 Ga0495596_0000141_36898_38334 476
1072 3300046500 Ga0495596_0007523 Ga0495596_0007523_1480_2910 476
1073 3300046501 Ga0495607_0019591 Ga0495607_0019591_129_1565 476
1074 3300046506 Ga0495583_0000025 Ga0495583_0000025_104517_105971 476
1075 3300046506 Ga0495583_0011021 Ga0495583_0011021_2354_3805 476
1076 3300046507 Ga0495606_0006495 Ga0495606_0006495_4227_5681 476
1077 3300046507 Ga0495606_0061506 Ga0495606_0061506_121_1557 476
1078 3300046512 Ga0495610_0000020 Ga0495610_0000020_314307_315737 476
1079 3300046512 Ga0495610_0000071 Ga0495610_0000071_31131_32585 476
1080 3300046512 Ga0495610_0000478 Ga0495610_0000478_33691_35145 476
1081 3300046512 Ga0495610_0002395 Ga0495610_0002395_8845_10281 476
1082 3300046513 Ga0495616_0005214 Ga0495616_0005214_3908_5362 476
1083 3300046513 Ga0495616_0022892 Ga0495616_0022892_385_1839 476
1084 3300046519 Ga0495632_0004458 Ga0495632_0004458_4312_5766 476
1085 3300046519 Ga0495632_0011966 Ga0495632_0011966_2109_3560 476
1086 3300046519 Ga0495632_0017082 Ga0495632_0017082_59_1489 476
1087 3300046519 Ga0495632_0018793 Ga0495632_0018793_1704_3140 476
1088 3300046522 Ga0495643_0000132 Ga0495643_0000132_101975_103405 476
1089 3300046522 Ga0495643_0009605 Ga0495643_0009605_1337_2773 476
1090 3300046522 Ga0495643_0036370 Ga0495643_0036370_359_1807 476
1091 3300046524 Ga0495648_0000101 Ga0495648_0000101_2227_3678 476
1092 3300046524 Ga0495648_0000634 Ga0495648_0000634_26112_27566 476
1093 3300046524 Ga0495648_0012976 Ga0495648_0012976_2766_4220 476
1094 3300046530 Ga0495654_0000135 Ga0495654_0000135_16587_18041 476
1095 3300046538 Ga0495609_0005528 Ga0495609_0005528_793_2229 476
1096 3300046542 Ga0495597_0003528 Ga0495597_0003528_3755_5203 476
1097 3300046660 Ga0495625_0000676 Ga0495625_0000676_31904_33358 476
1098 3300046660 Ga0495625_0002176 Ga0495625_0002176_16231_17685 476
1099 3300046660 Ga0495625_0020518 Ga0495625_0020518_338_1792 476
1100 3300046660 Ga0495625_0021050 Ga0495625_0021050_3530_4984 476
1101 3300046692 Ga0495671_0000063 Ga0495671_0000063_102743_104194 476
1102 3300047320 Ga0495672_0001086 Ga0495672_0001086_36_1490 476
1103 3300047446 Ga0495679_004380 Ga0495679_004380_4088_5542 476
1104 3300047469 Ga0495673_0000170 Ga0495673_0000170_102833_104284 476
1105 3300047469 Ga0495673_0001300 Ga0495673_0001300_16686_18140 476
1106 3300047470 Ga0495681_0000008 Ga0495681_0000008_2086_3540 476
1107 3300047470 Ga0495681_0000094 Ga0495681_0000094_57414_58844 476
1108 3300047472 Ga0495686_0000201 Ga0495686_0000201_28091_29548 476
1109 3300047472 Ga0495686_0005965 Ga0495686_0005965_7952_9406 476
1110 3300047472 Ga0495686_0014688 Ga0495686_0014688_3674_5119 476
1111 3300047472 Ga0495686_0089886 Ga0495686_0089886_99_1553 476
1112 3300048090 Ga0495615_0000239 Ga0495615_0000239_757_2193 476
1113 3300048091 Ga0495626_0001260 Ga0495626_0001260_4975_6405 476
1114 3300048905 Ga0496102_0087676 Ga0496102_0087676_1307_2761 476
1115 3300048906 Ga0496103_0001454 Ga0496103_0001454_619_2073 476
1116 3300048909 Ga0496106_0017067 Ga0496106_0017067_1877_3331 476
1117 3300048910 Ga0496107_0000028 Ga0496107_0000028_7499_8953 476
1118 3300048910 Ga0496107_0031961 Ga0496107_0031961_108_1562 476
1119 3300048911 Ga0496108_0012717 Ga0496108_0012717_2055_3509 476
1120 3300048913 Ga0496110_0019550 Ga0496110_0019550_2777_4231 476
1121 3300048918 Ga0496115_0002063 Ga0496115_0002063_6703_8157 476
1122 3300048919 Ga0496116_0000028 Ga0496116_0000028_203012_204442 476
1123 3300048919 Ga0496116_0034323 Ga0496116_0034323_922_2376 476
1124 3300048920 Ga0496117_0018898 Ga0496117_0018898_303_1757 476
1125 3300048924 Ga0496121_0000175 Ga0496121_0000175_2317_3771 476
1126 3300048924 Ga0496121_0002522 Ga0496121_0002522_12642_14072 476
1127 3300048924 Ga0496121_0004566 Ga0496121_0004566_9668_11098 476
1128 3300048924 Ga0496121_0005053 Ga0496121_0005053_11065_12519 476
1129 3300048925 Ga0496122_0002369 Ga0496122_0002369_15534_16964 476
1130 3300048925 Ga0496122_0009082 Ga0496122_0009082_9021_10457 476
1131 3300048926 Ga0496123_0001557 Ga0496123_0001557_24091_25521 476
1132 3300048926 Ga0496123_0007047 Ga0496123_0007047_9195_10631 476
1133 3300048927 Ga0496124_0021696 Ga0496124_0021696_1978_3432 476
1134 3300048927 Ga0496124_0025910 Ga0496124_0025910_698_2128 476
1135 3300048927 Ga0496124_0028114 Ga0496124_0028114_443_1873 476
1136 3300048928 Ga0496125_0019436 Ga0496125_0019436_3166_4596 476
1137 3300048928 Ga0496125_0020409 Ga0496125_0020409_2779_4233 476
1138 3300048928 Ga0496125_0020819 Ga0496125_0020819_3416_4870 476
1139 3300048928 Ga0496125_0025844 Ga0496125_0025844_3852_5306 476
1140 3300048928 Ga0496125_0058805 Ga0496125_0058805_1260_2747 476
1141 3300048929 Ga0496126_0000079 Ga0496126_0000079_38377_39807 476
1142 3300048929 Ga0496126_0025071 Ga0496126_0025071_2125_3579 476
1143 3300049459 Ga0495678_000699 Ga0495678_000699_10761_12215 476
1144 3300049513 Ga0501290_000086 Ga0501290_000086_5156_6604 476
1145 3300049515 Ga0501292_000019 Ga0501292_000019_48529_49977 476
1146 3300049517 Ga0501294_000190 Ga0501294_000190_5485_6933 476
1147 3300049523 Ga0501300_000128 Ga0501300_000128_3774_5222 476
1148 3300049579 Ga0501043_0185581 Ga0501043_0185581_76_1524 476
1149 3300049581 Ga0501047_0003383 Ga0501047_0003383_9223_10671 476
1150 3300049662 Ga0501222_000788 Ga0501222_000788_1542_2990 476
1151 3300049663 Ga0501223_000099 Ga0501223_000099_2126_3580 476
1152 3300049663 Ga0501223_002457 Ga0501223_002457_1834_3282 476
1153 3300049669 Ga0501235_000351 Ga0501235_000351_1928_3376 476
1154 3300049679 Ga0501249_000162 Ga0501249_000162_18692_20140 476
1155 3300049690 Ga0501261_000061 Ga0501261_000061_5681_7129 476
1156 3300049705 Ga0501225_0000131 Ga0501225_0000131_19475_20929 476
1157 3300049705 Ga0501225_0002229 Ga0501225_0002229_730_2178 476
1158 3300049775 Ga0501279_000008 Ga0501279_000008_78732_80180 476
1159 3300049776 Ga0501280_000131 Ga0501280_000131_5199_6647 476
1160 3300049777 Ga0501281_00097 Ga0501281_00097_5443_6891 476
1161 3300049778 Ga0501282_000184 Ga0501282_000184_3925_5373 476
1162 3300053086 Ga0500578_0000159 Ga0500578_0000159_4576_6030 476
1163 3300053087 Ga0500643_005911 Ga0500643_005911_1926_3380 476
1164 3300053088 Ga0500644_0000269 Ga0500644_0000269_16316_17770 476
1165 3300053091 Ga0500647_0074727 Ga0500647_0074727_107_1573 476
1166 3300053093 Ga0500651_0011395 Ga0500651_0011395_200_1648 476
1167 3300053104 Ga0500556_0015464 Ga0500556_0015464_378_1832 476
1168 3300053108 Ga0500562_002265 Ga0500562_002265_523_1977 476
1169 3300053111 Ga0500572_002012 Ga0500572_002012_1358_2824 476
1170 3300053116 Ga0500592_000270 Ga0500592_000270_4476_5924 476
1171 3300053118 Ga0500594_0000312 Ga0500594_0000312_9387_10841 476
1172 3300053122 Ga0500608_000348 Ga0500608_000348_62_1516 476
1173 3300053125 Ga0500618_000570 Ga0500618_000570_20926_22380 476
1174 3300053125 Ga0500618_003408 Ga0500618_003408_3334_4782 476
1175 3300053125 Ga0500618_016467 Ga0500618_016467_317_1747 476
1176 3300053130 Ga0500642_0001871 Ga0500642_0001871_3871_5319 476
1177 3300053133 Ga0500655_001064 Ga0500655_001064_3711_5159 476
1178 3300053136 Ga0500559_0000147 Ga0500559_0000147_39063_40529 476
1179 3300053138 Ga0500564_005262 Ga0500564_005262_3782_5236 476
1180 3300053156 Ga0500622_0013218 Ga0500622_0013218_2002_3450 476
1181 3300053156 Ga0500622_0059721 Ga0500622_0059721_478_1932 476
1182 3300053157 Ga0500624_000024 Ga0500624_000024_32507_33961 476
1183 3300053724 Ga0500570_002262 Ga0500570_002262_7889_9337 476
1184 3300053730 Ga0500645_000996 Ga0500645_000996_13552_15006 476
1185 3300053731 Ga0500609_000273 Ga0500609_000273_1458_2912 476
1186 iso_pu_bacteria 3000865235 3000865773 476
1187 2162886007 SwRhRL2b_contig_1042224 SwRhRL2b_0733.00002350 477
1188 2162886007 SwRhRL2b_contig_1442462 SwRhRL2b_0198.00001790 477
1189 3300003781 Ga0055536_1000542 Ga0055536_10005423 477
1190 3300003781 Ga0055536_1002254 Ga0055536_10022545 477
1191 3300003781 Ga0055536_1013600 Ga0055536_10136002 477
1192 3300003791 Ga0055530_10000187 Ga0055530_1000018734 477
1193 3300003794 Ga0055531_10000760 Ga0055531_1000076021 477
1194 3300003794 Ga0055531_10005948 Ga0055531_100059482 477
1195 3300003794 Ga0055531_10019415 Ga0055531_100194153 477
1196 3300005289 Ga0065704_10070744 Ga0065704_1007074418 477
1197 3300005289 Ga0065704_10075395 Ga0065704_100753956 477
1198 3300005347 Ga0070668_100000646 Ga0070668_1000006465 477
1199 3300005353 Ga0070669_100001232 Ga0070669_10000123215 477
1200 3300005367 Ga0070667_100004083 Ga0070667_10000408310 477
1201 3300005548 Ga0070665_100024168 Ga0070665_1000241683 477
1202 3300005578 Ga0068854_100013256 Ga0068854_1000132564 477
1203 3300005618 Ga0068864_100005875 Ga0068864_1000058758 477
1204 3300005841 Ga0068863_100000063 Ga0068863_10000006374 477
1205 3300005842 Ga0068858_100003592 Ga0068858_1000035928 477
1206 3300005843 Ga0068860_100000008 Ga0068860_100000008273 477
1207 3300005843 Ga0068860_100107746 Ga0068860_1001077461 477
1208 3300005844 Ga0068862_100009581 Ga0068862_1000095813 477
1209 3300006042 Ga0075368_10000454 Ga0075368_1000045411 477
1210 3300006048 Ga0075363_100000079 Ga0075363_1000000796 477
1211 3300006051 Ga0075364_10017101 Ga0075364_100171012 477
1212 3300006177 Ga0075362_10000006 Ga0075362_1000000642 477
1213 3300006186 Ga0075369_10004233 Ga0075369_100042334 477
1214 3300006186 Ga0075369_10015793 Ga0075369_100157933 477
1215 3300006195 Ga0075366_10000497 Ga0075366_100004971 477
1216 3300006353 Ga0075370_10000005 Ga0075370_1000000571 477
1217 3300006353 Ga0075370_10005294 Ga0075370_100052946 477
1218 3300006946 Ga0079104_1009947 Ga0079104_10099473 477
1219 3300009177 Ga0105248_10102764 Ga0105248_101027643 477
1220 3300025291 Ga0209675_1000196 Ga0209675_10001969 477
1221 3300025292 Ga0209676_1000518 Ga0209676_100051822 477
1222 3300025292 Ga0209676_1000569 Ga0209676_100056913 477
1223 3300025292 Ga0209676_1000929 Ga0209676_10009296 477
1224 3300025294 Ga0209025_1006572 Ga0209025_10065729 477
1225 3300025298 Ga0209050_1000218 Ga0209050_100021825 477
1226 3300025298 Ga0209050_1012126 Ga0209050_10121262 477
1227 3300025304 Ga0209257_1000130 Ga0209257_1000130133 477
1228 3300025304 Ga0209257_1001405 Ga0209257_10014057 477
1229 3300025304 Ga0209257_1007291 Ga0209257_10072913 477
1230 3300025711 Ga0207696_1002742 Ga0207696_10027423 477
1231 3300025923 Ga0207681_10000259 Ga0207681_1000025910 477
1232 3300025972 Ga0207668_10003159 Ga0207668_100031592 477
1233 3300025981 Ga0207640_10009509 Ga0207640_100095093 477
1234 3300026035 Ga0207703_10002678 Ga0207703_100026788 477
1235 3300026088 Ga0207641_10000081 Ga0207641_1000008193 477
1236 3300026095 Ga0207676_10028473 Ga0207676_100284733 477
1237 3300027866 Ga0209813_10000126 Ga0209813_1000012621 477
1238 3300027876 Ga0209974_10022986 Ga0209974_100229861 477
1239 3300028379 Ga0268266_10011818 Ga0268266_100118185 477
1240 3300028380 Ga0268265_10006244 Ga0268265_100062446 477
1241 3300028381 Ga0268264_10000018 Ga0268264_10000018261 477
1242 3300028381 Ga0268264_10021281 Ga0268264_100212812 477
1243 3300031616 Ga0307508_10028051 Ga0307508_100280512 477
1244 3300032004 Ga0307414_10000346 Ga0307414_100003466 477
1245 3300035242 Ga0373962_0011746 Ga0373962_0011746_66_1499 477
1246 3300045051 Ga0451576_0035173 Ga0451576_0035173_2051_3484 477
1247 3300046460 Ga0495638_0014288 Ga0495638_0014288_94_1527 477
1248 3300046660 Ga0495625_0002942 Ga0495625_0002942_9523_11004 477
1249 3300048905 Ga0496102_0000106 Ga0496102_0000106_66131_67594 477
1250 3300048906 Ga0496103_0000095 Ga0496103_0000095_36435_37898 477
1251 3300048907 Ga0496104_0000060 Ga0496104_0000060_21352_22815 477
1252 3300048908 Ga0496105_0000274 Ga0496105_0000274_15557_17020 477
1253 3300048910 Ga0496107_0004473 Ga0496107_0004473_383_1846 477
1254 3300048916 Ga0496113_0003962 Ga0496113_0003962_3977_5440 477
1255 3300048918 Ga0496115_0039667 Ga0496115_0039667_1271_2734 477
1256 3300048920 Ga0496117_0000366 Ga0496117_0000366_53381_54844 477
1257 3300048921 Ga0496118_0003332 Ga0496118_0003332_1219_2682 477
1258 3300048921 Ga0496118_0037076 Ga0496118_0037076_861_2306 477
1259 3300048922 Ga0496119_0001213 Ga0496119_0001213_13563_15026 477
1260 3300048923 Ga0496120_0001109 Ga0496120_0001109_16573_18036 477
1261 3300048924 Ga0496121_0000509 Ga0496121_0000509_9577_11022 477
1262 3300048924 Ga0496121_0013959 Ga0496121_0013959_2118_3581 477
1263 3300048925 Ga0496122_0004287 Ga0496122_0004287_12159_13622 477
1264 3300048926 Ga0496123_0010484 Ga0496123_0010484_2138_3601 477
1265 3300048927 Ga0496124_0001819 Ga0496124_0001819_20893_22356 477
1266 3300048928 Ga0496125_0159591 Ga0496125_0159591_26_1507 477
1267 3300048929 Ga0496126_0000294 Ga0496126_0000294_54562_56025 477
1268 3300049523 Ga0501300_001748 Ga0501300_001748_1519_3003 477
1269 3300049823 Ga0501044_0011325 Ga0501044_0011325_3191_4624 477
1270 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_94741_96174 477
1271 3300050489 nmdc:mga03683_6910_c1 nmdc:mga03683_6910_c1_2309_3742 477
1272 3300050490 nmdc:mga03n38_715_c1 nmdc:mga03n38_715_c1_6069_7502 477
1273 3300050491 nmdc:mga00v17_1761_c1 nmdc:mga00v17_1761_c1_9388_10821 477
1274 3300050492 nmdc:mga0yw44_71676_c1 nmdc:mga0yw44_71676_c1_525_1958 477
1275 3300050493 nmdc:mga0k408_20_c1 nmdc:mga0k408_20_c1_37882_39315 477
1276 3300050493 nmdc:mga0k408_4871_c1 nmdc:mga0k408_4871_c1_4423_5856 477
1277 3300050493 nmdc:mga0k408_72823_c1 nmdc:mga0k408_72823_c1_25_1458 477
1278 3300050494 nmdc:mga06z11_6034_c1 nmdc:mga06z11_6034_c1_1310_2743 477
1279 3300050494 nmdc:mga06z11_761_c1 nmdc:mga06z11_761_c1_1353_2786 477
1280 3300050495 nmdc:mga04h51_118_c1 nmdc:mga04h51_118_c1_17515_18948 477
1281 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_349584_351017 477
1282 3300050496 nmdc:mga07m45_711_c1 nmdc:mga07m45_711_c1_8144_9577 477
1283 3300050516 nmdc:mga0sz30_39184_c1 nmdc:mga0sz30_39184_c1_25_1458 477
1284 3300053121 Ga0500607_001726 Ga0500607_001726_9003_10436 477
1285 3300053121 Ga0500607_002875 Ga0500607_002875_5367_6800 477
1286 3300053136 Ga0500559_0002377 Ga0500559_0002377_7505_8938 477
1287 3300053156 Ga0500622_0002660 Ga0500622_0002660_472_1905 477
1288 3300053158 Ga0500627_0000101 Ga0500627_0000101_921_2405 477
1289 3300053178 Ga0500637_0001187 Ga0500637_0001187_398_1831 477
1290 3300053730 Ga0500645_003145 Ga0500645_003145_1095_2528 477
1291 3300053730 Ga0500645_007126 Ga0500645_007126_1771_3204 477
1292 iso_pu_bacteria 2738541275 2738712572 477
1293 iso_pu_bacteria 2738541301 2738850996 477
1294 iso_pu_bacteria 2738541304 2738866726 477
1295 iso_pu_bacteria 2738543022 2739299243 477
1296 iso_pu_bacteria 2738543033 2739360922 477
1297 iso_pu_bacteria 2928100450 2928103880 477
1298 iso_pu_bacteria 2928959182 2928961809 477

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10423

AMNp_N

Bacterial AMP nucleoside phosphorylase N-terminus

53

211

0.94

PF01048

PNP_UDP_1

Phosphorylase superfamily

293

503

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t8s-assembly1.cif.gz_C crystal structure of e.coli amp nucleosidase complexed with formicin 5'-monophosphate 0.9064 2 477
1t8s-assembly1.cif.gz_C crystal structure of e.coli amp nucleosidase complexed with formicin 5'-monophosphate 0.9044 2 477
1t8y-assembly1.cif.gz_E crystal structure of e.coli amp nucleosidase complexed with phosphate 0.9004 2 477
1t8s-assembly1.cif.gz_B crystal structure of e.coli amp nucleosidase complexed with formicin 5'-monophosphate 0.8989 2 477
1t8y-assembly1.cif.gz_E crystal structure of e.coli amp nucleosidase complexed with phosphate 0.8987 2 477
ID Description Score Start End Superfamily
1t8sB01 Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain 0.9301 2 142 3.30.1730.10
af_P0AE12_1_172_3.30.1730.10 Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain 0.9269 2 167 3.30.1730.10
2guwB01 Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain 0.9207 2 144 3.30.1730.10
2guwB01 Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain 0.9066 2 144 3.30.1730.10
1t8sB01 Alpha Beta;2-Layer Sandwich;amp nucleosidase, domain 1;AMP nucleoside phosphorylase, N-terminal domain 0.8917 2 142 3.30.1730.10
ID Description Score Start End GO Terms
AF-A0A350KUJ2-F1-model_v4 deleted 0.9678 1 308
AF-J8VP58-F1-model_v4 deleted 0.9635 4 149
AF-A0A3M3A0N2-F1-model_v4 AMP nucleosidase 0.9611 3 124 GO:0003824
GO:0009116
AF-A0A6N3UG82-F1-model_v4 deleted 0.9593 14 124
AF-A0A520JI55-F1-model_v4 AMP nucleosidase (EC 3.2.2.4) 0.9578 1 109 GO:0008714
GO:0009116

Feature Viewer

pLDDT pTM Quality
80.18 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map