F492664

General Info

Members Datasets Scaffolds Average Seq Length
1294 444 1294 151

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10066359|JGI25404J52841_100663591
Length 151
Sequence VDERTLQIQACMYQYSRAIYRSIKDLVDPYVTAETRIQYRREVLEACEQTMERLAKDPLYFAKPDRALFQDIRRYFPITCQAQVAWAVREGVAAAVAFIESQIEAGAFDGGIGIARCRATTRKGKPCQRTPLPERDYCPSHQHLERSKVAA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
104 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
105 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
106 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
107 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
108 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
131 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
199 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
200 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
227 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
228 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
255 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
256 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
260 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
261 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
262 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
263 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
264 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
265 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
266 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
312 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
338 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
339 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
400 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
401 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
408 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
409 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
410 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
413 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
416 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
417 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
421 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
422 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
423 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.43
Metatranscriptomes 7.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 10.2
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10142367 3300003203 Unclassified 701
2 JGI25407J50210_10002710 3300003373 Bacteria 4213
3 JGI25404J52841_10066359 3300003659 Bacteria 755
4 Ga0032354_1082681 3300003693 Unclassified 666
5 Ga0032354_1108405 3300003693 Unclassified 835
6 Ga0070658_10001819 3300005327 Bacteria 17950
7 Ga0070658_10014355 3300005327 Bacteria 6355
8 Ga0070658_10126046 3300005327 Unclassified 2131
9 Ga0070658_10127295 3300005327 Bacteria 2121
10 Ga0070676_10216600 3300005328 Bacteria 1262
11 Ga0070676_10776798 3300005328 Unclassified 705
12 Ga0070683_100032427 3300005329 Bacteria 4758
13 Ga0070683_100062845 3300005329 Bacteria 3452
14 Ga0070683_100146815 3300005329 Bacteria 2235
15 Ga0070683_100225095 3300005329 Bacteria 1783
16 Ga0070683_100313875 3300005329 Bacteria 1492
17 Ga0070683_100350081 3300005329 Bacteria 1407
18 Ga0070683_100372723 3300005329 Bacteria 1360
19 Ga0070683_100512039 3300005329 Unclassified 1147
20 Ga0070683_100517869 3300005329 Bacteria 1140
21 Ga0070683_100616578 3300005329 Bacteria 1038
22 Ga0070683_100776781 3300005329 Bacteria 918
23 Ga0070690_100176178 3300005330 Bacteria 1475
24 Ga0070666_10035265 3300005335 Bacteria 3318
25 Ga0070680_100061142 3300005336 Bacteria 3083
26 Ga0070680_100089572 3300005336 Bacteria 2546
27 Ga0070680_100132794 3300005336 Bacteria 2083
28 Ga0070680_100290523 3300005336 Bacteria 1386
29 Ga0070682_100001302 3300005337 Bacteria 14130
30 Ga0070682_100049194 3300005337 Bacteria 2627
31 Ga0070682_100056442 3300005337 Bacteria 2470
32 Ga0070682_100222048 3300005337 Bacteria 1345
33 Ga0070682_100498976 3300005337 Bacteria 943
34 Ga0068868_100110320 3300005338 Bacteria 2235
35 Ga0068868_100138734 3300005338 Bacteria 1994
36 Ga0068868_100640378 3300005338 Unclassified 945
37 Ga0068868_100682899 3300005338 Archaea 917
38 Ga0068868_100962164 3300005338 Bacteria 779
39 Ga0070660_100004585 3300005339 Bacteria 9551
40 Ga0070660_100004801 3300005339 Bacteria 9347
41 Ga0070660_100050409 3300005339 Bacteria 3203
42 Ga0070660_100085859 3300005339 Bacteria 2476
43 Ga0070660_100421334 3300005339 Bacteria 1105
44 Ga0070660_100439551 3300005339 Unclassified 1081
45 Ga0070691_10074100 3300005341 Unclassified 1656
46 Ga0070691_10083985 3300005341 Bacteria 1563
47 Ga0070691_10127175 3300005341 Bacteria 1288
48 Ga0070691_10157872 3300005341 Bacteria 1167
49 Ga0070691_10333396 3300005341 Bacteria 838
50 Ga0070687_100070312 3300005343 Bacteria 1877
51 Ga0070687_100333633 3300005343 Bacteria 973
52 Ga0070661_100140084 3300005344 Bacteria 1822
53 Ga0070661_100192041 3300005344 Bacteria 1558
54 Ga0070661_100211506 3300005344 Bacteria 1485
55 Ga0070661_100352031 3300005344 Bacteria 1156
56 Ga0070692_10187145 3300005345 Bacteria 1204
57 Ga0070692_10358636 3300005345 Unclassified 908
58 Ga0070692_10783232 3300005345 Bacteria 650
59 Ga0070668_100012108 3300005347 Bacteria 6423
60 Ga0070675_100087510 3300005354 Bacteria 2605
61 Ga0070675_100249193 3300005354 Bacteria 1554
62 Ga0070675_100490648 3300005354 Bacteria 1106
63 Ga0070675_100996960 3300005354 Unclassified 769
64 Ga0070671_100072418 3300005355 Bacteria 2878
65 Ga0070671_101200608 3300005355 Unclassified 668
66 Ga0070674_100038392 3300005356 Bacteria 3227
67 Ga0070674_100119094 3300005356 Bacteria 1952
68 Ga0070674_100193562 3300005356 Unclassified 1566
69 Ga0070688_100001012 3300005365 Bacteria 14123
70 Ga0070659_100022325 3300005366 Bacteria 4831
71 Ga0070659_100088578 3300005366 Bacteria 2479
72 Ga0070659_100137328 3300005366 Bacteria 1988
73 Ga0070659_100744459 3300005366 Bacteria 850
74 Ga0070709_10014260 3300005434 Bacteria 4493
75 Ga0070709_10386241 3300005434 Unclassified 1042
76 Ga0070709_10684574 3300005434 Bacteria 797
77 Ga0070714_100007622 3300005435 Bacteria 8428
78 Ga0070714_100014641 3300005435 Bacteria 6303
79 Ga0070714_100044213 3300005435 Bacteria 3770
80 Ga0070714_100068376 3300005435 Bacteria 3064
81 Ga0070714_100616671 3300005435 Bacteria 1043
82 Ga0070714_101618144 3300005435 Bacteria 633
83 Ga0070713_100032009 3300005436 Bacteria 4196
84 Ga0070710_10004520 3300005437 Bacteria 6576
85 Ga0070710_10025685 3300005437 Bacteria 3121
86 Ga0070701_10004495 3300005438 Bacteria 5659
87 Ga0070701_10282822 3300005438 Bacteria 1013
88 Ga0070701_10340226 3300005438 Bacteria 934
89 Ga0070711_100004518 3300005439 Bacteria 8225
90 Ga0070711_100099146 3300005439 Bacteria 2116
91 Ga0070711_100482290 3300005439 Unclassified 1019
92 Ga0070711_100787571 3300005439 Bacteria 806
93 Ga0070705_100050391 3300005440 Unclassified 2422
94 Ga0070700_100003038 3300005441 Bacteria 8601
95 Ga0070700_100526794 3300005441 Bacteria 914
96 Ga0070694_100016536 3300005444 Bacteria 4644
97 Ga0070708_100014812 3300005445 Bacteria 6427
98 Ga0070708_100290219 3300005445 Bacteria 1540
99 Ga0070708_100776206 3300005445 Bacteria 901
100 Ga0070708_100864005 3300005445 Unclassified 850
101 Ga0070708_101389761 3300005445 Bacteria 655
102 Ga0070663_100041208 3300005455 Bacteria 3237
103 Ga0070663_100074698 3300005455 Bacteria 2476
104 Ga0070663_100867727 3300005455 Bacteria 778
105 Ga0070678_100001535 3300005456 Bacteria 12345
106 Ga0070678_100006809 3300005456 Bacteria 6736
107 Ga0070678_100140005 3300005456 Bacteria 1935
108 Ga0070678_100294679 3300005456 Unclassified 1377
109 Ga0070678_100975265 3300005456 Unclassified 778
110 Ga0070678_101040183 3300005456 Unclassified 754
111 Ga0070662_100033036 3300005457 Bacteria 3641
112 Ga0070662_100290693 3300005457 Unclassified 1325
113 Ga0070681_10004088 3300005458 Bacteria 13788
114 Ga0070681_10006514 3300005458 Bacteria 11363
115 Ga0070681_10027460 3300005458 Bacteria 5722
116 Ga0070681_10082772 3300005458 Bacteria 3164
117 Ga0070681_10193383 3300005458 Unclassified 1954
118 Ga0070681_10268838 3300005458 Unclassified 1616
119 Ga0070681_10283103 3300005458 Unclassified 1569
120 Ga0070681_10290488 3300005458 Bacteria 1545
121 Ga0070681_10522189 3300005458 Unclassified 1101
122 Ga0068867_100008961 3300005459 Bacteria 7058
123 Ga0068867_100368361 3300005459 Bacteria 1204
124 Ga0070685_10079715 3300005466 Bacteria 1960
125 Ga0070685_10100491 3300005466 Bacteria 1766
126 Ga0070706_100036752 3300005467 Bacteria 4524
127 Ga0070706_100044922 3300005467 Bacteria 4080
128 Ga0070706_100277171 3300005467 Unclassified 1565
129 Ga0070706_100614519 3300005467 Unclassified 1010
130 Ga0070706_101311353 3300005467 Bacteria 664
131 Ga0070707_100043213 3300005468 Bacteria 4314
132 Ga0070707_100079618 3300005468 Unclassified 3162
133 Ga0070707_100103307 3300005468 Bacteria 2761
134 Ga0070707_100773229 3300005468 Unclassified 924
135 Ga0070698_100017750 3300005471 Bacteria 7494
136 Ga0070698_100040021 3300005471 Bacteria 4819
137 Ga0070698_100065237 3300005471 Bacteria 3666
138 Ga0070698_100106515 3300005471 Bacteria 2772
139 Ga0070698_100372924 3300005471 Unclassified 1359
140 Ga0070699_100057336 3300005518 Bacteria 3374
141 Ga0070699_100082900 3300005518 Bacteria 2796
142 Ga0070699_100486837 3300005518 Bacteria 1120
143 Ga0070679_100182831 3300005530 Unclassified 2068
144 Ga0070679_100196350 3300005530 Bacteria 1985
145 Ga0070679_100262979 3300005530 Bacteria 1680
146 Ga0070679_100282015 3300005530 Unclassified 1614
147 Ga0070679_100295910 3300005530 Unclassified 1570
148 Ga0070684_100000801 3300005535 Bacteria 21853
149 Ga0070684_100102941 3300005535 Bacteria 2553
150 Ga0070684_100692242 3300005535 Unclassified 950
151 Ga0070684_101147590 3300005535 Bacteria 730
152 Ga0070697_100144998 3300005536 Bacteria 1998
153 Ga0070697_100221996 3300005536 Bacteria 1611
154 Ga0070697_100662707 3300005536 Bacteria 919
155 Ga0070697_100750343 3300005536 Bacteria 862
156 Ga0068853_100033631 3300005539 Bacteria 4351
157 Ga0068853_100321819 3300005539 Bacteria 1434
158 Ga0070672_100098064 3300005543 Bacteria 2373
159 Ga0070686_100000601 3300005544 Bacteria 21265
160 Ga0070686_100139366 3300005544 Unclassified 1686
161 Ga0070686_100150075 3300005544 Bacteria 1632
162 Ga0070686_100225473 3300005544 Unclassified 1357
163 Ga0070686_100338468 3300005544 Unclassified 1127
164 Ga0070686_100690740 3300005544 Bacteria 813
165 Ga0070695_100048362 3300005545 Bacteria 2720
166 Ga0070696_100004604 3300005546 Bacteria 9206
167 Ga0070696_100263131 3300005546 Bacteria 1309
168 Ga0070693_100007688 3300005547 Bacteria 5279
169 Ga0070693_100018284 3300005547 Bacteria 3658
170 Ga0070693_100021315 3300005547 Bacteria 3431
171 Ga0070693_100034110 3300005547 Bacteria 2814
172 Ga0070693_100677572 3300005547 Unclassified 752
173 Ga0070665_100023330 3300005548 Bacteria 6228
174 Ga0070665_100226041 3300005548 Bacteria 1872
175 Ga0070704_100013972 3300005549 Bacteria 5003
176 Ga0070704_100048220 3300005549 Bacteria 2980
177 Ga0070704_100475868 3300005549 Unclassified 1080
178 Ga0070704_100761258 3300005549 Bacteria 863
179 Ga0068855_100025890 3300005563 Bacteria 7016
180 Ga0068855_100091414 3300005563 Bacteria 3510
181 Ga0068855_100118990 3300005563 Bacteria 3025
182 Ga0068855_100746732 3300005563 Bacteria 1044
183 Ga0070664_100281820 3300005564 Bacteria 1499
184 Ga0070664_100671501 3300005564 Unclassified 964
185 Ga0068857_100379305 3300005577 Unclassified 1313
186 Ga0068857_101107682 3300005577 Bacteria 765
187 Ga0068854_100266352 3300005578 Unclassified 1374
188 Ga0068854_101065808 3300005578 Bacteria 719
189 Ga0068856_100100179 3300005614 Bacteria 2889
190 Ga0068856_100166231 3300005614 Bacteria 2217
191 Ga0068856_100350522 3300005614 Bacteria 1495
192 Ga0068856_100563345 3300005614 Bacteria 1161
193 Ga0068856_100836793 3300005614 Bacteria 939
194 Ga0068856_100852208 3300005614 Bacteria 930
195 Ga0070702_100001307 3300005615 Bacteria 10098
196 Ga0070702_100428554 3300005615 Bacteria 954
197 Ga0070702_100666868 3300005615 Bacteria 788
198 Ga0070702_100707514 3300005615 Unclassified 768
199 Ga0068852_100144997 3300005616 Bacteria 2201
200 Ga0068859_100142576 3300005617 Bacteria 2470
201 Ga0068859_100830411 3300005617 Bacteria 1011
202 Ga0068864_100148089 3300005618 Unclassified 2124
203 Ga0068864_100393932 3300005618 Bacteria 1315
204 Ga0068864_100592602 3300005618 Bacteria 1075
205 Ga0068866_10001893 3300005718 Bacteria 8762
206 Ga0068866_10332312 3300005718 Unclassified 960
207 Ga0068861_100051803 3300005719 Bacteria 3118
208 Ga0068861_100333020 3300005719 Unclassified 1326
209 Ga0068861_100982220 3300005719 Unclassified 805
210 Ga0068870_10293364 3300005840 Bacteria 1024
211 Ga0068860_100060561 3300005843 Bacteria 3597
212 Ga0081455_10001467 3300005937 Bacteria 29203
213 Ga0081455_10022972 3300005937 Bacteria 5814
214 Ga0081455_10026240 3300005937 Bacteria 5365
215 Ga0081455_10194196 3300005937 Bacteria 1526
216 Ga0081455_10679134 3300005937 Bacteria 659
217 Ga0081538_10000810 3300005981 Bacteria 33926
218 Ga0081538_10029132 3300005981 Bacteria 3780
219 Ga0081538_10101464 3300005981 Bacteria 1448
220 Ga0081538_10264360 3300005981 Bacteria 648
221 Ga0081540_1006384 3300005983 Bacteria 8595
222 Ga0081540_1122615 3300005983 Bacteria 1076
223 Ga0081539_10002873 3300005985 Bacteria 22878
224 Ga0081539_10005502 3300005985 Bacteria 12866
225 Ga0081539_10064603 3300005985 Unclassified 1990
226 Ga0070717_10005916 3300006028 Bacteria 8956
227 Ga0070717_10023231 3300006028 Bacteria 4911
228 Ga0070717_10028663 3300006028 Bacteria 4459
229 Ga0070717_10770812 3300006028 Bacteria 875
230 Ga0070717_11477289 3300006028 Bacteria 617
231 Ga0075365_10004466 3300006038 Bacteria 7415
232 Ga0070715_10000547 3300006163 Bacteria 9895
233 Ga0070715_10016713 3300006163 Bacteria 2763
234 Ga0070716_100011977 3300006173 Bacteria 4382
235 Ga0070716_100068231 3300006173 Bacteria 2079
236 Ga0070712_100017518 3300006175 Bacteria 4639
237 Ga0070712_100018807 3300006175 Bacteria 4494
238 Ga0070712_100023644 3300006175 Bacteria 4062
239 Ga0070712_100025620 3300006175 Bacteria 3922
240 Ga0070712_100576012 3300006175 Bacteria 951
241 Ga0075367_10704883 3300006178 Bacteria 642
242 Ga0097621_100047104 3300006237 Bacteria 3492
243 Ga0097621_100720388 3300006237 Bacteria 920
244 Ga0068871_100007707 3300006358 Bacteria 7705
245 Ga0068871_100021840 3300006358 Bacteria 4927
246 Ga0068871_100225830 3300006358 Bacteria 1624
247 Ga0068871_100293750 3300006358 Bacteria 1425
248 Ga0075428_100058891 3300006844 Bacteria 4206
249 Ga0075428_100682551 3300006844 Bacteria 1094
250 Ga0075428_100872540 3300006844 Bacteria 955
251 Ga0075430_100955344 3300006846 Unclassified 706
252 Ga0075431_100214819 3300006847 Bacteria 1963
253 Ga0075433_10005721 3300006852 Bacteria 9780
254 Ga0075433_10009447 3300006852 Bacteria 7794
255 Ga0075433_10251602 3300006852 Bacteria 1568
256 Ga0075433_10353902 3300006852 Bacteria 1298
257 Ga0075433_10581390 3300006852 Bacteria 984
258 Ga0075433_10816622 3300006852 Bacteria 814
259 Ga0075433_11404369 3300006852 Unclassified 604
260 Ga0075434_100002659 3300006871 Bacteria 15780
261 Ga0075434_100007883 3300006871 Bacteria 9863
262 Ga0075434_100619985 3300006871 Bacteria 1101
263 Ga0075434_100725952 3300006871 Bacteria 1011
264 Ga0075429_100266247 3300006880 Bacteria 1501
265 Ga0068865_100005218 3300006881 Bacteria 7856
266 Ga0068865_100153223 3300006881 Bacteria 1751
267 Ga0075436_100013985 3300006914 Bacteria 5490
268 Ga0075436_100028807 3300006914 Bacteria 3820
269 Ga0075436_100177325 3300006914 Bacteria 1506
270 Ga0097620_100142577 3300006931 Bacteria 2470
271 Ga0097620_100830363 3300006931 Bacteria 1011
272 Ga0075435_100002008 3300007076 Bacteria 13319
273 Ga0075435_100042872 3300007076 Bacteria 3621
274 Ga0075435_100212215 3300007076 Bacteria 1643
275 Ga0075435_100659062 3300007076 Bacteria 909
276 Ga0075435_100730778 3300007076 Bacteria 861
277 Ga0105240_10013540 3300009093 Bacteria 11196
278 Ga0105240_10022932 3300009093 Bacteria 8269
279 Ga0105240_10369245 3300009093 Unclassified 1623
280 Ga0111539_10012599 3300009094 Bacteria 10595
281 Ga0111539_10043756 3300009094 Bacteria 5367
282 Ga0111539_10056167 3300009094 Bacteria 4680
283 Ga0111539_10139905 3300009094 Bacteria 2834
284 Ga0111539_10523278 3300009094 Unclassified 1382
285 Ga0111539_10695973 3300009094 Bacteria 1183
286 Ga0111539_10765654 3300009094 Unclassified 1124
287 Ga0105245_10012395 3300009098 Bacteria 7419
288 Ga0105245_10066849 3300009098 Bacteria 3254
289 Ga0105245_10239116 3300009098 Bacteria 1759
290 Ga0105245_10502889 3300009098 Bacteria 1228
291 Ga0114129_10063624 3300009147 Bacteria 5150
292 Ga0114129_10084137 3300009147 Bacteria 4417
293 Ga0114129_10103975 3300009147 Unclassified 3925
294 Ga0114129_10105057 3300009147 Bacteria 3903
295 Ga0114129_10297667 3300009147 Bacteria 2152
296 Ga0114129_11533003 3300009147 Unclassified 818
297 Ga0114129_11916082 3300009147 Unclassified 718
298 Ga0114129_11996118 3300009147 Unclassified 702
299 Ga0105243_10047204 3300009148 Bacteria 3389
300 Ga0105243_10075049 3300009148 Bacteria 2744
301 Ga0105243_10089760 3300009148 Bacteria 2528
302 Ga0105243_10225630 3300009148 Bacteria 1659
303 Ga0105243_11057786 3300009148 Unclassified 817
304 Ga0105241_10155054 3300009174 Bacteria 1877
305 Ga0105241_10289162 3300009174 Bacteria 1403
306 Ga0105241_10829768 3300009174 Unclassified 853
307 Ga0105242_10232162 3300009176 Bacteria 1654
308 Ga0105248_10296570 3300009177 Unclassified 1820
309 Ga0105248_10861225 3300009177 Bacteria 1023
310 Ga0105248_10926106 3300009177 Bacteria 984
311 Ga0105237_10061228 3300009545 Bacteria 3764
312 Ga0105238_10636068 3300009551 Bacteria 1076
313 Ga0105238_11044875 3300009551 Bacteria 838
314 Ga0105249_10037375 3300009553 Bacteria 4406
315 Ga0105239_10299013 3300010375 Bacteria 1812
316 Ga0105239_10569539 3300010375 Bacteria 1291
317 Ga0105239_10602377 3300010375 Bacteria 1253
318 Ga0105246_10383420 3300011119 Bacteria 1162
319 Ga0157346_1002678 3300012480 Unclassified 943
320 Ga0157335_1003378 3300012492 Bacteria 1020
321 Ga0157323_1030873 3300012495 Unclassified 568
322 Ga0157347_1035647 3300012502 Unclassified 640
323 Ga0157339_1018751 3300012505 Bacteria 715
324 Ga0157338_1057235 3300012515 Unclassified 576
325 Ga0157373_10867427 3300013100 Bacteria 668
326 Ga0157370_10012656 3300013104 Bacteria 8738
327 Ga0157370_10015330 3300013104 Bacteria 7795
328 Ga0157369_10007224 3300013105 Bacteria 12796
329 Ga0157369_10014831 3300013105 Bacteria 8794
330 Ga0157369_10085150 3300013105 Bacteria 3378
331 Ga0157369_10195732 3300013105 Bacteria 2123
332 Ga0157369_11080692 3300013105 Bacteria 820
333 Ga0157374_11261068 3300013296 Bacteria 761
334 Ga0157378_10345765 3300013297 Bacteria 1451
335 Ga0163162_10043186 3300013306 Bacteria 4514
336 Ga0163162_10790275 3300013306 Bacteria 1067
337 Ga0157372_10048315 3300013307 Bacteria 4730
338 Ga0157372_11533161 3300013307 Unclassified 768
339 Ga0157375_10084328 3300013308 Bacteria 3225
340 Ga0157375_10925021 3300013308 Unclassified 1015
341 Ga0163163_10095497 3300014325 Unclassified 2992
342 Ga0163163_10177243 3300014325 Bacteria 2178
343 Ga0163163_10233481 3300014325 Bacteria 1889
344 Ga0163163_10400628 3300014325 Archaea 1430
345 Ga0163163_11614892 3300014325 Unclassified 709
346 Ga0157380_10219626 3300014326 Bacteria 1700
347 Ga0157380_10793471 3300014326 Unclassified 963
348 Ga0182008_10001177 3300014497 Bacteria 18030
349 Ga0157377_10547068 3300014745 Unclassified 817
350 Ga0157377_10774238 3300014745 Unclassified 705
351 Ga0157379_10322581 3300014968 Bacteria 1410
352 Ga0157379_10392585 3300014968 Bacteria 1274
353 Ga0157376_10024024 3300014969 Bacteria 4780
354 Ga0157376_12076602 3300014969 Unclassified 606
355 Ga0157376_12418025 3300014969 Unclassified 565
356 Ga0157376_12847310 3300014969 Unclassified 523
357 Ga0182006_1006406 3300015261 Bacteria 5474
358 Ga0182007_10151282 3300015262 Unclassified 789
359 Ga0182005_1246970 3300015265 Unclassified 551
360 Ga0163161_10056959 3300017792 Bacteria 2839
361 Ga0163161_11054400 3300017792 Bacteria 696
362 Ga0197907_10040416 3300020069 Archaea 1440
363 Ga0197907_10115781 3300020069 Bacteria 568
364 Ga0197907_10259069 3300020069 Unclassified 688
365 Ga0197907_10646087 3300020069 Unclassified 729
366 Ga0197907_10816011 3300020069 Bacteria 1199
367 Ga0197907_10946676 3300020069 Archaea 876
368 Ga0197907_10989329 3300020069 Bacteria 798
369 Ga0197907_10991756 3300020069 Bacteria 1060
370 Ga0197907_11235414 3300020069 Bacteria 652
371 Ga0206356_10504429 3300020070 Bacteria 1257
372 Ga0206356_11081805 3300020070 Bacteria 5693
373 Ga0206356_11440917 3300020070 Unclassified 1315
374 Ga0206356_11539823 3300020070 Bacteria 993
375 Ga0206356_11574066 3300020070 Unclassified 593
376 Ga0206356_11829134 3300020070 Bacteria 876
377 Ga0206349_1032949 3300020075 Bacteria 1199
378 Ga0206349_1354224 3300020075 Bacteria 624
379 Ga0206349_1571039 3300020075 Bacteria 856
380 Ga0206349_1781439 3300020075 Bacteria 535
381 Ga0206355_1313739 3300020076 Bacteria 1528
382 Ga0206355_1618283 3300020076 Bacteria 657
383 Ga0206351_10087162 3300020077 Bacteria 729
384 Ga0206351_10101498 3300020077 Unclassified 623
385 Ga0206351_10280456 3300020077 Bacteria 763
386 Ga0206351_10906755 3300020077 Bacteria 638
387 Ga0206352_10477607 3300020078 Bacteria 755
388 Ga0206352_10598490 3300020078 Bacteria 1255
389 Ga0206352_10901676 3300020078 Bacteria 539
390 Ga0206350_10440665 3300020080 Bacteria 692
391 Ga0206350_10450772 3300020080 Unclassified 652
392 Ga0206350_10918953 3300020080 Bacteria 841
393 Ga0206350_11170503 3300020080 Unclassified 715
394 Ga0206350_11310057 3300020080 Bacteria 1118
395 Ga0206350_11330243 3300020080 Unclassified 684
396 Ga0206354_10319059 3300020081 Bacteria 1063
397 Ga0206354_10365229 3300020081 Bacteria 1132
398 Ga0206354_10750390 3300020081 Unclassified 673
399 Ga0206354_10951817 3300020081 Bacteria 3421
400 Ga0206353_10032922 3300020082 Bacteria 1362
401 Ga0206353_10535060 3300020082 Unclassified 652
402 Ga0206353_10752732 3300020082 Bacteria 9937
403 Ga0206353_11042009 3300020082 Bacteria 929
404 Ga0206353_11226669 3300020082 Bacteria 868
405 Ga0206353_11321372 3300020082 Bacteria 738
406 Ga0206353_12050204 3300020082 Unclassified 1370
407 Ga0224712_10013713 3300022467 Bacteria 2589
408 Ga0224712_10052056 3300022467 Bacteria 1597
409 Ga0224712_10121293 3300022467 Bacteria 1132
410 Ga0224712_10123476 3300022467 Bacteria 1124
411 Ga0224712_10142503 3300022467 Bacteria 1056
412 Ga0224712_10161701 3300022467 Archaea 999
413 Ga0224712_10218063 3300022467 Bacteria 872
414 Ga0224712_10285055 3300022467 Unclassified 770
415 Ga0224712_10287472 3300022467 Unclassified 767
416 Ga0224712_10337006 3300022467 Bacteria 711
417 Ga0224712_10474398 3300022467 Bacteria 603
418 Ga0207692_10006102 3300025898 Bacteria 4876
419 Ga0207692_10007669 3300025898 Bacteria 4430
420 Ga0207692_10017198 3300025898 Bacteria 3220
421 Ga0207692_10037623 3300025898 Bacteria 2368
422 Ga0207692_10154077 3300025898 Bacteria 1318
423 Ga0207642_10002179 3300025899 Bacteria 6071
424 Ga0207688_10183390 3300025901 Bacteria 1249
425 Ga0207688_10257601 3300025901 Bacteria 1058
426 Ga0207688_10378901 3300025901 Bacteria 875
427 Ga0207680_10015996 3300025903 Bacteria 3929
428 Ga0207647_10033839 3300025904 Bacteria 3268
429 Ga0207647_10290690 3300025904 Bacteria 932
430 Ga0207685_10003503 3300025905 Bacteria 3828
431 Ga0207685_10107047 3300025905 Bacteria 1206
432 Ga0207699_10003899 3300025906 Bacteria 7126
433 Ga0207699_10343782 3300025906 Bacteria 1052
434 Ga0207699_10421329 3300025906 Bacteria 954
435 Ga0207699_11100056 3300025906 Unclassified 588
436 Ga0207699_11241337 3300025906 Unclassified 552
437 Ga0207705_10084855 3300025909 Bacteria 2313
438 Ga0207705_10210842 3300025909 Bacteria 1473
439 Ga0207684_10049468 3300025910 Bacteria 3566
440 Ga0207684_10469504 3300025910 Unclassified 1080
441 Ga0207684_10645521 3300025910 Unclassified 902
442 Ga0207654_10207302 3300025911 Bacteria 1294
443 Ga0207654_10302127 3300025911 Bacteria 1089
444 Ga0207654_10948484 3300025911 Bacteria 625
445 Ga0207707_10016358 3300025912 Bacteria 6470
446 Ga0207707_10020322 3300025912 Bacteria 5799
447 Ga0207707_10049357 3300025912 Bacteria 3666
448 Ga0207707_10162341 3300025912 Unclassified 1953
449 Ga0207707_10221587 3300025912 Bacteria 1646
450 Ga0207695_10013582 3300025913 Bacteria 9700
451 Ga0207695_10019003 3300025913 Bacteria 7924
452 Ga0207695_10113884 3300025913 Bacteria 2680
453 Ga0207695_10502715 3300025913 Unclassified 1094
454 Ga0207695_10602076 3300025913 Unclassified 980
455 Ga0207671_10135658 3300025914 Bacteria 1892
456 Ga0207693_10000778 3300025915 Bacteria 28589
457 Ga0207693_10001363 3300025915 Bacteria 21637
458 Ga0207693_10004643 3300025915 Bacteria 11588
459 Ga0207693_10040137 3300025915 Bacteria 3686
460 Ga0207693_10599205 3300025915 Bacteria 858
461 Ga0207663_10006026 3300025916 Bacteria 6163
462 Ga0207663_10014147 3300025916 Bacteria 4361
463 Ga0207663_10033555 3300025916 Unclassified 3059
464 Ga0207660_10038322 3300025917 Bacteria 3345
465 Ga0207660_10055618 3300025917 Bacteria 2829
466 Ga0207660_10086730 3300025917 Bacteria 2312
467 Ga0207660_10141637 3300025917 Bacteria 1839
468 Ga0207662_10030100 3300025918 Bacteria 3149
469 Ga0207662_10181976 3300025918 Bacteria 1353
470 Ga0207657_10007552 3300025919 Bacteria 11143
471 Ga0207657_10011057 3300025919 Bacteria 8972
472 Ga0207657_10017756 3300025919 Bacteria 6812
473 Ga0207657_10026504 3300025919 Bacteria 5325
474 Ga0207657_10029871 3300025919 Bacteria 4955
475 Ga0207657_10033669 3300025919 Bacteria 4616
476 Ga0207657_10114680 3300025919 Bacteria 2222
477 Ga0207657_10250020 3300025919 Unclassified 1413
478 Ga0207657_11157163 3300025919 Bacteria 589
479 Ga0207649_10250280 3300025920 Unclassified 1276
480 Ga0207649_10338527 3300025920 Unclassified 1110
481 Ga0207649_10532375 3300025920 Unclassified 897
482 Ga0207649_10942008 3300025920 Bacteria 678
483 Ga0207652_10043343 3300025921 Bacteria 3831
484 Ga0207652_10071212 3300025921 Bacteria 3021
485 Ga0207652_10154373 3300025921 Bacteria 2056
486 Ga0207652_10658753 3300025921 Bacteria 936
487 Ga0207652_10705771 3300025921 Bacteria 900
488 Ga0207652_10770337 3300025921 Unclassified 856
489 Ga0207652_10963621 3300025921 Unclassified 751
490 Ga0207646_10000835 3300025922 Bacteria 40092
491 Ga0207646_10000865 3300025922 Bacteria 39159
492 Ga0207646_10045627 3300025922 Unclassified 3934
493 Ga0207646_10047954 3300025922 Bacteria 3830
494 Ga0207646_10099005 3300025922 Bacteria 2613
495 Ga0207646_10641640 3300025922 Unclassified 952
496 Ga0207659_10045709 3300025926 Bacteria 3089
497 Ga0207659_10375683 3300025926 Bacteria 1184
498 Ga0207687_10011371 3300025927 Bacteria 5818
499 Ga0207687_10021405 3300025927 Bacteria 4296
500 Ga0207687_10032474 3300025927 Bacteria 3536
501 Ga0207687_10046895 3300025927 Bacteria 2993
502 Ga0207687_10625599 3300025927 Bacteria 909
503 Ga0207687_10948390 3300025927 Bacteria 737
504 Ga0207700_10006703 3300025928 Bacteria 6988
505 Ga0207700_10187624 3300025928 Bacteria 1735
506 Ga0207700_10540118 3300025928 Bacteria 1034
507 Ga0207700_10760032 3300025928 Bacteria 866
508 Ga0207664_10001898 3300025929 Bacteria 13744
509 Ga0207664_10004348 3300025929 Bacteria 9600
510 Ga0207664_10033378 3300025929 Bacteria 3953
511 Ga0207664_10033903 3300025929 Bacteria 3928
512 Ga0207664_10059181 3300025929 Unclassified 3050
513 Ga0207664_10358747 3300025929 Unclassified 1291
514 Ga0207664_10404125 3300025929 Unclassified 1215
515 Ga0207664_10520905 3300025929 Bacteria 1066
516 Ga0207664_10644985 3300025929 Unclassified 952
517 Ga0207664_10945917 3300025929 Unclassified 773
518 Ga0207664_11184350 3300025929 Bacteria 682
519 Ga0207664_11349453 3300025929 Bacteria 633
520 Ga0207644_10114987 3300025931 Bacteria 2040
521 Ga0207644_10126411 3300025931 Bacteria 1952
522 Ga0207644_10155769 3300025931 Bacteria 1771
523 Ga0207644_10178644 3300025931 Bacteria 1662
524 Ga0207690_10011765 3300025932 Bacteria 5234
525 Ga0207690_10621537 3300025932 Bacteria 883
526 Ga0207690_10748280 3300025932 Bacteria 806
527 Ga0207706_10005427 3300025933 Bacteria 11881
528 Ga0207706_10082183 3300025933 Bacteria 2831
529 Ga0207686_10006786 3300025934 Bacteria 6166
530 Ga0207686_10070397 3300025934 Bacteria 2247
531 Ga0207686_10133288 3300025934 Bacteria 1707
532 Ga0207709_10000655 3300025935 Bacteria 28121
533 Ga0207709_10079938 3300025935 Bacteria 2104
534 Ga0207709_10186250 3300025935 Bacteria 1470
535 Ga0207709_10189755 3300025935 Bacteria 1459
536 Ga0207709_10200666 3300025935 Unclassified 1424
537 Ga0207709_10346166 3300025935 Bacteria 1120
538 Ga0207709_10454922 3300025935 Unclassified 990
539 Ga0207709_11727160 3300025935 Bacteria 520
540 Ga0207670_10014398 3300025936 Bacteria 4694
541 Ga0207670_11661705 3300025936 Bacteria 543
542 Ga0207669_10220113 3300025937 Bacteria 1392
543 Ga0207669_11194783 3300025937 Unclassified 644
544 Ga0207704_10002843 3300025938 Bacteria 7815
545 Ga0207704_11437701 3300025938 Unclassified 591
546 Ga0207665_10000336 3300025939 Bacteria 32436
547 Ga0207665_10000544 3300025939 Bacteria 25404
548 Ga0207691_10023027 3300025940 Bacteria 5867
549 Ga0207691_10220556 3300025940 Bacteria 1644
550 Ga0207691_10271825 3300025940 Unclassified 1459
551 Ga0207691_10771984 3300025940 Unclassified 809
552 Ga0207711_10065303 3300025941 Bacteria 3146
553 Ga0207711_10512130 3300025941 Unclassified 1119
554 Ga0207689_10355326 3300025942 Bacteria 1218
555 Ga0207661_10021154 3300025944 Bacteria 4874
556 Ga0207661_10296968 3300025944 Unclassified 1447
557 Ga0207661_10306710 3300025944 Bacteria 1424
558 Ga0207661_10603661 3300025944 Unclassified 1007
559 Ga0207661_10632484 3300025944 Bacteria 983
560 Ga0207661_11100825 3300025944 Unclassified 731
561 Ga0207679_10064814 3300025945 Bacteria 2732
562 Ga0207679_10613734 3300025945 Bacteria 981
563 Ga0207679_11619643 3300025945 Bacteria 593
564 Ga0207667_10014908 3300025949 Bacteria 8838
565 Ga0207667_10083012 3300025949 Bacteria 3318
566 Ga0207667_10239430 3300025949 Bacteria 1857
567 Ga0207667_10534994 3300025949 Unclassified 1186
568 Ga0207667_10543452 3300025949 Unclassified 1175
569 Ga0207667_12101688 3300025949 Bacteria 523
570 Ga0207651_10112845 3300025960 Bacteria 2044
571 Ga0207651_11272980 3300025960 Bacteria 661
572 Ga0207651_11904528 3300025960 Unclassified 535
573 Ga0207712_11297924 3300025961 Bacteria 650
574 Ga0207668_10209388 3300025972 Bacteria 1558
575 Ga0207640_10290492 3300025981 Unclassified 1289
576 Ga0207640_11046123 3300025981 Unclassified 720
577 Ga0207640_11115840 3300025981 Unclassified 698
578 Ga0207640_11751756 3300025981 Bacteria 561
579 Ga0207677_10034168 3300026023 Bacteria 3290
580 Ga0207677_10062174 3300026023 Bacteria 2589
581 Ga0207677_10099391 3300026023 Bacteria 2137
582 Ga0207677_10556308 3300026023 Bacteria 1001
583 Ga0207677_10630170 3300026023 Unclassified 944
584 Ga0207639_10041612 3300026041 Bacteria 3439
585 Ga0207639_10215981 3300026041 Bacteria 1653
586 Ga0207639_10241743 3300026041 Unclassified 1570
587 Ga0207639_10394626 3300026041 Bacteria 1245
588 Ga0207678_10006293 3300026067 Bacteria 10543
589 Ga0207678_10012544 3300026067 Bacteria 7443
590 Ga0207678_10145954 3300026067 Unclassified 2019
591 Ga0207678_10303312 3300026067 Bacteria 1372
592 Ga0207678_10826522 3300026067 Unclassified 818
593 Ga0207708_10000468 3300026075 Bacteria 31201
594 Ga0207708_10317014 3300026075 Bacteria 1271
595 Ga0207708_10509060 3300026075 Bacteria 1010
596 Ga0207702_10018302 3300026078 Bacteria 5794
597 Ga0207702_10028564 3300026078 Bacteria 4637
598 Ga0207702_10181504 3300026078 Bacteria 1938
599 Ga0207702_10368069 3300026078 Bacteria 1379
600 Ga0207702_10462149 3300026078 Unclassified 1233
601 Ga0207702_10787693 3300026078 Unclassified 939
602 Ga0207702_11711937 3300026078 Unclassified 621
603 Ga0207641_11034157 3300026088 Unclassified 819
604 Ga0207648_10000801 3300026089 Bacteria 35460
605 Ga0207648_10026457 3300026089 Bacteria 5155
606 Ga0207648_10319604 3300026089 Bacteria 1395
607 Ga0207648_10732853 3300026089 Bacteria 917
608 Ga0207676_10068223 3300026095 Bacteria 2844
609 Ga0207674_10175861 3300026116 Unclassified 2093
610 Ga0207674_10846048 3300026116 Bacteria 882
611 Ga0207675_100003932 3300026118 Bacteria 14424
612 Ga0207675_100011585 3300026118 Bacteria 8246
613 Ga0207675_100716536 3300026118 Unclassified 1010
614 Ga0207675_100897940 3300026118 Unclassified 902
615 Ga0207683_10000041 3300026121 Bacteria 94017
616 Ga0207683_10006496 3300026121 Bacteria 10004
617 Ga0207683_10038385 3300026121 Bacteria 4174
618 Ga0207683_10192049 3300026121 Bacteria 1854
619 Ga0207698_10159015 3300026142 Bacteria 1973
620 Ga0209998_10042363 3300027717 Bacteria 1036
621 Ga0209974_10060311 3300027876 Unclassified 1284
622 Ga0207428_10011552 3300027907 Bacteria 7798
623 Ga0207428_10273354 3300027907 Unclassified 1255
624 Ga0268266_10316526 3300028379 Unclassified 1459
625 Ga0268266_10487858 3300028379 Bacteria 1175
626 Ga0268266_10626469 3300028379 Bacteria 1034
627 Ga0268266_11240317 3300028379 Unclassified 721
628 Ga0268264_10666097 3300028381 Bacteria 1031
629 Ga0265319_1001184 3300028563 Bacteria 16127
630 Ga0265319_1047886 3300028563 Bacteria 1421
631 Ga0265318_10008728 3300028577 Bacteria 4490
632 Ga0265318_10041967 3300028577 Bacteria 1737
633 Ga0265322_10008319 3300028654 Bacteria 3023
634 Ga0265338_10005686 3300028800 Bacteria 16138
635 Ga0265338_10021756 3300028800 Bacteria 6668
636 Ga0265338_10049336 3300028800 Bacteria 3817
637 Ga0265338_10071275 3300028800 Bacteria 2974
638 Ga0265330_10014203 3300031235 Bacteria 3697
639 Ga0265332_10088592 3300031238 Unclassified 1310
640 Ga0265328_10097022 3300031239 Bacteria 1090
641 Ga0265320_10100948 3300031240 Bacteria 1329
642 Ga0265329_10082352 3300031242 Bacteria 1019
643 Ga0265340_10043102 3300031247 Bacteria 2213
644 Ga0265339_10005422 3300031249 Bacteria 8499
645 Ga0265331_10042749 3300031250 Unclassified 2198
646 Ga0265327_10027941 3300031251 Bacteria 3238
647 Ga0265327_10040289 3300031251 Bacteria 2528
648 Ga0265316_10139407 3300031344 Unclassified 1822
649 Ga0265316_10438782 3300031344 Bacteria 937
650 Ga0307408_100816795 3300031548 Unclassified 847
651 Ga0307408_100881441 3300031548 Bacteria 818
652 Ga0265313_10054249 3300031595 Bacteria 1904
653 Ga0265313_10171330 3300031595 Unclassified 917
654 Ga0265314_10037065 3300031711 Bacteria 3536
655 Ga0265314_10183910 3300031711 Unclassified 1249
656 Ga0265342_10031739 3300031712 Bacteria 3263
657 Ga0307405_10685370 3300031731 Bacteria 847
658 Ga0307405_11474539 3300031731 Bacteria 597
659 Ga0307413_10013094 3300031824 Bacteria 4154
660 Ga0307413_10133173 3300031824 Unclassified 1705
661 Ga0307413_10208002 3300031824 Unclassified 1419
662 Ga0307410_10106281 3300031852 Bacteria 2022
663 Ga0307410_11069234 3300031852 Bacteria 698
664 Ga0307406_10217630 3300031901 Unclassified 1417
665 Ga0307406_10437392 3300031901 Bacteria 1046
666 Ga0307406_10491808 3300031901 Unclassified 993
667 Ga0307407_10017436 3300031903 Bacteria 3603
668 Ga0307407_11433451 3300031903 Unclassified 545
669 Ga0307409_100073101 3300031995 Bacteria 2733
670 Ga0307409_100080946 3300031995 Bacteria 2623
671 Ga0307409_100539139 3300031995 Bacteria 1143
672 Ga0307416_100083403 3300032002 Unclassified 2712
673 Ga0307416_100227725 3300032002 Bacteria 1794
674 Ga0307416_100385547 3300032002 Bacteria 1433
675 Ga0307416_100501233 3300032002 Unclassified 1278
676 Ga0307416_100640371 3300032002 Unclassified 1147
677 Ga0307416_100653652 3300032002 Unclassified 1136
678 Ga0307416_100656259 3300032002 Bacteria 1134
679 Ga0307416_101965094 3300032002 Unclassified 688
680 Ga0307414_11412582 3300032004 Unclassified 647
681 Ga0307411_10140631 3300032005 Unclassified 1779
682 Ga0307415_100056494 3300032126 Bacteria 2691
683 Ga0307415_100303402 3300032126 Unclassified 1324
684 Ga0307415_101298074 3300032126 Bacteria 689
685 Ga0373958_0035589 3300034819 Bacteria 997
686 Ga0373928_0041857 3300035084 Bacteria 1055
687 Ga0373929_0005112 3300035085 Bacteria 2359
688 Ga0373940_0055264 3300035088 Bacteria 1124
689 Ga0373944_0050180 3300035089 Bacteria 1313
690 Ga0373949_0090444 3300035090 Bacteria 827
691 Ga0373952_0043091 3300035092 Bacteria 1050
692 Ga0373936_0033789 3300035113 Bacteria 2029
693 Ga0373936_0072951 3300035113 Bacteria 1418
694 Ga0373939_0045219 3300035114 Bacteria 1343
695 Ga0373954_0327878 3300035118 Unclassified 756
696 Ga0373943_0000813 3300035170 Bacteria 13694
697 Ga0373943_0105490 3300035170 Bacteria 1479
698 Ga0373943_0111041 3300035170 Bacteria 1446
699 Ga0373946_0150740 3300035171 Bacteria 1085
700 Ga0373946_0241158 3300035171 Unclassified 879
701 Ga0373961_0052040 3300035241 Bacteria 1218
702 Ga0373961_0075692 3300035241 Bacteria 1050
703 Ga0373962_0055198 3300035242 Bacteria 1154
704 Ga0373931_0032081 3300035691 Archaea 2716
705 Ga0373931_0211437 3300035691 Bacteria 1163
706 Ga0373931_0245511 3300035691 Unclassified 1087
707 Ga0373935_0235506 3300035692 Bacteria 1276
708 Ga0373935_0684805 3300035692 Unclassified 753
709 Ga0373927_0041489 3300035695 Bacteria 2985
710 Ga0373947_0006490 3300035725 Bacteria 6789
711 Ga0373947_0009782 3300035725 Bacteria 5504
712 Ga0373947_0030406 3300035725 Bacteria 3173
713 Ga0373947_0047281 3300035725 Bacteria 2578
714 Ga0373947_0072999 3300035725 Unclassified 2108
715 Ga0373937_1032637 3300036401 Unclassified 771
716 Ga0373925_0000812 3300037068 Bacteria 28759
717 Ga0373925_0196937 3300037068 Bacteria 1601
718 Ga0373925_0699626 3300037068 Bacteria 836
719 Ga0373925_0718463 3300037068 Bacteria 824
720 Ga0395899_0005142 3300037312 Bacteria 10174
721 Ga0395899_0044946 3300037312 Bacteria 3289
722 Ga0395899_0086273 3300037312 Bacteria 2280
723 Ga0395899_0089674 3300037312 Unclassified 2230
724 Ga0395900_0001655 3300037418 Bacteria 26083
725 Ga0395900_0002249 3300037418 Bacteria 21466
726 Ga0395900_0003362 3300037418 Bacteria 17277
727 Ga0395900_0006320 3300037418 Bacteria 12353
728 Ga0395900_0006716 3300037418 Bacteria 11946
729 Ga0395900_0007766 3300037418 Bacteria 11064
730 Ga0395900_0017894 3300037418 Bacteria 7233
731 Ga0395900_0020761 3300037418 Bacteria 6714
732 Ga0395900_0027097 3300037418 Bacteria 5867
733 Ga0395900_0032020 3300037418 Bacteria 5406
734 Ga0395900_0037264 3300037418 Bacteria 5015
735 Ga0395900_0102290 3300037418 Unclassified 2943
736 Ga0395900_0144086 3300037418 Bacteria 2437
737 Ga0395900_0181058 3300037418 Bacteria 2142
738 Ga0395900_0184989 3300037418 Unclassified 2115
739 Ga0395900_0293118 3300037418 Bacteria 1615
740 Ga0395900_0719696 3300037418 Bacteria 930
741 Ga0395900_0836344 3300037418 Unclassified 847
742 Ga0395900_0893922 3300037418 Unclassified 812
743 Ga0395900_1094394 3300037418 Unclassified 714
744 Ga0395898_0001213 3300037466 Bacteria 38909
745 Ga0395898_0020563 3300037466 Bacteria 6704
746 Ga0395898_0025315 3300037466 Bacteria 5981
747 Ga0395898_0028831 3300037466 Bacteria 5564
748 Ga0395898_0059109 3300037466 Bacteria 3731
749 Ga0395898_0060749 3300037466 Bacteria 3672
750 Ga0395898_0062235 3300037466 Bacteria 3624
751 Ga0395898_0084924 3300037466 Bacteria 3051
752 Ga0395898_0110958 3300037466 Unclassified 2629
753 Ga0395898_0129714 3300037466 Bacteria 2415
754 Ga0395898_0133413 3300037466 Bacteria 2378
755 Ga0395898_0149816 3300037466 Unclassified 2232
756 Ga0395898_0203263 3300037466 Bacteria 1891
757 Ga0395898_0361399 3300037466 Unclassified 1384
758 Ga0395898_0472905 3300037466 Bacteria 1193
759 Ga0395898_0491584 3300037466 Bacteria 1167
760 Ga0395898_0508994 3300037466 Unclassified 1145
761 Ga0395898_0564518 3300037466 Bacteria 1080
762 Ga0395898_0729085 3300037466 Bacteria 933
763 Ga0395898_0918769 3300037466 Bacteria 813
764 Ga0395898_1159276 3300037466 Unclassified 705
765 Ga0395898_1896003 3300037466 Unclassified 516
766 Ga0395905_0004783 3300037471 Bacteria 13988
767 Ga0395905_0006777 3300037471 Bacteria 11477
768 Ga0395905_0007521 3300037471 Bacteria 10833
769 Ga0395905_0011439 3300037471 Bacteria 8575
770 Ga0395905_0020345 3300037471 Bacteria 6287
771 Ga0395905_0061123 3300037471 Bacteria 3523
772 Ga0395905_0129527 3300037471 Unclassified 2373
773 Ga0395905_0286410 3300037471 Bacteria 1534
774 Ga0395905_0463257 3300037471 Bacteria 1166
775 Ga0395905_0642720 3300037471 Bacteria 963
776 Ga0395905_0651964 3300037471 Bacteria 955
777 Ga0395905_0774761 3300037471 Bacteria 862
778 Ga0395905_1181163 3300037471 Unclassified 669
779 Ga0395901_0000809 3300038443 Bacteria 34767
780 Ga0395901_0006450 3300038443 Bacteria 11889
781 Ga0395901_0006756 3300038443 Bacteria 11586
782 Ga0395901_0006980 3300038443 Bacteria 11413
783 Ga0395901_0009659 3300038443 Bacteria 9785
784 Ga0395901_0022292 3300038443 Bacteria 6490
785 Ga0395901_0057131 3300038443 Bacteria 4059
786 Ga0395901_0060705 3300038443 Bacteria 3934
787 Ga0395901_0065114 3300038443 Bacteria 3794
788 Ga0395901_0074149 3300038443 Bacteria 3550
789 Ga0395901_0077280 3300038443 Bacteria 3474
790 Ga0395901_0077973 3300038443 Bacteria 3458
791 Ga0395901_0101550 3300038443 Bacteria 3018
792 Ga0395901_0107100 3300038443 Bacteria 2934
793 Ga0395901_0108700 3300038443 Bacteria 2911
794 Ga0395901_0299293 3300038443 Unclassified 1668
795 Ga0395901_0388518 3300038443 Bacteria 1435
796 Ga0395901_0413074 3300038443 Bacteria 1385
797 Ga0395901_0558716 3300038443 Unclassified 1159
798 Ga0395901_0569344 3300038443 Unclassified 1146
799 Ga0395901_1394686 3300038443 Unclassified 659
800 Ga0436365_1172237 3300039437 Unclassified 762
801 Ga0436360_0769076 3300039438 Archaea 791
802 Ga0436362_1228474 3300039453 Archaea 582
803 Ga0451789_0993490 3300041443 Unclassified 788
804 Ga0451789_1134997 3300041443 Bacteria 965
805 Ga0451800_1121739 3300041459 Unclassified 775
806 Ga0451839_0248092 3300041496 Unclassified 657
807 Ga0439445_0025872 3300042004 Bacteria 1499
808 Ga0439448_0002325 3300042005 Bacteria 5148
809 Ga0439455_0021157 3300042012 Bacteria 1548
810 Ga0450906_059770 3300042145 Bacteria 677
811 Ga0450907_014954 3300042146 Unclassified 1295
812 Ga0450910_052409 3300042147 Bacteria 677
813 Ga0439458_0024096 3300042157 Unclassified 1421
814 Ga0439434_0062341 3300042435 Unclassified 1167
815 Ga0439444_0037767 3300042437 Unclassified 936
816 Ga0450918_058941 3300042531 Unclassified 707
817 Ga0453683_0249518 3300044673 Bacteria 1131
818 Ga0466965_0279540 3300044683 Bacteria 901
819 Ga0466966_0041164 3300044684 Bacteria 2969
820 Ga0466961_0024090 3300044693 Bacteria 3916
821 Ga0466961_0202950 3300044693 Bacteria 1226
822 Ga0466963_0000744 3300044694 Bacteria 16050
823 Ga0466963_0002408 3300044694 Bacteria 10463
824 Ga0466963_0006073 3300044694 Bacteria 7120
825 Ga0466963_0031510 3300044694 Bacteria 3428
826 Ga0466963_0153414 3300044694 Bacteria 1600
827 Ga0466963_0709525 3300044694 Unclassified 710
828 Ga0466964_0065227 3300044706 Unclassified 1525
829 Ga0466964_0134102 3300044706 Unclassified 1131
830 Ga0453684_2444840 3300044712 Unclassified 517
831 Ga0466968_0024637 3300044735 Unclassified 2460
832 Ga0466957_0014432 3300044842 Bacteria 4600
833 Ga0466957_0021324 3300044842 Bacteria 3817
834 Ga0466957_0024900 3300044842 Bacteria 3545
835 Ga0466957_0121909 3300044842 Bacteria 1663
836 Ga0466957_0146888 3300044842 Bacteria 1522
837 Ga0466957_0266953 3300044842 Unclassified 1142
838 Ga0466957_0582636 3300044842 Bacteria 782
839 Ga0466960_0016942 3300044901 Bacteria 3169
840 Ga0466959_0033845 3300045049 Bacteria 3779
841 Ga0466959_0631493 3300045049 Bacteria 719
842 Ga0451576_0037970 3300045051 Bacteria 5099
843 Ga0466958_0002356 3300045836 Bacteria 9453
844 Ga0466958_0003510 3300045836 Bacteria 8146
845 Ga0466958_0004437 3300045836 Bacteria 7409
846 Ga0466958_0274513 3300045836 Bacteria 1080
847 Ga0466958_0357947 3300045836 Bacteria 940
848 Ga0466958_0428879 3300045836 Unclassified 855
849 Ga0466967_0005287 3300045976 Bacteria 8910
850 Ga0466967_0033110 3300045976 Bacteria 4373
851 Ga0466967_0036315 3300045976 Bacteria 4205
852 Ga0466967_0119834 3300045976 Bacteria 2429
853 Ga0466967_0125019 3300045976 Bacteria 2381
854 Ga0466967_0250303 3300045976 Bacteria 1692
855 Ga0466967_0283936 3300045976 Unclassified 1589
856 Ga0466967_0349891 3300045976 Bacteria 1430
857 Ga0466967_0477364 3300045976 Bacteria 1221
858 Ga0466967_0794600 3300045976 Unclassified 939
859 Ga0466967_0858164 3300045976 Unclassified 902
860 Ga0466967_1141361 3300045976 Bacteria 776
861 Ga0466967_2385549 3300045976 Bacteria 524
862 Ga0495603_0005797 3300046455 Bacteria 7389
863 Ga0495603_0042538 3300046455 Bacteria 2715
864 Ga0495590_0163177 3300046457 Bacteria 811
865 Ga0495629_0148342 3300046459 Bacteria 1630
866 Ga0495629_0157980 3300046459 Bacteria 1575
867 Ga0495629_0187479 3300046459 Bacteria 1432
868 Ga0495641_0011587 3300046461 Bacteria 5009
869 Ga0495641_0036634 3300046461 Unclassified 2304
870 Ga0495641_0170249 3300046461 Bacteria 975
871 Ga0495651_0716744 3300046462 Bacteria 622
872 Ga0495580_0001957 3300046472 Bacteria 18089
873 Ga0495582_0092659 3300046473 Unclassified 1686
874 Ga0495582_0095145 3300046473 Bacteria 1663
875 Ga0495605_0246811 3300046474 Bacteria 765
876 Ga0495605_0273339 3300046474 Unclassified 719
877 Ga0495639_0000699 3300046475 Bacteria 15350
878 Ga0495639_0091609 3300046475 Bacteria 1427
879 Ga0495639_0529372 3300046475 Bacteria 603
880 Ga0495639_0564318 3300046475 Bacteria 584
881 Ga0495662_0048384 3300046476 Bacteria 2052
882 Ga0495664_0009726 3300046477 Bacteria 5387
883 Ga0495584_0104789 3300046491 Bacteria 1430
884 Ga0495584_0209392 3300046491 Unclassified 991
885 Ga0495584_0420765 3300046491 Unclassified 679
886 Ga0495585_0446738 3300046492 Unclassified 619
887 Ga0495594_0001276 3300046499 Bacteria 13161
888 Ga0495596_0040412 3300046500 Bacteria 1842
889 Ga0495596_0052304 3300046500 Bacteria 1599
890 Ga0495596_0079524 3300046500 Bacteria 1273
891 Ga0495596_0267132 3300046500 Unclassified 664
892 Ga0495607_0192209 3300046501 Bacteria 1016
893 Ga0495608_0848061 3300046511 Bacteria 537
894 Ga0495618_0036416 3300046514 Bacteria 3087
895 Ga0495630_0001491 3300046517 Bacteria 16191
896 Ga0495630_0172845 3300046517 Bacteria 1646
897 Ga0495630_0682969 3300046517 Unclassified 786
898 Ga0495631_0160449 3300046518 Bacteria 965
899 Ga0495631_0206952 3300046518 Unclassified 839
900 Ga0495631_0260207 3300046518 Unclassified 739
901 Ga0495631_0357429 3300046518 Bacteria 621
902 Ga0495637_0052345 3300046520 Bacteria 1705
903 Ga0495644_0045114 3300046523 Bacteria 1658
904 Ga0495644_0072877 3300046523 Bacteria 1291
905 Ga0495644_0093176 3300046523 Bacteria 1138
906 Ga0495644_0093325 3300046523 Unclassified 1137
907 Ga0495644_0222836 3300046523 Bacteria 729
908 Ga0495663_0002901 3300046525 Bacteria 5061
909 Ga0495663_0003885 3300046525 Unclassified 4260
910 Ga0495666_0000298 3300046526 Bacteria 21680
911 Ga0495666_0003426 3300046526 Bacteria 7998
912 Ga0495642_0241587 3300046528 Unclassified 789
913 Ga0495652_0113884 3300046529 Bacteria 2170
914 Ga0495652_0709931 3300046529 Unclassified 676
915 Ga0495665_0051507 3300046531 Bacteria 2180
916 Ga0495640_0050221 3300046533 Bacteria 2874
917 Ga0495640_0287575 3300046533 Bacteria 1023
918 Ga0495586_0011405 3300046535 Bacteria 4727
919 Ga0495586_0098296 3300046535 Bacteria 1622
920 Ga0495587_0339430 3300046536 Unclassified 838
921 Ga0495598_0172318 3300046537 Unclassified 768
922 Ga0495609_0049150 3300046538 Unclassified 1883
923 Ga0495609_0115922 3300046538 Bacteria 1154
924 Ga0495609_0140262 3300046538 Unclassified 1032
925 Ga0495621_0191120 3300046539 Unclassified 821
926 Ga0495633_0470538 3300046558 Unclassified 567
927 Ga0495656_0010427 3300046615 Bacteria 3379
928 Ga0495656_0176238 3300046615 Unclassified 1048
929 Ga0495656_0316474 3300046615 Unclassified 803
930 Ga0495656_0384359 3300046615 Unclassified 732
931 Ga0495634_0062554 3300046642 Unclassified 2471
932 Ga0495634_0215920 3300046642 Bacteria 1186
933 Ga0495611_0317855 3300046648 Unclassified 717
934 Ga0495635_0011220 3300046663 Bacteria 6281
935 Ga0495635_0540260 3300046663 Bacteria 765
936 Ga0495659_0005869 3300046664 Unclassified 3877
937 Ga0495659_0016342 3300046664 Unclassified 2447
938 Ga0495659_0067505 3300046664 Unclassified 1334
939 Ga0495659_0148606 3300046664 Unclassified 940
940 Ga0495588_0048749 3300046674 Bacteria 2176
941 Ga0495588_0422380 3300046674 Bacteria 700
942 Ga0495599_0121005 3300046678 Bacteria 1627
943 Ga0495647_0001206 3300046681 Bacteria 7981
944 Ga0495658_0080498 3300046683 Bacteria 1910
945 Ga0495658_0134588 3300046683 Bacteria 1507
946 Ga0495658_0169670 3300046683 Bacteria 1350
947 Ga0495658_0357905 3300046683 Bacteria 928
948 Ga0495658_0416658 3300046683 Bacteria 857
949 Ga0495658_0895582 3300046683 Unclassified 567
950 Ga0495669_0640959 3300046684 Unclassified 517
951 Ga0495613_0172299 3300046689 Bacteria 1535
952 Ga0495613_0313738 3300046689 Bacteria 1083
953 Ga0495624_0007376 3300046690 Bacteria 7724
954 Ga0495670_0114120 3300046691 Bacteria 1400
955 Ga0495670_0429045 3300046691 Unclassified 715
956 Ga0495670_0786783 3300046691 Bacteria 519
957 Ga0495671_0255484 3300046692 Bacteria 846
958 Ga0495589_0037338 3300046794 Unclassified 2434
959 Ga0495589_0386230 3300046794 Unclassified 643
960 Ga0495581_0004047 3300047315 Bacteria 8443
961 Ga0495581_0155844 3300047315 Unclassified 1335
962 Ga0495581_0340955 3300047315 Bacteria 875
963 Ga0495604_0836995 3300047317 Unclassified 578
964 Ga0495636_0109586 3300047318 Bacteria 1214
965 Ga0495636_0168407 3300047318 Unclassified 990
966 Ga0495636_0213749 3300047318 Unclassified 883
967 Ga0495674_0027631 3300047319 Bacteria 5182
968 Ga0495676_0006956 3300047321 Bacteria 10382
969 Ga0495676_0018911 3300047321 Bacteria 6068
970 Ga0495676_0019336 3300047321 Bacteria 5992
971 Ga0495676_0119176 3300047321 Unclassified 1923
972 Ga0495676_0375113 3300047321 Bacteria 947
973 Ga0495680_0304064 3300047322 Bacteria 1119
974 Ga0495680_0517406 3300047322 Unclassified 808
975 Ga0495675_0794262 3300047444 Unclassified 524
976 Ga0495677_0234197 3300047445 Unclassified 717
977 Ga0495679_087273 3300047446 Bacteria 879
978 Ga0495685_015551 3300047447 Bacteria 2597
979 Ga0495684_0101058 3300047471 Bacteria 2180
980 Ga0495684_0229576 3300047471 Unclassified 1358
981 Ga0495684_0468980 3300047471 Bacteria 871
982 Ga0495593_0004815 3300047673 Bacteria 8004
983 Ga0495593_0436893 3300047673 Unclassified 655
984 Ga0495614_0001813 3300048089 Bacteria 9357
985 Ga0495615_0098767 3300048090 Bacteria 822
986 Ga0495615_0296562 3300048090 Bacteria 523
987 Ga0495626_0379213 3300048091 Unclassified 549
988 Ga0496100_0003025 3300048903 Bacteria 8671
989 Ga0496100_0073572 3300048903 Bacteria 2287
990 Ga0496100_0112371 3300048903 Bacteria 1895
991 Ga0496100_0775513 3300048903 Bacteria 750
992 Ga0496100_0905530 3300048903 Bacteria 693
993 Ga0496101_0007189 3300048904 Bacteria 7204
994 Ga0496101_0044862 3300048904 Bacteria 3165
995 Ga0496101_0054758 3300048904 Unclassified 2880
996 Ga0496101_0095461 3300048904 Bacteria 2218
997 Ga0496101_0098101 3300048904 Bacteria 2189
998 Ga0496101_0140288 3300048904 Bacteria 1841
999 Ga0496101_0204261 3300048904 Unclassified 1528
1000 Ga0496101_0332581 3300048904 Bacteria 1192
1001 Ga0496101_0426100 3300048904 Bacteria 1046
1002 Ga0496102_0005234 3300048905 Bacteria 11010
1003 Ga0496102_0041411 3300048905 Bacteria 4171
1004 Ga0496102_0043823 3300048905 Bacteria 4058
1005 Ga0496102_0107787 3300048905 Bacteria 2594
1006 Ga0496102_0257836 3300048905 Unclassified 1644
1007 Ga0496102_0535820 3300048905 Unclassified 1093
1008 Ga0496103_0006523 3300048906 Bacteria 6961
1009 Ga0496103_0014934 3300048906 Bacteria 4616
1010 Ga0496103_0059182 3300048906 Bacteria 2380
1011 Ga0496103_0256971 3300048906 Unclassified 1124
1012 Ga0496103_0314659 3300048906 Bacteria 1007
1013 Ga0496103_0387789 3300048906 Bacteria 897
1014 Ga0496104_0000465 3300048907 Bacteria 34961
1015 Ga0496104_0001293 3300048907 Bacteria 21572
1016 Ga0496104_0004690 3300048907 Bacteria 11903
1017 Ga0496104_0057628 3300048907 Bacteria 3675
1018 Ga0496104_0064939 3300048907 Bacteria 3462
1019 Ga0496104_0097732 3300048907 Bacteria 2810
1020 Ga0496104_0914245 3300048907 Bacteria 782
1021 Ga0496104_1047916 3300048907 Unclassified 719
1022 Ga0496104_1377422 3300048907 Unclassified 608
1023 Ga0496105_0000567 3300048908 Bacteria 24437
1024 Ga0496105_0001494 3300048908 Bacteria 16523
1025 Ga0496105_0033728 3300048908 Bacteria 4206
1026 Ga0496105_0051157 3300048908 Bacteria 3413
1027 Ga0496105_0187235 3300048908 Bacteria 1694
1028 Ga0496105_0438616 3300048908 Bacteria 1032
1029 Ga0496105_0446533 3300048908 Unclassified 1021
1030 Ga0496106_0003242 3300048909 Bacteria 12172
1031 Ga0496106_0007756 3300048909 Bacteria 7944
1032 Ga0496106_0049191 3300048909 Bacteria 3175
1033 Ga0496106_0081483 3300048909 Bacteria 2486
1034 Ga0496106_0788218 3300048909 Unclassified 754
1035 Ga0496106_1255153 3300048909 Unclassified 576
1036 Ga0496107_0001702 3300048910 Bacteria 13784
1037 Ga0496107_0009067 3300048910 Bacteria 6897
1038 Ga0496107_0220077 3300048910 Unclassified 1412
1039 Ga0496107_0335020 3300048910 Unclassified 1126
1040 Ga0496107_0583830 3300048910 Unclassified 827
1041 Ga0496107_0667953 3300048910 Bacteria 765
1042 Ga0496107_1091240 3300048910 Bacteria 577
1043 Ga0496108_0001327 3300048911 Bacteria 19451
1044 Ga0496108_0001889 3300048911 Bacteria 16782
1045 Ga0496108_0009890 3300048911 Bacteria 7729
1046 Ga0496108_0010249 3300048911 Bacteria 7608
1047 Ga0496108_0018453 3300048911 Bacteria 5711
1048 Ga0496108_0030309 3300048911 Bacteria 4483
1049 Ga0496108_0384046 3300048911 Bacteria 1226
1050 Ga0496108_0406643 3300048911 Bacteria 1189
1051 Ga0496108_0593903 3300048911 Bacteria 965
1052 Ga0496109_0002664 3300048912 Bacteria 14980
1053 Ga0496109_0003753 3300048912 Bacteria 12693
1054 Ga0496109_0011893 3300048912 Bacteria 7492
1055 Ga0496109_0024484 3300048912 Bacteria 5367
1056 Ga0496109_0071267 3300048912 Bacteria 3190
1057 Ga0496109_0077082 3300048912 Bacteria 3067
1058 Ga0496109_0368632 3300048912 Bacteria 1357
1059 Ga0496109_0423908 3300048912 Bacteria 1257
1060 Ga0496109_0448446 3300048912 Unclassified 1219
1061 Ga0496110_0000607 3300048913 Bacteria 24647
1062 Ga0496110_0000686 3300048913 Bacteria 23305
1063 Ga0496110_0001231 3300048913 Bacteria 18265
1064 Ga0496110_0002554 3300048913 Bacteria 13680
1065 Ga0496110_0007796 3300048913 Bacteria 8578
1066 Ga0496110_0028638 3300048913 Bacteria 4786
1067 Ga0496110_0041397 3300048913 Bacteria 4020
1068 Ga0496110_0260112 3300048913 Bacteria 1580
1069 Ga0496110_0299571 3300048913 Unclassified 1464
1070 Ga0496110_0490635 3300048913 Unclassified 1119
1071 Ga0496110_1638309 3300048913 Bacteria 553
1072 Ga0496111_0000143 3300048914 Bacteria 32058
1073 Ga0496111_0000268 3300048914 Bacteria 25447
1074 Ga0496111_0001049 3300048914 Bacteria 15218
1075 Ga0496111_0002012 3300048914 Bacteria 12086
1076 Ga0496111_0021403 3300048914 Bacteria 4515
1077 Ga0496111_0028084 3300048914 Bacteria 3985
1078 Ga0496111_0054535 3300048914 Bacteria 2890
1079 Ga0496111_0087209 3300048914 Bacteria 2284
1080 Ga0496111_0126911 3300048914 Bacteria 1886
1081 Ga0496112_0008601 3300048915 Bacteria 9148
1082 Ga0496112_0018951 3300048915 Bacteria 6486
1083 Ga0496112_0021571 3300048915 Bacteria 6127
1084 Ga0496112_0042473 3300048915 Bacteria 4448
1085 Ga0496112_0044452 3300048915 Bacteria 4352
1086 Ga0496112_0066637 3300048915 Bacteria 3553
1087 Ga0496112_0079007 3300048915 Bacteria 3253
1088 Ga0496112_0148963 3300048915 Bacteria 2307
1089 Ga0496112_0282221 3300048915 Bacteria 1608
1090 Ga0496112_1335654 3300048915 Bacteria 632
1091 Ga0496112_1805120 3300048915 Unclassified 523
1092 Ga0496113_0000470 3300048916 Bacteria 19761
1093 Ga0496113_0002207 3300048916 Bacteria 11228
1094 Ga0496113_0013465 3300048916 Bacteria 5543
1095 Ga0496113_0029986 3300048916 Bacteria 3933
1096 Ga0496113_0039515 3300048916 Bacteria 3473
1097 Ga0496113_0070947 3300048916 Bacteria 2649
1098 Ga0496113_0220859 3300048916 Bacteria 1510
1099 Ga0496113_0623371 3300048916 Bacteria 863
1100 Ga0496114_0007895 3300048917 Bacteria 8421
1101 Ga0496114_0027671 3300048917 Bacteria 4646
1102 Ga0496114_0028575 3300048917 Bacteria 4577
1103 Ga0496114_0043115 3300048917 Bacteria 3742
1104 Ga0496114_0056780 3300048917 Bacteria 3267
1105 Ga0496114_0123569 3300048917 Unclassified 2228
1106 Ga0496114_0218353 3300048917 Bacteria 1673
1107 Ga0496114_0246748 3300048917 Bacteria 1571
1108 Ga0496114_0327959 3300048917 Bacteria 1353
1109 Ga0496114_0478742 3300048917 Bacteria 1101
1110 Ga0496114_0748186 3300048917 Unclassified 855
1111 Ga0496115_0010231 3300048918 Bacteria 6999
1112 Ga0496115_0121230 3300048918 Bacteria 2152
1113 Ga0496115_0174698 3300048918 Bacteria 1776
1114 Ga0496115_0555712 3300048918 Unclassified 917
1115 Ga0496115_0571458 3300048918 Bacteria 902
1116 Ga0496115_0631093 3300048918 Bacteria 849
1117 Ga0501306_060129 3300049127 Unclassified 625
1118 Ga0501308_055440 3300049128 Unclassified 588
1119 Ga0501309_043998 3300049129 Unclassified 688
1120 Ga0501310_023288 3300049130 Unclassified 787
1121 Ga0501305_096812 3300049161 Unclassified 546
1122 Ga0501315_069655 3300049531 Bacteria 582
1123 Ga0501315_075734 3300049531 Unclassified 565
1124 Ga0501316_067455 3300049532 Unclassified 537
1125 Ga0501317_081759 3300049533 Unclassified 560
1126 Ga0501320_031813 3300049536 Unclassified 660
1127 Ga0501323_026410 3300049539 Unclassified 795
1128 Ga0501031_0020421 3300049568 Bacteria 4317
1129 Ga0501031_0032228 3300049568 Bacteria 3417
1130 Ga0501032_0083039 3300049569 Bacteria 2131
1131 Ga0501032_0106525 3300049569 Bacteria 1857
1132 Ga0501033_0201019 3300049570 Bacteria 1423
1133 Ga0501033_0299050 3300049570 Bacteria 1133
1134 Ga0501036_0008154 3300049572 Bacteria 8585
1135 Ga0501036_0017361 3300049572 Bacteria 6016
1136 Ga0501036_0221940 3300049572 Bacteria 1587
1137 Ga0501036_0337426 3300049572 Bacteria 1259
1138 Ga0501037_0072648 3300049573 Bacteria 2502
1139 Ga0501037_0301661 3300049573 Unclassified 1112
1140 Ga0501038_0075580 3300049574 Bacteria 2847
1141 Ga0501038_0179785 3300049574 Bacteria 1707
1142 Ga0501038_0463156 3300049574 Unclassified 973
1143 Ga0501039_0020102 3300049575 Bacteria 5119
1144 Ga0501039_0022610 3300049575 Bacteria 4826
1145 Ga0501040_0011235 3300049576 Bacteria 5860
1146 Ga0501040_0029428 3300049576 Bacteria 3707
1147 Ga0501041_0025936 3300049577 Bacteria 3524
1148 Ga0501041_0033827 3300049577 Bacteria 3093
1149 Ga0501041_0186573 3300049577 Bacteria 1299
1150 Ga0501042_0004455 3300049578 Bacteria 8929
1151 Ga0501042_0109780 3300049578 Unclassified 1986
1152 Ga0501042_0213008 3300049578 Unclassified 1394
1153 Ga0501043_0068569 3300049579 Bacteria 2785
1154 Ga0501046_0034103 3300049580 Bacteria 4110
1155 Ga0501046_0045758 3300049580 Bacteria 3475
1156 Ga0501046_0157286 3300049580 Bacteria 1711
1157 Ga0501047_0063063 3300049581 Bacteria 3575
1158 Ga0501048_0006233 3300049582 Bacteria 9070
1159 Ga0501048_0026410 3300049582 Bacteria 4228
1160 Ga0501067_0016472 3300049583 Bacteria 4083
1161 Ga0501067_0085329 3300049583 Bacteria 1752
1162 Ga0501067_0215463 3300049583 Bacteria 1069
1163 Ga0501067_0297180 3300049583 Bacteria 899
1164 Ga0501068_0010140 3300049584 Bacteria 5286
1165 Ga0501069_0035516 3300049585 Unclassified 2747
1166 Ga0501069_0090960 3300049585 Bacteria 1726
1167 Ga0501069_0189362 3300049585 Unclassified 1190
1168 Ga0501070_0003032 3300049586 Bacteria 14629
1169 Ga0501070_0244857 3300049586 Bacteria 1467
1170 Ga0501070_0981713 3300049586 Unclassified 656
1171 Ga0501071_0006130 3300049587 Bacteria 7793
1172 Ga0501071_0015906 3300049587 Bacteria 5167
1173 Ga0501072_0005956 3300049588 Bacteria 9289
1174 Ga0501072_0040149 3300049588 Bacteria 3674
1175 Ga0501073_0180700 3300049589 Bacteria 1460
1176 Ga0501073_0346123 3300049589 Bacteria 1026
1177 Ga0501073_0363800 3300049589 Bacteria 999
1178 Ga0501074_0169548 3300049590 Bacteria 1558
1179 Ga0501074_0250499 3300049590 Bacteria 1259
1180 Ga0501074_0333684 3300049590 Bacteria 1076
1181 Ga0501075_0021603 3300049591 Bacteria 4693
1182 Ga0501075_0259293 3300049591 Bacteria 1325
1183 Ga0501076_0057189 3300049592 Bacteria 3096
1184 Ga0501076_0073176 3300049592 Bacteria 2743
1185 Ga0501076_0105910 3300049592 Bacteria 2270
1186 Ga0501076_0222880 3300049592 Unclassified 1541
1187 Ga0501077_0018208 3300049593 Bacteria 4443
1188 Ga0501077_0277573 3300049593 Bacteria 1066
1189 Ga0501198_068694 3300049649 Unclassified 664
1190 Ga0501079_0025083 3300049741 Bacteria 4573
1191 Ga0501079_0027705 3300049741 Bacteria 4346
1192 Ga0501079_0157032 3300049741 Unclassified 1773
1193 Ga0501079_1082212 3300049741 Bacteria 632
1194 Ga0501080_0037881 3300049742 Bacteria 4503
1195 Ga0501080_0185783 3300049742 Bacteria 1911
1196 Ga0501081_0005943 3300049743 Bacteria 7900
1197 Ga0501081_0027124 3300049743 Bacteria 3866
1198 Ga0501081_0034980 3300049743 Bacteria 3419
1199 Ga0501081_0881278 3300049743 Unclassified 675
1200 Ga0501081_1198079 3300049743 Unclassified 575
1201 Ga0501265_027997 3300049762 Unclassified 798
1202 Ga0501278_018503 3300049774 Bacteria 625
1203 Ga0501035_0093061 3300049822 Bacteria 2652
1204 Ga0501044_0320999 3300049823 Bacteria 1473
1205 Ga0501045_0016680 3300049824 Bacteria 5217
1206 Ga0501045_0049757 3300049824 Bacteria 3056
1207 Ga0501045_0277173 3300049824 Unclassified 1248
1208 Ga0501045_0435296 3300049824 Unclassified 975
1209 nmdc:mga0yw44_170136_c1 3300050492 Bacteria 1430
1210 nmdc:mga0yw44_995252_c1 3300050492 Unclassified 568
1211 nmdc:mga05p37_14477_c1 3300050507 Bacteria 9471
1212 nmdc:mga05p37_40586_c1 3300050507 Bacteria 5715
1213 nmdc:mga05p37_741755_c1 3300050507 Bacteria 1084
1214 nmdc:mga05p37_87023_c1 3300050507 Unclassified 3851
1215 nmdc:mga09592_184067_c1 3300050508 Bacteria 1807
1216 nmdc:mga09592_242266_c1 3300050508 Bacteria 1562
1217 nmdc:mga09592_409810_c1 3300050508 Bacteria 1171
1218 nmdc:mga0qj67_497499_c1 3300050509 Bacteria 980
1219 nmdc:mga08y16_133018_c1 3300050511 Bacteria 2585
1220 nmdc:mga08y16_1892509_c1 3300050511 Unclassified 548
1221 nmdc:mga08y16_425406_c1 3300050511 Unclassified 1357
1222 nmdc:mga0n895_1242399_c1 3300050512 Bacteria 718
1223 nmdc:mga0n895_1537_c1 3300050512 Bacteria 17340
1224 nmdc:mga0n895_45890_c1 3300050512 Bacteria 4267
1225 nmdc:mga0n895_538713_c1 3300050512 Bacteria 1174
1226 nmdc:mga0n895_611918_c1 3300050512 Unclassified 1091
1227 nmdc:mga0n895_906346_c1 3300050512 Unclassified 867
1228 nmdc:mga0rr50_1704978_c1 3300050513 Bacteria 531
1229 nmdc:mga0rr50_189532_c1 3300050513 Bacteria 1684
1230 nmdc:mga0rr50_3988_c1 3300050513 Bacteria 8601
1231 nmdc:mga0rr50_45176_c1 3300050513 Bacteria 3236
1232 nmdc:mga0rr50_545237_c1 3300050513 Bacteria 987
1233 nmdc:mga0rr50_76299_c1 3300050513 Bacteria 2573
1234 nmdc:mga08x19_110110_c1 3300050514 Bacteria 1836
1235 nmdc:mga08x19_593749_c1 3300050514 Unclassified 785
1236 nmdc:mga0a205_1355381_c1 3300050515 Unclassified 559
1237 nmdc:mga0a205_53447_c1 3300050515 Bacteria 3899
1238 nmdc:mga0a205_615555_c1 3300050515 Bacteria 938
1239 nmdc:mga0a205_70334_c1 3300050515 Bacteria 3378
1240 nmdc:mga0a205_719512_c1 3300050515 Unclassified 848
1241 nmdc:mga0a205_9777_c1 3300050515 Bacteria 8790
1242 Ga0495601_0012146 3300053077 Bacteria 5163
1243 Ga0495612_0014933 3300053078 Bacteria 3115
1244 Ga0495655_0121409 3300053083 Bacteria 796
1245 Ga0495595_0300059 3300053084 Bacteria 808
1246 Ga0495619_0002360 3300053085 Bacteria 12420
1247 Ga0495619_0022723 3300053085 Bacteria 4016
1248 Ga0501084_0007712 3300054114 Bacteria 8867
1249 Ga0501084_0011070 3300054114 Bacteria 7469
1250 Ga0501084_0065323 3300054114 Bacteria 3044
1251 Ga0590074_048561 3300059423 Bacteria 774
1252 Ga0590075_021758 3300059424 Unclassified 1602
1253 Ga0590075_027704 3300059424 Bacteria 1430
1254 Ga0590077_077850 3300059426 Unclassified 762
1255 Ga0587066_073763 3300059490 Unclassified 724
1256 Ga0587066_155087 3300059490 Bacteria 571
1257 Ga0587073_0148781 3300059492 Unclassified 660
1258 Ga0587077_077747 3300059493 Unclassified 755
1259 Ga0587077_223962 3300059493 Unclassified 532
1260 Ga0587080_028064 3300059503 Unclassified 964
1261 Ga0587082_139217 3300059504 Unclassified 564
1262 Ga0587083_0123187 3300059505 Unclassified 672
1263 Ga0587085_062516 3300059506 Bacteria 708
1264 Ga0587086_098774 3300059507 Unclassified 536
1265 Ga0587106_050627 3300059605 Unclassified 735
1266 Ga0587106_087329 3300059605 Bacteria 617
1267 Ga0587106_109255 3300059605 Bacteria 574
1268 Ga0587106_127851 3300059605 Unclassified 546
1269 Ga0587129_014405 3300059608 Bacteria 650
1270 Ga0587099_029092 3300059622 Unclassified 663
1271 Ga0587115_079294 3300059626 Bacteria 579
1272 Ga0587128_068964 3300059630 Unclassified 685
1273 Ga0587128_104308 3300059630 Bacteria 598
1274 Ga0587067_170253 3300059640 Unclassified 560
1275 Ga0587068_155730 3300059641 Bacteria 520
1276 Ga0587107_090601 3300059652 Unclassified 590
1277 Ga0587107_110129 3300059652 Unclassified 556
1278 Ga0587114_035893 3300059655 Bacteria 782
1279 Ga0587114_074001 3300059655 Unclassified 622
1280 Ga0587114_077394 3300059655 Unclassified 613
1281 Ga0587114_098672 3300059655 Unclassified 567
1282 Ga0587071_121864 3300060344 Bacteria 624
1283 Ga0587111_0213790 3300060346 Unclassified 553
1284 Ga0501082_0047529 3300060353 Bacteria 3698
1285 Ga0501082_0059270 3300060353 Bacteria 3299
1286 Ga0501082_0728445 3300060353 Bacteria 868
1287 Ga0501082_0790364 3300060353 Bacteria 830
1288 Ga0466962_0011131 3300061719 Bacteria 4329
1289 Ga0466962_0015403 3300061719 Unclassified 3686
1290 Ga0466962_0099199 3300061719 Bacteria 1398
1291 Ga0466962_0111257 3300061719 Unclassified 1318
1292 Ga0530510_0004115 3300061734 Bacteria 10040
1293 Ga0530510_0004914 3300061734 Bacteria 9234
1294 Ga0530510_0560488 3300061734 Bacteria 868

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0684805 Ga0373935_0684805_26_457 143
2 3300046517 Ga0495630_0682969 Ga0495630_0682969_23_454 143
3 3300049572 Ga0501036_0221940 Ga0501036_0221940_99_545 146
4 3300049577 Ga0501041_0186573 Ga0501041_0186573_706_1152 146
5 3300049591 Ga0501075_0259293 Ga0501075_0259293_702_1148 146
6 3300049592 Ga0501076_0105910 Ga0501076_0105910_560_1006 146
7 3300046523 Ga0495644_0093325 Ga0495644_0093325_384_869 147
8 3300003373 JGI25407J50210_10002710 JGI25407J50210_100027101 148
9 3300005468 Ga0070707_100773229 Ga0070707_1007732291 148
10 3300005981 Ga0081538_10000810 Ga0081538_1000081035 148
11 3300005981 Ga0081538_10029132 Ga0081538_100291324 148
12 3300005981 Ga0081538_10101464 Ga0081538_101014642 148
13 3300005981 Ga0081538_10264360 Ga0081538_102643601 148
14 3300009094 Ga0111539_10043756 Ga0111539_100437562 148
15 3300009148 Ga0105243_11057786 Ga0105243_110577862 148
16 3300012480 Ga0157346_1002678 Ga0157346_10026781 148
17 3300020078 Ga0206352_10477607 Ga0206352_104776071 148
18 3300025906 Ga0207699_11241337 Ga0207699_112413371 148
19 3300025910 Ga0207684_10645521 Ga0207684_106455212 148
20 3300025918 Ga0207662_10181976 Ga0207662_101819761 148
21 3300025922 Ga0207646_10099005 Ga0207646_100990051 148
22 3300025922 Ga0207646_10641640 Ga0207646_106416402 148
23 3300025929 Ga0207664_10404125 Ga0207664_104041252 148
24 3300025929 Ga0207664_11349453 Ga0207664_113494531 148
25 3300026067 Ga0207678_10826522 Ga0207678_108265222 148
26 3300031548 Ga0307408_100816795 Ga0307408_1008167952 148
27 3300032002 Ga0307416_100653652 Ga0307416_1006536522 148
28 3300035118 Ga0373954_0327878 Ga0373954_0327878_160_606 148
29 3300037418 Ga0395900_0020761 Ga0395900_0020761_3288_3734 148
30 3300037466 Ga0395898_0059109 Ga0395898_0059109_1190_1636 148
31 3300037471 Ga0395905_0774761 Ga0395905_0774761_271_717 148
32 3300038443 Ga0395901_0006450 Ga0395901_0006450_1454_1900 148
33 3300044712 Ga0453684_2444840 Ga0453684_2444840_46_492 148
34 3300045976 Ga0466967_0349891 Ga0466967_0349891_367_813 148
35 3300046475 Ga0495639_0091609 Ga0495639_0091609_104_550 148
36 3300046491 Ga0495584_0209392 Ga0495584_0209392_514_960 148
37 3300046492 Ga0495585_0446738 Ga0495585_0446738_59_544 148
38 3300046523 Ga0495644_0093176 Ga0495644_0093176_81_527 148
39 3300046528 Ga0495642_0241587 Ga0495642_0241587_59_505 148
40 3300046529 Ga0495652_0709931 Ga0495652_0709931_24_470 148
41 3300046536 Ga0495587_0339430 Ga0495587_0339430_369_815 148
42 3300046537 Ga0495598_0172318 Ga0495598_0172318_196_642 148
43 3300046664 Ga0495659_0067505 Ga0495659_0067505_759_1205 148
44 3300046683 Ga0495658_0416658 Ga0495658_0416658_319_765 148
45 3300046683 Ga0495658_0895582 Ga0495658_0895582_48_494 148
46 3300047317 Ga0495604_0836995 Ga0495604_0836995_97_543 148
47 3300047318 Ga0495636_0168407 Ga0495636_0168407_346_831 148
48 3300047322 Ga0495680_0304064 Ga0495680_0304064_13_459 148
49 3300047322 Ga0495680_0517406 Ga0495680_0517406_166_612 148
50 3300047445 Ga0495677_0234197 Ga0495677_0234197_162_608 148
51 3300047471 Ga0495684_0229576 Ga0495684_0229576_847_1293 148
52 3300048905 Ga0496102_0041411 Ga0496102_0041411_127_573 148
53 3300048912 Ga0496109_0448446 Ga0496109_0448446_139_585 148
54 3300049536 Ga0501320_031813 Ga0501320_031813_39_491 148
55 3300050512 nmdc:mga0n895_538713_c1 nmdc:mga0n895_538713_c1_186_632 148
56 3300050515 nmdc:mga0a205_719512_c1 nmdc:mga0a205_719512_c1_312_758 148
57 3300053085 Ga0495619_0022723 Ga0495619_0022723_1664_2110 148
58 3300059605 Ga0587106_087329 Ga0587106_087329_16_462 148
59 3300059626 Ga0587115_079294 Ga0587115_079294_96_542 148
60 3300059641 Ga0587068_155730 Ga0587068_155730_61_507 148
61 3300059655 Ga0587114_077394 Ga0587114_077394_12_458 148
62 3300003659 JGI25404J52841_10066359 JGI25404J52841_100663591 149
63 3300003693 Ga0032354_1082681 Ga0032354_10826811 149
64 3300003693 Ga0032354_1108405 Ga0032354_11084052 149
65 3300005327 Ga0070658_10001819 Ga0070658_100018199 149
66 3300005327 Ga0070658_10014355 Ga0070658_100143552 149
67 3300005327 Ga0070658_10126046 Ga0070658_101260462 149
68 3300005327 Ga0070658_10127295 Ga0070658_101272953 149
69 3300005328 Ga0070676_10216600 Ga0070676_102166002 149
70 3300005328 Ga0070676_10776798 Ga0070676_107767981 149
71 3300005329 Ga0070683_100032427 Ga0070683_1000324272 149
72 3300005329 Ga0070683_100062845 Ga0070683_1000628452 149
73 3300005329 Ga0070683_100146815 Ga0070683_1001468152 149
74 3300005329 Ga0070683_100225095 Ga0070683_1002250953 149
75 3300005329 Ga0070683_100313875 Ga0070683_1003138752 149
76 3300005329 Ga0070683_100350081 Ga0070683_1003500812 149
77 3300005329 Ga0070683_100372723 Ga0070683_1003727232 149
78 3300005329 Ga0070683_100512039 Ga0070683_1005120392 149
79 3300005329 Ga0070683_100517869 Ga0070683_1005178692 149
80 3300005329 Ga0070683_100776781 Ga0070683_1007767811 149
81 3300005336 Ga0070680_100061142 Ga0070680_1000611422 149
82 3300005336 Ga0070680_100089572 Ga0070680_1000895722 149
83 3300005336 Ga0070680_100132794 Ga0070680_1001327943 149
84 3300005336 Ga0070680_100290523 Ga0070680_1002905231 149
85 3300005337 Ga0070682_100049194 Ga0070682_1000491945 149
86 3300005337 Ga0070682_100056442 Ga0070682_1000564422 149
87 3300005337 Ga0070682_100222048 Ga0070682_1002220482 149
88 3300005337 Ga0070682_100498976 Ga0070682_1004989761 149
89 3300005338 Ga0068868_100110320 Ga0068868_1001103202 149
90 3300005338 Ga0068868_100138734 Ga0068868_1001387342 149
91 3300005338 Ga0068868_100682899 Ga0068868_1006828991 149
92 3300005339 Ga0070660_100004585 Ga0070660_1000045853 149
93 3300005339 Ga0070660_100004801 Ga0070660_1000048015 149
94 3300005339 Ga0070660_100050409 Ga0070660_1000504093 149
95 3300005339 Ga0070660_100421334 Ga0070660_1004213342 149
96 3300005339 Ga0070660_100439551 Ga0070660_1004395512 149
97 3300005341 Ga0070691_10074100 Ga0070691_100741002 149
98 3300005341 Ga0070691_10083985 Ga0070691_100839852 149
99 3300005341 Ga0070691_10157872 Ga0070691_101578722 149
100 3300005341 Ga0070691_10333396 Ga0070691_103333962 149
101 3300005343 Ga0070687_100333633 Ga0070687_1003336331 149
102 3300005344 Ga0070661_100192041 Ga0070661_1001920412 149
103 3300005344 Ga0070661_100211506 Ga0070661_1002115062 149
104 3300005344 Ga0070661_100352031 Ga0070661_1003520311 149
105 3300005345 Ga0070692_10187145 Ga0070692_101871452 149
106 3300005345 Ga0070692_10358636 Ga0070692_103586362 149
107 3300005345 Ga0070692_10783232 Ga0070692_107832321 149
108 3300005347 Ga0070668_100012108 Ga0070668_1000121084 149
109 3300005354 Ga0070675_100490648 Ga0070675_1004906483 149
110 3300005354 Ga0070675_100996960 Ga0070675_1009969601 149
111 3300005355 Ga0070671_101200608 Ga0070671_1012006081 149
112 3300005356 Ga0070674_100193562 Ga0070674_1001935622 149
113 3300005366 Ga0070659_100088578 Ga0070659_1000885781 149
114 3300005366 Ga0070659_100137328 Ga0070659_1001373282 149
115 3300005366 Ga0070659_100744459 Ga0070659_1007444592 149
116 3300005434 Ga0070709_10014260 Ga0070709_100142602 149
117 3300005434 Ga0070709_10684574 Ga0070709_106845741 149
118 3300005435 Ga0070714_100007622 Ga0070714_1000076224 149
119 3300005435 Ga0070714_100014641 Ga0070714_1000146413 149
120 3300005435 Ga0070714_100044213 Ga0070714_1000442133 149
121 3300005435 Ga0070714_100068376 Ga0070714_1000683762 149
122 3300005435 Ga0070714_100616671 Ga0070714_1006166711 149
123 3300005435 Ga0070714_101618144 Ga0070714_1016181441 149
124 3300005436 Ga0070713_100032009 Ga0070713_1000320093 149
125 3300005437 Ga0070710_10004520 Ga0070710_100045203 149
126 3300005438 Ga0070701_10282822 Ga0070701_102828221 149
127 3300005439 Ga0070711_100004518 Ga0070711_1000045184 149
128 3300005439 Ga0070711_100099146 Ga0070711_1000991462 149
129 3300005439 Ga0070711_100787571 Ga0070711_1007875711 149
130 3300005441 Ga0070700_100526794 Ga0070700_1005267942 149
131 3300005445 Ga0070708_100290219 Ga0070708_1002902192 149
132 3300005445 Ga0070708_100776206 Ga0070708_1007762062 149
133 3300005445 Ga0070708_101389761 Ga0070708_1013897611 149
134 3300005455 Ga0070663_100041208 Ga0070663_1000412081 149
135 3300005456 Ga0070678_100006809 Ga0070678_1000068093 149
136 3300005456 Ga0070678_100140005 Ga0070678_1001400053 149
137 3300005456 Ga0070678_100294679 Ga0070678_1002946792 149
138 3300005456 Ga0070678_101040183 Ga0070678_1010401831 149
139 3300005457 Ga0070662_100033036 Ga0070662_1000330363 149
140 3300005457 Ga0070662_100290693 Ga0070662_1002906932 149
141 3300005458 Ga0070681_10004088 Ga0070681_1000408812 149
142 3300005458 Ga0070681_10006514 Ga0070681_100065149 149
143 3300005458 Ga0070681_10027460 Ga0070681_100274607 149
144 3300005458 Ga0070681_10082772 Ga0070681_100827724 149
145 3300005458 Ga0070681_10193383 Ga0070681_101933832 149
146 3300005458 Ga0070681_10268838 Ga0070681_102688382 149
147 3300005458 Ga0070681_10283103 Ga0070681_102831032 149
148 3300005458 Ga0070681_10290488 Ga0070681_102904882 149
149 3300005459 Ga0068867_100368361 Ga0068867_1003683612 149
150 3300005467 Ga0070706_100614519 Ga0070706_1006145192 149
151 3300005467 Ga0070706_101311353 Ga0070706_1013113531 149
152 3300005468 Ga0070707_100103307 Ga0070707_1001033071 149
153 3300005471 Ga0070698_100040021 Ga0070698_1000400212 149
154 3300005471 Ga0070698_100065237 Ga0070698_1000652372 149
155 3300005471 Ga0070698_100372924 Ga0070698_1003729242 149
156 3300005518 Ga0070699_100486837 Ga0070699_1004868372 149
157 3300005530 Ga0070679_100182831 Ga0070679_1001828312 149
158 3300005530 Ga0070679_100196350 Ga0070679_1001963502 149
159 3300005530 Ga0070679_100262979 Ga0070679_1002629792 149
160 3300005530 Ga0070679_100282015 Ga0070679_1002820152 149
161 3300005530 Ga0070679_100295910 Ga0070679_1002959102 149
162 3300005535 Ga0070684_100000801 Ga0070684_10000080121 149
163 3300005535 Ga0070684_100102941 Ga0070684_1001029413 149
164 3300005535 Ga0070684_100692242 Ga0070684_1006922422 149
165 3300005535 Ga0070684_101147590 Ga0070684_1011475901 149
166 3300005536 Ga0070697_100221996 Ga0070697_1002219962 149
167 3300005536 Ga0070697_100662707 Ga0070697_1006627071 149
168 3300005536 Ga0070697_100750343 Ga0070697_1007503431 149
169 3300005539 Ga0068853_100321819 Ga0068853_1003218192 149
170 3300005544 Ga0070686_100139366 Ga0070686_1001393662 149
171 3300005544 Ga0070686_100150075 Ga0070686_1001500752 149
172 3300005544 Ga0070686_100225473 Ga0070686_1002254732 149
173 3300005544 Ga0070686_100690740 Ga0070686_1006907401 149
174 3300005546 Ga0070696_100263131 Ga0070696_1002631312 149
175 3300005547 Ga0070693_100007688 Ga0070693_1000076883 149
176 3300005547 Ga0070693_100021315 Ga0070693_1000213155 149
177 3300005547 Ga0070693_100034110 Ga0070693_1000341102 149
178 3300005547 Ga0070693_100677572 Ga0070693_1006775721 149
179 3300005548 Ga0070665_100226041 Ga0070665_1002260412 149
180 3300005549 Ga0070704_100048220 Ga0070704_1000482205 149
181 3300005549 Ga0070704_100475868 Ga0070704_1004758681 149
182 3300005563 Ga0068855_100025890 Ga0068855_1000258901 149
183 3300005563 Ga0068855_100091414 Ga0068855_1000914142 149
184 3300005563 Ga0068855_100118990 Ga0068855_1001189901 149
185 3300005563 Ga0068855_100746732 Ga0068855_1007467323 149
186 3300005564 Ga0070664_100281820 Ga0070664_1002818202 149
187 3300005577 Ga0068857_100379305 Ga0068857_1003793052 149
188 3300005577 Ga0068857_101107682 Ga0068857_1011076822 149
189 3300005578 Ga0068854_101065808 Ga0068854_1010658081 149
190 3300005614 Ga0068856_100100179 Ga0068856_1001001794 149
191 3300005614 Ga0068856_100166231 Ga0068856_1001662311 149
192 3300005614 Ga0068856_100350522 Ga0068856_1003505222 149
193 3300005614 Ga0068856_100563345 Ga0068856_1005633452 149
194 3300005614 Ga0068856_100836793 Ga0068856_1008367932 149
195 3300005614 Ga0068856_100852208 Ga0068856_1008522081 149
196 3300005615 Ga0070702_100666868 Ga0070702_1006668681 149
197 3300005615 Ga0070702_100707514 Ga0070702_1007075141 149
198 3300005617 Ga0068859_100830411 Ga0068859_1008304111 149
199 3300005618 Ga0068864_100148089 Ga0068864_1001480893 149
200 3300005618 Ga0068864_100592602 Ga0068864_1005926022 149
201 3300005718 Ga0068866_10332312 Ga0068866_103323122 149
202 3300005719 Ga0068861_100333020 Ga0068861_1003330202 149
203 3300005719 Ga0068861_100982220 Ga0068861_1009822201 149
204 3300005840 Ga0068870_10293364 Ga0068870_102933641 149
205 3300005937 Ga0081455_10001467 Ga0081455_100014672 149
206 3300005937 Ga0081455_10022972 Ga0081455_100229722 149
207 3300005937 Ga0081455_10026240 Ga0081455_100262404 149
208 3300005937 Ga0081455_10679134 Ga0081455_106791341 149
209 3300005983 Ga0081540_1006384 Ga0081540_10063845 149
210 3300005983 Ga0081540_1122615 Ga0081540_11226152 149
211 3300005985 Ga0081539_10002873 Ga0081539_100028735 149
212 3300005985 Ga0081539_10005502 Ga0081539_1000550213 149
213 3300006028 Ga0070717_10005916 Ga0070717_100059163 149
214 3300006028 Ga0070717_10023231 Ga0070717_100232312 149
215 3300006028 Ga0070717_10770812 Ga0070717_107708121 149
216 3300006028 Ga0070717_11477289 Ga0070717_114772891 149
217 3300006163 Ga0070715_10000547 Ga0070715_100005472 149
218 3300006163 Ga0070715_10016713 Ga0070715_100167132 149
219 3300006173 Ga0070716_100011977 Ga0070716_1000119771 149
220 3300006175 Ga0070712_100017518 Ga0070712_1000175182 149
221 3300006175 Ga0070712_100018807 Ga0070712_1000188074 149
222 3300006175 Ga0070712_100023644 Ga0070712_1000236444 149
223 3300006175 Ga0070712_100576012 Ga0070712_1005760121 149
224 3300006237 Ga0097621_100720388 Ga0097621_1007203881 149
225 3300006358 Ga0068871_100007707 Ga0068871_1000077079 149
226 3300006358 Ga0068871_100225830 Ga0068871_1002258303 149
227 3300006358 Ga0068871_100293750 Ga0068871_1002937502 149
228 3300006844 Ga0075428_100058891 Ga0075428_1000588912 149
229 3300006844 Ga0075428_100682551 Ga0075428_1006825511 149
230 3300006844 Ga0075428_100872540 Ga0075428_1008725402 149
231 3300006846 Ga0075430_100955344 Ga0075430_1009553441 149
232 3300006847 Ga0075431_100214819 Ga0075431_1002148192 149
233 3300006852 Ga0075433_10251602 Ga0075433_102516022 149
234 3300006852 Ga0075433_10353902 Ga0075433_103539022 149
235 3300006852 Ga0075433_10581390 Ga0075433_105813902 149
236 3300006852 Ga0075433_10816622 Ga0075433_108166222 149
237 3300006852 Ga0075433_11404369 Ga0075433_114043691 149
238 3300006871 Ga0075434_100007883 Ga0075434_1000078833 149
239 3300006871 Ga0075434_100619985 Ga0075434_1006199852 149
240 3300006871 Ga0075434_100725952 Ga0075434_1007259522 149
241 3300006880 Ga0075429_100266247 Ga0075429_1002662472 149
242 3300006881 Ga0068865_100153223 Ga0068865_1001532232 149
243 3300006914 Ga0075436_100013985 Ga0075436_1000139853 149
244 3300006914 Ga0075436_100177325 Ga0075436_1001773253 149
245 3300006931 Ga0097620_100830363 Ga0097620_1008303631 149
246 3300007076 Ga0075435_100042872 Ga0075435_1000428725 149
247 3300007076 Ga0075435_100212215 Ga0075435_1002122153 149
248 3300007076 Ga0075435_100659062 Ga0075435_1006590621 149
249 3300007076 Ga0075435_100730778 Ga0075435_1007307782 149
250 3300009093 Ga0105240_10022932 Ga0105240_100229321 149
251 3300009093 Ga0105240_10369245 Ga0105240_103692453 149
252 3300009094 Ga0111539_10056167 Ga0111539_100561676 149
253 3300009094 Ga0111539_10139905 Ga0111539_101399055 149
254 3300009094 Ga0111539_10523278 Ga0111539_105232782 149
255 3300009094 Ga0111539_10695973 Ga0111539_106959732 149
256 3300009094 Ga0111539_10765654 Ga0111539_107656542 149
257 3300009098 Ga0105245_10066849 Ga0105245_100668492 149
258 3300009098 Ga0105245_10239116 Ga0105245_102391162 149
259 3300009147 Ga0114129_10084137 Ga0114129_100841372 149
260 3300009147 Ga0114129_10105057 Ga0114129_101050571 149
261 3300009147 Ga0114129_10297667 Ga0114129_102976672 149
262 3300009147 Ga0114129_11533003 Ga0114129_115330032 149
263 3300009147 Ga0114129_11916082 Ga0114129_119160821 149
264 3300009147 Ga0114129_11996118 Ga0114129_119961182 149
265 3300009148 Ga0105243_10047204 Ga0105243_100472043 149
266 3300009148 Ga0105243_10089760 Ga0105243_100897602 149
267 3300009148 Ga0105243_10225630 Ga0105243_102256302 149
268 3300009174 Ga0105241_10155054 Ga0105241_101550541 149
269 3300009174 Ga0105241_10289162 Ga0105241_102891622 149
270 3300009176 Ga0105242_10232162 Ga0105242_102321622 149
271 3300009177 Ga0105248_10861225 Ga0105248_108612252 149
272 3300009177 Ga0105248_10926106 Ga0105248_109261062 149
273 3300009551 Ga0105238_10636068 Ga0105238_106360681 149
274 3300009551 Ga0105238_11044875 Ga0105238_110448752 149
275 3300009553 Ga0105249_10037375 Ga0105249_100373752 149
276 3300010375 Ga0105239_10299013 Ga0105239_102990133 149
277 3300010375 Ga0105239_10569539 Ga0105239_105695392 149
278 3300010375 Ga0105239_10602377 Ga0105239_106023771 149
279 3300011119 Ga0105246_10383420 Ga0105246_103834201 149
280 3300012492 Ga0157335_1003378 Ga0157335_10033782 149
281 3300012495 Ga0157323_1030873 Ga0157323_10308731 149
282 3300012502 Ga0157347_1035647 Ga0157347_10356471 149
283 3300012505 Ga0157339_1018751 Ga0157339_10187511 149
284 3300013100 Ga0157373_10867427 Ga0157373_108674271 149
285 3300013104 Ga0157370_10012656 Ga0157370_100126562 149
286 3300013104 Ga0157370_10015330 Ga0157370_100153309 149
287 3300013105 Ga0157369_10007224 Ga0157369_1000722414 149
288 3300013105 Ga0157369_10014831 Ga0157369_100148312 149
289 3300013105 Ga0157369_10085150 Ga0157369_100851501 149
290 3300013105 Ga0157369_10195732 Ga0157369_101957322 149
291 3300013105 Ga0157369_11080692 Ga0157369_110806922 149
292 3300013296 Ga0157374_11261068 Ga0157374_112610681 149
293 3300013297 Ga0157378_10345765 Ga0157378_103457652 149
294 3300013306 Ga0163162_10043186 Ga0163162_100431863 149
295 3300013306 Ga0163162_10790275 Ga0163162_107902753 149
296 3300013307 Ga0157372_11533161 Ga0157372_115331611 149
297 3300013308 Ga0157375_10084328 Ga0157375_100843281 149
298 3300013308 Ga0157375_10925021 Ga0157375_109250211 149
299 3300014325 Ga0163163_10095497 Ga0163163_100954972 149
300 3300014325 Ga0163163_10400628 Ga0163163_104006282 149
301 3300014325 Ga0163163_11614892 Ga0163163_116148921 149
302 3300014326 Ga0157380_10793471 Ga0157380_107934711 149
303 3300014497 Ga0182008_10001177 Ga0182008_1000117726 149
304 3300014745 Ga0157377_10547068 Ga0157377_105470682 149
305 3300014745 Ga0157377_10774238 Ga0157377_107742381 149
306 3300014968 Ga0157379_10322581 Ga0157379_103225812 149
307 3300014968 Ga0157379_10392585 Ga0157379_103925852 149
308 3300014969 Ga0157376_10024024 Ga0157376_100240243 149
309 3300014969 Ga0157376_12076602 Ga0157376_120766021 149
310 3300014969 Ga0157376_12847310 Ga0157376_128473101 149
311 3300015261 Ga0182006_1006406 Ga0182006_10064068 149
312 3300015265 Ga0182005_1246970 Ga0182005_12469701 149
313 3300017792 Ga0163161_10056959 Ga0163161_100569592 149
314 3300017792 Ga0163161_11054400 Ga0163161_110544002 149
315 3300020069 Ga0197907_10115781 Ga0197907_101157811 149
316 3300020069 Ga0197907_10259069 Ga0197907_102590691 149
317 3300020069 Ga0197907_10646087 Ga0197907_106460871 149
318 3300020069 Ga0197907_10816011 Ga0197907_108160112 149
319 3300020069 Ga0197907_10946676 Ga0197907_109466761 149
320 3300020069 Ga0197907_10989329 Ga0197907_109893291 149
321 3300020069 Ga0197907_10991756 Ga0197907_109917562 149
322 3300020069 Ga0197907_11235414 Ga0197907_112354141 149
323 3300020070 Ga0206356_11081805 Ga0206356_1108180510 149
324 3300020070 Ga0206356_11440917 Ga0206356_114409171 149
325 3300020070 Ga0206356_11539823 Ga0206356_115398232 149
326 3300020070 Ga0206356_11829134 Ga0206356_118291341 149
327 3300020075 Ga0206349_1032949 Ga0206349_10329492 149
328 3300020075 Ga0206349_1354224 Ga0206349_13542241 149
329 3300020075 Ga0206349_1781439 Ga0206349_17814391 149
330 3300020076 Ga0206355_1618283 Ga0206355_16182831 149
331 3300020077 Ga0206351_10087162 Ga0206351_100871621 149
332 3300020077 Ga0206351_10101498 Ga0206351_101014981 149
333 3300020077 Ga0206351_10280456 Ga0206351_102804561 149
334 3300020077 Ga0206351_10906755 Ga0206351_109067551 149
335 3300020078 Ga0206352_10598490 Ga0206352_105984902 149
336 3300020078 Ga0206352_10901676 Ga0206352_109016761 149
337 3300020080 Ga0206350_10440665 Ga0206350_104406651 149
338 3300020080 Ga0206350_10450772 Ga0206350_104507721 149
339 3300020080 Ga0206350_11170503 Ga0206350_111705031 149
340 3300020080 Ga0206350_11310057 Ga0206350_113100571 149
341 3300020080 Ga0206350_11330243 Ga0206350_113302431 149
342 3300020081 Ga0206354_10319059 Ga0206354_103190592 149
343 3300020081 Ga0206354_10365229 Ga0206354_103652292 149
344 3300020081 Ga0206354_10750390 Ga0206354_107503901 149
345 3300020081 Ga0206354_10951817 Ga0206354_109518177 149
346 3300020082 Ga0206353_10032922 Ga0206353_100329223 149
347 3300020082 Ga0206353_10535060 Ga0206353_105350602 149
348 3300020082 Ga0206353_10752732 Ga0206353_107527329 149
349 3300020082 Ga0206353_11042009 Ga0206353_110420091 149
350 3300020082 Ga0206353_11226669 Ga0206353_112266692 149
351 3300020082 Ga0206353_12050204 Ga0206353_120502042 149
352 3300022467 Ga0224712_10013713 Ga0224712_100137133 149
353 3300022467 Ga0224712_10052056 Ga0224712_100520562 149
354 3300022467 Ga0224712_10121293 Ga0224712_101212932 149
355 3300022467 Ga0224712_10123476 Ga0224712_101234762 149
356 3300022467 Ga0224712_10161701 Ga0224712_101617012 149
357 3300022467 Ga0224712_10218063 Ga0224712_102180632 149
358 3300022467 Ga0224712_10287472 Ga0224712_102874722 149
359 3300022467 Ga0224712_10337006 Ga0224712_103370062 149
360 3300022467 Ga0224712_10474398 Ga0224712_104743981 149
361 3300025898 Ga0207692_10006102 Ga0207692_100061025 149
362 3300025898 Ga0207692_10007669 Ga0207692_100076692 149
363 3300025898 Ga0207692_10037623 Ga0207692_100376232 149
364 3300025901 Ga0207688_10183390 Ga0207688_101833902 149
365 3300025901 Ga0207688_10257601 Ga0207688_102576012 149
366 3300025901 Ga0207688_10378901 Ga0207688_103789011 149
367 3300025904 Ga0207647_10290690 Ga0207647_102906902 149
368 3300025905 Ga0207685_10003503 Ga0207685_100035033 149
369 3300025905 Ga0207685_10107047 Ga0207685_101070472 149
370 3300025906 Ga0207699_10003899 Ga0207699_100038993 149
371 3300025906 Ga0207699_10343782 Ga0207699_103437822 149
372 3300025906 Ga0207699_10421329 Ga0207699_104213292 149
373 3300025906 Ga0207699_11100056 Ga0207699_111000561 149
374 3300025909 Ga0207705_10084855 Ga0207705_100848552 149
375 3300025909 Ga0207705_10210842 Ga0207705_102108423 149
376 3300025911 Ga0207654_10207302 Ga0207654_102073021 149
377 3300025911 Ga0207654_10948484 Ga0207654_109484841 149
378 3300025912 Ga0207707_10016358 Ga0207707_100163583 149
379 3300025912 Ga0207707_10020322 Ga0207707_100203223 149
380 3300025912 Ga0207707_10049357 Ga0207707_100493572 149
381 3300025912 Ga0207707_10162341 Ga0207707_101623412 149
382 3300025912 Ga0207707_10221587 Ga0207707_102215871 149
383 3300025913 Ga0207695_10019003 Ga0207695_100190035 149
384 3300025913 Ga0207695_10113884 Ga0207695_101138842 149
385 3300025913 Ga0207695_10502715 Ga0207695_105027151 149
386 3300025913 Ga0207695_10602076 Ga0207695_106020761 149
387 3300025915 Ga0207693_10001363 Ga0207693_100013635 149
388 3300025915 Ga0207693_10004643 Ga0207693_1000464310 149
389 3300025916 Ga0207663_10006026 Ga0207663_100060262 149
390 3300025916 Ga0207663_10033555 Ga0207663_100335552 149
391 3300025917 Ga0207660_10038322 Ga0207660_100383222 149
392 3300025917 Ga0207660_10055618 Ga0207660_100556183 149
393 3300025917 Ga0207660_10086730 Ga0207660_100867301 149
394 3300025917 Ga0207660_10141637 Ga0207660_101416372 149
395 3300025919 Ga0207657_10007552 Ga0207657_100075528 149
396 3300025919 Ga0207657_10011057 Ga0207657_100110574 149
397 3300025919 Ga0207657_10017756 Ga0207657_100177565 149
398 3300025919 Ga0207657_10026504 Ga0207657_100265042 149
399 3300025919 Ga0207657_10029871 Ga0207657_100298715 149
400 3300025919 Ga0207657_10114680 Ga0207657_101146804 149
401 3300025919 Ga0207657_11157163 Ga0207657_111571631 149
402 3300025920 Ga0207649_10250280 Ga0207649_102502802 149
403 3300025920 Ga0207649_10338527 Ga0207649_103385271 149
404 3300025920 Ga0207649_10532375 Ga0207649_105323751 149
405 3300025920 Ga0207649_10942008 Ga0207649_109420081 149
406 3300025921 Ga0207652_10043343 Ga0207652_100433432 149
407 3300025921 Ga0207652_10071212 Ga0207652_100712125 149
408 3300025921 Ga0207652_10154373 Ga0207652_101543732 149
409 3300025921 Ga0207652_10658753 Ga0207652_106587531 149
410 3300025921 Ga0207652_10705771 Ga0207652_107057711 149
411 3300025921 Ga0207652_10770337 Ga0207652_107703372 149
412 3300025921 Ga0207652_10963621 Ga0207652_109636211 149
413 3300025922 Ga0207646_10000835 Ga0207646_1000083531 149
414 3300025922 Ga0207646_10047954 Ga0207646_100479543 149
415 3300025926 Ga0207659_10375683 Ga0207659_103756831 149
416 3300025927 Ga0207687_10021405 Ga0207687_100214052 149
417 3300025927 Ga0207687_10032474 Ga0207687_100324742 149
418 3300025927 Ga0207687_10046895 Ga0207687_100468952 149
419 3300025927 Ga0207687_10625599 Ga0207687_106255991 149
420 3300025928 Ga0207700_10006703 Ga0207700_100067035 149
421 3300025928 Ga0207700_10540118 Ga0207700_105401182 149
422 3300025928 Ga0207700_10760032 Ga0207700_107600322 149
423 3300025929 Ga0207664_10001898 Ga0207664_1000189810 149
424 3300025929 Ga0207664_10004348 Ga0207664_100043488 149
425 3300025929 Ga0207664_10033378 Ga0207664_100333782 149
426 3300025929 Ga0207664_10033903 Ga0207664_100339032 149
427 3300025929 Ga0207664_10059181 Ga0207664_100591812 149
428 3300025929 Ga0207664_10358747 Ga0207664_103587472 149
429 3300025929 Ga0207664_10520905 Ga0207664_105209051 149
430 3300025929 Ga0207664_10644985 Ga0207664_106449852 149
431 3300025929 Ga0207664_11184350 Ga0207664_111843501 149
432 3300025931 Ga0207644_10114987 Ga0207644_101149872 149
433 3300025931 Ga0207644_10126411 Ga0207644_101264111 149
434 3300025931 Ga0207644_10178644 Ga0207644_101786442 149
435 3300025932 Ga0207690_10621537 Ga0207690_106215371 149
436 3300025932 Ga0207690_10748280 Ga0207690_107482802 149
437 3300025933 Ga0207706_10005427 Ga0207706_100054273 149
438 3300025933 Ga0207706_10082183 Ga0207706_100821835 149
439 3300025934 Ga0207686_10070397 Ga0207686_100703972 149
440 3300025934 Ga0207686_10133288 Ga0207686_101332883 149
441 3300025935 Ga0207709_10186250 Ga0207709_101862502 149
442 3300025935 Ga0207709_10189755 Ga0207709_101897552 149
443 3300025935 Ga0207709_10200666 Ga0207709_102006662 149
444 3300025935 Ga0207709_10346166 Ga0207709_103461661 149
445 3300025935 Ga0207709_11727160 Ga0207709_117271601 149
446 3300025936 Ga0207670_11661705 Ga0207670_116617051 149
447 3300025937 Ga0207669_11194783 Ga0207669_111947832 149
448 3300025938 Ga0207704_11437701 Ga0207704_114377011 149
449 3300025939 Ga0207665_10000336 Ga0207665_1000033629 149
450 3300025939 Ga0207665_10000544 Ga0207665_1000054426 149
451 3300025940 Ga0207691_10220556 Ga0207691_102205562 149
452 3300025940 Ga0207691_10271825 Ga0207691_102718252 149
453 3300025941 Ga0207711_10512130 Ga0207711_105121301 149
454 3300025944 Ga0207661_10021154 Ga0207661_100211542 149
455 3300025944 Ga0207661_10296968 Ga0207661_102969682 149
456 3300025944 Ga0207661_10306710 Ga0207661_103067101 149
457 3300025944 Ga0207661_10603661 Ga0207661_106036612 149
458 3300025944 Ga0207661_10632484 Ga0207661_106324841 149
459 3300025944 Ga0207661_11100825 Ga0207661_111008251 149
460 3300025945 Ga0207679_10064814 Ga0207679_100648141 149
461 3300025945 Ga0207679_10613734 Ga0207679_106137342 149
462 3300025945 Ga0207679_11619643 Ga0207679_116196431 149
463 3300025949 Ga0207667_10014908 Ga0207667_100149086 149
464 3300025949 Ga0207667_10083012 Ga0207667_100830125 149
465 3300025949 Ga0207667_10239430 Ga0207667_102394303 149
466 3300025949 Ga0207667_10534994 Ga0207667_105349942 149
467 3300025949 Ga0207667_10543452 Ga0207667_105434522 149
468 3300025949 Ga0207667_12101688 Ga0207667_121016881 149
469 3300025960 Ga0207651_11272980 Ga0207651_112729801 149
470 3300025960 Ga0207651_11904528 Ga0207651_119045281 149
471 3300025961 Ga0207712_11297924 Ga0207712_112979241 149
472 3300025972 Ga0207668_10209388 Ga0207668_102093881 149
473 3300025981 Ga0207640_11046123 Ga0207640_110461232 149
474 3300025981 Ga0207640_11115840 Ga0207640_111158402 149
475 3300025981 Ga0207640_11751756 Ga0207640_117517561 149
476 3300026023 Ga0207677_10034168 Ga0207677_100341685 149
477 3300026023 Ga0207677_10062174 Ga0207677_100621742 149
478 3300026023 Ga0207677_10099391 Ga0207677_100993914 149
479 3300026023 Ga0207677_10556308 Ga0207677_105563081 149
480 3300026041 Ga0207639_10215981 Ga0207639_102159812 149
481 3300026041 Ga0207639_10241743 Ga0207639_102417432 149
482 3300026041 Ga0207639_10394626 Ga0207639_103946262 149
483 3300026067 Ga0207678_10012544 Ga0207678_100125441 149
484 3300026067 Ga0207678_10145954 Ga0207678_101459541 149
485 3300026075 Ga0207708_10317014 Ga0207708_103170142 149
486 3300026078 Ga0207702_10018302 Ga0207702_100183022 149
487 3300026078 Ga0207702_10028564 Ga0207702_100285642 149
488 3300026078 Ga0207702_10181504 Ga0207702_101815042 149
489 3300026078 Ga0207702_10368069 Ga0207702_103680692 149
490 3300026078 Ga0207702_10462149 Ga0207702_104621492 149
491 3300026078 Ga0207702_10787693 Ga0207702_107876932 149
492 3300026078 Ga0207702_11711937 Ga0207702_117119371 149
493 3300026089 Ga0207648_10319604 Ga0207648_103196043 149
494 3300026089 Ga0207648_10732853 Ga0207648_107328531 149
495 3300026116 Ga0207674_10175861 Ga0207674_101758613 149
496 3300026116 Ga0207674_10846048 Ga0207674_108460482 149
497 3300026118 Ga0207675_100003932 Ga0207675_10000393212 149
498 3300026118 Ga0207675_100716536 Ga0207675_1007165362 149
499 3300026118 Ga0207675_100897940 Ga0207675_1008979401 149
500 3300026121 Ga0207683_10006496 Ga0207683_1000649612 149
501 3300026121 Ga0207683_10038385 Ga0207683_100383852 149
502 3300026121 Ga0207683_10192049 Ga0207683_101920492 149
503 3300027717 Ga0209998_10042363 Ga0209998_100423631 149
504 3300027907 Ga0207428_10011552 Ga0207428_100115527 149
505 3300028379 Ga0268266_10487858 Ga0268266_104878581 149
506 3300028563 Ga0265319_1001184 Ga0265319_10011849 149
507 3300028577 Ga0265318_10008728 Ga0265318_100087282 149
508 3300028654 Ga0265322_10008319 Ga0265322_100083192 149
509 3300028800 Ga0265338_10021756 Ga0265338_100217564 149
510 3300031235 Ga0265330_10014203 Ga0265330_100142034 149
511 3300031238 Ga0265332_10088592 Ga0265332_100885922 149
512 3300031239 Ga0265328_10097022 Ga0265328_100970221 149
513 3300031240 Ga0265320_10100948 Ga0265320_101009482 149
514 3300031242 Ga0265329_10082352 Ga0265329_100823521 149
515 3300031247 Ga0265340_10043102 Ga0265340_100431023 149
516 3300031249 Ga0265339_10005422 Ga0265339_100054222 149
517 3300031250 Ga0265331_10042749 Ga0265331_100427492 149
518 3300031251 Ga0265327_10027941 Ga0265327_100279413 149
519 3300031344 Ga0265316_10139407 Ga0265316_101394072 149
520 3300031344 Ga0265316_10438782 Ga0265316_104387822 149
521 3300031711 Ga0265314_10037065 Ga0265314_100370652 149
522 3300031711 Ga0265314_10183910 Ga0265314_101839102 149
523 3300031712 Ga0265342_10031739 Ga0265342_100317394 149
524 3300031731 Ga0307405_11474539 Ga0307405_114745391 149
525 3300031824 Ga0307413_10013094 Ga0307413_100130945 149
526 3300031852 Ga0307410_10106281 Ga0307410_101062812 149
527 3300031901 Ga0307406_10217630 Ga0307406_102176301 149
528 3300031901 Ga0307406_10437392 Ga0307406_104373921 149
529 3300031903 Ga0307407_10017436 Ga0307407_100174363 149
530 3300031995 Ga0307409_100073101 Ga0307409_1000731012 149
531 3300031995 Ga0307409_100080946 Ga0307409_1000809465 149
532 3300031995 Ga0307409_100539139 Ga0307409_1005391392 149
533 3300032002 Ga0307416_100083403 Ga0307416_1000834032 149
534 3300032002 Ga0307416_100501233 Ga0307416_1005012332 149
535 3300032002 Ga0307416_100656259 Ga0307416_1006562592 149
536 3300032004 Ga0307414_11412582 Ga0307414_114125822 149
537 3300032005 Ga0307411_10140631 Ga0307411_101406312 149
538 3300032126 Ga0307415_100056494 Ga0307415_1000564943 149
539 3300034819 Ga0373958_0035589 Ga0373958_0035589_474_923 149
540 3300035084 Ga0373928_0041857 Ga0373928_0041857_17_466 149
541 3300035085 Ga0373929_0005112 Ga0373929_0005112_1496_1945 149
542 3300035088 Ga0373940_0055264 Ga0373940_0055264_159_608 149
543 3300035089 Ga0373944_0050180 Ga0373944_0050180_775_1224 149
544 3300035090 Ga0373949_0090444 Ga0373949_0090444_346_795 149
545 3300035092 Ga0373952_0043091 Ga0373952_0043091_381_830 149
546 3300035113 Ga0373936_0033789 Ga0373936_0033789_701_1150 149
547 3300035113 Ga0373936_0072951 Ga0373936_0072951_549_998 149
548 3300035114 Ga0373939_0045219 Ga0373939_0045219_437_886 149
549 3300035170 Ga0373943_0000813 Ga0373943_0000813_8938_9387 149
550 3300035170 Ga0373943_0105490 Ga0373943_0105490_735_1184 149
551 3300035170 Ga0373943_0111041 Ga0373943_0111041_115_564 149
552 3300035171 Ga0373946_0150740 Ga0373946_0150740_77_526 149
553 3300035241 Ga0373961_0052040 Ga0373961_0052040_342_791 149
554 3300035242 Ga0373962_0055198 Ga0373962_0055198_597_1046 149
555 3300035691 Ga0373931_0032081 Ga0373931_0032081_235_684 149
556 3300035691 Ga0373931_0211437 Ga0373931_0211437_32_481 149
557 3300035691 Ga0373931_0245511 Ga0373931_0245511_481_930 149
558 3300035692 Ga0373935_0235506 Ga0373935_0235506_535_984 149
559 3300035725 Ga0373947_0006490 Ga0373947_0006490_4773_5222 149
560 3300035725 Ga0373947_0009782 Ga0373947_0009782_3310_3759 149
561 3300035725 Ga0373947_0047281 Ga0373947_0047281_168_617 149
562 3300035725 Ga0373947_0072999 Ga0373947_0072999_266_715 149
563 3300037068 Ga0373925_0000812 Ga0373925_0000812_7914_8363 149
564 3300037068 Ga0373925_0699626 Ga0373925_0699626_14_463 149
565 3300037068 Ga0373925_0718463 Ga0373925_0718463_77_526 149
566 3300037312 Ga0395899_0044946 Ga0395899_0044946_1643_2092 149
567 3300037418 Ga0395900_0006320 Ga0395900_0006320_8802_9251 149
568 3300037418 Ga0395900_0032020 Ga0395900_0032020_685_1134 149
569 3300037418 Ga0395900_0037264 Ga0395900_0037264_3699_4148 149
570 3300037418 Ga0395900_0144086 Ga0395900_0144086_1948_2397 149
571 3300037418 Ga0395900_0184989 Ga0395900_0184989_398_856 149
572 3300037418 Ga0395900_0293118 Ga0395900_0293118_179_628 149
573 3300037418 Ga0395900_0719696 Ga0395900_0719696_328_777 149
574 3300037418 Ga0395900_0836344 Ga0395900_0836344_184_633 149
575 3300037418 Ga0395900_0893922 Ga0395900_0893922_219_668 149
576 3300037418 Ga0395900_1094394 Ga0395900_1094394_235_684 149
577 3300037466 Ga0395898_0025315 Ga0395898_0025315_53_502 149
578 3300037466 Ga0395898_0062235 Ga0395898_0062235_718_1167 149
579 3300037466 Ga0395898_0084924 Ga0395898_0084924_2360_2809 149
580 3300037466 Ga0395898_0129714 Ga0395898_0129714_88_537 149
581 3300037466 Ga0395898_0203263 Ga0395898_0203263_659_1108 149
582 3300037466 Ga0395898_0361399 Ga0395898_0361399_300_749 149
583 3300037466 Ga0395898_0472905 Ga0395898_0472905_218_667 149
584 3300037466 Ga0395898_0491584 Ga0395898_0491584_279_731 149
585 3300037466 Ga0395898_0508994 Ga0395898_0508994_143_616 149
586 3300037466 Ga0395898_1159276 Ga0395898_1159276_64_513 149
587 3300037471 Ga0395905_0007521 Ga0395905_0007521_4008_4457 149
588 3300037471 Ga0395905_0286410 Ga0395905_0286410_382_831 149
589 3300037471 Ga0395905_0651964 Ga0395905_0651964_14_463 149
590 3300038443 Ga0395901_0022292 Ga0395901_0022292_223_672 149
591 3300038443 Ga0395901_0057131 Ga0395901_0057131_1826_2275 149
592 3300038443 Ga0395901_0065114 Ga0395901_0065114_243_692 149
593 3300038443 Ga0395901_0107100 Ga0395901_0107100_1983_2432 149
594 3300038443 Ga0395901_0108700 Ga0395901_0108700_1946_2404 149
595 3300038443 Ga0395901_0299293 Ga0395901_0299293_396_845 149
596 3300038443 Ga0395901_0388518 Ga0395901_0388518_862_1311 149
597 3300038443 Ga0395901_0569344 Ga0395901_0569344_329_778 149
598 3300039437 Ga0436365_1172237 Ga0436365_1172237_57_506 149
599 3300039438 Ga0436360_0769076 Ga0436360_0769076_260_709 149
600 3300039453 Ga0436362_1228474 Ga0436362_1228474_80_529 149
601 3300041443 Ga0451789_1134997 Ga0451789_1134997_141_590 149
602 3300041496 Ga0451839_0248092 Ga0451839_0248092_64_513 149
603 3300042005 Ga0439448_0002325 Ga0439448_0002325_3234_3683 149
604 3300042012 Ga0439455_0021157 Ga0439455_0021157_431_880 149
605 3300042157 Ga0439458_0024096 Ga0439458_0024096_373_822 149
606 3300042437 Ga0439444_0037767 Ga0439444_0037767_55_504 149
607 3300044673 Ga0453683_0249518 Ga0453683_0249518_397_846 149
608 3300044694 Ga0466963_0000744 Ga0466963_0000744_12073_12522 149
609 3300044694 Ga0466963_0002408 Ga0466963_0002408_8592_9041 149
610 3300044694 Ga0466963_0031510 Ga0466963_0031510_2304_2753 149
611 3300044694 Ga0466963_0153414 Ga0466963_0153414_31_480 149
612 3300044694 Ga0466963_0709525 Ga0466963_0709525_37_486 149
613 3300044706 Ga0466964_0134102 Ga0466964_0134102_577_1026 149
614 3300044842 Ga0466957_0014432 Ga0466957_0014432_921_1376 149
615 3300044842 Ga0466957_0121909 Ga0466957_0121909_716_1165 149
616 3300044842 Ga0466957_0582636 Ga0466957_0582636_290_739 149
617 3300044901 Ga0466960_0016942 Ga0466960_0016942_1426_1875 149
618 3300045049 Ga0466959_0631493 Ga0466959_0631493_146_601 149
619 3300045051 Ga0451576_0037970 Ga0451576_0037970_149_598 149
620 3300045836 Ga0466958_0003510 Ga0466958_0003510_757_1212 149
621 3300045836 Ga0466958_0357947 Ga0466958_0357947_44_493 149
622 3300045836 Ga0466958_0428879 Ga0466958_0428879_378_830 149
623 3300045976 Ga0466967_0005287 Ga0466967_0005287_1694_2143 149
624 3300045976 Ga0466967_0033110 Ga0466967_0033110_2954_3403 149
625 3300045976 Ga0466967_0036315 Ga0466967_0036315_872_1321 149
626 3300045976 Ga0466967_0119834 Ga0466967_0119834_1771_2220 149
627 3300045976 Ga0466967_0125019 Ga0466967_0125019_121_570 149
628 3300045976 Ga0466967_0250303 Ga0466967_0250303_1001_1450 149
629 3300045976 Ga0466967_0477364 Ga0466967_0477364_364_813 149
630 3300045976 Ga0466967_0858164 Ga0466967_0858164_388_837 149
631 3300045976 Ga0466967_1141361 Ga0466967_1141361_221_670 149
632 3300045976 Ga0466967_2385549 Ga0466967_2385549_49_498 149
633 3300046455 Ga0495603_0005797 Ga0495603_0005797_210_659 149
634 3300046455 Ga0495603_0042538 Ga0495603_0042538_2155_2604 149
635 3300046457 Ga0495590_0163177 Ga0495590_0163177_18_467 149
636 3300046459 Ga0495629_0148342 Ga0495629_0148342_1150_1599 149
637 3300046459 Ga0495629_0157980 Ga0495629_0157980_158_607 149
638 3300046459 Ga0495629_0187479 Ga0495629_0187479_285_734 149
639 3300046461 Ga0495641_0011587 Ga0495641_0011587_1058_1507 149
640 3300046461 Ga0495641_0036634 Ga0495641_0036634_1744_2193 149
641 3300046461 Ga0495641_0170249 Ga0495641_0170249_502_951 149
642 3300046462 Ga0495651_0716744 Ga0495651_0716744_38_487 149
643 3300046472 Ga0495580_0001957 Ga0495580_0001957_4059_4508 149
644 3300046473 Ga0495582_0092659 Ga0495582_0092659_1003_1452 149
645 3300046473 Ga0495582_0095145 Ga0495582_0095145_65_514 149
646 3300046474 Ga0495605_0273339 Ga0495605_0273339_218_667 149
647 3300046475 Ga0495639_0000699 Ga0495639_0000699_13825_14274 149
648 3300046475 Ga0495639_0529372 Ga0495639_0529372_107_556 149
649 3300046475 Ga0495639_0564318 Ga0495639_0564318_58_507 149
650 3300046476 Ga0495662_0048384 Ga0495662_0048384_582_1031 149
651 3300046477 Ga0495664_0009726 Ga0495664_0009726_3431_3880 149
652 3300046491 Ga0495584_0104789 Ga0495584_0104789_150_599 149
653 3300046499 Ga0495594_0001276 Ga0495594_0001276_5688_6137 149
654 3300046500 Ga0495596_0052304 Ga0495596_0052304_502_951 149
655 3300046500 Ga0495596_0079524 Ga0495596_0079524_149_598 149
656 3300046501 Ga0495607_0192209 Ga0495607_0192209_394_843 149
657 3300046514 Ga0495618_0036416 Ga0495618_0036416_1617_2066 149
658 3300046517 Ga0495630_0001491 Ga0495630_0001491_6813_7262 149
659 3300046517 Ga0495630_0172845 Ga0495630_0172845_767_1216 149
660 3300046520 Ga0495637_0052345 Ga0495637_0052345_262_711 149
661 3300046523 Ga0495644_0045114 Ga0495644_0045114_470_919 149
662 3300046523 Ga0495644_0222836 Ga0495644_0222836_14_463 149
663 3300046526 Ga0495666_0000298 Ga0495666_0000298_7978_8427 149
664 3300046526 Ga0495666_0003426 Ga0495666_0003426_1035_1484 149
665 3300046529 Ga0495652_0113884 Ga0495652_0113884_1512_1961 149
666 3300046531 Ga0495665_0051507 Ga0495665_0051507_582_1031 149
667 3300046533 Ga0495640_0050221 Ga0495640_0050221_1972_2421 149
668 3300046533 Ga0495640_0287575 Ga0495640_0287575_408_857 149
669 3300046535 Ga0495586_0011405 Ga0495586_0011405_4214_4663 149
670 3300046535 Ga0495586_0098296 Ga0495586_0098296_890_1339 149
671 3300046538 Ga0495609_0115922 Ga0495609_0115922_183_632 149
672 3300046538 Ga0495609_0140262 Ga0495609_0140262_40_489 149
673 3300046539 Ga0495621_0191120 Ga0495621_0191120_53_502 149
674 3300046615 Ga0495656_0176238 Ga0495656_0176238_474_923 149
675 3300046642 Ga0495634_0062554 Ga0495634_0062554_1787_2236 149
676 3300046642 Ga0495634_0215920 Ga0495634_0215920_488_937 149
677 3300046648 Ga0495611_0317855 Ga0495611_0317855_56_505 149
678 3300046663 Ga0495635_0011220 Ga0495635_0011220_2822_3271 149
679 3300046663 Ga0495635_0540260 Ga0495635_0540260_293_742 149
680 3300046664 Ga0495659_0148606 Ga0495659_0148606_83_532 149
681 3300046674 Ga0495588_0048749 Ga0495588_0048749_1287_1736 149
682 3300046674 Ga0495588_0422380 Ga0495588_0422380_88_537 149
683 3300046678 Ga0495599_0121005 Ga0495599_0121005_413_862 149
684 3300046681 Ga0495647_0001206 Ga0495647_0001206_2898_3347 149
685 3300046683 Ga0495658_0080498 Ga0495658_0080498_1150_1599 149
686 3300046683 Ga0495658_0134588 Ga0495658_0134588_572_1021 149
687 3300046683 Ga0495658_0169670 Ga0495658_0169670_24_473 149
688 3300046683 Ga0495658_0357905 Ga0495658_0357905_19_468 149
689 3300046689 Ga0495613_0172299 Ga0495613_0172299_1022_1471 149
690 3300046689 Ga0495613_0313738 Ga0495613_0313738_207_656 149
691 3300046690 Ga0495624_0007376 Ga0495624_0007376_5949_6398 149
692 3300046691 Ga0495670_0429045 Ga0495670_0429045_251_700 149
693 3300046691 Ga0495670_0786783 Ga0495670_0786783_56_505 149
694 3300046692 Ga0495671_0255484 Ga0495671_0255484_259_708 149
695 3300047315 Ga0495581_0004047 Ga0495581_0004047_3559_4008 149
696 3300047315 Ga0495581_0340955 Ga0495581_0340955_14_463 149
697 3300047318 Ga0495636_0213749 Ga0495636_0213749_256_705 149
698 3300047319 Ga0495674_0027631 Ga0495674_0027631_3479_3928 149
699 3300047321 Ga0495676_0006956 Ga0495676_0006956_5821_6270 149
700 3300047321 Ga0495676_0018911 Ga0495676_0018911_5237_5686 149
701 3300047321 Ga0495676_0119176 Ga0495676_0119176_21_470 149
702 3300047321 Ga0495676_0375113 Ga0495676_0375113_56_505 149
703 3300047447 Ga0495685_015551 Ga0495685_015551_1741_2190 149
704 3300047471 Ga0495684_0101058 Ga0495684_0101058_1150_1599 149
705 3300047673 Ga0495593_0004815 Ga0495593_0004815_104_553 149
706 3300047673 Ga0495593_0436893 Ga0495593_0436893_112_561 149
707 3300048089 Ga0495614_0001813 Ga0495614_0001813_6088_6537 149
708 3300048090 Ga0495615_0296562 Ga0495615_0296562_50_499 149
709 3300048091 Ga0495626_0379213 Ga0495626_0379213_30_479 149
710 3300048903 Ga0496100_0003025 Ga0496100_0003025_3897_4346 149
711 3300048903 Ga0496100_0073572 Ga0496100_0073572_635_1084 149
712 3300048903 Ga0496100_0775513 Ga0496100_0775513_133_582 149
713 3300048903 Ga0496100_0905530 Ga0496100_0905530_72_521 149
714 3300048904 Ga0496101_0007189 Ga0496101_0007189_4649_5098 149
715 3300048904 Ga0496101_0054758 Ga0496101_0054758_172_621 149
716 3300048904 Ga0496101_0098101 Ga0496101_0098101_355_804 149
717 3300048904 Ga0496101_0140288 Ga0496101_0140288_186_635 149
718 3300048904 Ga0496101_0204261 Ga0496101_0204261_229_678 149
719 3300048904 Ga0496101_0332581 Ga0496101_0332581_160_609 149
720 3300048904 Ga0496101_0426100 Ga0496101_0426100_319_768 149
721 3300048905 Ga0496102_0005234 Ga0496102_0005234_2575_3024 149
722 3300048905 Ga0496102_0043823 Ga0496102_0043823_2779_3228 149
723 3300048905 Ga0496102_0107787 Ga0496102_0107787_1578_2027 149
724 3300048905 Ga0496102_0257836 Ga0496102_0257836_289_738 149
725 3300048905 Ga0496102_0535820 Ga0496102_0535820_584_1033 149
726 3300048906 Ga0496103_0006523 Ga0496103_0006523_1195_1644 149
727 3300048906 Ga0496103_0059182 Ga0496103_0059182_392_841 149
728 3300048906 Ga0496103_0314659 Ga0496103_0314659_534_983 149
729 3300048906 Ga0496103_0387789 Ga0496103_0387789_317_766 149
730 3300048907 Ga0496104_0000465 Ga0496104_0000465_7703_8152 149
731 3300048907 Ga0496104_0001293 Ga0496104_0001293_13805_14254 149
732 3300048907 Ga0496104_0004690 Ga0496104_0004690_10212_10661 149
733 3300048907 Ga0496104_0057628 Ga0496104_0057628_3132_3581 149
734 3300048907 Ga0496104_0064939 Ga0496104_0064939_2779_3228 149
735 3300048907 Ga0496104_0097732 Ga0496104_0097732_883_1332 149
736 3300048907 Ga0496104_0914245 Ga0496104_0914245_109_558 149
737 3300048907 Ga0496104_1047916 Ga0496104_1047916_144_593 149
738 3300048908 Ga0496105_0000567 Ga0496105_0000567_17775_18224 149
739 3300048908 Ga0496105_0001494 Ga0496105_0001494_2397_2846 149
740 3300048908 Ga0496105_0033728 Ga0496105_0033728_3433_3882 149
741 3300048908 Ga0496105_0051157 Ga0496105_0051157_1919_2368 149
742 3300048908 Ga0496105_0187235 Ga0496105_0187235_1109_1558 149
743 3300048908 Ga0496105_0438616 Ga0496105_0438616_21_470 149
744 3300048909 Ga0496106_0003242 Ga0496106_0003242_5328_5777 149
745 3300048909 Ga0496106_0007756 Ga0496106_0007756_2018_2467 149
746 3300048909 Ga0496106_0049191 Ga0496106_0049191_2107_2556 149
747 3300048909 Ga0496106_0081483 Ga0496106_0081483_222_671 149
748 3300048909 Ga0496106_0788218 Ga0496106_0788218_188_637 149
749 3300048910 Ga0496107_0001702 Ga0496107_0001702_5203_5652 149
750 3300048910 Ga0496107_0009067 Ga0496107_0009067_2557_3006 149
751 3300048910 Ga0496107_0220077 Ga0496107_0220077_132_581 149
752 3300048910 Ga0496107_0335020 Ga0496107_0335020_307_756 149
753 3300048910 Ga0496107_0667953 Ga0496107_0667953_278_727 149
754 3300048910 Ga0496107_1091240 Ga0496107_1091240_48_497 149
755 3300048911 Ga0496108_0001327 Ga0496108_0001327_18800_19249 149
756 3300048911 Ga0496108_0001889 Ga0496108_0001889_257_706 149
757 3300048911 Ga0496108_0009890 Ga0496108_0009890_5112_5561 149
758 3300048911 Ga0496108_0018453 Ga0496108_0018453_3985_4434 149
759 3300048911 Ga0496108_0030309 Ga0496108_0030309_758_1207 149
760 3300048911 Ga0496108_0384046 Ga0496108_0384046_188_637 149
761 3300048911 Ga0496108_0406643 Ga0496108_0406643_206_655 149
762 3300048912 Ga0496109_0002664 Ga0496109_0002664_6247_6696 149
763 3300048912 Ga0496109_0011893 Ga0496109_0011893_6669_7118 149
764 3300048912 Ga0496109_0024484 Ga0496109_0024484_160_609 149
765 3300048912 Ga0496109_0071267 Ga0496109_0071267_2114_2563 149
766 3300048912 Ga0496109_0077082 Ga0496109_0077082_1471_1920 149
767 3300048912 Ga0496109_0423908 Ga0496109_0423908_684_1133 149
768 3300048913 Ga0496110_0000607 Ga0496110_0000607_8524_8973 149
769 3300048913 Ga0496110_0000686 Ga0496110_0000686_21122_21571 149
770 3300048913 Ga0496110_0001231 Ga0496110_0001231_4791_5240 149
771 3300048913 Ga0496110_0002554 Ga0496110_0002554_142_591 149
772 3300048913 Ga0496110_0007796 Ga0496110_0007796_5915_6364 149
773 3300048913 Ga0496110_0028638 Ga0496110_0028638_166_615 149
774 3300048913 Ga0496110_0490635 Ga0496110_0490635_155_604 149
775 3300048913 Ga0496110_1638309 Ga0496110_1638309_64_513 149
776 3300048914 Ga0496111_0000143 Ga0496111_0000143_27143_27592 149
777 3300048914 Ga0496111_0001049 Ga0496111_0001049_14636_15085 149
778 3300048914 Ga0496111_0002012 Ga0496111_0002012_5479_5928 149
779 3300048914 Ga0496111_0021403 Ga0496111_0021403_4039_4488 149
780 3300048914 Ga0496111_0028084 Ga0496111_0028084_646_1095 149
781 3300048914 Ga0496111_0054535 Ga0496111_0054535_2244_2693 149
782 3300048914 Ga0496111_0087209 Ga0496111_0087209_1825_2274 149
783 3300048915 Ga0496112_0008601 Ga0496112_0008601_8406_8855 149
784 3300048915 Ga0496112_0018951 Ga0496112_0018951_915_1364 149
785 3300048915 Ga0496112_0021571 Ga0496112_0021571_4457_4906 149
786 3300048915 Ga0496112_0042473 Ga0496112_0042473_3284_3733 149
787 3300048915 Ga0496112_0066637 Ga0496112_0066637_2629_3078 149
788 3300048915 Ga0496112_0079007 Ga0496112_0079007_1919_2368 149
789 3300048915 Ga0496112_0282221 Ga0496112_0282221_57_506 149
790 3300048915 Ga0496112_1335654 Ga0496112_1335654_107_556 149
791 3300048916 Ga0496113_0000470 Ga0496113_0000470_2910_3359 149
792 3300048916 Ga0496113_0002207 Ga0496113_0002207_4108_4557 149
793 3300048916 Ga0496113_0013465 Ga0496113_0013465_4065_4514 149
794 3300048916 Ga0496113_0029986 Ga0496113_0029986_306_755 149
795 3300048916 Ga0496113_0039515 Ga0496113_0039515_80_529 149
796 3300048916 Ga0496113_0623371 Ga0496113_0623371_190_639 149
797 3300048917 Ga0496114_0007895 Ga0496114_0007895_2758_3207 149
798 3300048917 Ga0496114_0027671 Ga0496114_0027671_2718_3167 149
799 3300048917 Ga0496114_0028575 Ga0496114_0028575_588_1037 149
800 3300048917 Ga0496114_0056780 Ga0496114_0056780_2076_2525 149
801 3300048917 Ga0496114_0123569 Ga0496114_0123569_401_850 149
802 3300048917 Ga0496114_0218353 Ga0496114_0218353_95_544 149
803 3300048917 Ga0496114_0246748 Ga0496114_0246748_125_574 149
804 3300048917 Ga0496114_0327959 Ga0496114_0327959_605_1054 149
805 3300048917 Ga0496114_0478742 Ga0496114_0478742_431_880 149
806 3300048918 Ga0496115_0010231 Ga0496115_0010231_3419_3868 149
807 3300048918 Ga0496115_0121230 Ga0496115_0121230_1259_1708 149
808 3300048918 Ga0496115_0174698 Ga0496115_0174698_1138_1587 149
809 3300048918 Ga0496115_0555712 Ga0496115_0555712_162_611 149
810 3300048918 Ga0496115_0571458 Ga0496115_0571458_225_674 149
811 3300048918 Ga0496115_0631093 Ga0496115_0631093_378_827 149
812 3300049127 Ga0501306_060129 Ga0501306_060129_67_525 149
813 3300049128 Ga0501308_055440 Ga0501308_055440_82_540 149
814 3300049129 Ga0501309_043998 Ga0501309_043998_165_623 149
815 3300049130 Ga0501310_023288 Ga0501310_023288_259_717 149
816 3300049161 Ga0501305_096812 Ga0501305_096812_67_525 149
817 3300049531 Ga0501315_069655 Ga0501315_069655_65_523 149
818 3300049532 Ga0501316_067455 Ga0501316_067455_23_481 149
819 3300049539 Ga0501323_026410 Ga0501323_026410_65_523 149
820 3300049568 Ga0501031_0032228 Ga0501031_0032228_1822_2271 149
821 3300049569 Ga0501032_0083039 Ga0501032_0083039_746_1195 149
822 3300049570 Ga0501033_0201019 Ga0501033_0201019_380_829 149
823 3300049572 Ga0501036_0017361 Ga0501036_0017361_3325_3774 149
824 3300049572 Ga0501036_0337426 Ga0501036_0337426_299_748 149
825 3300049573 Ga0501037_0301661 Ga0501037_0301661_329_778 149
826 3300049574 Ga0501038_0179785 Ga0501038_0179785_1003_1452 149
827 3300049575 Ga0501039_0020102 Ga0501039_0020102_3225_3674 149
828 3300049576 Ga0501040_0011235 Ga0501040_0011235_3341_3790 149
829 3300049577 Ga0501041_0033827 Ga0501041_0033827_483_932 149
830 3300049578 Ga0501042_0109780 Ga0501042_0109780_1522_1971 149
831 3300049578 Ga0501042_0213008 Ga0501042_0213008_330_779 149
832 3300049579 Ga0501043_0068569 Ga0501043_0068569_1980_2429 149
833 3300049580 Ga0501046_0034103 Ga0501046_0034103_1189_1638 149
834 3300049580 Ga0501046_0157286 Ga0501046_0157286_576_1025 149
835 3300049581 Ga0501047_0063063 Ga0501047_0063063_2170_2619 149
836 3300049582 Ga0501048_0006233 Ga0501048_0006233_5761_6210 149
837 3300049583 Ga0501067_0016472 Ga0501067_0016472_2675_3124 149
838 3300049583 Ga0501067_0215463 Ga0501067_0215463_547_996 149
839 3300049583 Ga0501067_0297180 Ga0501067_0297180_138_587 149
840 3300049584 Ga0501068_0010140 Ga0501068_0010140_2207_2656 149
841 3300049585 Ga0501069_0035516 Ga0501069_0035516_2138_2587 149
842 3300049585 Ga0501069_0189362 Ga0501069_0189362_603_1052 149
843 3300049586 Ga0501070_0003032 Ga0501070_0003032_632_1081 149
844 3300049586 Ga0501070_0244857 Ga0501070_0244857_136_585 149
845 3300049586 Ga0501070_0981713 Ga0501070_0981713_23_472 149
846 3300049587 Ga0501071_0006130 Ga0501071_0006130_5515_5964 149
847 3300049588 Ga0501072_0040149 Ga0501072_0040149_1372_1821 149
848 3300049589 Ga0501073_0180700 Ga0501073_0180700_262_711 149
849 3300049589 Ga0501073_0346123 Ga0501073_0346123_533_982 149
850 3300049590 Ga0501074_0169548 Ga0501074_0169548_397_846 149
851 3300049590 Ga0501074_0333684 Ga0501074_0333684_576_1025 149
852 3300049591 Ga0501075_0021603 Ga0501075_0021603_1076_1525 149
853 3300049592 Ga0501076_0057189 Ga0501076_0057189_794_1243 149
854 3300049592 Ga0501076_0222880 Ga0501076_0222880_644_1093 149
855 3300049593 Ga0501077_0018208 Ga0501077_0018208_2848_3297 149
856 3300049593 Ga0501077_0277573 Ga0501077_0277573_82_531 149
857 3300049649 Ga0501198_068694 Ga0501198_068694_93_551 149
858 3300049741 Ga0501079_0025083 Ga0501079_0025083_2426_2875 149
859 3300049741 Ga0501079_0157032 Ga0501079_0157032_544_993 149
860 3300049742 Ga0501080_0037881 Ga0501080_0037881_987_1436 149
861 3300049742 Ga0501080_0185783 Ga0501080_0185783_1069_1518 149
862 3300049743 Ga0501081_0005943 Ga0501081_0005943_3295_3744 149
863 3300049743 Ga0501081_0027124 Ga0501081_0027124_2599_3048 149
864 3300049743 Ga0501081_0881278 Ga0501081_0881278_11_460 149
865 3300049743 Ga0501081_1198079 Ga0501081_1198079_66_515 149
866 3300049762 Ga0501265_027997 Ga0501265_027997_190_648 149
867 3300049822 Ga0501035_0093061 Ga0501035_0093061_14_463 149
868 3300049823 Ga0501044_0320999 Ga0501044_0320999_242_691 149
869 3300049824 Ga0501045_0016680 Ga0501045_0016680_1904_2353 149
870 3300049824 Ga0501045_0277173 Ga0501045_0277173_201_650 149
871 3300049824 Ga0501045_0435296 Ga0501045_0435296_230_679 149
872 3300050507 nmdc:mga05p37_14477_c1 nmdc:mga05p37_14477_c1_1417_1890 149
873 3300050508 nmdc:mga09592_184067_c1 nmdc:mga09592_184067_c1_371_820 149
874 3300050508 nmdc:mga09592_242266_c1 nmdc:mga09592_242266_c1_346_819 149
875 3300050511 nmdc:mga08y16_133018_c1 nmdc:mga08y16_133018_c1_677_1126 149
876 3300050511 nmdc:mga08y16_1892509_c1 nmdc:mga08y16_1892509_c1_14_463 149
877 3300050511 nmdc:mga08y16_425406_c1 nmdc:mga08y16_425406_c1_518_967 149
878 3300050512 nmdc:mga0n895_1242399_c1 nmdc:mga0n895_1242399_c1_136_585 149
879 3300050512 nmdc:mga0n895_1537_c1 nmdc:mga0n895_1537_c1_15044_15493 149
880 3300050512 nmdc:mga0n895_611918_c1 nmdc:mga0n895_611918_c1_161_610 149
881 3300050512 nmdc:mga0n895_906346_c1 nmdc:mga0n895_906346_c1_238_687 149
882 3300050513 nmdc:mga0rr50_1704978_c1 nmdc:mga0rr50_1704978_c1_35_484 149
883 3300050513 nmdc:mga0rr50_189532_c1 nmdc:mga0rr50_189532_c1_246_695 149
884 3300050513 nmdc:mga0rr50_3988_c1 nmdc:mga0rr50_3988_c1_2772_3221 149
885 3300050513 nmdc:mga0rr50_45176_c1 nmdc:mga0rr50_45176_c1_1452_1901 149
886 3300050513 nmdc:mga0rr50_545237_c1 nmdc:mga0rr50_545237_c1_398_847 149
887 3300050514 nmdc:mga08x19_110110_c1 nmdc:mga08x19_110110_c1_831_1280 149
888 3300050515 nmdc:mga0a205_1355381_c1 nmdc:mga0a205_1355381_c1_28_477 149
889 3300050515 nmdc:mga0a205_615555_c1 nmdc:mga0a205_615555_c1_195_644 149
890 3300050515 nmdc:mga0a205_70334_c1 nmdc:mga0a205_70334_c1_2684_3133 149
891 3300050515 nmdc:mga0a205_9777_c1 nmdc:mga0a205_9777_c1_461_910 149
892 3300053077 Ga0495601_0012146 Ga0495601_0012146_454_903 149
893 3300053078 Ga0495612_0014933 Ga0495612_0014933_1337_1786 149
894 3300053083 Ga0495655_0121409 Ga0495655_0121409_286_735 149
895 3300053084 Ga0495595_0300059 Ga0495595_0300059_306_755 149
896 3300053085 Ga0495619_0002360 Ga0495619_0002360_5456_5905 149
897 3300054114 Ga0501084_0011070 Ga0501084_0011070_5041_5490 149
898 3300054114 Ga0501084_0065323 Ga0501084_0065323_1564_2013 149
899 3300059490 Ga0587066_073763 Ga0587066_073763_190_639 149
900 3300059503 Ga0587080_028064 Ga0587080_028064_142_591 149
901 3300059504 Ga0587082_139217 Ga0587082_139217_92_541 149
902 3300059505 Ga0587083_0123187 Ga0587083_0123187_62_511 149
903 3300059506 Ga0587085_062516 Ga0587085_062516_70_519 149
904 3300059507 Ga0587086_098774 Ga0587086_098774_27_476 149
905 3300059605 Ga0587106_109255 Ga0587106_109255_58_510 149
906 3300059605 Ga0587106_127851 Ga0587106_127851_68_517 149
907 3300059608 Ga0587129_014405 Ga0587129_014405_149_598 149
908 3300059630 Ga0587128_104308 Ga0587128_104308_102_551 149
909 3300059640 Ga0587067_170253 Ga0587067_170253_69_518 149
910 3300059652 Ga0587107_110129 Ga0587107_110129_15_464 149
911 3300059655 Ga0587114_035893 Ga0587114_035893_314_763 149
912 3300059655 Ga0587114_074001 Ga0587114_074001_154_603 149
913 3300060346 Ga0587111_0213790 Ga0587111_0213790_47_496 149
914 3300060353 Ga0501082_0059270 Ga0501082_0059270_1147_1596 149
915 3300060353 Ga0501082_0790364 Ga0501082_0790364_231_680 149
916 3300061719 Ga0466962_0015403 Ga0466962_0015403_312_767 149
917 3300061719 Ga0466962_0099199 Ga0466962_0099199_820_1269 149
918 3300061734 Ga0530510_0004115 Ga0530510_0004115_2307_2756 149
919 3300061734 Ga0530510_0560488 Ga0530510_0560488_194_643 149
920 3300005344 Ga0070661_100140084 Ga0070661_1001400842 150
921 3300005434 Ga0070709_10386241 Ga0070709_103862412 150
922 3300005455 Ga0070663_100867727 Ga0070663_1008677272 150
923 3300006178 Ga0075367_10704883 Ga0075367_107048831 150
924 3300009098 Ga0105245_10012395 Ga0105245_100123956 150
925 3300009098 Ga0105245_10502889 Ga0105245_105028892 150
926 3300009177 Ga0105248_10296570 Ga0105248_102965703 150
927 3300014325 Ga0163163_10233481 Ga0163163_102334813 150
928 3300014969 Ga0157376_12418025 Ga0157376_124180251 150
929 3300015262 Ga0182007_10151282 Ga0182007_101512821 150
930 3300025915 Ga0207693_10040137 Ga0207693_100401373 150
931 3300028379 Ga0268266_11240317 Ga0268266_112403171 150
932 3300031251 Ga0265327_10040289 Ga0265327_100402893 150
933 3300031548 Ga0307408_100881441 Ga0307408_1008814411 150
934 3300031731 Ga0307405_10685370 Ga0307405_106853702 150
935 3300037312 Ga0395899_0089674 Ga0395899_0089674_77_529 150
936 3300037418 Ga0395900_0002249 Ga0395900_0002249_5476_5928 150
937 3300037418 Ga0395900_0003362 Ga0395900_0003362_2912_3364 150
938 3300037418 Ga0395900_0006716 Ga0395900_0006716_4746_5201 150
939 3300037418 Ga0395900_0007766 Ga0395900_0007766_3525_3980 150
940 3300037418 Ga0395900_0102290 Ga0395900_0102290_1868_2320 150
941 3300037466 Ga0395898_0001213 Ga0395898_0001213_27169_27621 150
942 3300037466 Ga0395898_0020563 Ga0395898_0020563_85_537 150
943 3300037466 Ga0395898_0028831 Ga0395898_0028831_93_548 150
944 3300037466 Ga0395898_0110958 Ga0395898_0110958_89_541 150
945 3300037466 Ga0395898_0133413 Ga0395898_0133413_392_844 150
946 3300037466 Ga0395898_0729085 Ga0395898_0729085_464_916 150
947 3300037466 Ga0395898_0918769 Ga0395898_0918769_145_600 150
948 3300037466 Ga0395898_1896003 Ga0395898_1896003_41_493 150
949 3300037471 Ga0395905_0004783 Ga0395905_0004783_2586_3038 150
950 3300037471 Ga0395905_0006777 Ga0395905_0006777_7792_8244 150
951 3300037471 Ga0395905_0011439 Ga0395905_0011439_472_927 150
952 3300037471 Ga0395905_0061123 Ga0395905_0061123_32_484 150
953 3300037471 Ga0395905_0463257 Ga0395905_0463257_550_1005 150
954 3300038443 Ga0395901_0000809 Ga0395901_0000809_9230_9682 150
955 3300038443 Ga0395901_0006756 Ga0395901_0006756_6963_7415 150
956 3300038443 Ga0395901_0006980 Ga0395901_0006980_5090_5545 150
957 3300038443 Ga0395901_0074149 Ga0395901_0074149_258_710 150
958 3300038443 Ga0395901_0077280 Ga0395901_0077280_2454_2906 150
959 3300038443 Ga0395901_0101550 Ga0395901_0101550_59_514 150
960 3300038443 Ga0395901_0558716 Ga0395901_0558716_50_502 150
961 3300041443 Ga0451789_0993490 Ga0451789_0993490_74_526 150
962 3300041459 Ga0451800_1121739 Ga0451800_1121739_267_719 150
963 3300046474 Ga0495605_0246811 Ga0495605_0246811_203_655 150
964 3300046491 Ga0495584_0420765 Ga0495584_0420765_63_515 150
965 3300046500 Ga0495596_0267132 Ga0495596_0267132_85_537 150
966 3300046511 Ga0495608_0848061 Ga0495608_0848061_34_486 150
967 3300046518 Ga0495631_0260207 Ga0495631_0260207_12_464 150
968 3300046518 Ga0495631_0357429 Ga0495631_0357429_79_531 150
969 3300046525 Ga0495663_0002901 Ga0495663_0002901_1538_1990 150
970 3300046664 Ga0495659_0005869 Ga0495659_0005869_2113_2565 150
971 3300046684 Ga0495669_0640959 Ga0495669_0640959_19_471 150
972 3300046794 Ga0495589_0386230 Ga0495589_0386230_62_514 150
973 3300047444 Ga0495675_0794262 Ga0495675_0794262_33_485 150
974 3300047446 Ga0495679_087273 Ga0495679_087273_19_471 150
975 3300047471 Ga0495684_0468980 Ga0495684_0468980_163_624 150
976 3300048903 Ga0496100_0112371 Ga0496100_0112371_313_765 150
977 3300048904 Ga0496101_0044862 Ga0496101_0044862_1216_1668 150
978 3300048904 Ga0496101_0095461 Ga0496101_0095461_829_1281 150
979 3300048906 Ga0496103_0014934 Ga0496103_0014934_466_918 150
980 3300048906 Ga0496103_0256971 Ga0496103_0256971_96_548 150
981 3300048907 Ga0496104_1377422 Ga0496104_1377422_70_522 150
982 3300048908 Ga0496105_0446533 Ga0496105_0446533_434_886 150
983 3300048909 Ga0496106_1255153 Ga0496106_1255153_110_562 150
984 3300048910 Ga0496107_0583830 Ga0496107_0583830_238_690 150
985 3300048911 Ga0496108_0010249 Ga0496108_0010249_4747_5199 150
986 3300048911 Ga0496108_0593903 Ga0496108_0593903_61_513 150
987 3300048912 Ga0496109_0003753 Ga0496109_0003753_8624_9076 150
988 3300048912 Ga0496109_0368632 Ga0496109_0368632_633_1085 150
989 3300048913 Ga0496110_0041397 Ga0496110_0041397_980_1432 150
990 3300048913 Ga0496110_0260112 Ga0496110_0260112_604_1056 150
991 3300048913 Ga0496110_0299571 Ga0496110_0299571_915_1367 150
992 3300048914 Ga0496111_0000268 Ga0496111_0000268_16709_17161 150
993 3300048915 Ga0496112_0044452 Ga0496112_0044452_3328_3780 150
994 3300048915 Ga0496112_1805120 Ga0496112_1805120_22_474 150
995 3300048916 Ga0496113_0070947 Ga0496113_0070947_1829_2281 150
996 3300048916 Ga0496113_0220859 Ga0496113_0220859_63_515 150
997 3300048917 Ga0496114_0043115 Ga0496114_0043115_516_968 150
998 3300048917 Ga0496114_0748186 Ga0496114_0748186_260_712 150
999 3300050492 nmdc:mga0yw44_170136_c1 nmdc:mga0yw44_170136_c1_282_734 150
1000 3300050492 nmdc:mga0yw44_995252_c1 nmdc:mga0yw44_995252_c1_65_517 150
1001 3300050507 nmdc:mga05p37_741755_c1 nmdc:mga05p37_741755_c1_406_861 150
1002 3300059490 Ga0587066_155087 Ga0587066_155087_60_512 150
1003 3300059493 Ga0587077_077747 Ga0587077_077747_250_702 150
1004 3300059605 Ga0587106_050627 Ga0587106_050627_144_596 150
1005 3300059622 Ga0587099_029092 Ga0587099_029092_118_570 150
1006 3300059630 Ga0587128_068964 Ga0587128_068964_183_635 150
1007 3300059652 Ga0587107_090601 Ga0587107_090601_62_514 150
1008 3300059655 Ga0587114_098672 Ga0587114_098672_51_503 150
1009 3300060344 Ga0587071_121864 Ga0587071_121864_58_510 150
1010 3300025915 Ga0207693_10599205 Ga0207693_105992052 151
1011 3300026067 Ga0207678_10303312 Ga0207678_103033122 151
1012 3300050508 nmdc:mga09592_409810_c1 nmdc:mga09592_409810_c1_19_531 151
1013 3300050509 nmdc:mga0qj67_497499_c1 nmdc:mga0qj67_497499_c1_218_730 151
1014 3300005329 Ga0070683_100616578 Ga0070683_1006165781 152
1015 3300005338 Ga0068868_100962164 Ga0068868_1009621641 152
1016 3300005354 Ga0070675_100249193 Ga0070675_1002491932 152
1017 3300005356 Ga0070674_100119094 Ga0070674_1001190942 152
1018 3300005438 Ga0070701_10340226 Ga0070701_103402261 152
1019 3300005466 Ga0070685_10079715 Ga0070685_100797151 152
1020 3300005518 Ga0070699_100082900 Ga0070699_1000829004 152
1021 3300005549 Ga0070704_100761258 Ga0070704_1007612581 152
1022 3300005615 Ga0070702_100428554 Ga0070702_1004285542 152
1023 3300009148 Ga0105243_10075049 Ga0105243_100750494 152
1024 3300012515 Ga0157338_1057235 Ga0157338_10572351 152
1025 3300014325 Ga0163163_10177243 Ga0163163_101772431 152
1026 3300014326 Ga0157380_10219626 Ga0157380_102196262 152
1027 3300025926 Ga0207659_10045709 Ga0207659_100457093 152
1028 3300025927 Ga0207687_10948390 Ga0207687_109483901 152
1029 3300025929 Ga0207664_10945917 Ga0207664_109459171 152
1030 3300025935 Ga0207709_10079938 Ga0207709_100799382 152
1031 3300025937 Ga0207669_10220113 Ga0207669_102201132 152
1032 3300025942 Ga0207689_10355326 Ga0207689_103553262 152
1033 3300026088 Ga0207641_11034157 Ga0207641_110341571 152
1034 3300028379 Ga0268266_10626469 Ga0268266_106264692 152
1035 3300031595 Ga0265313_10171330 Ga0265313_101713302 152
1036 3300031824 Ga0307413_10133173 Ga0307413_101331732 152
1037 3300031824 Ga0307413_10208002 Ga0307413_102080022 152
1038 3300031852 Ga0307410_11069234 Ga0307410_110692342 152
1039 3300031901 Ga0307406_10491808 Ga0307406_104918081 152
1040 3300031903 Ga0307407_11433451 Ga0307407_114334511 152
1041 3300032002 Ga0307416_100227725 Ga0307416_1002277252 152
1042 3300032002 Ga0307416_100385547 Ga0307416_1003855472 152
1043 3300032002 Ga0307416_100640371 Ga0307416_1006403712 152
1044 3300032002 Ga0307416_101965094 Ga0307416_1019650941 152
1045 3300032126 Ga0307415_100303402 Ga0307415_1003034022 152
1046 3300042004 Ga0439445_0025872 Ga0439445_0025872_318_779 152
1047 3300042145 Ga0450906_059770 Ga0450906_059770_88_549 152
1048 3300042146 Ga0450907_014954 Ga0450907_014954_491_952 152
1049 3300042147 Ga0450910_052409 Ga0450910_052409_56_517 152
1050 3300042435 Ga0439434_0062341 Ga0439434_0062341_417_878 152
1051 3300042531 Ga0450918_058941 Ga0450918_058941_76_537 152
1052 3300046518 Ga0495631_0160449 Ga0495631_0160449_74_535 152
1053 3300046518 Ga0495631_0206952 Ga0495631_0206952_157_618 152
1054 3300046523 Ga0495644_0072877 Ga0495644_0072877_197_658 152
1055 3300046615 Ga0495656_0316474 Ga0495656_0316474_15_476 152
1056 3300046615 Ga0495656_0384359 Ga0495656_0384359_149_610 152
1057 3300048090 Ga0495615_0098767 Ga0495615_0098767_286_747 152
1058 3300049531 Ga0501315_075734 Ga0501315_075734_40_501 152
1059 3300049533 Ga0501317_081759 Ga0501317_081759_60_521 152
1060 3300049568 Ga0501031_0020421 Ga0501031_0020421_235_696 152
1061 3300049569 Ga0501032_0106525 Ga0501032_0106525_86_547 152
1062 3300049570 Ga0501033_0299050 Ga0501033_0299050_16_477 152
1063 3300049572 Ga0501036_0008154 Ga0501036_0008154_2595_3056 152
1064 3300049573 Ga0501037_0072648 Ga0501037_0072648_1420_1881 152
1065 3300049574 Ga0501038_0075580 Ga0501038_0075580_2147_2608 152
1066 3300049574 Ga0501038_0463156 Ga0501038_0463156_29_490 152
1067 3300049575 Ga0501039_0022610 Ga0501039_0022610_2087_2548 152
1068 3300049576 Ga0501040_0029428 Ga0501040_0029428_1156_1617 152
1069 3300049577 Ga0501041_0025936 Ga0501041_0025936_2089_2550 152
1070 3300049578 Ga0501042_0004455 Ga0501042_0004455_4268_4729 152
1071 3300049580 Ga0501046_0045758 Ga0501046_0045758_473_934 152
1072 3300049582 Ga0501048_0026410 Ga0501048_0026410_2290_2751 152
1073 3300049585 Ga0501069_0090960 Ga0501069_0090960_132_593 152
1074 3300049587 Ga0501071_0015906 Ga0501071_0015906_2364_2825 152
1075 3300049588 Ga0501072_0005956 Ga0501072_0005956_2543_3004 152
1076 3300049589 Ga0501073_0363800 Ga0501073_0363800_171_632 152
1077 3300049590 Ga0501074_0250499 Ga0501074_0250499_294_755 152
1078 3300049592 Ga0501076_0073176 Ga0501076_0073176_784_1245 152
1079 3300049741 Ga0501079_0027705 Ga0501079_0027705_2371_2832 152
1080 3300049741 Ga0501079_1082212 Ga0501079_1082212_109_570 152
1081 3300049743 Ga0501081_0034980 Ga0501081_0034980_549_1010 152
1082 3300049774 Ga0501278_018503 Ga0501278_018503_105_566 152
1083 3300049824 Ga0501045_0049757 Ga0501045_0049757_556_1017 152
1084 3300054114 Ga0501084_0007712 Ga0501084_0007712_1120_1581 152
1085 3300059423 Ga0590074_048561 Ga0590074_048561_174_635 152
1086 3300059424 Ga0590075_021758 Ga0590075_021758_671_1132 152
1087 3300059424 Ga0590075_027704 Ga0590075_027704_298_759 152
1088 3300059426 Ga0590077_077850 Ga0590077_077850_111_572 152
1089 3300060353 Ga0501082_0047529 Ga0501082_0047529_1872_2333 152
1090 3300060353 Ga0501082_0728445 Ga0501082_0728445_254_715 152
1091 3300061734 Ga0530510_0004914 Ga0530510_0004914_5909_6370 152
1092 3300005564 Ga0070664_100671501 Ga0070664_1006715012 153
1093 3300009093 Ga0105240_10013540 Ga0105240_100135403 153
1094 3300009545 Ga0105237_10061228 Ga0105237_100612283 153
1095 3300013307 Ga0157372_10048315 Ga0157372_100483155 153
1096 3300020069 Ga0197907_10040416 Ga0197907_100404162 153
1097 3300020070 Ga0206356_10504429 Ga0206356_105044292 153
1098 3300020075 Ga0206349_1571039 Ga0206349_15710391 153
1099 3300020076 Ga0206355_1313739 Ga0206355_13137392 153
1100 3300020080 Ga0206350_10918953 Ga0206350_109189532 153
1101 3300020082 Ga0206353_11321372 Ga0206353_113213721 153
1102 3300022467 Ga0224712_10142503 Ga0224712_101425032 153
1103 3300025913 Ga0207695_10013582 Ga0207695_100135827 153
1104 3300025919 Ga0207657_10250020 Ga0207657_102500203 153
1105 3300026089 Ga0207648_10026457 Ga0207648_100264576 153
1106 3300028800 Ga0265338_10071275 Ga0265338_100712754 153
1107 3300032126 Ga0307415_101298074 Ga0307415_1012980741 153
1108 3300036401 Ga0373937_1032637 Ga0373937_1032637_123_584 153
1109 3300038443 Ga0395901_1394686 Ga0395901_1394686_35_496 153
1110 3300044683 Ga0466965_0279540 Ga0466965_0279540_82_543 153
1111 3300044684 Ga0466966_0041164 Ga0466966_0041164_720_1181 153
1112 3300044693 Ga0466961_0024090 Ga0466961_0024090_1471_1932 153
1113 3300044693 Ga0466961_0202950 Ga0466961_0202950_615_1076 153
1114 3300044694 Ga0466963_0006073 Ga0466963_0006073_144_605 153
1115 3300044706 Ga0466964_0065227 Ga0466964_0065227_962_1423 153
1116 3300044735 Ga0466968_0024637 Ga0466968_0024637_684_1145 153
1117 3300044842 Ga0466957_0021324 Ga0466957_0021324_852_1313 153
1118 3300044842 Ga0466957_0024900 Ga0466957_0024900_2674_3135 153
1119 3300044842 Ga0466957_0146888 Ga0466957_0146888_890_1351 153
1120 3300045049 Ga0466959_0033845 Ga0466959_0033845_2466_2927 153
1121 3300045836 Ga0466958_0002356 Ga0466958_0002356_7694_8155 153
1122 3300045836 Ga0466958_0004437 Ga0466958_0004437_4965_5426 153
1123 3300045976 Ga0466967_0794600 Ga0466967_0794600_391_852 153
1124 3300049583 Ga0501067_0085329 Ga0501067_0085329_982_1443 153
1125 3300059492 Ga0587073_0148781 Ga0587073_0148781_175_636 153
1126 3300061719 Ga0466962_0011131 Ga0466962_0011131_1152_1613 153
1127 3300061719 Ga0466962_0111257 Ga0466962_0111257_212_673 153
1128 3300006852 Ga0075433_10005721 Ga0075433_100057216 154
1129 3300006871 Ga0075434_100002659 Ga0075434_1000026598 154
1130 3300007076 Ga0075435_100002008 Ga0075435_1000020088 154
1131 3300009174 Ga0105241_10829768 Ga0105241_108297682 154
1132 3300027876 Ga0209974_10060311 Ga0209974_100603112 154
1133 3300027907 Ga0207428_10273354 Ga0207428_102733542 154
1134 3300028563 Ga0265319_1047886 Ga0265319_10478862 154
1135 3300028577 Ga0265318_10041967 Ga0265318_100419671 154
1136 3300035171 Ga0373946_0241158 Ga0373946_0241158_194_658 154
1137 3300035241 Ga0373961_0075692 Ga0373961_0075692_147_611 154
1138 3300035695 Ga0373927_0041489 Ga0373927_0041489_81_545 154
1139 3300035725 Ga0373947_0030406 Ga0373947_0030406_2214_2678 154
1140 3300037068 Ga0373925_0196937 Ga0373925_0196937_115_579 154
1141 3300044842 Ga0466957_0266953 Ga0466957_0266953_638_1102 154
1142 3300045836 Ga0466958_0274513 Ga0466958_0274513_111_575 154
1143 3300045976 Ga0466967_0283936 Ga0466967_0283936_407_871 154
1144 3300047315 Ga0495581_0155844 Ga0495581_0155844_33_497 154
1145 3300047321 Ga0495676_0019336 Ga0495676_0019336_1319_1783 154
1146 3300048915 Ga0496112_0148963 Ga0496112_0148963_1679_2143 154
1147 3300028800 Ga0265338_10005686 Ga0265338_100056865 155
1148 3300028800 Ga0265338_10049336 Ga0265338_100493362 155
1149 3300031595 Ga0265313_10054249 Ga0265313_100542492 155
1150 3300059493 Ga0587077_223962 Ga0587077_223962_16_483 155
1151 3300003203 JGI25406J46586_10142367 JGI25406J46586_101423671 156
1152 3300005330 Ga0070690_100176178 Ga0070690_1001761782 156
1153 3300005335 Ga0070666_10035265 Ga0070666_100352652 156
1154 3300005337 Ga0070682_100001302 Ga0070682_10000130210 156
1155 3300005338 Ga0068868_100640378 Ga0068868_1006403781 156
1156 3300005339 Ga0070660_100085859 Ga0070660_1000858592 156
1157 3300005341 Ga0070691_10127175 Ga0070691_101271752 156
1158 3300005343 Ga0070687_100070312 Ga0070687_1000703122 156
1159 3300005354 Ga0070675_100087510 Ga0070675_1000875103 156
1160 3300005355 Ga0070671_100072418 Ga0070671_1000724182 156
1161 3300005356 Ga0070674_100038392 Ga0070674_1000383922 156
1162 3300005365 Ga0070688_100001012 Ga0070688_10000101214 156
1163 3300005366 Ga0070659_100022325 Ga0070659_1000223253 156
1164 3300005437 Ga0070710_10025685 Ga0070710_100256855 156
1165 3300005438 Ga0070701_10004495 Ga0070701_100044953 156
1166 3300005439 Ga0070711_100482290 Ga0070711_1004822901 156
1167 3300005440 Ga0070705_100050391 Ga0070705_1000503912 156
1168 3300005441 Ga0070700_100003038 Ga0070700_1000030381 156
1169 3300005444 Ga0070694_100016536 Ga0070694_1000165366 156
1170 3300005445 Ga0070708_100014812 Ga0070708_1000148121 156
1171 3300005445 Ga0070708_100864005 Ga0070708_1008640051 156
1172 3300005455 Ga0070663_100074698 Ga0070663_1000746982 156
1173 3300005456 Ga0070678_100001535 Ga0070678_1000015352 156
1174 3300005456 Ga0070678_100975265 Ga0070678_1009752651 156
1175 3300005458 Ga0070681_10522189 Ga0070681_105221892 156
1176 3300005459 Ga0068867_100008961 Ga0068867_1000089611 156
1177 3300005466 Ga0070685_10100491 Ga0070685_101004911 156
1178 3300005467 Ga0070706_100036752 Ga0070706_1000367524 156
1179 3300005467 Ga0070706_100044922 Ga0070706_1000449222 156
1180 3300005467 Ga0070706_100277171 Ga0070706_1002771712 156
1181 3300005468 Ga0070707_100043213 Ga0070707_1000432137 156
1182 3300005468 Ga0070707_100079618 Ga0070707_1000796183 156
1183 3300005471 Ga0070698_100017750 Ga0070698_1000177505 156
1184 3300005471 Ga0070698_100106515 Ga0070698_1001065152 156
1185 3300005518 Ga0070699_100057336 Ga0070699_1000573365 156
1186 3300005536 Ga0070697_100144998 Ga0070697_1001449982 156
1187 3300005539 Ga0068853_100033631 Ga0068853_1000336313 156
1188 3300005543 Ga0070672_100098064 Ga0070672_1000980642 156
1189 3300005544 Ga0070686_100000601 Ga0070686_10000060115 156
1190 3300005544 Ga0070686_100338468 Ga0070686_1003384681 156
1191 3300005545 Ga0070695_100048362 Ga0070695_1000483622 156
1192 3300005546 Ga0070696_100004604 Ga0070696_1000046042 156
1193 3300005547 Ga0070693_100018284 Ga0070693_1000182843 156
1194 3300005548 Ga0070665_100023330 Ga0070665_1000233302 156
1195 3300005549 Ga0070704_100013972 Ga0070704_1000139723 156
1196 3300005578 Ga0068854_100266352 Ga0068854_1002663522 156
1197 3300005615 Ga0070702_100001307 Ga0070702_1000013073 156
1198 3300005616 Ga0068852_100144997 Ga0068852_1001449972 156
1199 3300005617 Ga0068859_100142576 Ga0068859_1001425762 156
1200 3300005618 Ga0068864_100393932 Ga0068864_1003939322 156
1201 3300005718 Ga0068866_10001893 Ga0068866_100018933 156
1202 3300005719 Ga0068861_100051803 Ga0068861_1000518035 156
1203 3300005843 Ga0068860_100060561 Ga0068860_1000605612 156
1204 3300005937 Ga0081455_10194196 Ga0081455_101941963 156
1205 3300005985 Ga0081539_10064603 Ga0081539_100646032 156
1206 3300006028 Ga0070717_10028663 Ga0070717_100286634 156
1207 3300006038 Ga0075365_10004466 Ga0075365_100044663 156
1208 3300006173 Ga0070716_100068231 Ga0070716_1000682312 156
1209 3300006175 Ga0070712_100025620 Ga0070712_1000256202 156
1210 3300006237 Ga0097621_100047104 Ga0097621_1000471042 156
1211 3300006358 Ga0068871_100021840 Ga0068871_1000218401 156
1212 3300006852 Ga0075433_10009447 Ga0075433_100094474 156
1213 3300006881 Ga0068865_100005218 Ga0068865_1000052187 156
1214 3300006914 Ga0075436_100028807 Ga0075436_1000288072 156
1215 3300006931 Ga0097620_100142577 Ga0097620_1001425772 156
1216 3300009094 Ga0111539_10012599 Ga0111539_100125992 156
1217 3300009147 Ga0114129_10063624 Ga0114129_100636242 156
1218 3300009147 Ga0114129_10103975 Ga0114129_101039753 156
1219 3300020070 Ga0206356_11574066 Ga0206356_115740661 156
1220 3300022467 Ga0224712_10285055 Ga0224712_102850552 156
1221 3300025898 Ga0207692_10017198 Ga0207692_100171985 156
1222 3300025898 Ga0207692_10154077 Ga0207692_101540772 156
1223 3300025899 Ga0207642_10002179 Ga0207642_100021792 156
1224 3300025903 Ga0207680_10015996 Ga0207680_100159965 156
1225 3300025904 Ga0207647_10033839 Ga0207647_100338396 156
1226 3300025910 Ga0207684_10049468 Ga0207684_100494683 156
1227 3300025910 Ga0207684_10469504 Ga0207684_104695042 156
1228 3300025911 Ga0207654_10302127 Ga0207654_103021272 156
1229 3300025914 Ga0207671_10135658 Ga0207671_101356582 156
1230 3300025915 Ga0207693_10000778 Ga0207693_1000077814 156
1231 3300025916 Ga0207663_10014147 Ga0207663_100141472 156
1232 3300025918 Ga0207662_10030100 Ga0207662_100301002 156
1233 3300025919 Ga0207657_10033669 Ga0207657_100336692 156
1234 3300025922 Ga0207646_10000865 Ga0207646_1000086528 156
1235 3300025922 Ga0207646_10045627 Ga0207646_100456273 156
1236 3300025927 Ga0207687_10011371 Ga0207687_100113712 156
1237 3300025928 Ga0207700_10187624 Ga0207700_101876242 156
1238 3300025931 Ga0207644_10155769 Ga0207644_101557692 156
1239 3300025932 Ga0207690_10011765 Ga0207690_100117653 156
1240 3300025934 Ga0207686_10006786 Ga0207686_100067866 156
1241 3300025935 Ga0207709_10000655 Ga0207709_1000065519 156
1242 3300025935 Ga0207709_10454922 Ga0207709_104549222 156
1243 3300025936 Ga0207670_10014398 Ga0207670_100143985 156
1244 3300025938 Ga0207704_10002843 Ga0207704_100028436 156
1245 3300025940 Ga0207691_10023027 Ga0207691_100230277 156
1246 3300025940 Ga0207691_10771984 Ga0207691_107719841 156
1247 3300025941 Ga0207711_10065303 Ga0207711_100653031 156
1248 3300025960 Ga0207651_10112845 Ga0207651_101128451 156
1249 3300025981 Ga0207640_10290492 Ga0207640_102904921 156
1250 3300026023 Ga0207677_10630170 Ga0207677_106301702 156
1251 3300026041 Ga0207639_10041612 Ga0207639_100416122 156
1252 3300026067 Ga0207678_10006293 Ga0207678_100062932 156
1253 3300026075 Ga0207708_10000468 Ga0207708_1000046816 156
1254 3300026075 Ga0207708_10509060 Ga0207708_105090601 156
1255 3300026089 Ga0207648_10000801 Ga0207648_1000080128 156
1256 3300026095 Ga0207676_10068223 Ga0207676_100682235 156
1257 3300026118 Ga0207675_100011585 Ga0207675_1000115855 156
1258 3300026121 Ga0207683_10000041 Ga0207683_1000004160 156
1259 3300026142 Ga0207698_10159015 Ga0207698_101590152 156
1260 3300028379 Ga0268266_10316526 Ga0268266_103165262 156
1261 3300028381 Ga0268264_10666097 Ga0268264_106660972 156
1262 3300037312 Ga0395899_0005142 Ga0395899_0005142_4249_4719 156
1263 3300037312 Ga0395899_0086273 Ga0395899_0086273_829_1314 156
1264 3300037418 Ga0395900_0001655 Ga0395900_0001655_6177_6647 156
1265 3300037418 Ga0395900_0017894 Ga0395900_0017894_1712_2182 156
1266 3300037418 Ga0395900_0027097 Ga0395900_0027097_4107_4577 156
1267 3300037418 Ga0395900_0181058 Ga0395900_0181058_198_683 156
1268 3300037466 Ga0395898_0060749 Ga0395898_0060749_1018_1488 156
1269 3300037466 Ga0395898_0149816 Ga0395898_0149816_1421_1891 156
1270 3300037466 Ga0395898_0564518 Ga0395898_0564518_551_1021 156
1271 3300037471 Ga0395905_0020345 Ga0395905_0020345_1568_2038 156
1272 3300037471 Ga0395905_0129527 Ga0395905_0129527_26_496 156
1273 3300037471 Ga0395905_0642720 Ga0395905_0642720_26_496 156
1274 3300037471 Ga0395905_1181163 Ga0395905_1181163_143_613 156
1275 3300038443 Ga0395901_0009659 Ga0395901_0009659_8041_8511 156
1276 3300038443 Ga0395901_0060705 Ga0395901_0060705_2297_2767 156
1277 3300038443 Ga0395901_0077973 Ga0395901_0077973_1234_1704 156
1278 3300038443 Ga0395901_0413074 Ga0395901_0413074_688_1158 156
1279 3300046500 Ga0495596_0040412 Ga0495596_0040412_49_519 156
1280 3300046525 Ga0495663_0003885 Ga0495663_0003885_3441_3911 156
1281 3300046538 Ga0495609_0049150 Ga0495609_0049150_442_912 156
1282 3300046558 Ga0495633_0470538 Ga0495633_0470538_47_517 156
1283 3300046615 Ga0495656_0010427 Ga0495656_0010427_2616_3086 156
1284 3300046664 Ga0495659_0016342 Ga0495659_0016342_106_576 156
1285 3300046691 Ga0495670_0114120 Ga0495670_0114120_781_1251 156
1286 3300046794 Ga0495589_0037338 Ga0495589_0037338_32_502 156
1287 3300047318 Ga0495636_0109586 Ga0495636_0109586_260_730 156
1288 3300048914 Ga0496111_0126911 Ga0496111_0126911_645_1115 156
1289 3300050507 nmdc:mga05p37_40586_c1 nmdc:mga05p37_40586_c1_1181_1651 156
1290 3300050507 nmdc:mga05p37_87023_c1 nmdc:mga05p37_87023_c1_2084_2554 156
1291 3300050512 nmdc:mga0n895_45890_c1 nmdc:mga0n895_45890_c1_2994_3464 156
1292 3300050513 nmdc:mga0rr50_76299_c1 nmdc:mga0rr50_76299_c1_1027_1497 156
1293 3300050514 nmdc:mga08x19_593749_c1 nmdc:mga08x19_593749_c1_61_531 156
1294 3300050515 nmdc:mga0a205_53447_c1 nmdc:mga0a205_53447_c1_3326_3796 156

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ek2-assembly1.cif.gz_A cryo-em structure of vccn1 in lipid nanodisc 0.5113 6 110
6z1r-assembly1.cif.gz_L bovine atp synthase f1-peripheral stalk domain, state 2 0.5113 15 99
6ziq-assembly1.cif.gz_N bovine atp synthase stator domain, state 1 0.4975 15 99
7ui2-assembly1.cif.gz_A the crystal structure of 15kda phlebotomus papatasi salivary protein ppsp15. 0.4963 23 97
7ek3-assembly1.cif.gz_A cryo-em structure of vccn1 y332a mutant in lipid nanodisc 0.4831 6 111
ID Description Score Start End Superfamily
af_Q10QG0_190_247_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5815 44 102 1.25.10.10
af_Q3E9B4_162_219_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5715 46 102 1.25.10.10
af_Q10LS2_233_292_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5711 50 101 1.25.10.10
af_A0A1D6MF66_318_375_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5703 46 102 1.25.10.10
af_Q9ZU65_234_291_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.57 46 102 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A538GLN0-F1-model_v4 Uncharacterized protein 0.7399 1 156
AF-A0A538GLN0-F1-model_v4 Uncharacterized protein 0.7354 1 156
AF-A0A538GKP2-F1-model_v4 Uncharacterized protein 0.7232 10 156
AF-A0A538GKP2-F1-model_v4 Uncharacterized protein 0.7089 10 156
AF-A0A7V9P7A3-F1-model_v4 Uncharacterized protein 0.7053 31 155

Feature Viewer

pLDDT pTM Quality
88.13 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map