F492664
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1294 | 444 | 1294 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10066359|JGI25404J52841_100663591 |
| Length | 151 |
| Sequence | VDERTLQIQACMYQYSRAIYRSIKDLVDPYVTAETRIQYRREVLEACEQTMERLAKDPLYFAKPDRALFQDIRRYFPITCQAQVAWAVREGVAAAVAFIESQIEAGAFDGGIGIARCRATTRKGKPCQRTPLPERDYCPSHQHLERSKVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 104 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 105 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 107 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 108 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 131 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 254 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 260 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 261 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 262 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 263 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 266 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 397 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 401 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 421 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 422 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 423 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 444 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.43 |
| Metatranscriptomes | 7.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 10.2 |
| Rhizosphere | 89.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10142367 | 3300003203 | Unclassified | 701 |
| 2 | JGI25407J50210_10002710 | 3300003373 | Bacteria | 4213 |
| 3 | JGI25404J52841_10066359 | 3300003659 | Bacteria | 755 |
| 4 | Ga0032354_1082681 | 3300003693 | Unclassified | 666 |
| 5 | Ga0032354_1108405 | 3300003693 | Unclassified | 835 |
| 6 | Ga0070658_10001819 | 3300005327 | Bacteria | 17950 |
| 7 | Ga0070658_10014355 | 3300005327 | Bacteria | 6355 |
| 8 | Ga0070658_10126046 | 3300005327 | Unclassified | 2131 |
| 9 | Ga0070658_10127295 | 3300005327 | Bacteria | 2121 |
| 10 | Ga0070676_10216600 | 3300005328 | Bacteria | 1262 |
| 11 | Ga0070676_10776798 | 3300005328 | Unclassified | 705 |
| 12 | Ga0070683_100032427 | 3300005329 | Bacteria | 4758 |
| 13 | Ga0070683_100062845 | 3300005329 | Bacteria | 3452 |
| 14 | Ga0070683_100146815 | 3300005329 | Bacteria | 2235 |
| 15 | Ga0070683_100225095 | 3300005329 | Bacteria | 1783 |
| 16 | Ga0070683_100313875 | 3300005329 | Bacteria | 1492 |
| 17 | Ga0070683_100350081 | 3300005329 | Bacteria | 1407 |
| 18 | Ga0070683_100372723 | 3300005329 | Bacteria | 1360 |
| 19 | Ga0070683_100512039 | 3300005329 | Unclassified | 1147 |
| 20 | Ga0070683_100517869 | 3300005329 | Bacteria | 1140 |
| 21 | Ga0070683_100616578 | 3300005329 | Bacteria | 1038 |
| 22 | Ga0070683_100776781 | 3300005329 | Bacteria | 918 |
| 23 | Ga0070690_100176178 | 3300005330 | Bacteria | 1475 |
| 24 | Ga0070666_10035265 | 3300005335 | Bacteria | 3318 |
| 25 | Ga0070680_100061142 | 3300005336 | Bacteria | 3083 |
| 26 | Ga0070680_100089572 | 3300005336 | Bacteria | 2546 |
| 27 | Ga0070680_100132794 | 3300005336 | Bacteria | 2083 |
| 28 | Ga0070680_100290523 | 3300005336 | Bacteria | 1386 |
| 29 | Ga0070682_100001302 | 3300005337 | Bacteria | 14130 |
| 30 | Ga0070682_100049194 | 3300005337 | Bacteria | 2627 |
| 31 | Ga0070682_100056442 | 3300005337 | Bacteria | 2470 |
| 32 | Ga0070682_100222048 | 3300005337 | Bacteria | 1345 |
| 33 | Ga0070682_100498976 | 3300005337 | Bacteria | 943 |
| 34 | Ga0068868_100110320 | 3300005338 | Bacteria | 2235 |
| 35 | Ga0068868_100138734 | 3300005338 | Bacteria | 1994 |
| 36 | Ga0068868_100640378 | 3300005338 | Unclassified | 945 |
| 37 | Ga0068868_100682899 | 3300005338 | Archaea | 917 |
| 38 | Ga0068868_100962164 | 3300005338 | Bacteria | 779 |
| 39 | Ga0070660_100004585 | 3300005339 | Bacteria | 9551 |
| 40 | Ga0070660_100004801 | 3300005339 | Bacteria | 9347 |
| 41 | Ga0070660_100050409 | 3300005339 | Bacteria | 3203 |
| 42 | Ga0070660_100085859 | 3300005339 | Bacteria | 2476 |
| 43 | Ga0070660_100421334 | 3300005339 | Bacteria | 1105 |
| 44 | Ga0070660_100439551 | 3300005339 | Unclassified | 1081 |
| 45 | Ga0070691_10074100 | 3300005341 | Unclassified | 1656 |
| 46 | Ga0070691_10083985 | 3300005341 | Bacteria | 1563 |
| 47 | Ga0070691_10127175 | 3300005341 | Bacteria | 1288 |
| 48 | Ga0070691_10157872 | 3300005341 | Bacteria | 1167 |
| 49 | Ga0070691_10333396 | 3300005341 | Bacteria | 838 |
| 50 | Ga0070687_100070312 | 3300005343 | Bacteria | 1877 |
| 51 | Ga0070687_100333633 | 3300005343 | Bacteria | 973 |
| 52 | Ga0070661_100140084 | 3300005344 | Bacteria | 1822 |
| 53 | Ga0070661_100192041 | 3300005344 | Bacteria | 1558 |
| 54 | Ga0070661_100211506 | 3300005344 | Bacteria | 1485 |
| 55 | Ga0070661_100352031 | 3300005344 | Bacteria | 1156 |
| 56 | Ga0070692_10187145 | 3300005345 | Bacteria | 1204 |
| 57 | Ga0070692_10358636 | 3300005345 | Unclassified | 908 |
| 58 | Ga0070692_10783232 | 3300005345 | Bacteria | 650 |
| 59 | Ga0070668_100012108 | 3300005347 | Bacteria | 6423 |
| 60 | Ga0070675_100087510 | 3300005354 | Bacteria | 2605 |
| 61 | Ga0070675_100249193 | 3300005354 | Bacteria | 1554 |
| 62 | Ga0070675_100490648 | 3300005354 | Bacteria | 1106 |
| 63 | Ga0070675_100996960 | 3300005354 | Unclassified | 769 |
| 64 | Ga0070671_100072418 | 3300005355 | Bacteria | 2878 |
| 65 | Ga0070671_101200608 | 3300005355 | Unclassified | 668 |
| 66 | Ga0070674_100038392 | 3300005356 | Bacteria | 3227 |
| 67 | Ga0070674_100119094 | 3300005356 | Bacteria | 1952 |
| 68 | Ga0070674_100193562 | 3300005356 | Unclassified | 1566 |
| 69 | Ga0070688_100001012 | 3300005365 | Bacteria | 14123 |
| 70 | Ga0070659_100022325 | 3300005366 | Bacteria | 4831 |
| 71 | Ga0070659_100088578 | 3300005366 | Bacteria | 2479 |
| 72 | Ga0070659_100137328 | 3300005366 | Bacteria | 1988 |
| 73 | Ga0070659_100744459 | 3300005366 | Bacteria | 850 |
| 74 | Ga0070709_10014260 | 3300005434 | Bacteria | 4493 |
| 75 | Ga0070709_10386241 | 3300005434 | Unclassified | 1042 |
| 76 | Ga0070709_10684574 | 3300005434 | Bacteria | 797 |
| 77 | Ga0070714_100007622 | 3300005435 | Bacteria | 8428 |
| 78 | Ga0070714_100014641 | 3300005435 | Bacteria | 6303 |
| 79 | Ga0070714_100044213 | 3300005435 | Bacteria | 3770 |
| 80 | Ga0070714_100068376 | 3300005435 | Bacteria | 3064 |
| 81 | Ga0070714_100616671 | 3300005435 | Bacteria | 1043 |
| 82 | Ga0070714_101618144 | 3300005435 | Bacteria | 633 |
| 83 | Ga0070713_100032009 | 3300005436 | Bacteria | 4196 |
| 84 | Ga0070710_10004520 | 3300005437 | Bacteria | 6576 |
| 85 | Ga0070710_10025685 | 3300005437 | Bacteria | 3121 |
| 86 | Ga0070701_10004495 | 3300005438 | Bacteria | 5659 |
| 87 | Ga0070701_10282822 | 3300005438 | Bacteria | 1013 |
| 88 | Ga0070701_10340226 | 3300005438 | Bacteria | 934 |
| 89 | Ga0070711_100004518 | 3300005439 | Bacteria | 8225 |
| 90 | Ga0070711_100099146 | 3300005439 | Bacteria | 2116 |
| 91 | Ga0070711_100482290 | 3300005439 | Unclassified | 1019 |
| 92 | Ga0070711_100787571 | 3300005439 | Bacteria | 806 |
| 93 | Ga0070705_100050391 | 3300005440 | Unclassified | 2422 |
| 94 | Ga0070700_100003038 | 3300005441 | Bacteria | 8601 |
| 95 | Ga0070700_100526794 | 3300005441 | Bacteria | 914 |
| 96 | Ga0070694_100016536 | 3300005444 | Bacteria | 4644 |
| 97 | Ga0070708_100014812 | 3300005445 | Bacteria | 6427 |
| 98 | Ga0070708_100290219 | 3300005445 | Bacteria | 1540 |
| 99 | Ga0070708_100776206 | 3300005445 | Bacteria | 901 |
| 100 | Ga0070708_100864005 | 3300005445 | Unclassified | 850 |
| 101 | Ga0070708_101389761 | 3300005445 | Bacteria | 655 |
| 102 | Ga0070663_100041208 | 3300005455 | Bacteria | 3237 |
| 103 | Ga0070663_100074698 | 3300005455 | Bacteria | 2476 |
| 104 | Ga0070663_100867727 | 3300005455 | Bacteria | 778 |
| 105 | Ga0070678_100001535 | 3300005456 | Bacteria | 12345 |
| 106 | Ga0070678_100006809 | 3300005456 | Bacteria | 6736 |
| 107 | Ga0070678_100140005 | 3300005456 | Bacteria | 1935 |
| 108 | Ga0070678_100294679 | 3300005456 | Unclassified | 1377 |
| 109 | Ga0070678_100975265 | 3300005456 | Unclassified | 778 |
| 110 | Ga0070678_101040183 | 3300005456 | Unclassified | 754 |
| 111 | Ga0070662_100033036 | 3300005457 | Bacteria | 3641 |
| 112 | Ga0070662_100290693 | 3300005457 | Unclassified | 1325 |
| 113 | Ga0070681_10004088 | 3300005458 | Bacteria | 13788 |
| 114 | Ga0070681_10006514 | 3300005458 | Bacteria | 11363 |
| 115 | Ga0070681_10027460 | 3300005458 | Bacteria | 5722 |
| 116 | Ga0070681_10082772 | 3300005458 | Bacteria | 3164 |
| 117 | Ga0070681_10193383 | 3300005458 | Unclassified | 1954 |
| 118 | Ga0070681_10268838 | 3300005458 | Unclassified | 1616 |
| 119 | Ga0070681_10283103 | 3300005458 | Unclassified | 1569 |
| 120 | Ga0070681_10290488 | 3300005458 | Bacteria | 1545 |
| 121 | Ga0070681_10522189 | 3300005458 | Unclassified | 1101 |
| 122 | Ga0068867_100008961 | 3300005459 | Bacteria | 7058 |
| 123 | Ga0068867_100368361 | 3300005459 | Bacteria | 1204 |
| 124 | Ga0070685_10079715 | 3300005466 | Bacteria | 1960 |
| 125 | Ga0070685_10100491 | 3300005466 | Bacteria | 1766 |
| 126 | Ga0070706_100036752 | 3300005467 | Bacteria | 4524 |
| 127 | Ga0070706_100044922 | 3300005467 | Bacteria | 4080 |
| 128 | Ga0070706_100277171 | 3300005467 | Unclassified | 1565 |
| 129 | Ga0070706_100614519 | 3300005467 | Unclassified | 1010 |
| 130 | Ga0070706_101311353 | 3300005467 | Bacteria | 664 |
| 131 | Ga0070707_100043213 | 3300005468 | Bacteria | 4314 |
| 132 | Ga0070707_100079618 | 3300005468 | Unclassified | 3162 |
| 133 | Ga0070707_100103307 | 3300005468 | Bacteria | 2761 |
| 134 | Ga0070707_100773229 | 3300005468 | Unclassified | 924 |
| 135 | Ga0070698_100017750 | 3300005471 | Bacteria | 7494 |
| 136 | Ga0070698_100040021 | 3300005471 | Bacteria | 4819 |
| 137 | Ga0070698_100065237 | 3300005471 | Bacteria | 3666 |
| 138 | Ga0070698_100106515 | 3300005471 | Bacteria | 2772 |
| 139 | Ga0070698_100372924 | 3300005471 | Unclassified | 1359 |
| 140 | Ga0070699_100057336 | 3300005518 | Bacteria | 3374 |
| 141 | Ga0070699_100082900 | 3300005518 | Bacteria | 2796 |
| 142 | Ga0070699_100486837 | 3300005518 | Bacteria | 1120 |
| 143 | Ga0070679_100182831 | 3300005530 | Unclassified | 2068 |
| 144 | Ga0070679_100196350 | 3300005530 | Bacteria | 1985 |
| 145 | Ga0070679_100262979 | 3300005530 | Bacteria | 1680 |
| 146 | Ga0070679_100282015 | 3300005530 | Unclassified | 1614 |
| 147 | Ga0070679_100295910 | 3300005530 | Unclassified | 1570 |
| 148 | Ga0070684_100000801 | 3300005535 | Bacteria | 21853 |
| 149 | Ga0070684_100102941 | 3300005535 | Bacteria | 2553 |
| 150 | Ga0070684_100692242 | 3300005535 | Unclassified | 950 |
| 151 | Ga0070684_101147590 | 3300005535 | Bacteria | 730 |
| 152 | Ga0070697_100144998 | 3300005536 | Bacteria | 1998 |
| 153 | Ga0070697_100221996 | 3300005536 | Bacteria | 1611 |
| 154 | Ga0070697_100662707 | 3300005536 | Bacteria | 919 |
| 155 | Ga0070697_100750343 | 3300005536 | Bacteria | 862 |
| 156 | Ga0068853_100033631 | 3300005539 | Bacteria | 4351 |
| 157 | Ga0068853_100321819 | 3300005539 | Bacteria | 1434 |
| 158 | Ga0070672_100098064 | 3300005543 | Bacteria | 2373 |
| 159 | Ga0070686_100000601 | 3300005544 | Bacteria | 21265 |
| 160 | Ga0070686_100139366 | 3300005544 | Unclassified | 1686 |
| 161 | Ga0070686_100150075 | 3300005544 | Bacteria | 1632 |
| 162 | Ga0070686_100225473 | 3300005544 | Unclassified | 1357 |
| 163 | Ga0070686_100338468 | 3300005544 | Unclassified | 1127 |
| 164 | Ga0070686_100690740 | 3300005544 | Bacteria | 813 |
| 165 | Ga0070695_100048362 | 3300005545 | Bacteria | 2720 |
| 166 | Ga0070696_100004604 | 3300005546 | Bacteria | 9206 |
| 167 | Ga0070696_100263131 | 3300005546 | Bacteria | 1309 |
| 168 | Ga0070693_100007688 | 3300005547 | Bacteria | 5279 |
| 169 | Ga0070693_100018284 | 3300005547 | Bacteria | 3658 |
| 170 | Ga0070693_100021315 | 3300005547 | Bacteria | 3431 |
| 171 | Ga0070693_100034110 | 3300005547 | Bacteria | 2814 |
| 172 | Ga0070693_100677572 | 3300005547 | Unclassified | 752 |
| 173 | Ga0070665_100023330 | 3300005548 | Bacteria | 6228 |
| 174 | Ga0070665_100226041 | 3300005548 | Bacteria | 1872 |
| 175 | Ga0070704_100013972 | 3300005549 | Bacteria | 5003 |
| 176 | Ga0070704_100048220 | 3300005549 | Bacteria | 2980 |
| 177 | Ga0070704_100475868 | 3300005549 | Unclassified | 1080 |
| 178 | Ga0070704_100761258 | 3300005549 | Bacteria | 863 |
| 179 | Ga0068855_100025890 | 3300005563 | Bacteria | 7016 |
| 180 | Ga0068855_100091414 | 3300005563 | Bacteria | 3510 |
| 181 | Ga0068855_100118990 | 3300005563 | Bacteria | 3025 |
| 182 | Ga0068855_100746732 | 3300005563 | Bacteria | 1044 |
| 183 | Ga0070664_100281820 | 3300005564 | Bacteria | 1499 |
| 184 | Ga0070664_100671501 | 3300005564 | Unclassified | 964 |
| 185 | Ga0068857_100379305 | 3300005577 | Unclassified | 1313 |
| 186 | Ga0068857_101107682 | 3300005577 | Bacteria | 765 |
| 187 | Ga0068854_100266352 | 3300005578 | Unclassified | 1374 |
| 188 | Ga0068854_101065808 | 3300005578 | Bacteria | 719 |
| 189 | Ga0068856_100100179 | 3300005614 | Bacteria | 2889 |
| 190 | Ga0068856_100166231 | 3300005614 | Bacteria | 2217 |
| 191 | Ga0068856_100350522 | 3300005614 | Bacteria | 1495 |
| 192 | Ga0068856_100563345 | 3300005614 | Bacteria | 1161 |
| 193 | Ga0068856_100836793 | 3300005614 | Bacteria | 939 |
| 194 | Ga0068856_100852208 | 3300005614 | Bacteria | 930 |
| 195 | Ga0070702_100001307 | 3300005615 | Bacteria | 10098 |
| 196 | Ga0070702_100428554 | 3300005615 | Bacteria | 954 |
| 197 | Ga0070702_100666868 | 3300005615 | Bacteria | 788 |
| 198 | Ga0070702_100707514 | 3300005615 | Unclassified | 768 |
| 199 | Ga0068852_100144997 | 3300005616 | Bacteria | 2201 |
| 200 | Ga0068859_100142576 | 3300005617 | Bacteria | 2470 |
| 201 | Ga0068859_100830411 | 3300005617 | Bacteria | 1011 |
| 202 | Ga0068864_100148089 | 3300005618 | Unclassified | 2124 |
| 203 | Ga0068864_100393932 | 3300005618 | Bacteria | 1315 |
| 204 | Ga0068864_100592602 | 3300005618 | Bacteria | 1075 |
| 205 | Ga0068866_10001893 | 3300005718 | Bacteria | 8762 |
| 206 | Ga0068866_10332312 | 3300005718 | Unclassified | 960 |
| 207 | Ga0068861_100051803 | 3300005719 | Bacteria | 3118 |
| 208 | Ga0068861_100333020 | 3300005719 | Unclassified | 1326 |
| 209 | Ga0068861_100982220 | 3300005719 | Unclassified | 805 |
| 210 | Ga0068870_10293364 | 3300005840 | Bacteria | 1024 |
| 211 | Ga0068860_100060561 | 3300005843 | Bacteria | 3597 |
| 212 | Ga0081455_10001467 | 3300005937 | Bacteria | 29203 |
| 213 | Ga0081455_10022972 | 3300005937 | Bacteria | 5814 |
| 214 | Ga0081455_10026240 | 3300005937 | Bacteria | 5365 |
| 215 | Ga0081455_10194196 | 3300005937 | Bacteria | 1526 |
| 216 | Ga0081455_10679134 | 3300005937 | Bacteria | 659 |
| 217 | Ga0081538_10000810 | 3300005981 | Bacteria | 33926 |
| 218 | Ga0081538_10029132 | 3300005981 | Bacteria | 3780 |
| 219 | Ga0081538_10101464 | 3300005981 | Bacteria | 1448 |
| 220 | Ga0081538_10264360 | 3300005981 | Bacteria | 648 |
| 221 | Ga0081540_1006384 | 3300005983 | Bacteria | 8595 |
| 222 | Ga0081540_1122615 | 3300005983 | Bacteria | 1076 |
| 223 | Ga0081539_10002873 | 3300005985 | Bacteria | 22878 |
| 224 | Ga0081539_10005502 | 3300005985 | Bacteria | 12866 |
| 225 | Ga0081539_10064603 | 3300005985 | Unclassified | 1990 |
| 226 | Ga0070717_10005916 | 3300006028 | Bacteria | 8956 |
| 227 | Ga0070717_10023231 | 3300006028 | Bacteria | 4911 |
| 228 | Ga0070717_10028663 | 3300006028 | Bacteria | 4459 |
| 229 | Ga0070717_10770812 | 3300006028 | Bacteria | 875 |
| 230 | Ga0070717_11477289 | 3300006028 | Bacteria | 617 |
| 231 | Ga0075365_10004466 | 3300006038 | Bacteria | 7415 |
| 232 | Ga0070715_10000547 | 3300006163 | Bacteria | 9895 |
| 233 | Ga0070715_10016713 | 3300006163 | Bacteria | 2763 |
| 234 | Ga0070716_100011977 | 3300006173 | Bacteria | 4382 |
| 235 | Ga0070716_100068231 | 3300006173 | Bacteria | 2079 |
| 236 | Ga0070712_100017518 | 3300006175 | Bacteria | 4639 |
| 237 | Ga0070712_100018807 | 3300006175 | Bacteria | 4494 |
| 238 | Ga0070712_100023644 | 3300006175 | Bacteria | 4062 |
| 239 | Ga0070712_100025620 | 3300006175 | Bacteria | 3922 |
| 240 | Ga0070712_100576012 | 3300006175 | Bacteria | 951 |
| 241 | Ga0075367_10704883 | 3300006178 | Bacteria | 642 |
| 242 | Ga0097621_100047104 | 3300006237 | Bacteria | 3492 |
| 243 | Ga0097621_100720388 | 3300006237 | Bacteria | 920 |
| 244 | Ga0068871_100007707 | 3300006358 | Bacteria | 7705 |
| 245 | Ga0068871_100021840 | 3300006358 | Bacteria | 4927 |
| 246 | Ga0068871_100225830 | 3300006358 | Bacteria | 1624 |
| 247 | Ga0068871_100293750 | 3300006358 | Bacteria | 1425 |
| 248 | Ga0075428_100058891 | 3300006844 | Bacteria | 4206 |
| 249 | Ga0075428_100682551 | 3300006844 | Bacteria | 1094 |
| 250 | Ga0075428_100872540 | 3300006844 | Bacteria | 955 |
| 251 | Ga0075430_100955344 | 3300006846 | Unclassified | 706 |
| 252 | Ga0075431_100214819 | 3300006847 | Bacteria | 1963 |
| 253 | Ga0075433_10005721 | 3300006852 | Bacteria | 9780 |
| 254 | Ga0075433_10009447 | 3300006852 | Bacteria | 7794 |
| 255 | Ga0075433_10251602 | 3300006852 | Bacteria | 1568 |
| 256 | Ga0075433_10353902 | 3300006852 | Bacteria | 1298 |
| 257 | Ga0075433_10581390 | 3300006852 | Bacteria | 984 |
| 258 | Ga0075433_10816622 | 3300006852 | Bacteria | 814 |
| 259 | Ga0075433_11404369 | 3300006852 | Unclassified | 604 |
| 260 | Ga0075434_100002659 | 3300006871 | Bacteria | 15780 |
| 261 | Ga0075434_100007883 | 3300006871 | Bacteria | 9863 |
| 262 | Ga0075434_100619985 | 3300006871 | Bacteria | 1101 |
| 263 | Ga0075434_100725952 | 3300006871 | Bacteria | 1011 |
| 264 | Ga0075429_100266247 | 3300006880 | Bacteria | 1501 |
| 265 | Ga0068865_100005218 | 3300006881 | Bacteria | 7856 |
| 266 | Ga0068865_100153223 | 3300006881 | Bacteria | 1751 |
| 267 | Ga0075436_100013985 | 3300006914 | Bacteria | 5490 |
| 268 | Ga0075436_100028807 | 3300006914 | Bacteria | 3820 |
| 269 | Ga0075436_100177325 | 3300006914 | Bacteria | 1506 |
| 270 | Ga0097620_100142577 | 3300006931 | Bacteria | 2470 |
| 271 | Ga0097620_100830363 | 3300006931 | Bacteria | 1011 |
| 272 | Ga0075435_100002008 | 3300007076 | Bacteria | 13319 |
| 273 | Ga0075435_100042872 | 3300007076 | Bacteria | 3621 |
| 274 | Ga0075435_100212215 | 3300007076 | Bacteria | 1643 |
| 275 | Ga0075435_100659062 | 3300007076 | Bacteria | 909 |
| 276 | Ga0075435_100730778 | 3300007076 | Bacteria | 861 |
| 277 | Ga0105240_10013540 | 3300009093 | Bacteria | 11196 |
| 278 | Ga0105240_10022932 | 3300009093 | Bacteria | 8269 |
| 279 | Ga0105240_10369245 | 3300009093 | Unclassified | 1623 |
| 280 | Ga0111539_10012599 | 3300009094 | Bacteria | 10595 |
| 281 | Ga0111539_10043756 | 3300009094 | Bacteria | 5367 |
| 282 | Ga0111539_10056167 | 3300009094 | Bacteria | 4680 |
| 283 | Ga0111539_10139905 | 3300009094 | Bacteria | 2834 |
| 284 | Ga0111539_10523278 | 3300009094 | Unclassified | 1382 |
| 285 | Ga0111539_10695973 | 3300009094 | Bacteria | 1183 |
| 286 | Ga0111539_10765654 | 3300009094 | Unclassified | 1124 |
| 287 | Ga0105245_10012395 | 3300009098 | Bacteria | 7419 |
| 288 | Ga0105245_10066849 | 3300009098 | Bacteria | 3254 |
| 289 | Ga0105245_10239116 | 3300009098 | Bacteria | 1759 |
| 290 | Ga0105245_10502889 | 3300009098 | Bacteria | 1228 |
| 291 | Ga0114129_10063624 | 3300009147 | Bacteria | 5150 |
| 292 | Ga0114129_10084137 | 3300009147 | Bacteria | 4417 |
| 293 | Ga0114129_10103975 | 3300009147 | Unclassified | 3925 |
| 294 | Ga0114129_10105057 | 3300009147 | Bacteria | 3903 |
| 295 | Ga0114129_10297667 | 3300009147 | Bacteria | 2152 |
| 296 | Ga0114129_11533003 | 3300009147 | Unclassified | 818 |
| 297 | Ga0114129_11916082 | 3300009147 | Unclassified | 718 |
| 298 | Ga0114129_11996118 | 3300009147 | Unclassified | 702 |
| 299 | Ga0105243_10047204 | 3300009148 | Bacteria | 3389 |
| 300 | Ga0105243_10075049 | 3300009148 | Bacteria | 2744 |
| 301 | Ga0105243_10089760 | 3300009148 | Bacteria | 2528 |
| 302 | Ga0105243_10225630 | 3300009148 | Bacteria | 1659 |
| 303 | Ga0105243_11057786 | 3300009148 | Unclassified | 817 |
| 304 | Ga0105241_10155054 | 3300009174 | Bacteria | 1877 |
| 305 | Ga0105241_10289162 | 3300009174 | Bacteria | 1403 |
| 306 | Ga0105241_10829768 | 3300009174 | Unclassified | 853 |
| 307 | Ga0105242_10232162 | 3300009176 | Bacteria | 1654 |
| 308 | Ga0105248_10296570 | 3300009177 | Unclassified | 1820 |
| 309 | Ga0105248_10861225 | 3300009177 | Bacteria | 1023 |
| 310 | Ga0105248_10926106 | 3300009177 | Bacteria | 984 |
| 311 | Ga0105237_10061228 | 3300009545 | Bacteria | 3764 |
| 312 | Ga0105238_10636068 | 3300009551 | Bacteria | 1076 |
| 313 | Ga0105238_11044875 | 3300009551 | Bacteria | 838 |
| 314 | Ga0105249_10037375 | 3300009553 | Bacteria | 4406 |
| 315 | Ga0105239_10299013 | 3300010375 | Bacteria | 1812 |
| 316 | Ga0105239_10569539 | 3300010375 | Bacteria | 1291 |
| 317 | Ga0105239_10602377 | 3300010375 | Bacteria | 1253 |
| 318 | Ga0105246_10383420 | 3300011119 | Bacteria | 1162 |
| 319 | Ga0157346_1002678 | 3300012480 | Unclassified | 943 |
| 320 | Ga0157335_1003378 | 3300012492 | Bacteria | 1020 |
| 321 | Ga0157323_1030873 | 3300012495 | Unclassified | 568 |
| 322 | Ga0157347_1035647 | 3300012502 | Unclassified | 640 |
| 323 | Ga0157339_1018751 | 3300012505 | Bacteria | 715 |
| 324 | Ga0157338_1057235 | 3300012515 | Unclassified | 576 |
| 325 | Ga0157373_10867427 | 3300013100 | Bacteria | 668 |
| 326 | Ga0157370_10012656 | 3300013104 | Bacteria | 8738 |
| 327 | Ga0157370_10015330 | 3300013104 | Bacteria | 7795 |
| 328 | Ga0157369_10007224 | 3300013105 | Bacteria | 12796 |
| 329 | Ga0157369_10014831 | 3300013105 | Bacteria | 8794 |
| 330 | Ga0157369_10085150 | 3300013105 | Bacteria | 3378 |
| 331 | Ga0157369_10195732 | 3300013105 | Bacteria | 2123 |
| 332 | Ga0157369_11080692 | 3300013105 | Bacteria | 820 |
| 333 | Ga0157374_11261068 | 3300013296 | Bacteria | 761 |
| 334 | Ga0157378_10345765 | 3300013297 | Bacteria | 1451 |
| 335 | Ga0163162_10043186 | 3300013306 | Bacteria | 4514 |
| 336 | Ga0163162_10790275 | 3300013306 | Bacteria | 1067 |
| 337 | Ga0157372_10048315 | 3300013307 | Bacteria | 4730 |
| 338 | Ga0157372_11533161 | 3300013307 | Unclassified | 768 |
| 339 | Ga0157375_10084328 | 3300013308 | Bacteria | 3225 |
| 340 | Ga0157375_10925021 | 3300013308 | Unclassified | 1015 |
| 341 | Ga0163163_10095497 | 3300014325 | Unclassified | 2992 |
| 342 | Ga0163163_10177243 | 3300014325 | Bacteria | 2178 |
| 343 | Ga0163163_10233481 | 3300014325 | Bacteria | 1889 |
| 344 | Ga0163163_10400628 | 3300014325 | Archaea | 1430 |
| 345 | Ga0163163_11614892 | 3300014325 | Unclassified | 709 |
| 346 | Ga0157380_10219626 | 3300014326 | Bacteria | 1700 |
| 347 | Ga0157380_10793471 | 3300014326 | Unclassified | 963 |
| 348 | Ga0182008_10001177 | 3300014497 | Bacteria | 18030 |
| 349 | Ga0157377_10547068 | 3300014745 | Unclassified | 817 |
| 350 | Ga0157377_10774238 | 3300014745 | Unclassified | 705 |
| 351 | Ga0157379_10322581 | 3300014968 | Bacteria | 1410 |
| 352 | Ga0157379_10392585 | 3300014968 | Bacteria | 1274 |
| 353 | Ga0157376_10024024 | 3300014969 | Bacteria | 4780 |
| 354 | Ga0157376_12076602 | 3300014969 | Unclassified | 606 |
| 355 | Ga0157376_12418025 | 3300014969 | Unclassified | 565 |
| 356 | Ga0157376_12847310 | 3300014969 | Unclassified | 523 |
| 357 | Ga0182006_1006406 | 3300015261 | Bacteria | 5474 |
| 358 | Ga0182007_10151282 | 3300015262 | Unclassified | 789 |
| 359 | Ga0182005_1246970 | 3300015265 | Unclassified | 551 |
| 360 | Ga0163161_10056959 | 3300017792 | Bacteria | 2839 |
| 361 | Ga0163161_11054400 | 3300017792 | Bacteria | 696 |
| 362 | Ga0197907_10040416 | 3300020069 | Archaea | 1440 |
| 363 | Ga0197907_10115781 | 3300020069 | Bacteria | 568 |
| 364 | Ga0197907_10259069 | 3300020069 | Unclassified | 688 |
| 365 | Ga0197907_10646087 | 3300020069 | Unclassified | 729 |
| 366 | Ga0197907_10816011 | 3300020069 | Bacteria | 1199 |
| 367 | Ga0197907_10946676 | 3300020069 | Archaea | 876 |
| 368 | Ga0197907_10989329 | 3300020069 | Bacteria | 798 |
| 369 | Ga0197907_10991756 | 3300020069 | Bacteria | 1060 |
| 370 | Ga0197907_11235414 | 3300020069 | Bacteria | 652 |
| 371 | Ga0206356_10504429 | 3300020070 | Bacteria | 1257 |
| 372 | Ga0206356_11081805 | 3300020070 | Bacteria | 5693 |
| 373 | Ga0206356_11440917 | 3300020070 | Unclassified | 1315 |
| 374 | Ga0206356_11539823 | 3300020070 | Bacteria | 993 |
| 375 | Ga0206356_11574066 | 3300020070 | Unclassified | 593 |
| 376 | Ga0206356_11829134 | 3300020070 | Bacteria | 876 |
| 377 | Ga0206349_1032949 | 3300020075 | Bacteria | 1199 |
| 378 | Ga0206349_1354224 | 3300020075 | Bacteria | 624 |
| 379 | Ga0206349_1571039 | 3300020075 | Bacteria | 856 |
| 380 | Ga0206349_1781439 | 3300020075 | Bacteria | 535 |
| 381 | Ga0206355_1313739 | 3300020076 | Bacteria | 1528 |
| 382 | Ga0206355_1618283 | 3300020076 | Bacteria | 657 |
| 383 | Ga0206351_10087162 | 3300020077 | Bacteria | 729 |
| 384 | Ga0206351_10101498 | 3300020077 | Unclassified | 623 |
| 385 | Ga0206351_10280456 | 3300020077 | Bacteria | 763 |
| 386 | Ga0206351_10906755 | 3300020077 | Bacteria | 638 |
| 387 | Ga0206352_10477607 | 3300020078 | Bacteria | 755 |
| 388 | Ga0206352_10598490 | 3300020078 | Bacteria | 1255 |
| 389 | Ga0206352_10901676 | 3300020078 | Bacteria | 539 |
| 390 | Ga0206350_10440665 | 3300020080 | Bacteria | 692 |
| 391 | Ga0206350_10450772 | 3300020080 | Unclassified | 652 |
| 392 | Ga0206350_10918953 | 3300020080 | Bacteria | 841 |
| 393 | Ga0206350_11170503 | 3300020080 | Unclassified | 715 |
| 394 | Ga0206350_11310057 | 3300020080 | Bacteria | 1118 |
| 395 | Ga0206350_11330243 | 3300020080 | Unclassified | 684 |
| 396 | Ga0206354_10319059 | 3300020081 | Bacteria | 1063 |
| 397 | Ga0206354_10365229 | 3300020081 | Bacteria | 1132 |
| 398 | Ga0206354_10750390 | 3300020081 | Unclassified | 673 |
| 399 | Ga0206354_10951817 | 3300020081 | Bacteria | 3421 |
| 400 | Ga0206353_10032922 | 3300020082 | Bacteria | 1362 |
| 401 | Ga0206353_10535060 | 3300020082 | Unclassified | 652 |
| 402 | Ga0206353_10752732 | 3300020082 | Bacteria | 9937 |
| 403 | Ga0206353_11042009 | 3300020082 | Bacteria | 929 |
| 404 | Ga0206353_11226669 | 3300020082 | Bacteria | 868 |
| 405 | Ga0206353_11321372 | 3300020082 | Bacteria | 738 |
| 406 | Ga0206353_12050204 | 3300020082 | Unclassified | 1370 |
| 407 | Ga0224712_10013713 | 3300022467 | Bacteria | 2589 |
| 408 | Ga0224712_10052056 | 3300022467 | Bacteria | 1597 |
| 409 | Ga0224712_10121293 | 3300022467 | Bacteria | 1132 |
| 410 | Ga0224712_10123476 | 3300022467 | Bacteria | 1124 |
| 411 | Ga0224712_10142503 | 3300022467 | Bacteria | 1056 |
| 412 | Ga0224712_10161701 | 3300022467 | Archaea | 999 |
| 413 | Ga0224712_10218063 | 3300022467 | Bacteria | 872 |
| 414 | Ga0224712_10285055 | 3300022467 | Unclassified | 770 |
| 415 | Ga0224712_10287472 | 3300022467 | Unclassified | 767 |
| 416 | Ga0224712_10337006 | 3300022467 | Bacteria | 711 |
| 417 | Ga0224712_10474398 | 3300022467 | Bacteria | 603 |
| 418 | Ga0207692_10006102 | 3300025898 | Bacteria | 4876 |
| 419 | Ga0207692_10007669 | 3300025898 | Bacteria | 4430 |
| 420 | Ga0207692_10017198 | 3300025898 | Bacteria | 3220 |
| 421 | Ga0207692_10037623 | 3300025898 | Bacteria | 2368 |
| 422 | Ga0207692_10154077 | 3300025898 | Bacteria | 1318 |
| 423 | Ga0207642_10002179 | 3300025899 | Bacteria | 6071 |
| 424 | Ga0207688_10183390 | 3300025901 | Bacteria | 1249 |
| 425 | Ga0207688_10257601 | 3300025901 | Bacteria | 1058 |
| 426 | Ga0207688_10378901 | 3300025901 | Bacteria | 875 |
| 427 | Ga0207680_10015996 | 3300025903 | Bacteria | 3929 |
| 428 | Ga0207647_10033839 | 3300025904 | Bacteria | 3268 |
| 429 | Ga0207647_10290690 | 3300025904 | Bacteria | 932 |
| 430 | Ga0207685_10003503 | 3300025905 | Bacteria | 3828 |
| 431 | Ga0207685_10107047 | 3300025905 | Bacteria | 1206 |
| 432 | Ga0207699_10003899 | 3300025906 | Bacteria | 7126 |
| 433 | Ga0207699_10343782 | 3300025906 | Bacteria | 1052 |
| 434 | Ga0207699_10421329 | 3300025906 | Bacteria | 954 |
| 435 | Ga0207699_11100056 | 3300025906 | Unclassified | 588 |
| 436 | Ga0207699_11241337 | 3300025906 | Unclassified | 552 |
| 437 | Ga0207705_10084855 | 3300025909 | Bacteria | 2313 |
| 438 | Ga0207705_10210842 | 3300025909 | Bacteria | 1473 |
| 439 | Ga0207684_10049468 | 3300025910 | Bacteria | 3566 |
| 440 | Ga0207684_10469504 | 3300025910 | Unclassified | 1080 |
| 441 | Ga0207684_10645521 | 3300025910 | Unclassified | 902 |
| 442 | Ga0207654_10207302 | 3300025911 | Bacteria | 1294 |
| 443 | Ga0207654_10302127 | 3300025911 | Bacteria | 1089 |
| 444 | Ga0207654_10948484 | 3300025911 | Bacteria | 625 |
| 445 | Ga0207707_10016358 | 3300025912 | Bacteria | 6470 |
| 446 | Ga0207707_10020322 | 3300025912 | Bacteria | 5799 |
| 447 | Ga0207707_10049357 | 3300025912 | Bacteria | 3666 |
| 448 | Ga0207707_10162341 | 3300025912 | Unclassified | 1953 |
| 449 | Ga0207707_10221587 | 3300025912 | Bacteria | 1646 |
| 450 | Ga0207695_10013582 | 3300025913 | Bacteria | 9700 |
| 451 | Ga0207695_10019003 | 3300025913 | Bacteria | 7924 |
| 452 | Ga0207695_10113884 | 3300025913 | Bacteria | 2680 |
| 453 | Ga0207695_10502715 | 3300025913 | Unclassified | 1094 |
| 454 | Ga0207695_10602076 | 3300025913 | Unclassified | 980 |
| 455 | Ga0207671_10135658 | 3300025914 | Bacteria | 1892 |
| 456 | Ga0207693_10000778 | 3300025915 | Bacteria | 28589 |
| 457 | Ga0207693_10001363 | 3300025915 | Bacteria | 21637 |
| 458 | Ga0207693_10004643 | 3300025915 | Bacteria | 11588 |
| 459 | Ga0207693_10040137 | 3300025915 | Bacteria | 3686 |
| 460 | Ga0207693_10599205 | 3300025915 | Bacteria | 858 |
| 461 | Ga0207663_10006026 | 3300025916 | Bacteria | 6163 |
| 462 | Ga0207663_10014147 | 3300025916 | Bacteria | 4361 |
| 463 | Ga0207663_10033555 | 3300025916 | Unclassified | 3059 |
| 464 | Ga0207660_10038322 | 3300025917 | Bacteria | 3345 |
| 465 | Ga0207660_10055618 | 3300025917 | Bacteria | 2829 |
| 466 | Ga0207660_10086730 | 3300025917 | Bacteria | 2312 |
| 467 | Ga0207660_10141637 | 3300025917 | Bacteria | 1839 |
| 468 | Ga0207662_10030100 | 3300025918 | Bacteria | 3149 |
| 469 | Ga0207662_10181976 | 3300025918 | Bacteria | 1353 |
| 470 | Ga0207657_10007552 | 3300025919 | Bacteria | 11143 |
| 471 | Ga0207657_10011057 | 3300025919 | Bacteria | 8972 |
| 472 | Ga0207657_10017756 | 3300025919 | Bacteria | 6812 |
| 473 | Ga0207657_10026504 | 3300025919 | Bacteria | 5325 |
| 474 | Ga0207657_10029871 | 3300025919 | Bacteria | 4955 |
| 475 | Ga0207657_10033669 | 3300025919 | Bacteria | 4616 |
| 476 | Ga0207657_10114680 | 3300025919 | Bacteria | 2222 |
| 477 | Ga0207657_10250020 | 3300025919 | Unclassified | 1413 |
| 478 | Ga0207657_11157163 | 3300025919 | Bacteria | 589 |
| 479 | Ga0207649_10250280 | 3300025920 | Unclassified | 1276 |
| 480 | Ga0207649_10338527 | 3300025920 | Unclassified | 1110 |
| 481 | Ga0207649_10532375 | 3300025920 | Unclassified | 897 |
| 482 | Ga0207649_10942008 | 3300025920 | Bacteria | 678 |
| 483 | Ga0207652_10043343 | 3300025921 | Bacteria | 3831 |
| 484 | Ga0207652_10071212 | 3300025921 | Bacteria | 3021 |
| 485 | Ga0207652_10154373 | 3300025921 | Bacteria | 2056 |
| 486 | Ga0207652_10658753 | 3300025921 | Bacteria | 936 |
| 487 | Ga0207652_10705771 | 3300025921 | Bacteria | 900 |
| 488 | Ga0207652_10770337 | 3300025921 | Unclassified | 856 |
| 489 | Ga0207652_10963621 | 3300025921 | Unclassified | 751 |
| 490 | Ga0207646_10000835 | 3300025922 | Bacteria | 40092 |
| 491 | Ga0207646_10000865 | 3300025922 | Bacteria | 39159 |
| 492 | Ga0207646_10045627 | 3300025922 | Unclassified | 3934 |
| 493 | Ga0207646_10047954 | 3300025922 | Bacteria | 3830 |
| 494 | Ga0207646_10099005 | 3300025922 | Bacteria | 2613 |
| 495 | Ga0207646_10641640 | 3300025922 | Unclassified | 952 |
| 496 | Ga0207659_10045709 | 3300025926 | Bacteria | 3089 |
| 497 | Ga0207659_10375683 | 3300025926 | Bacteria | 1184 |
| 498 | Ga0207687_10011371 | 3300025927 | Bacteria | 5818 |
| 499 | Ga0207687_10021405 | 3300025927 | Bacteria | 4296 |
| 500 | Ga0207687_10032474 | 3300025927 | Bacteria | 3536 |
| 501 | Ga0207687_10046895 | 3300025927 | Bacteria | 2993 |
| 502 | Ga0207687_10625599 | 3300025927 | Bacteria | 909 |
| 503 | Ga0207687_10948390 | 3300025927 | Bacteria | 737 |
| 504 | Ga0207700_10006703 | 3300025928 | Bacteria | 6988 |
| 505 | Ga0207700_10187624 | 3300025928 | Bacteria | 1735 |
| 506 | Ga0207700_10540118 | 3300025928 | Bacteria | 1034 |
| 507 | Ga0207700_10760032 | 3300025928 | Bacteria | 866 |
| 508 | Ga0207664_10001898 | 3300025929 | Bacteria | 13744 |
| 509 | Ga0207664_10004348 | 3300025929 | Bacteria | 9600 |
| 510 | Ga0207664_10033378 | 3300025929 | Bacteria | 3953 |
| 511 | Ga0207664_10033903 | 3300025929 | Bacteria | 3928 |
| 512 | Ga0207664_10059181 | 3300025929 | Unclassified | 3050 |
| 513 | Ga0207664_10358747 | 3300025929 | Unclassified | 1291 |
| 514 | Ga0207664_10404125 | 3300025929 | Unclassified | 1215 |
| 515 | Ga0207664_10520905 | 3300025929 | Bacteria | 1066 |
| 516 | Ga0207664_10644985 | 3300025929 | Unclassified | 952 |
| 517 | Ga0207664_10945917 | 3300025929 | Unclassified | 773 |
| 518 | Ga0207664_11184350 | 3300025929 | Bacteria | 682 |
| 519 | Ga0207664_11349453 | 3300025929 | Bacteria | 633 |
| 520 | Ga0207644_10114987 | 3300025931 | Bacteria | 2040 |
| 521 | Ga0207644_10126411 | 3300025931 | Bacteria | 1952 |
| 522 | Ga0207644_10155769 | 3300025931 | Bacteria | 1771 |
| 523 | Ga0207644_10178644 | 3300025931 | Bacteria | 1662 |
| 524 | Ga0207690_10011765 | 3300025932 | Bacteria | 5234 |
| 525 | Ga0207690_10621537 | 3300025932 | Bacteria | 883 |
| 526 | Ga0207690_10748280 | 3300025932 | Bacteria | 806 |
| 527 | Ga0207706_10005427 | 3300025933 | Bacteria | 11881 |
| 528 | Ga0207706_10082183 | 3300025933 | Bacteria | 2831 |
| 529 | Ga0207686_10006786 | 3300025934 | Bacteria | 6166 |
| 530 | Ga0207686_10070397 | 3300025934 | Bacteria | 2247 |
| 531 | Ga0207686_10133288 | 3300025934 | Bacteria | 1707 |
| 532 | Ga0207709_10000655 | 3300025935 | Bacteria | 28121 |
| 533 | Ga0207709_10079938 | 3300025935 | Bacteria | 2104 |
| 534 | Ga0207709_10186250 | 3300025935 | Bacteria | 1470 |
| 535 | Ga0207709_10189755 | 3300025935 | Bacteria | 1459 |
| 536 | Ga0207709_10200666 | 3300025935 | Unclassified | 1424 |
| 537 | Ga0207709_10346166 | 3300025935 | Bacteria | 1120 |
| 538 | Ga0207709_10454922 | 3300025935 | Unclassified | 990 |
| 539 | Ga0207709_11727160 | 3300025935 | Bacteria | 520 |
| 540 | Ga0207670_10014398 | 3300025936 | Bacteria | 4694 |
| 541 | Ga0207670_11661705 | 3300025936 | Bacteria | 543 |
| 542 | Ga0207669_10220113 | 3300025937 | Bacteria | 1392 |
| 543 | Ga0207669_11194783 | 3300025937 | Unclassified | 644 |
| 544 | Ga0207704_10002843 | 3300025938 | Bacteria | 7815 |
| 545 | Ga0207704_11437701 | 3300025938 | Unclassified | 591 |
| 546 | Ga0207665_10000336 | 3300025939 | Bacteria | 32436 |
| 547 | Ga0207665_10000544 | 3300025939 | Bacteria | 25404 |
| 548 | Ga0207691_10023027 | 3300025940 | Bacteria | 5867 |
| 549 | Ga0207691_10220556 | 3300025940 | Bacteria | 1644 |
| 550 | Ga0207691_10271825 | 3300025940 | Unclassified | 1459 |
| 551 | Ga0207691_10771984 | 3300025940 | Unclassified | 809 |
| 552 | Ga0207711_10065303 | 3300025941 | Bacteria | 3146 |
| 553 | Ga0207711_10512130 | 3300025941 | Unclassified | 1119 |
| 554 | Ga0207689_10355326 | 3300025942 | Bacteria | 1218 |
| 555 | Ga0207661_10021154 | 3300025944 | Bacteria | 4874 |
| 556 | Ga0207661_10296968 | 3300025944 | Unclassified | 1447 |
| 557 | Ga0207661_10306710 | 3300025944 | Bacteria | 1424 |
| 558 | Ga0207661_10603661 | 3300025944 | Unclassified | 1007 |
| 559 | Ga0207661_10632484 | 3300025944 | Bacteria | 983 |
| 560 | Ga0207661_11100825 | 3300025944 | Unclassified | 731 |
| 561 | Ga0207679_10064814 | 3300025945 | Bacteria | 2732 |
| 562 | Ga0207679_10613734 | 3300025945 | Bacteria | 981 |
| 563 | Ga0207679_11619643 | 3300025945 | Bacteria | 593 |
| 564 | Ga0207667_10014908 | 3300025949 | Bacteria | 8838 |
| 565 | Ga0207667_10083012 | 3300025949 | Bacteria | 3318 |
| 566 | Ga0207667_10239430 | 3300025949 | Bacteria | 1857 |
| 567 | Ga0207667_10534994 | 3300025949 | Unclassified | 1186 |
| 568 | Ga0207667_10543452 | 3300025949 | Unclassified | 1175 |
| 569 | Ga0207667_12101688 | 3300025949 | Bacteria | 523 |
| 570 | Ga0207651_10112845 | 3300025960 | Bacteria | 2044 |
| 571 | Ga0207651_11272980 | 3300025960 | Bacteria | 661 |
| 572 | Ga0207651_11904528 | 3300025960 | Unclassified | 535 |
| 573 | Ga0207712_11297924 | 3300025961 | Bacteria | 650 |
| 574 | Ga0207668_10209388 | 3300025972 | Bacteria | 1558 |
| 575 | Ga0207640_10290492 | 3300025981 | Unclassified | 1289 |
| 576 | Ga0207640_11046123 | 3300025981 | Unclassified | 720 |
| 577 | Ga0207640_11115840 | 3300025981 | Unclassified | 698 |
| 578 | Ga0207640_11751756 | 3300025981 | Bacteria | 561 |
| 579 | Ga0207677_10034168 | 3300026023 | Bacteria | 3290 |
| 580 | Ga0207677_10062174 | 3300026023 | Bacteria | 2589 |
| 581 | Ga0207677_10099391 | 3300026023 | Bacteria | 2137 |
| 582 | Ga0207677_10556308 | 3300026023 | Bacteria | 1001 |
| 583 | Ga0207677_10630170 | 3300026023 | Unclassified | 944 |
| 584 | Ga0207639_10041612 | 3300026041 | Bacteria | 3439 |
| 585 | Ga0207639_10215981 | 3300026041 | Bacteria | 1653 |
| 586 | Ga0207639_10241743 | 3300026041 | Unclassified | 1570 |
| 587 | Ga0207639_10394626 | 3300026041 | Bacteria | 1245 |
| 588 | Ga0207678_10006293 | 3300026067 | Bacteria | 10543 |
| 589 | Ga0207678_10012544 | 3300026067 | Bacteria | 7443 |
| 590 | Ga0207678_10145954 | 3300026067 | Unclassified | 2019 |
| 591 | Ga0207678_10303312 | 3300026067 | Bacteria | 1372 |
| 592 | Ga0207678_10826522 | 3300026067 | Unclassified | 818 |
| 593 | Ga0207708_10000468 | 3300026075 | Bacteria | 31201 |
| 594 | Ga0207708_10317014 | 3300026075 | Bacteria | 1271 |
| 595 | Ga0207708_10509060 | 3300026075 | Bacteria | 1010 |
| 596 | Ga0207702_10018302 | 3300026078 | Bacteria | 5794 |
| 597 | Ga0207702_10028564 | 3300026078 | Bacteria | 4637 |
| 598 | Ga0207702_10181504 | 3300026078 | Bacteria | 1938 |
| 599 | Ga0207702_10368069 | 3300026078 | Bacteria | 1379 |
| 600 | Ga0207702_10462149 | 3300026078 | Unclassified | 1233 |
| 601 | Ga0207702_10787693 | 3300026078 | Unclassified | 939 |
| 602 | Ga0207702_11711937 | 3300026078 | Unclassified | 621 |
| 603 | Ga0207641_11034157 | 3300026088 | Unclassified | 819 |
| 604 | Ga0207648_10000801 | 3300026089 | Bacteria | 35460 |
| 605 | Ga0207648_10026457 | 3300026089 | Bacteria | 5155 |
| 606 | Ga0207648_10319604 | 3300026089 | Bacteria | 1395 |
| 607 | Ga0207648_10732853 | 3300026089 | Bacteria | 917 |
| 608 | Ga0207676_10068223 | 3300026095 | Bacteria | 2844 |
| 609 | Ga0207674_10175861 | 3300026116 | Unclassified | 2093 |
| 610 | Ga0207674_10846048 | 3300026116 | Bacteria | 882 |
| 611 | Ga0207675_100003932 | 3300026118 | Bacteria | 14424 |
| 612 | Ga0207675_100011585 | 3300026118 | Bacteria | 8246 |
| 613 | Ga0207675_100716536 | 3300026118 | Unclassified | 1010 |
| 614 | Ga0207675_100897940 | 3300026118 | Unclassified | 902 |
| 615 | Ga0207683_10000041 | 3300026121 | Bacteria | 94017 |
| 616 | Ga0207683_10006496 | 3300026121 | Bacteria | 10004 |
| 617 | Ga0207683_10038385 | 3300026121 | Bacteria | 4174 |
| 618 | Ga0207683_10192049 | 3300026121 | Bacteria | 1854 |
| 619 | Ga0207698_10159015 | 3300026142 | Bacteria | 1973 |
| 620 | Ga0209998_10042363 | 3300027717 | Bacteria | 1036 |
| 621 | Ga0209974_10060311 | 3300027876 | Unclassified | 1284 |
| 622 | Ga0207428_10011552 | 3300027907 | Bacteria | 7798 |
| 623 | Ga0207428_10273354 | 3300027907 | Unclassified | 1255 |
| 624 | Ga0268266_10316526 | 3300028379 | Unclassified | 1459 |
| 625 | Ga0268266_10487858 | 3300028379 | Bacteria | 1175 |
| 626 | Ga0268266_10626469 | 3300028379 | Bacteria | 1034 |
| 627 | Ga0268266_11240317 | 3300028379 | Unclassified | 721 |
| 628 | Ga0268264_10666097 | 3300028381 | Bacteria | 1031 |
| 629 | Ga0265319_1001184 | 3300028563 | Bacteria | 16127 |
| 630 | Ga0265319_1047886 | 3300028563 | Bacteria | 1421 |
| 631 | Ga0265318_10008728 | 3300028577 | Bacteria | 4490 |
| 632 | Ga0265318_10041967 | 3300028577 | Bacteria | 1737 |
| 633 | Ga0265322_10008319 | 3300028654 | Bacteria | 3023 |
| 634 | Ga0265338_10005686 | 3300028800 | Bacteria | 16138 |
| 635 | Ga0265338_10021756 | 3300028800 | Bacteria | 6668 |
| 636 | Ga0265338_10049336 | 3300028800 | Bacteria | 3817 |
| 637 | Ga0265338_10071275 | 3300028800 | Bacteria | 2974 |
| 638 | Ga0265330_10014203 | 3300031235 | Bacteria | 3697 |
| 639 | Ga0265332_10088592 | 3300031238 | Unclassified | 1310 |
| 640 | Ga0265328_10097022 | 3300031239 | Bacteria | 1090 |
| 641 | Ga0265320_10100948 | 3300031240 | Bacteria | 1329 |
| 642 | Ga0265329_10082352 | 3300031242 | Bacteria | 1019 |
| 643 | Ga0265340_10043102 | 3300031247 | Bacteria | 2213 |
| 644 | Ga0265339_10005422 | 3300031249 | Bacteria | 8499 |
| 645 | Ga0265331_10042749 | 3300031250 | Unclassified | 2198 |
| 646 | Ga0265327_10027941 | 3300031251 | Bacteria | 3238 |
| 647 | Ga0265327_10040289 | 3300031251 | Bacteria | 2528 |
| 648 | Ga0265316_10139407 | 3300031344 | Unclassified | 1822 |
| 649 | Ga0265316_10438782 | 3300031344 | Bacteria | 937 |
| 650 | Ga0307408_100816795 | 3300031548 | Unclassified | 847 |
| 651 | Ga0307408_100881441 | 3300031548 | Bacteria | 818 |
| 652 | Ga0265313_10054249 | 3300031595 | Bacteria | 1904 |
| 653 | Ga0265313_10171330 | 3300031595 | Unclassified | 917 |
| 654 | Ga0265314_10037065 | 3300031711 | Bacteria | 3536 |
| 655 | Ga0265314_10183910 | 3300031711 | Unclassified | 1249 |
| 656 | Ga0265342_10031739 | 3300031712 | Bacteria | 3263 |
| 657 | Ga0307405_10685370 | 3300031731 | Bacteria | 847 |
| 658 | Ga0307405_11474539 | 3300031731 | Bacteria | 597 |
| 659 | Ga0307413_10013094 | 3300031824 | Bacteria | 4154 |
| 660 | Ga0307413_10133173 | 3300031824 | Unclassified | 1705 |
| 661 | Ga0307413_10208002 | 3300031824 | Unclassified | 1419 |
| 662 | Ga0307410_10106281 | 3300031852 | Bacteria | 2022 |
| 663 | Ga0307410_11069234 | 3300031852 | Bacteria | 698 |
| 664 | Ga0307406_10217630 | 3300031901 | Unclassified | 1417 |
| 665 | Ga0307406_10437392 | 3300031901 | Bacteria | 1046 |
| 666 | Ga0307406_10491808 | 3300031901 | Unclassified | 993 |
| 667 | Ga0307407_10017436 | 3300031903 | Bacteria | 3603 |
| 668 | Ga0307407_11433451 | 3300031903 | Unclassified | 545 |
| 669 | Ga0307409_100073101 | 3300031995 | Bacteria | 2733 |
| 670 | Ga0307409_100080946 | 3300031995 | Bacteria | 2623 |
| 671 | Ga0307409_100539139 | 3300031995 | Bacteria | 1143 |
| 672 | Ga0307416_100083403 | 3300032002 | Unclassified | 2712 |
| 673 | Ga0307416_100227725 | 3300032002 | Bacteria | 1794 |
| 674 | Ga0307416_100385547 | 3300032002 | Bacteria | 1433 |
| 675 | Ga0307416_100501233 | 3300032002 | Unclassified | 1278 |
| 676 | Ga0307416_100640371 | 3300032002 | Unclassified | 1147 |
| 677 | Ga0307416_100653652 | 3300032002 | Unclassified | 1136 |
| 678 | Ga0307416_100656259 | 3300032002 | Bacteria | 1134 |
| 679 | Ga0307416_101965094 | 3300032002 | Unclassified | 688 |
| 680 | Ga0307414_11412582 | 3300032004 | Unclassified | 647 |
| 681 | Ga0307411_10140631 | 3300032005 | Unclassified | 1779 |
| 682 | Ga0307415_100056494 | 3300032126 | Bacteria | 2691 |
| 683 | Ga0307415_100303402 | 3300032126 | Unclassified | 1324 |
| 684 | Ga0307415_101298074 | 3300032126 | Bacteria | 689 |
| 685 | Ga0373958_0035589 | 3300034819 | Bacteria | 997 |
| 686 | Ga0373928_0041857 | 3300035084 | Bacteria | 1055 |
| 687 | Ga0373929_0005112 | 3300035085 | Bacteria | 2359 |
| 688 | Ga0373940_0055264 | 3300035088 | Bacteria | 1124 |
| 689 | Ga0373944_0050180 | 3300035089 | Bacteria | 1313 |
| 690 | Ga0373949_0090444 | 3300035090 | Bacteria | 827 |
| 691 | Ga0373952_0043091 | 3300035092 | Bacteria | 1050 |
| 692 | Ga0373936_0033789 | 3300035113 | Bacteria | 2029 |
| 693 | Ga0373936_0072951 | 3300035113 | Bacteria | 1418 |
| 694 | Ga0373939_0045219 | 3300035114 | Bacteria | 1343 |
| 695 | Ga0373954_0327878 | 3300035118 | Unclassified | 756 |
| 696 | Ga0373943_0000813 | 3300035170 | Bacteria | 13694 |
| 697 | Ga0373943_0105490 | 3300035170 | Bacteria | 1479 |
| 698 | Ga0373943_0111041 | 3300035170 | Bacteria | 1446 |
| 699 | Ga0373946_0150740 | 3300035171 | Bacteria | 1085 |
| 700 | Ga0373946_0241158 | 3300035171 | Unclassified | 879 |
| 701 | Ga0373961_0052040 | 3300035241 | Bacteria | 1218 |
| 702 | Ga0373961_0075692 | 3300035241 | Bacteria | 1050 |
| 703 | Ga0373962_0055198 | 3300035242 | Bacteria | 1154 |
| 704 | Ga0373931_0032081 | 3300035691 | Archaea | 2716 |
| 705 | Ga0373931_0211437 | 3300035691 | Bacteria | 1163 |
| 706 | Ga0373931_0245511 | 3300035691 | Unclassified | 1087 |
| 707 | Ga0373935_0235506 | 3300035692 | Bacteria | 1276 |
| 708 | Ga0373935_0684805 | 3300035692 | Unclassified | 753 |
| 709 | Ga0373927_0041489 | 3300035695 | Bacteria | 2985 |
| 710 | Ga0373947_0006490 | 3300035725 | Bacteria | 6789 |
| 711 | Ga0373947_0009782 | 3300035725 | Bacteria | 5504 |
| 712 | Ga0373947_0030406 | 3300035725 | Bacteria | 3173 |
| 713 | Ga0373947_0047281 | 3300035725 | Bacteria | 2578 |
| 714 | Ga0373947_0072999 | 3300035725 | Unclassified | 2108 |
| 715 | Ga0373937_1032637 | 3300036401 | Unclassified | 771 |
| 716 | Ga0373925_0000812 | 3300037068 | Bacteria | 28759 |
| 717 | Ga0373925_0196937 | 3300037068 | Bacteria | 1601 |
| 718 | Ga0373925_0699626 | 3300037068 | Bacteria | 836 |
| 719 | Ga0373925_0718463 | 3300037068 | Bacteria | 824 |
| 720 | Ga0395899_0005142 | 3300037312 | Bacteria | 10174 |
| 721 | Ga0395899_0044946 | 3300037312 | Bacteria | 3289 |
| 722 | Ga0395899_0086273 | 3300037312 | Bacteria | 2280 |
| 723 | Ga0395899_0089674 | 3300037312 | Unclassified | 2230 |
| 724 | Ga0395900_0001655 | 3300037418 | Bacteria | 26083 |
| 725 | Ga0395900_0002249 | 3300037418 | Bacteria | 21466 |
| 726 | Ga0395900_0003362 | 3300037418 | Bacteria | 17277 |
| 727 | Ga0395900_0006320 | 3300037418 | Bacteria | 12353 |
| 728 | Ga0395900_0006716 | 3300037418 | Bacteria | 11946 |
| 729 | Ga0395900_0007766 | 3300037418 | Bacteria | 11064 |
| 730 | Ga0395900_0017894 | 3300037418 | Bacteria | 7233 |
| 731 | Ga0395900_0020761 | 3300037418 | Bacteria | 6714 |
| 732 | Ga0395900_0027097 | 3300037418 | Bacteria | 5867 |
| 733 | Ga0395900_0032020 | 3300037418 | Bacteria | 5406 |
| 734 | Ga0395900_0037264 | 3300037418 | Bacteria | 5015 |
| 735 | Ga0395900_0102290 | 3300037418 | Unclassified | 2943 |
| 736 | Ga0395900_0144086 | 3300037418 | Bacteria | 2437 |
| 737 | Ga0395900_0181058 | 3300037418 | Bacteria | 2142 |
| 738 | Ga0395900_0184989 | 3300037418 | Unclassified | 2115 |
| 739 | Ga0395900_0293118 | 3300037418 | Bacteria | 1615 |
| 740 | Ga0395900_0719696 | 3300037418 | Bacteria | 930 |
| 741 | Ga0395900_0836344 | 3300037418 | Unclassified | 847 |
| 742 | Ga0395900_0893922 | 3300037418 | Unclassified | 812 |
| 743 | Ga0395900_1094394 | 3300037418 | Unclassified | 714 |
| 744 | Ga0395898_0001213 | 3300037466 | Bacteria | 38909 |
| 745 | Ga0395898_0020563 | 3300037466 | Bacteria | 6704 |
| 746 | Ga0395898_0025315 | 3300037466 | Bacteria | 5981 |
| 747 | Ga0395898_0028831 | 3300037466 | Bacteria | 5564 |
| 748 | Ga0395898_0059109 | 3300037466 | Bacteria | 3731 |
| 749 | Ga0395898_0060749 | 3300037466 | Bacteria | 3672 |
| 750 | Ga0395898_0062235 | 3300037466 | Bacteria | 3624 |
| 751 | Ga0395898_0084924 | 3300037466 | Bacteria | 3051 |
| 752 | Ga0395898_0110958 | 3300037466 | Unclassified | 2629 |
| 753 | Ga0395898_0129714 | 3300037466 | Bacteria | 2415 |
| 754 | Ga0395898_0133413 | 3300037466 | Bacteria | 2378 |
| 755 | Ga0395898_0149816 | 3300037466 | Unclassified | 2232 |
| 756 | Ga0395898_0203263 | 3300037466 | Bacteria | 1891 |
| 757 | Ga0395898_0361399 | 3300037466 | Unclassified | 1384 |
| 758 | Ga0395898_0472905 | 3300037466 | Bacteria | 1193 |
| 759 | Ga0395898_0491584 | 3300037466 | Bacteria | 1167 |
| 760 | Ga0395898_0508994 | 3300037466 | Unclassified | 1145 |
| 761 | Ga0395898_0564518 | 3300037466 | Bacteria | 1080 |
| 762 | Ga0395898_0729085 | 3300037466 | Bacteria | 933 |
| 763 | Ga0395898_0918769 | 3300037466 | Bacteria | 813 |
| 764 | Ga0395898_1159276 | 3300037466 | Unclassified | 705 |
| 765 | Ga0395898_1896003 | 3300037466 | Unclassified | 516 |
| 766 | Ga0395905_0004783 | 3300037471 | Bacteria | 13988 |
| 767 | Ga0395905_0006777 | 3300037471 | Bacteria | 11477 |
| 768 | Ga0395905_0007521 | 3300037471 | Bacteria | 10833 |
| 769 | Ga0395905_0011439 | 3300037471 | Bacteria | 8575 |
| 770 | Ga0395905_0020345 | 3300037471 | Bacteria | 6287 |
| 771 | Ga0395905_0061123 | 3300037471 | Bacteria | 3523 |
| 772 | Ga0395905_0129527 | 3300037471 | Unclassified | 2373 |
| 773 | Ga0395905_0286410 | 3300037471 | Bacteria | 1534 |
| 774 | Ga0395905_0463257 | 3300037471 | Bacteria | 1166 |
| 775 | Ga0395905_0642720 | 3300037471 | Bacteria | 963 |
| 776 | Ga0395905_0651964 | 3300037471 | Bacteria | 955 |
| 777 | Ga0395905_0774761 | 3300037471 | Bacteria | 862 |
| 778 | Ga0395905_1181163 | 3300037471 | Unclassified | 669 |
| 779 | Ga0395901_0000809 | 3300038443 | Bacteria | 34767 |
| 780 | Ga0395901_0006450 | 3300038443 | Bacteria | 11889 |
| 781 | Ga0395901_0006756 | 3300038443 | Bacteria | 11586 |
| 782 | Ga0395901_0006980 | 3300038443 | Bacteria | 11413 |
| 783 | Ga0395901_0009659 | 3300038443 | Bacteria | 9785 |
| 784 | Ga0395901_0022292 | 3300038443 | Bacteria | 6490 |
| 785 | Ga0395901_0057131 | 3300038443 | Bacteria | 4059 |
| 786 | Ga0395901_0060705 | 3300038443 | Bacteria | 3934 |
| 787 | Ga0395901_0065114 | 3300038443 | Bacteria | 3794 |
| 788 | Ga0395901_0074149 | 3300038443 | Bacteria | 3550 |
| 789 | Ga0395901_0077280 | 3300038443 | Bacteria | 3474 |
| 790 | Ga0395901_0077973 | 3300038443 | Bacteria | 3458 |
| 791 | Ga0395901_0101550 | 3300038443 | Bacteria | 3018 |
| 792 | Ga0395901_0107100 | 3300038443 | Bacteria | 2934 |
| 793 | Ga0395901_0108700 | 3300038443 | Bacteria | 2911 |
| 794 | Ga0395901_0299293 | 3300038443 | Unclassified | 1668 |
| 795 | Ga0395901_0388518 | 3300038443 | Bacteria | 1435 |
| 796 | Ga0395901_0413074 | 3300038443 | Bacteria | 1385 |
| 797 | Ga0395901_0558716 | 3300038443 | Unclassified | 1159 |
| 798 | Ga0395901_0569344 | 3300038443 | Unclassified | 1146 |
| 799 | Ga0395901_1394686 | 3300038443 | Unclassified | 659 |
| 800 | Ga0436365_1172237 | 3300039437 | Unclassified | 762 |
| 801 | Ga0436360_0769076 | 3300039438 | Archaea | 791 |
| 802 | Ga0436362_1228474 | 3300039453 | Archaea | 582 |
| 803 | Ga0451789_0993490 | 3300041443 | Unclassified | 788 |
| 804 | Ga0451789_1134997 | 3300041443 | Bacteria | 965 |
| 805 | Ga0451800_1121739 | 3300041459 | Unclassified | 775 |
| 806 | Ga0451839_0248092 | 3300041496 | Unclassified | 657 |
| 807 | Ga0439445_0025872 | 3300042004 | Bacteria | 1499 |
| 808 | Ga0439448_0002325 | 3300042005 | Bacteria | 5148 |
| 809 | Ga0439455_0021157 | 3300042012 | Bacteria | 1548 |
| 810 | Ga0450906_059770 | 3300042145 | Bacteria | 677 |
| 811 | Ga0450907_014954 | 3300042146 | Unclassified | 1295 |
| 812 | Ga0450910_052409 | 3300042147 | Bacteria | 677 |
| 813 | Ga0439458_0024096 | 3300042157 | Unclassified | 1421 |
| 814 | Ga0439434_0062341 | 3300042435 | Unclassified | 1167 |
| 815 | Ga0439444_0037767 | 3300042437 | Unclassified | 936 |
| 816 | Ga0450918_058941 | 3300042531 | Unclassified | 707 |
| 817 | Ga0453683_0249518 | 3300044673 | Bacteria | 1131 |
| 818 | Ga0466965_0279540 | 3300044683 | Bacteria | 901 |
| 819 | Ga0466966_0041164 | 3300044684 | Bacteria | 2969 |
| 820 | Ga0466961_0024090 | 3300044693 | Bacteria | 3916 |
| 821 | Ga0466961_0202950 | 3300044693 | Bacteria | 1226 |
| 822 | Ga0466963_0000744 | 3300044694 | Bacteria | 16050 |
| 823 | Ga0466963_0002408 | 3300044694 | Bacteria | 10463 |
| 824 | Ga0466963_0006073 | 3300044694 | Bacteria | 7120 |
| 825 | Ga0466963_0031510 | 3300044694 | Bacteria | 3428 |
| 826 | Ga0466963_0153414 | 3300044694 | Bacteria | 1600 |
| 827 | Ga0466963_0709525 | 3300044694 | Unclassified | 710 |
| 828 | Ga0466964_0065227 | 3300044706 | Unclassified | 1525 |
| 829 | Ga0466964_0134102 | 3300044706 | Unclassified | 1131 |
| 830 | Ga0453684_2444840 | 3300044712 | Unclassified | 517 |
| 831 | Ga0466968_0024637 | 3300044735 | Unclassified | 2460 |
| 832 | Ga0466957_0014432 | 3300044842 | Bacteria | 4600 |
| 833 | Ga0466957_0021324 | 3300044842 | Bacteria | 3817 |
| 834 | Ga0466957_0024900 | 3300044842 | Bacteria | 3545 |
| 835 | Ga0466957_0121909 | 3300044842 | Bacteria | 1663 |
| 836 | Ga0466957_0146888 | 3300044842 | Bacteria | 1522 |
| 837 | Ga0466957_0266953 | 3300044842 | Unclassified | 1142 |
| 838 | Ga0466957_0582636 | 3300044842 | Bacteria | 782 |
| 839 | Ga0466960_0016942 | 3300044901 | Bacteria | 3169 |
| 840 | Ga0466959_0033845 | 3300045049 | Bacteria | 3779 |
| 841 | Ga0466959_0631493 | 3300045049 | Bacteria | 719 |
| 842 | Ga0451576_0037970 | 3300045051 | Bacteria | 5099 |
| 843 | Ga0466958_0002356 | 3300045836 | Bacteria | 9453 |
| 844 | Ga0466958_0003510 | 3300045836 | Bacteria | 8146 |
| 845 | Ga0466958_0004437 | 3300045836 | Bacteria | 7409 |
| 846 | Ga0466958_0274513 | 3300045836 | Bacteria | 1080 |
| 847 | Ga0466958_0357947 | 3300045836 | Bacteria | 940 |
| 848 | Ga0466958_0428879 | 3300045836 | Unclassified | 855 |
| 849 | Ga0466967_0005287 | 3300045976 | Bacteria | 8910 |
| 850 | Ga0466967_0033110 | 3300045976 | Bacteria | 4373 |
| 851 | Ga0466967_0036315 | 3300045976 | Bacteria | 4205 |
| 852 | Ga0466967_0119834 | 3300045976 | Bacteria | 2429 |
| 853 | Ga0466967_0125019 | 3300045976 | Bacteria | 2381 |
| 854 | Ga0466967_0250303 | 3300045976 | Bacteria | 1692 |
| 855 | Ga0466967_0283936 | 3300045976 | Unclassified | 1589 |
| 856 | Ga0466967_0349891 | 3300045976 | Bacteria | 1430 |
| 857 | Ga0466967_0477364 | 3300045976 | Bacteria | 1221 |
| 858 | Ga0466967_0794600 | 3300045976 | Unclassified | 939 |
| 859 | Ga0466967_0858164 | 3300045976 | Unclassified | 902 |
| 860 | Ga0466967_1141361 | 3300045976 | Bacteria | 776 |
| 861 | Ga0466967_2385549 | 3300045976 | Bacteria | 524 |
| 862 | Ga0495603_0005797 | 3300046455 | Bacteria | 7389 |
| 863 | Ga0495603_0042538 | 3300046455 | Bacteria | 2715 |
| 864 | Ga0495590_0163177 | 3300046457 | Bacteria | 811 |
| 865 | Ga0495629_0148342 | 3300046459 | Bacteria | 1630 |
| 866 | Ga0495629_0157980 | 3300046459 | Bacteria | 1575 |
| 867 | Ga0495629_0187479 | 3300046459 | Bacteria | 1432 |
| 868 | Ga0495641_0011587 | 3300046461 | Bacteria | 5009 |
| 869 | Ga0495641_0036634 | 3300046461 | Unclassified | 2304 |
| 870 | Ga0495641_0170249 | 3300046461 | Bacteria | 975 |
| 871 | Ga0495651_0716744 | 3300046462 | Bacteria | 622 |
| 872 | Ga0495580_0001957 | 3300046472 | Bacteria | 18089 |
| 873 | Ga0495582_0092659 | 3300046473 | Unclassified | 1686 |
| 874 | Ga0495582_0095145 | 3300046473 | Bacteria | 1663 |
| 875 | Ga0495605_0246811 | 3300046474 | Bacteria | 765 |
| 876 | Ga0495605_0273339 | 3300046474 | Unclassified | 719 |
| 877 | Ga0495639_0000699 | 3300046475 | Bacteria | 15350 |
| 878 | Ga0495639_0091609 | 3300046475 | Bacteria | 1427 |
| 879 | Ga0495639_0529372 | 3300046475 | Bacteria | 603 |
| 880 | Ga0495639_0564318 | 3300046475 | Bacteria | 584 |
| 881 | Ga0495662_0048384 | 3300046476 | Bacteria | 2052 |
| 882 | Ga0495664_0009726 | 3300046477 | Bacteria | 5387 |
| 883 | Ga0495584_0104789 | 3300046491 | Bacteria | 1430 |
| 884 | Ga0495584_0209392 | 3300046491 | Unclassified | 991 |
| 885 | Ga0495584_0420765 | 3300046491 | Unclassified | 679 |
| 886 | Ga0495585_0446738 | 3300046492 | Unclassified | 619 |
| 887 | Ga0495594_0001276 | 3300046499 | Bacteria | 13161 |
| 888 | Ga0495596_0040412 | 3300046500 | Bacteria | 1842 |
| 889 | Ga0495596_0052304 | 3300046500 | Bacteria | 1599 |
| 890 | Ga0495596_0079524 | 3300046500 | Bacteria | 1273 |
| 891 | Ga0495596_0267132 | 3300046500 | Unclassified | 664 |
| 892 | Ga0495607_0192209 | 3300046501 | Bacteria | 1016 |
| 893 | Ga0495608_0848061 | 3300046511 | Bacteria | 537 |
| 894 | Ga0495618_0036416 | 3300046514 | Bacteria | 3087 |
| 895 | Ga0495630_0001491 | 3300046517 | Bacteria | 16191 |
| 896 | Ga0495630_0172845 | 3300046517 | Bacteria | 1646 |
| 897 | Ga0495630_0682969 | 3300046517 | Unclassified | 786 |
| 898 | Ga0495631_0160449 | 3300046518 | Bacteria | 965 |
| 899 | Ga0495631_0206952 | 3300046518 | Unclassified | 839 |
| 900 | Ga0495631_0260207 | 3300046518 | Unclassified | 739 |
| 901 | Ga0495631_0357429 | 3300046518 | Bacteria | 621 |
| 902 | Ga0495637_0052345 | 3300046520 | Bacteria | 1705 |
| 903 | Ga0495644_0045114 | 3300046523 | Bacteria | 1658 |
| 904 | Ga0495644_0072877 | 3300046523 | Bacteria | 1291 |
| 905 | Ga0495644_0093176 | 3300046523 | Bacteria | 1138 |
| 906 | Ga0495644_0093325 | 3300046523 | Unclassified | 1137 |
| 907 | Ga0495644_0222836 | 3300046523 | Bacteria | 729 |
| 908 | Ga0495663_0002901 | 3300046525 | Bacteria | 5061 |
| 909 | Ga0495663_0003885 | 3300046525 | Unclassified | 4260 |
| 910 | Ga0495666_0000298 | 3300046526 | Bacteria | 21680 |
| 911 | Ga0495666_0003426 | 3300046526 | Bacteria | 7998 |
| 912 | Ga0495642_0241587 | 3300046528 | Unclassified | 789 |
| 913 | Ga0495652_0113884 | 3300046529 | Bacteria | 2170 |
| 914 | Ga0495652_0709931 | 3300046529 | Unclassified | 676 |
| 915 | Ga0495665_0051507 | 3300046531 | Bacteria | 2180 |
| 916 | Ga0495640_0050221 | 3300046533 | Bacteria | 2874 |
| 917 | Ga0495640_0287575 | 3300046533 | Bacteria | 1023 |
| 918 | Ga0495586_0011405 | 3300046535 | Bacteria | 4727 |
| 919 | Ga0495586_0098296 | 3300046535 | Bacteria | 1622 |
| 920 | Ga0495587_0339430 | 3300046536 | Unclassified | 838 |
| 921 | Ga0495598_0172318 | 3300046537 | Unclassified | 768 |
| 922 | Ga0495609_0049150 | 3300046538 | Unclassified | 1883 |
| 923 | Ga0495609_0115922 | 3300046538 | Bacteria | 1154 |
| 924 | Ga0495609_0140262 | 3300046538 | Unclassified | 1032 |
| 925 | Ga0495621_0191120 | 3300046539 | Unclassified | 821 |
| 926 | Ga0495633_0470538 | 3300046558 | Unclassified | 567 |
| 927 | Ga0495656_0010427 | 3300046615 | Bacteria | 3379 |
| 928 | Ga0495656_0176238 | 3300046615 | Unclassified | 1048 |
| 929 | Ga0495656_0316474 | 3300046615 | Unclassified | 803 |
| 930 | Ga0495656_0384359 | 3300046615 | Unclassified | 732 |
| 931 | Ga0495634_0062554 | 3300046642 | Unclassified | 2471 |
| 932 | Ga0495634_0215920 | 3300046642 | Bacteria | 1186 |
| 933 | Ga0495611_0317855 | 3300046648 | Unclassified | 717 |
| 934 | Ga0495635_0011220 | 3300046663 | Bacteria | 6281 |
| 935 | Ga0495635_0540260 | 3300046663 | Bacteria | 765 |
| 936 | Ga0495659_0005869 | 3300046664 | Unclassified | 3877 |
| 937 | Ga0495659_0016342 | 3300046664 | Unclassified | 2447 |
| 938 | Ga0495659_0067505 | 3300046664 | Unclassified | 1334 |
| 939 | Ga0495659_0148606 | 3300046664 | Unclassified | 940 |
| 940 | Ga0495588_0048749 | 3300046674 | Bacteria | 2176 |
| 941 | Ga0495588_0422380 | 3300046674 | Bacteria | 700 |
| 942 | Ga0495599_0121005 | 3300046678 | Bacteria | 1627 |
| 943 | Ga0495647_0001206 | 3300046681 | Bacteria | 7981 |
| 944 | Ga0495658_0080498 | 3300046683 | Bacteria | 1910 |
| 945 | Ga0495658_0134588 | 3300046683 | Bacteria | 1507 |
| 946 | Ga0495658_0169670 | 3300046683 | Bacteria | 1350 |
| 947 | Ga0495658_0357905 | 3300046683 | Bacteria | 928 |
| 948 | Ga0495658_0416658 | 3300046683 | Bacteria | 857 |
| 949 | Ga0495658_0895582 | 3300046683 | Unclassified | 567 |
| 950 | Ga0495669_0640959 | 3300046684 | Unclassified | 517 |
| 951 | Ga0495613_0172299 | 3300046689 | Bacteria | 1535 |
| 952 | Ga0495613_0313738 | 3300046689 | Bacteria | 1083 |
| 953 | Ga0495624_0007376 | 3300046690 | Bacteria | 7724 |
| 954 | Ga0495670_0114120 | 3300046691 | Bacteria | 1400 |
| 955 | Ga0495670_0429045 | 3300046691 | Unclassified | 715 |
| 956 | Ga0495670_0786783 | 3300046691 | Bacteria | 519 |
| 957 | Ga0495671_0255484 | 3300046692 | Bacteria | 846 |
| 958 | Ga0495589_0037338 | 3300046794 | Unclassified | 2434 |
| 959 | Ga0495589_0386230 | 3300046794 | Unclassified | 643 |
| 960 | Ga0495581_0004047 | 3300047315 | Bacteria | 8443 |
| 961 | Ga0495581_0155844 | 3300047315 | Unclassified | 1335 |
| 962 | Ga0495581_0340955 | 3300047315 | Bacteria | 875 |
| 963 | Ga0495604_0836995 | 3300047317 | Unclassified | 578 |
| 964 | Ga0495636_0109586 | 3300047318 | Bacteria | 1214 |
| 965 | Ga0495636_0168407 | 3300047318 | Unclassified | 990 |
| 966 | Ga0495636_0213749 | 3300047318 | Unclassified | 883 |
| 967 | Ga0495674_0027631 | 3300047319 | Bacteria | 5182 |
| 968 | Ga0495676_0006956 | 3300047321 | Bacteria | 10382 |
| 969 | Ga0495676_0018911 | 3300047321 | Bacteria | 6068 |
| 970 | Ga0495676_0019336 | 3300047321 | Bacteria | 5992 |
| 971 | Ga0495676_0119176 | 3300047321 | Unclassified | 1923 |
| 972 | Ga0495676_0375113 | 3300047321 | Bacteria | 947 |
| 973 | Ga0495680_0304064 | 3300047322 | Bacteria | 1119 |
| 974 | Ga0495680_0517406 | 3300047322 | Unclassified | 808 |
| 975 | Ga0495675_0794262 | 3300047444 | Unclassified | 524 |
| 976 | Ga0495677_0234197 | 3300047445 | Unclassified | 717 |
| 977 | Ga0495679_087273 | 3300047446 | Bacteria | 879 |
| 978 | Ga0495685_015551 | 3300047447 | Bacteria | 2597 |
| 979 | Ga0495684_0101058 | 3300047471 | Bacteria | 2180 |
| 980 | Ga0495684_0229576 | 3300047471 | Unclassified | 1358 |
| 981 | Ga0495684_0468980 | 3300047471 | Bacteria | 871 |
| 982 | Ga0495593_0004815 | 3300047673 | Bacteria | 8004 |
| 983 | Ga0495593_0436893 | 3300047673 | Unclassified | 655 |
| 984 | Ga0495614_0001813 | 3300048089 | Bacteria | 9357 |
| 985 | Ga0495615_0098767 | 3300048090 | Bacteria | 822 |
| 986 | Ga0495615_0296562 | 3300048090 | Bacteria | 523 |
| 987 | Ga0495626_0379213 | 3300048091 | Unclassified | 549 |
| 988 | Ga0496100_0003025 | 3300048903 | Bacteria | 8671 |
| 989 | Ga0496100_0073572 | 3300048903 | Bacteria | 2287 |
| 990 | Ga0496100_0112371 | 3300048903 | Bacteria | 1895 |
| 991 | Ga0496100_0775513 | 3300048903 | Bacteria | 750 |
| 992 | Ga0496100_0905530 | 3300048903 | Bacteria | 693 |
| 993 | Ga0496101_0007189 | 3300048904 | Bacteria | 7204 |
| 994 | Ga0496101_0044862 | 3300048904 | Bacteria | 3165 |
| 995 | Ga0496101_0054758 | 3300048904 | Unclassified | 2880 |
| 996 | Ga0496101_0095461 | 3300048904 | Bacteria | 2218 |
| 997 | Ga0496101_0098101 | 3300048904 | Bacteria | 2189 |
| 998 | Ga0496101_0140288 | 3300048904 | Bacteria | 1841 |
| 999 | Ga0496101_0204261 | 3300048904 | Unclassified | 1528 |
| 1000 | Ga0496101_0332581 | 3300048904 | Bacteria | 1192 |
| 1001 | Ga0496101_0426100 | 3300048904 | Bacteria | 1046 |
| 1002 | Ga0496102_0005234 | 3300048905 | Bacteria | 11010 |
| 1003 | Ga0496102_0041411 | 3300048905 | Bacteria | 4171 |
| 1004 | Ga0496102_0043823 | 3300048905 | Bacteria | 4058 |
| 1005 | Ga0496102_0107787 | 3300048905 | Bacteria | 2594 |
| 1006 | Ga0496102_0257836 | 3300048905 | Unclassified | 1644 |
| 1007 | Ga0496102_0535820 | 3300048905 | Unclassified | 1093 |
| 1008 | Ga0496103_0006523 | 3300048906 | Bacteria | 6961 |
| 1009 | Ga0496103_0014934 | 3300048906 | Bacteria | 4616 |
| 1010 | Ga0496103_0059182 | 3300048906 | Bacteria | 2380 |
| 1011 | Ga0496103_0256971 | 3300048906 | Unclassified | 1124 |
| 1012 | Ga0496103_0314659 | 3300048906 | Bacteria | 1007 |
| 1013 | Ga0496103_0387789 | 3300048906 | Bacteria | 897 |
| 1014 | Ga0496104_0000465 | 3300048907 | Bacteria | 34961 |
| 1015 | Ga0496104_0001293 | 3300048907 | Bacteria | 21572 |
| 1016 | Ga0496104_0004690 | 3300048907 | Bacteria | 11903 |
| 1017 | Ga0496104_0057628 | 3300048907 | Bacteria | 3675 |
| 1018 | Ga0496104_0064939 | 3300048907 | Bacteria | 3462 |
| 1019 | Ga0496104_0097732 | 3300048907 | Bacteria | 2810 |
| 1020 | Ga0496104_0914245 | 3300048907 | Bacteria | 782 |
| 1021 | Ga0496104_1047916 | 3300048907 | Unclassified | 719 |
| 1022 | Ga0496104_1377422 | 3300048907 | Unclassified | 608 |
| 1023 | Ga0496105_0000567 | 3300048908 | Bacteria | 24437 |
| 1024 | Ga0496105_0001494 | 3300048908 | Bacteria | 16523 |
| 1025 | Ga0496105_0033728 | 3300048908 | Bacteria | 4206 |
| 1026 | Ga0496105_0051157 | 3300048908 | Bacteria | 3413 |
| 1027 | Ga0496105_0187235 | 3300048908 | Bacteria | 1694 |
| 1028 | Ga0496105_0438616 | 3300048908 | Bacteria | 1032 |
| 1029 | Ga0496105_0446533 | 3300048908 | Unclassified | 1021 |
| 1030 | Ga0496106_0003242 | 3300048909 | Bacteria | 12172 |
| 1031 | Ga0496106_0007756 | 3300048909 | Bacteria | 7944 |
| 1032 | Ga0496106_0049191 | 3300048909 | Bacteria | 3175 |
| 1033 | Ga0496106_0081483 | 3300048909 | Bacteria | 2486 |
| 1034 | Ga0496106_0788218 | 3300048909 | Unclassified | 754 |
| 1035 | Ga0496106_1255153 | 3300048909 | Unclassified | 576 |
| 1036 | Ga0496107_0001702 | 3300048910 | Bacteria | 13784 |
| 1037 | Ga0496107_0009067 | 3300048910 | Bacteria | 6897 |
| 1038 | Ga0496107_0220077 | 3300048910 | Unclassified | 1412 |
| 1039 | Ga0496107_0335020 | 3300048910 | Unclassified | 1126 |
| 1040 | Ga0496107_0583830 | 3300048910 | Unclassified | 827 |
| 1041 | Ga0496107_0667953 | 3300048910 | Bacteria | 765 |
| 1042 | Ga0496107_1091240 | 3300048910 | Bacteria | 577 |
| 1043 | Ga0496108_0001327 | 3300048911 | Bacteria | 19451 |
| 1044 | Ga0496108_0001889 | 3300048911 | Bacteria | 16782 |
| 1045 | Ga0496108_0009890 | 3300048911 | Bacteria | 7729 |
| 1046 | Ga0496108_0010249 | 3300048911 | Bacteria | 7608 |
| 1047 | Ga0496108_0018453 | 3300048911 | Bacteria | 5711 |
| 1048 | Ga0496108_0030309 | 3300048911 | Bacteria | 4483 |
| 1049 | Ga0496108_0384046 | 3300048911 | Bacteria | 1226 |
| 1050 | Ga0496108_0406643 | 3300048911 | Bacteria | 1189 |
| 1051 | Ga0496108_0593903 | 3300048911 | Bacteria | 965 |
| 1052 | Ga0496109_0002664 | 3300048912 | Bacteria | 14980 |
| 1053 | Ga0496109_0003753 | 3300048912 | Bacteria | 12693 |
| 1054 | Ga0496109_0011893 | 3300048912 | Bacteria | 7492 |
| 1055 | Ga0496109_0024484 | 3300048912 | Bacteria | 5367 |
| 1056 | Ga0496109_0071267 | 3300048912 | Bacteria | 3190 |
| 1057 | Ga0496109_0077082 | 3300048912 | Bacteria | 3067 |
| 1058 | Ga0496109_0368632 | 3300048912 | Bacteria | 1357 |
| 1059 | Ga0496109_0423908 | 3300048912 | Bacteria | 1257 |
| 1060 | Ga0496109_0448446 | 3300048912 | Unclassified | 1219 |
| 1061 | Ga0496110_0000607 | 3300048913 | Bacteria | 24647 |
| 1062 | Ga0496110_0000686 | 3300048913 | Bacteria | 23305 |
| 1063 | Ga0496110_0001231 | 3300048913 | Bacteria | 18265 |
| 1064 | Ga0496110_0002554 | 3300048913 | Bacteria | 13680 |
| 1065 | Ga0496110_0007796 | 3300048913 | Bacteria | 8578 |
| 1066 | Ga0496110_0028638 | 3300048913 | Bacteria | 4786 |
| 1067 | Ga0496110_0041397 | 3300048913 | Bacteria | 4020 |
| 1068 | Ga0496110_0260112 | 3300048913 | Bacteria | 1580 |
| 1069 | Ga0496110_0299571 | 3300048913 | Unclassified | 1464 |
| 1070 | Ga0496110_0490635 | 3300048913 | Unclassified | 1119 |
| 1071 | Ga0496110_1638309 | 3300048913 | Bacteria | 553 |
| 1072 | Ga0496111_0000143 | 3300048914 | Bacteria | 32058 |
| 1073 | Ga0496111_0000268 | 3300048914 | Bacteria | 25447 |
| 1074 | Ga0496111_0001049 | 3300048914 | Bacteria | 15218 |
| 1075 | Ga0496111_0002012 | 3300048914 | Bacteria | 12086 |
| 1076 | Ga0496111_0021403 | 3300048914 | Bacteria | 4515 |
| 1077 | Ga0496111_0028084 | 3300048914 | Bacteria | 3985 |
| 1078 | Ga0496111_0054535 | 3300048914 | Bacteria | 2890 |
| 1079 | Ga0496111_0087209 | 3300048914 | Bacteria | 2284 |
| 1080 | Ga0496111_0126911 | 3300048914 | Bacteria | 1886 |
| 1081 | Ga0496112_0008601 | 3300048915 | Bacteria | 9148 |
| 1082 | Ga0496112_0018951 | 3300048915 | Bacteria | 6486 |
| 1083 | Ga0496112_0021571 | 3300048915 | Bacteria | 6127 |
| 1084 | Ga0496112_0042473 | 3300048915 | Bacteria | 4448 |
| 1085 | Ga0496112_0044452 | 3300048915 | Bacteria | 4352 |
| 1086 | Ga0496112_0066637 | 3300048915 | Bacteria | 3553 |
| 1087 | Ga0496112_0079007 | 3300048915 | Bacteria | 3253 |
| 1088 | Ga0496112_0148963 | 3300048915 | Bacteria | 2307 |
| 1089 | Ga0496112_0282221 | 3300048915 | Bacteria | 1608 |
| 1090 | Ga0496112_1335654 | 3300048915 | Bacteria | 632 |
| 1091 | Ga0496112_1805120 | 3300048915 | Unclassified | 523 |
| 1092 | Ga0496113_0000470 | 3300048916 | Bacteria | 19761 |
| 1093 | Ga0496113_0002207 | 3300048916 | Bacteria | 11228 |
| 1094 | Ga0496113_0013465 | 3300048916 | Bacteria | 5543 |
| 1095 | Ga0496113_0029986 | 3300048916 | Bacteria | 3933 |
| 1096 | Ga0496113_0039515 | 3300048916 | Bacteria | 3473 |
| 1097 | Ga0496113_0070947 | 3300048916 | Bacteria | 2649 |
| 1098 | Ga0496113_0220859 | 3300048916 | Bacteria | 1510 |
| 1099 | Ga0496113_0623371 | 3300048916 | Bacteria | 863 |
| 1100 | Ga0496114_0007895 | 3300048917 | Bacteria | 8421 |
| 1101 | Ga0496114_0027671 | 3300048917 | Bacteria | 4646 |
| 1102 | Ga0496114_0028575 | 3300048917 | Bacteria | 4577 |
| 1103 | Ga0496114_0043115 | 3300048917 | Bacteria | 3742 |
| 1104 | Ga0496114_0056780 | 3300048917 | Bacteria | 3267 |
| 1105 | Ga0496114_0123569 | 3300048917 | Unclassified | 2228 |
| 1106 | Ga0496114_0218353 | 3300048917 | Bacteria | 1673 |
| 1107 | Ga0496114_0246748 | 3300048917 | Bacteria | 1571 |
| 1108 | Ga0496114_0327959 | 3300048917 | Bacteria | 1353 |
| 1109 | Ga0496114_0478742 | 3300048917 | Bacteria | 1101 |
| 1110 | Ga0496114_0748186 | 3300048917 | Unclassified | 855 |
| 1111 | Ga0496115_0010231 | 3300048918 | Bacteria | 6999 |
| 1112 | Ga0496115_0121230 | 3300048918 | Bacteria | 2152 |
| 1113 | Ga0496115_0174698 | 3300048918 | Bacteria | 1776 |
| 1114 | Ga0496115_0555712 | 3300048918 | Unclassified | 917 |
| 1115 | Ga0496115_0571458 | 3300048918 | Bacteria | 902 |
| 1116 | Ga0496115_0631093 | 3300048918 | Bacteria | 849 |
| 1117 | Ga0501306_060129 | 3300049127 | Unclassified | 625 |
| 1118 | Ga0501308_055440 | 3300049128 | Unclassified | 588 |
| 1119 | Ga0501309_043998 | 3300049129 | Unclassified | 688 |
| 1120 | Ga0501310_023288 | 3300049130 | Unclassified | 787 |
| 1121 | Ga0501305_096812 | 3300049161 | Unclassified | 546 |
| 1122 | Ga0501315_069655 | 3300049531 | Bacteria | 582 |
| 1123 | Ga0501315_075734 | 3300049531 | Unclassified | 565 |
| 1124 | Ga0501316_067455 | 3300049532 | Unclassified | 537 |
| 1125 | Ga0501317_081759 | 3300049533 | Unclassified | 560 |
| 1126 | Ga0501320_031813 | 3300049536 | Unclassified | 660 |
| 1127 | Ga0501323_026410 | 3300049539 | Unclassified | 795 |
| 1128 | Ga0501031_0020421 | 3300049568 | Bacteria | 4317 |
| 1129 | Ga0501031_0032228 | 3300049568 | Bacteria | 3417 |
| 1130 | Ga0501032_0083039 | 3300049569 | Bacteria | 2131 |
| 1131 | Ga0501032_0106525 | 3300049569 | Bacteria | 1857 |
| 1132 | Ga0501033_0201019 | 3300049570 | Bacteria | 1423 |
| 1133 | Ga0501033_0299050 | 3300049570 | Bacteria | 1133 |
| 1134 | Ga0501036_0008154 | 3300049572 | Bacteria | 8585 |
| 1135 | Ga0501036_0017361 | 3300049572 | Bacteria | 6016 |
| 1136 | Ga0501036_0221940 | 3300049572 | Bacteria | 1587 |
| 1137 | Ga0501036_0337426 | 3300049572 | Bacteria | 1259 |
| 1138 | Ga0501037_0072648 | 3300049573 | Bacteria | 2502 |
| 1139 | Ga0501037_0301661 | 3300049573 | Unclassified | 1112 |
| 1140 | Ga0501038_0075580 | 3300049574 | Bacteria | 2847 |
| 1141 | Ga0501038_0179785 | 3300049574 | Bacteria | 1707 |
| 1142 | Ga0501038_0463156 | 3300049574 | Unclassified | 973 |
| 1143 | Ga0501039_0020102 | 3300049575 | Bacteria | 5119 |
| 1144 | Ga0501039_0022610 | 3300049575 | Bacteria | 4826 |
| 1145 | Ga0501040_0011235 | 3300049576 | Bacteria | 5860 |
| 1146 | Ga0501040_0029428 | 3300049576 | Bacteria | 3707 |
| 1147 | Ga0501041_0025936 | 3300049577 | Bacteria | 3524 |
| 1148 | Ga0501041_0033827 | 3300049577 | Bacteria | 3093 |
| 1149 | Ga0501041_0186573 | 3300049577 | Bacteria | 1299 |
| 1150 | Ga0501042_0004455 | 3300049578 | Bacteria | 8929 |
| 1151 | Ga0501042_0109780 | 3300049578 | Unclassified | 1986 |
| 1152 | Ga0501042_0213008 | 3300049578 | Unclassified | 1394 |
| 1153 | Ga0501043_0068569 | 3300049579 | Bacteria | 2785 |
| 1154 | Ga0501046_0034103 | 3300049580 | Bacteria | 4110 |
| 1155 | Ga0501046_0045758 | 3300049580 | Bacteria | 3475 |
| 1156 | Ga0501046_0157286 | 3300049580 | Bacteria | 1711 |
| 1157 | Ga0501047_0063063 | 3300049581 | Bacteria | 3575 |
| 1158 | Ga0501048_0006233 | 3300049582 | Bacteria | 9070 |
| 1159 | Ga0501048_0026410 | 3300049582 | Bacteria | 4228 |
| 1160 | Ga0501067_0016472 | 3300049583 | Bacteria | 4083 |
| 1161 | Ga0501067_0085329 | 3300049583 | Bacteria | 1752 |
| 1162 | Ga0501067_0215463 | 3300049583 | Bacteria | 1069 |
| 1163 | Ga0501067_0297180 | 3300049583 | Bacteria | 899 |
| 1164 | Ga0501068_0010140 | 3300049584 | Bacteria | 5286 |
| 1165 | Ga0501069_0035516 | 3300049585 | Unclassified | 2747 |
| 1166 | Ga0501069_0090960 | 3300049585 | Bacteria | 1726 |
| 1167 | Ga0501069_0189362 | 3300049585 | Unclassified | 1190 |
| 1168 | Ga0501070_0003032 | 3300049586 | Bacteria | 14629 |
| 1169 | Ga0501070_0244857 | 3300049586 | Bacteria | 1467 |
| 1170 | Ga0501070_0981713 | 3300049586 | Unclassified | 656 |
| 1171 | Ga0501071_0006130 | 3300049587 | Bacteria | 7793 |
| 1172 | Ga0501071_0015906 | 3300049587 | Bacteria | 5167 |
| 1173 | Ga0501072_0005956 | 3300049588 | Bacteria | 9289 |
| 1174 | Ga0501072_0040149 | 3300049588 | Bacteria | 3674 |
| 1175 | Ga0501073_0180700 | 3300049589 | Bacteria | 1460 |
| 1176 | Ga0501073_0346123 | 3300049589 | Bacteria | 1026 |
| 1177 | Ga0501073_0363800 | 3300049589 | Bacteria | 999 |
| 1178 | Ga0501074_0169548 | 3300049590 | Bacteria | 1558 |
| 1179 | Ga0501074_0250499 | 3300049590 | Bacteria | 1259 |
| 1180 | Ga0501074_0333684 | 3300049590 | Bacteria | 1076 |
| 1181 | Ga0501075_0021603 | 3300049591 | Bacteria | 4693 |
| 1182 | Ga0501075_0259293 | 3300049591 | Bacteria | 1325 |
| 1183 | Ga0501076_0057189 | 3300049592 | Bacteria | 3096 |
| 1184 | Ga0501076_0073176 | 3300049592 | Bacteria | 2743 |
| 1185 | Ga0501076_0105910 | 3300049592 | Bacteria | 2270 |
| 1186 | Ga0501076_0222880 | 3300049592 | Unclassified | 1541 |
| 1187 | Ga0501077_0018208 | 3300049593 | Bacteria | 4443 |
| 1188 | Ga0501077_0277573 | 3300049593 | Bacteria | 1066 |
| 1189 | Ga0501198_068694 | 3300049649 | Unclassified | 664 |
| 1190 | Ga0501079_0025083 | 3300049741 | Bacteria | 4573 |
| 1191 | Ga0501079_0027705 | 3300049741 | Bacteria | 4346 |
| 1192 | Ga0501079_0157032 | 3300049741 | Unclassified | 1773 |
| 1193 | Ga0501079_1082212 | 3300049741 | Bacteria | 632 |
| 1194 | Ga0501080_0037881 | 3300049742 | Bacteria | 4503 |
| 1195 | Ga0501080_0185783 | 3300049742 | Bacteria | 1911 |
| 1196 | Ga0501081_0005943 | 3300049743 | Bacteria | 7900 |
| 1197 | Ga0501081_0027124 | 3300049743 | Bacteria | 3866 |
| 1198 | Ga0501081_0034980 | 3300049743 | Bacteria | 3419 |
| 1199 | Ga0501081_0881278 | 3300049743 | Unclassified | 675 |
| 1200 | Ga0501081_1198079 | 3300049743 | Unclassified | 575 |
| 1201 | Ga0501265_027997 | 3300049762 | Unclassified | 798 |
| 1202 | Ga0501278_018503 | 3300049774 | Bacteria | 625 |
| 1203 | Ga0501035_0093061 | 3300049822 | Bacteria | 2652 |
| 1204 | Ga0501044_0320999 | 3300049823 | Bacteria | 1473 |
| 1205 | Ga0501045_0016680 | 3300049824 | Bacteria | 5217 |
| 1206 | Ga0501045_0049757 | 3300049824 | Bacteria | 3056 |
| 1207 | Ga0501045_0277173 | 3300049824 | Unclassified | 1248 |
| 1208 | Ga0501045_0435296 | 3300049824 | Unclassified | 975 |
| 1209 | nmdc:mga0yw44_170136_c1 | 3300050492 | Bacteria | 1430 |
| 1210 | nmdc:mga0yw44_995252_c1 | 3300050492 | Unclassified | 568 |
| 1211 | nmdc:mga05p37_14477_c1 | 3300050507 | Bacteria | 9471 |
| 1212 | nmdc:mga05p37_40586_c1 | 3300050507 | Bacteria | 5715 |
| 1213 | nmdc:mga05p37_741755_c1 | 3300050507 | Bacteria | 1084 |
| 1214 | nmdc:mga05p37_87023_c1 | 3300050507 | Unclassified | 3851 |
| 1215 | nmdc:mga09592_184067_c1 | 3300050508 | Bacteria | 1807 |
| 1216 | nmdc:mga09592_242266_c1 | 3300050508 | Bacteria | 1562 |
| 1217 | nmdc:mga09592_409810_c1 | 3300050508 | Bacteria | 1171 |
| 1218 | nmdc:mga0qj67_497499_c1 | 3300050509 | Bacteria | 980 |
| 1219 | nmdc:mga08y16_133018_c1 | 3300050511 | Bacteria | 2585 |
| 1220 | nmdc:mga08y16_1892509_c1 | 3300050511 | Unclassified | 548 |
| 1221 | nmdc:mga08y16_425406_c1 | 3300050511 | Unclassified | 1357 |
| 1222 | nmdc:mga0n895_1242399_c1 | 3300050512 | Bacteria | 718 |
| 1223 | nmdc:mga0n895_1537_c1 | 3300050512 | Bacteria | 17340 |
| 1224 | nmdc:mga0n895_45890_c1 | 3300050512 | Bacteria | 4267 |
| 1225 | nmdc:mga0n895_538713_c1 | 3300050512 | Bacteria | 1174 |
| 1226 | nmdc:mga0n895_611918_c1 | 3300050512 | Unclassified | 1091 |
| 1227 | nmdc:mga0n895_906346_c1 | 3300050512 | Unclassified | 867 |
| 1228 | nmdc:mga0rr50_1704978_c1 | 3300050513 | Bacteria | 531 |
| 1229 | nmdc:mga0rr50_189532_c1 | 3300050513 | Bacteria | 1684 |
| 1230 | nmdc:mga0rr50_3988_c1 | 3300050513 | Bacteria | 8601 |
| 1231 | nmdc:mga0rr50_45176_c1 | 3300050513 | Bacteria | 3236 |
| 1232 | nmdc:mga0rr50_545237_c1 | 3300050513 | Bacteria | 987 |
| 1233 | nmdc:mga0rr50_76299_c1 | 3300050513 | Bacteria | 2573 |
| 1234 | nmdc:mga08x19_110110_c1 | 3300050514 | Bacteria | 1836 |
| 1235 | nmdc:mga08x19_593749_c1 | 3300050514 | Unclassified | 785 |
| 1236 | nmdc:mga0a205_1355381_c1 | 3300050515 | Unclassified | 559 |
| 1237 | nmdc:mga0a205_53447_c1 | 3300050515 | Bacteria | 3899 |
| 1238 | nmdc:mga0a205_615555_c1 | 3300050515 | Bacteria | 938 |
| 1239 | nmdc:mga0a205_70334_c1 | 3300050515 | Bacteria | 3378 |
| 1240 | nmdc:mga0a205_719512_c1 | 3300050515 | Unclassified | 848 |
| 1241 | nmdc:mga0a205_9777_c1 | 3300050515 | Bacteria | 8790 |
| 1242 | Ga0495601_0012146 | 3300053077 | Bacteria | 5163 |
| 1243 | Ga0495612_0014933 | 3300053078 | Bacteria | 3115 |
| 1244 | Ga0495655_0121409 | 3300053083 | Bacteria | 796 |
| 1245 | Ga0495595_0300059 | 3300053084 | Bacteria | 808 |
| 1246 | Ga0495619_0002360 | 3300053085 | Bacteria | 12420 |
| 1247 | Ga0495619_0022723 | 3300053085 | Bacteria | 4016 |
| 1248 | Ga0501084_0007712 | 3300054114 | Bacteria | 8867 |
| 1249 | Ga0501084_0011070 | 3300054114 | Bacteria | 7469 |
| 1250 | Ga0501084_0065323 | 3300054114 | Bacteria | 3044 |
| 1251 | Ga0590074_048561 | 3300059423 | Bacteria | 774 |
| 1252 | Ga0590075_021758 | 3300059424 | Unclassified | 1602 |
| 1253 | Ga0590075_027704 | 3300059424 | Bacteria | 1430 |
| 1254 | Ga0590077_077850 | 3300059426 | Unclassified | 762 |
| 1255 | Ga0587066_073763 | 3300059490 | Unclassified | 724 |
| 1256 | Ga0587066_155087 | 3300059490 | Bacteria | 571 |
| 1257 | Ga0587073_0148781 | 3300059492 | Unclassified | 660 |
| 1258 | Ga0587077_077747 | 3300059493 | Unclassified | 755 |
| 1259 | Ga0587077_223962 | 3300059493 | Unclassified | 532 |
| 1260 | Ga0587080_028064 | 3300059503 | Unclassified | 964 |
| 1261 | Ga0587082_139217 | 3300059504 | Unclassified | 564 |
| 1262 | Ga0587083_0123187 | 3300059505 | Unclassified | 672 |
| 1263 | Ga0587085_062516 | 3300059506 | Bacteria | 708 |
| 1264 | Ga0587086_098774 | 3300059507 | Unclassified | 536 |
| 1265 | Ga0587106_050627 | 3300059605 | Unclassified | 735 |
| 1266 | Ga0587106_087329 | 3300059605 | Bacteria | 617 |
| 1267 | Ga0587106_109255 | 3300059605 | Bacteria | 574 |
| 1268 | Ga0587106_127851 | 3300059605 | Unclassified | 546 |
| 1269 | Ga0587129_014405 | 3300059608 | Bacteria | 650 |
| 1270 | Ga0587099_029092 | 3300059622 | Unclassified | 663 |
| 1271 | Ga0587115_079294 | 3300059626 | Bacteria | 579 |
| 1272 | Ga0587128_068964 | 3300059630 | Unclassified | 685 |
| 1273 | Ga0587128_104308 | 3300059630 | Bacteria | 598 |
| 1274 | Ga0587067_170253 | 3300059640 | Unclassified | 560 |
| 1275 | Ga0587068_155730 | 3300059641 | Bacteria | 520 |
| 1276 | Ga0587107_090601 | 3300059652 | Unclassified | 590 |
| 1277 | Ga0587107_110129 | 3300059652 | Unclassified | 556 |
| 1278 | Ga0587114_035893 | 3300059655 | Bacteria | 782 |
| 1279 | Ga0587114_074001 | 3300059655 | Unclassified | 622 |
| 1280 | Ga0587114_077394 | 3300059655 | Unclassified | 613 |
| 1281 | Ga0587114_098672 | 3300059655 | Unclassified | 567 |
| 1282 | Ga0587071_121864 | 3300060344 | Bacteria | 624 |
| 1283 | Ga0587111_0213790 | 3300060346 | Unclassified | 553 |
| 1284 | Ga0501082_0047529 | 3300060353 | Bacteria | 3698 |
| 1285 | Ga0501082_0059270 | 3300060353 | Bacteria | 3299 |
| 1286 | Ga0501082_0728445 | 3300060353 | Bacteria | 868 |
| 1287 | Ga0501082_0790364 | 3300060353 | Bacteria | 830 |
| 1288 | Ga0466962_0011131 | 3300061719 | Bacteria | 4329 |
| 1289 | Ga0466962_0015403 | 3300061719 | Unclassified | 3686 |
| 1290 | Ga0466962_0099199 | 3300061719 | Bacteria | 1398 |
| 1291 | Ga0466962_0111257 | 3300061719 | Unclassified | 1318 |
| 1292 | Ga0530510_0004115 | 3300061734 | Bacteria | 10040 |
| 1293 | Ga0530510_0004914 | 3300061734 | Bacteria | 9234 |
| 1294 | Ga0530510_0560488 | 3300061734 | Bacteria | 868 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0684805 | Ga0373935_0684805_26_457 | 143 |
| 2 | 3300046517 | Ga0495630_0682969 | Ga0495630_0682969_23_454 | 143 |
| 3 | 3300049572 | Ga0501036_0221940 | Ga0501036_0221940_99_545 | 146 |
| 4 | 3300049577 | Ga0501041_0186573 | Ga0501041_0186573_706_1152 | 146 |
| 5 | 3300049591 | Ga0501075_0259293 | Ga0501075_0259293_702_1148 | 146 |
| 6 | 3300049592 | Ga0501076_0105910 | Ga0501076_0105910_560_1006 | 146 |
| 7 | 3300046523 | Ga0495644_0093325 | Ga0495644_0093325_384_869 | 147 |
| 8 | 3300003373 | JGI25407J50210_10002710 | JGI25407J50210_100027101 | 148 |
| 9 | 3300005468 | Ga0070707_100773229 | Ga0070707_1007732291 | 148 |
| 10 | 3300005981 | Ga0081538_10000810 | Ga0081538_1000081035 | 148 |
| 11 | 3300005981 | Ga0081538_10029132 | Ga0081538_100291324 | 148 |
| 12 | 3300005981 | Ga0081538_10101464 | Ga0081538_101014642 | 148 |
| 13 | 3300005981 | Ga0081538_10264360 | Ga0081538_102643601 | 148 |
| 14 | 3300009094 | Ga0111539_10043756 | Ga0111539_100437562 | 148 |
| 15 | 3300009148 | Ga0105243_11057786 | Ga0105243_110577862 | 148 |
| 16 | 3300012480 | Ga0157346_1002678 | Ga0157346_10026781 | 148 |
| 17 | 3300020078 | Ga0206352_10477607 | Ga0206352_104776071 | 148 |
| 18 | 3300025906 | Ga0207699_11241337 | Ga0207699_112413371 | 148 |
| 19 | 3300025910 | Ga0207684_10645521 | Ga0207684_106455212 | 148 |
| 20 | 3300025918 | Ga0207662_10181976 | Ga0207662_101819761 | 148 |
| 21 | 3300025922 | Ga0207646_10099005 | Ga0207646_100990051 | 148 |
| 22 | 3300025922 | Ga0207646_10641640 | Ga0207646_106416402 | 148 |
| 23 | 3300025929 | Ga0207664_10404125 | Ga0207664_104041252 | 148 |
| 24 | 3300025929 | Ga0207664_11349453 | Ga0207664_113494531 | 148 |
| 25 | 3300026067 | Ga0207678_10826522 | Ga0207678_108265222 | 148 |
| 26 | 3300031548 | Ga0307408_100816795 | Ga0307408_1008167952 | 148 |
| 27 | 3300032002 | Ga0307416_100653652 | Ga0307416_1006536522 | 148 |
| 28 | 3300035118 | Ga0373954_0327878 | Ga0373954_0327878_160_606 | 148 |
| 29 | 3300037418 | Ga0395900_0020761 | Ga0395900_0020761_3288_3734 | 148 |
| 30 | 3300037466 | Ga0395898_0059109 | Ga0395898_0059109_1190_1636 | 148 |
| 31 | 3300037471 | Ga0395905_0774761 | Ga0395905_0774761_271_717 | 148 |
| 32 | 3300038443 | Ga0395901_0006450 | Ga0395901_0006450_1454_1900 | 148 |
| 33 | 3300044712 | Ga0453684_2444840 | Ga0453684_2444840_46_492 | 148 |
| 34 | 3300045976 | Ga0466967_0349891 | Ga0466967_0349891_367_813 | 148 |
| 35 | 3300046475 | Ga0495639_0091609 | Ga0495639_0091609_104_550 | 148 |
| 36 | 3300046491 | Ga0495584_0209392 | Ga0495584_0209392_514_960 | 148 |
| 37 | 3300046492 | Ga0495585_0446738 | Ga0495585_0446738_59_544 | 148 |
| 38 | 3300046523 | Ga0495644_0093176 | Ga0495644_0093176_81_527 | 148 |
| 39 | 3300046528 | Ga0495642_0241587 | Ga0495642_0241587_59_505 | 148 |
| 40 | 3300046529 | Ga0495652_0709931 | Ga0495652_0709931_24_470 | 148 |
| 41 | 3300046536 | Ga0495587_0339430 | Ga0495587_0339430_369_815 | 148 |
| 42 | 3300046537 | Ga0495598_0172318 | Ga0495598_0172318_196_642 | 148 |
| 43 | 3300046664 | Ga0495659_0067505 | Ga0495659_0067505_759_1205 | 148 |
| 44 | 3300046683 | Ga0495658_0416658 | Ga0495658_0416658_319_765 | 148 |
| 45 | 3300046683 | Ga0495658_0895582 | Ga0495658_0895582_48_494 | 148 |
| 46 | 3300047317 | Ga0495604_0836995 | Ga0495604_0836995_97_543 | 148 |
| 47 | 3300047318 | Ga0495636_0168407 | Ga0495636_0168407_346_831 | 148 |
| 48 | 3300047322 | Ga0495680_0304064 | Ga0495680_0304064_13_459 | 148 |
| 49 | 3300047322 | Ga0495680_0517406 | Ga0495680_0517406_166_612 | 148 |
| 50 | 3300047445 | Ga0495677_0234197 | Ga0495677_0234197_162_608 | 148 |
| 51 | 3300047471 | Ga0495684_0229576 | Ga0495684_0229576_847_1293 | 148 |
| 52 | 3300048905 | Ga0496102_0041411 | Ga0496102_0041411_127_573 | 148 |
| 53 | 3300048912 | Ga0496109_0448446 | Ga0496109_0448446_139_585 | 148 |
| 54 | 3300049536 | Ga0501320_031813 | Ga0501320_031813_39_491 | 148 |
| 55 | 3300050512 | nmdc:mga0n895_538713_c1 | nmdc:mga0n895_538713_c1_186_632 | 148 |
| 56 | 3300050515 | nmdc:mga0a205_719512_c1 | nmdc:mga0a205_719512_c1_312_758 | 148 |
| 57 | 3300053085 | Ga0495619_0022723 | Ga0495619_0022723_1664_2110 | 148 |
| 58 | 3300059605 | Ga0587106_087329 | Ga0587106_087329_16_462 | 148 |
| 59 | 3300059626 | Ga0587115_079294 | Ga0587115_079294_96_542 | 148 |
| 60 | 3300059641 | Ga0587068_155730 | Ga0587068_155730_61_507 | 148 |
| 61 | 3300059655 | Ga0587114_077394 | Ga0587114_077394_12_458 | 148 |
| 62 | 3300003659 | JGI25404J52841_10066359 | JGI25404J52841_100663591 | 149 |
| 63 | 3300003693 | Ga0032354_1082681 | Ga0032354_10826811 | 149 |
| 64 | 3300003693 | Ga0032354_1108405 | Ga0032354_11084052 | 149 |
| 65 | 3300005327 | Ga0070658_10001819 | Ga0070658_100018199 | 149 |
| 66 | 3300005327 | Ga0070658_10014355 | Ga0070658_100143552 | 149 |
| 67 | 3300005327 | Ga0070658_10126046 | Ga0070658_101260462 | 149 |
| 68 | 3300005327 | Ga0070658_10127295 | Ga0070658_101272953 | 149 |
| 69 | 3300005328 | Ga0070676_10216600 | Ga0070676_102166002 | 149 |
| 70 | 3300005328 | Ga0070676_10776798 | Ga0070676_107767981 | 149 |
| 71 | 3300005329 | Ga0070683_100032427 | Ga0070683_1000324272 | 149 |
| 72 | 3300005329 | Ga0070683_100062845 | Ga0070683_1000628452 | 149 |
| 73 | 3300005329 | Ga0070683_100146815 | Ga0070683_1001468152 | 149 |
| 74 | 3300005329 | Ga0070683_100225095 | Ga0070683_1002250953 | 149 |
| 75 | 3300005329 | Ga0070683_100313875 | Ga0070683_1003138752 | 149 |
| 76 | 3300005329 | Ga0070683_100350081 | Ga0070683_1003500812 | 149 |
| 77 | 3300005329 | Ga0070683_100372723 | Ga0070683_1003727232 | 149 |
| 78 | 3300005329 | Ga0070683_100512039 | Ga0070683_1005120392 | 149 |
| 79 | 3300005329 | Ga0070683_100517869 | Ga0070683_1005178692 | 149 |
| 80 | 3300005329 | Ga0070683_100776781 | Ga0070683_1007767811 | 149 |
| 81 | 3300005336 | Ga0070680_100061142 | Ga0070680_1000611422 | 149 |
| 82 | 3300005336 | Ga0070680_100089572 | Ga0070680_1000895722 | 149 |
| 83 | 3300005336 | Ga0070680_100132794 | Ga0070680_1001327943 | 149 |
| 84 | 3300005336 | Ga0070680_100290523 | Ga0070680_1002905231 | 149 |
| 85 | 3300005337 | Ga0070682_100049194 | Ga0070682_1000491945 | 149 |
| 86 | 3300005337 | Ga0070682_100056442 | Ga0070682_1000564422 | 149 |
| 87 | 3300005337 | Ga0070682_100222048 | Ga0070682_1002220482 | 149 |
| 88 | 3300005337 | Ga0070682_100498976 | Ga0070682_1004989761 | 149 |
| 89 | 3300005338 | Ga0068868_100110320 | Ga0068868_1001103202 | 149 |
| 90 | 3300005338 | Ga0068868_100138734 | Ga0068868_1001387342 | 149 |
| 91 | 3300005338 | Ga0068868_100682899 | Ga0068868_1006828991 | 149 |
| 92 | 3300005339 | Ga0070660_100004585 | Ga0070660_1000045853 | 149 |
| 93 | 3300005339 | Ga0070660_100004801 | Ga0070660_1000048015 | 149 |
| 94 | 3300005339 | Ga0070660_100050409 | Ga0070660_1000504093 | 149 |
| 95 | 3300005339 | Ga0070660_100421334 | Ga0070660_1004213342 | 149 |
| 96 | 3300005339 | Ga0070660_100439551 | Ga0070660_1004395512 | 149 |
| 97 | 3300005341 | Ga0070691_10074100 | Ga0070691_100741002 | 149 |
| 98 | 3300005341 | Ga0070691_10083985 | Ga0070691_100839852 | 149 |
| 99 | 3300005341 | Ga0070691_10157872 | Ga0070691_101578722 | 149 |
| 100 | 3300005341 | Ga0070691_10333396 | Ga0070691_103333962 | 149 |
| 101 | 3300005343 | Ga0070687_100333633 | Ga0070687_1003336331 | 149 |
| 102 | 3300005344 | Ga0070661_100192041 | Ga0070661_1001920412 | 149 |
| 103 | 3300005344 | Ga0070661_100211506 | Ga0070661_1002115062 | 149 |
| 104 | 3300005344 | Ga0070661_100352031 | Ga0070661_1003520311 | 149 |
| 105 | 3300005345 | Ga0070692_10187145 | Ga0070692_101871452 | 149 |
| 106 | 3300005345 | Ga0070692_10358636 | Ga0070692_103586362 | 149 |
| 107 | 3300005345 | Ga0070692_10783232 | Ga0070692_107832321 | 149 |
| 108 | 3300005347 | Ga0070668_100012108 | Ga0070668_1000121084 | 149 |
| 109 | 3300005354 | Ga0070675_100490648 | Ga0070675_1004906483 | 149 |
| 110 | 3300005354 | Ga0070675_100996960 | Ga0070675_1009969601 | 149 |
| 111 | 3300005355 | Ga0070671_101200608 | Ga0070671_1012006081 | 149 |
| 112 | 3300005356 | Ga0070674_100193562 | Ga0070674_1001935622 | 149 |
| 113 | 3300005366 | Ga0070659_100088578 | Ga0070659_1000885781 | 149 |
| 114 | 3300005366 | Ga0070659_100137328 | Ga0070659_1001373282 | 149 |
| 115 | 3300005366 | Ga0070659_100744459 | Ga0070659_1007444592 | 149 |
| 116 | 3300005434 | Ga0070709_10014260 | Ga0070709_100142602 | 149 |
| 117 | 3300005434 | Ga0070709_10684574 | Ga0070709_106845741 | 149 |
| 118 | 3300005435 | Ga0070714_100007622 | Ga0070714_1000076224 | 149 |
| 119 | 3300005435 | Ga0070714_100014641 | Ga0070714_1000146413 | 149 |
| 120 | 3300005435 | Ga0070714_100044213 | Ga0070714_1000442133 | 149 |
| 121 | 3300005435 | Ga0070714_100068376 | Ga0070714_1000683762 | 149 |
| 122 | 3300005435 | Ga0070714_100616671 | Ga0070714_1006166711 | 149 |
| 123 | 3300005435 | Ga0070714_101618144 | Ga0070714_1016181441 | 149 |
| 124 | 3300005436 | Ga0070713_100032009 | Ga0070713_1000320093 | 149 |
| 125 | 3300005437 | Ga0070710_10004520 | Ga0070710_100045203 | 149 |
| 126 | 3300005438 | Ga0070701_10282822 | Ga0070701_102828221 | 149 |
| 127 | 3300005439 | Ga0070711_100004518 | Ga0070711_1000045184 | 149 |
| 128 | 3300005439 | Ga0070711_100099146 | Ga0070711_1000991462 | 149 |
| 129 | 3300005439 | Ga0070711_100787571 | Ga0070711_1007875711 | 149 |
| 130 | 3300005441 | Ga0070700_100526794 | Ga0070700_1005267942 | 149 |
| 131 | 3300005445 | Ga0070708_100290219 | Ga0070708_1002902192 | 149 |
| 132 | 3300005445 | Ga0070708_100776206 | Ga0070708_1007762062 | 149 |
| 133 | 3300005445 | Ga0070708_101389761 | Ga0070708_1013897611 | 149 |
| 134 | 3300005455 | Ga0070663_100041208 | Ga0070663_1000412081 | 149 |
| 135 | 3300005456 | Ga0070678_100006809 | Ga0070678_1000068093 | 149 |
| 136 | 3300005456 | Ga0070678_100140005 | Ga0070678_1001400053 | 149 |
| 137 | 3300005456 | Ga0070678_100294679 | Ga0070678_1002946792 | 149 |
| 138 | 3300005456 | Ga0070678_101040183 | Ga0070678_1010401831 | 149 |
| 139 | 3300005457 | Ga0070662_100033036 | Ga0070662_1000330363 | 149 |
| 140 | 3300005457 | Ga0070662_100290693 | Ga0070662_1002906932 | 149 |
| 141 | 3300005458 | Ga0070681_10004088 | Ga0070681_1000408812 | 149 |
| 142 | 3300005458 | Ga0070681_10006514 | Ga0070681_100065149 | 149 |
| 143 | 3300005458 | Ga0070681_10027460 | Ga0070681_100274607 | 149 |
| 144 | 3300005458 | Ga0070681_10082772 | Ga0070681_100827724 | 149 |
| 145 | 3300005458 | Ga0070681_10193383 | Ga0070681_101933832 | 149 |
| 146 | 3300005458 | Ga0070681_10268838 | Ga0070681_102688382 | 149 |
| 147 | 3300005458 | Ga0070681_10283103 | Ga0070681_102831032 | 149 |
| 148 | 3300005458 | Ga0070681_10290488 | Ga0070681_102904882 | 149 |
| 149 | 3300005459 | Ga0068867_100368361 | Ga0068867_1003683612 | 149 |
| 150 | 3300005467 | Ga0070706_100614519 | Ga0070706_1006145192 | 149 |
| 151 | 3300005467 | Ga0070706_101311353 | Ga0070706_1013113531 | 149 |
| 152 | 3300005468 | Ga0070707_100103307 | Ga0070707_1001033071 | 149 |
| 153 | 3300005471 | Ga0070698_100040021 | Ga0070698_1000400212 | 149 |
| 154 | 3300005471 | Ga0070698_100065237 | Ga0070698_1000652372 | 149 |
| 155 | 3300005471 | Ga0070698_100372924 | Ga0070698_1003729242 | 149 |
| 156 | 3300005518 | Ga0070699_100486837 | Ga0070699_1004868372 | 149 |
| 157 | 3300005530 | Ga0070679_100182831 | Ga0070679_1001828312 | 149 |
| 158 | 3300005530 | Ga0070679_100196350 | Ga0070679_1001963502 | 149 |
| 159 | 3300005530 | Ga0070679_100262979 | Ga0070679_1002629792 | 149 |
| 160 | 3300005530 | Ga0070679_100282015 | Ga0070679_1002820152 | 149 |
| 161 | 3300005530 | Ga0070679_100295910 | Ga0070679_1002959102 | 149 |
| 162 | 3300005535 | Ga0070684_100000801 | Ga0070684_10000080121 | 149 |
| 163 | 3300005535 | Ga0070684_100102941 | Ga0070684_1001029413 | 149 |
| 164 | 3300005535 | Ga0070684_100692242 | Ga0070684_1006922422 | 149 |
| 165 | 3300005535 | Ga0070684_101147590 | Ga0070684_1011475901 | 149 |
| 166 | 3300005536 | Ga0070697_100221996 | Ga0070697_1002219962 | 149 |
| 167 | 3300005536 | Ga0070697_100662707 | Ga0070697_1006627071 | 149 |
| 168 | 3300005536 | Ga0070697_100750343 | Ga0070697_1007503431 | 149 |
| 169 | 3300005539 | Ga0068853_100321819 | Ga0068853_1003218192 | 149 |
| 170 | 3300005544 | Ga0070686_100139366 | Ga0070686_1001393662 | 149 |
| 171 | 3300005544 | Ga0070686_100150075 | Ga0070686_1001500752 | 149 |
| 172 | 3300005544 | Ga0070686_100225473 | Ga0070686_1002254732 | 149 |
| 173 | 3300005544 | Ga0070686_100690740 | Ga0070686_1006907401 | 149 |
| 174 | 3300005546 | Ga0070696_100263131 | Ga0070696_1002631312 | 149 |
| 175 | 3300005547 | Ga0070693_100007688 | Ga0070693_1000076883 | 149 |
| 176 | 3300005547 | Ga0070693_100021315 | Ga0070693_1000213155 | 149 |
| 177 | 3300005547 | Ga0070693_100034110 | Ga0070693_1000341102 | 149 |
| 178 | 3300005547 | Ga0070693_100677572 | Ga0070693_1006775721 | 149 |
| 179 | 3300005548 | Ga0070665_100226041 | Ga0070665_1002260412 | 149 |
| 180 | 3300005549 | Ga0070704_100048220 | Ga0070704_1000482205 | 149 |
| 181 | 3300005549 | Ga0070704_100475868 | Ga0070704_1004758681 | 149 |
| 182 | 3300005563 | Ga0068855_100025890 | Ga0068855_1000258901 | 149 |
| 183 | 3300005563 | Ga0068855_100091414 | Ga0068855_1000914142 | 149 |
| 184 | 3300005563 | Ga0068855_100118990 | Ga0068855_1001189901 | 149 |
| 185 | 3300005563 | Ga0068855_100746732 | Ga0068855_1007467323 | 149 |
| 186 | 3300005564 | Ga0070664_100281820 | Ga0070664_1002818202 | 149 |
| 187 | 3300005577 | Ga0068857_100379305 | Ga0068857_1003793052 | 149 |
| 188 | 3300005577 | Ga0068857_101107682 | Ga0068857_1011076822 | 149 |
| 189 | 3300005578 | Ga0068854_101065808 | Ga0068854_1010658081 | 149 |
| 190 | 3300005614 | Ga0068856_100100179 | Ga0068856_1001001794 | 149 |
| 191 | 3300005614 | Ga0068856_100166231 | Ga0068856_1001662311 | 149 |
| 192 | 3300005614 | Ga0068856_100350522 | Ga0068856_1003505222 | 149 |
| 193 | 3300005614 | Ga0068856_100563345 | Ga0068856_1005633452 | 149 |
| 194 | 3300005614 | Ga0068856_100836793 | Ga0068856_1008367932 | 149 |
| 195 | 3300005614 | Ga0068856_100852208 | Ga0068856_1008522081 | 149 |
| 196 | 3300005615 | Ga0070702_100666868 | Ga0070702_1006668681 | 149 |
| 197 | 3300005615 | Ga0070702_100707514 | Ga0070702_1007075141 | 149 |
| 198 | 3300005617 | Ga0068859_100830411 | Ga0068859_1008304111 | 149 |
| 199 | 3300005618 | Ga0068864_100148089 | Ga0068864_1001480893 | 149 |
| 200 | 3300005618 | Ga0068864_100592602 | Ga0068864_1005926022 | 149 |
| 201 | 3300005718 | Ga0068866_10332312 | Ga0068866_103323122 | 149 |
| 202 | 3300005719 | Ga0068861_100333020 | Ga0068861_1003330202 | 149 |
| 203 | 3300005719 | Ga0068861_100982220 | Ga0068861_1009822201 | 149 |
| 204 | 3300005840 | Ga0068870_10293364 | Ga0068870_102933641 | 149 |
| 205 | 3300005937 | Ga0081455_10001467 | Ga0081455_100014672 | 149 |
| 206 | 3300005937 | Ga0081455_10022972 | Ga0081455_100229722 | 149 |
| 207 | 3300005937 | Ga0081455_10026240 | Ga0081455_100262404 | 149 |
| 208 | 3300005937 | Ga0081455_10679134 | Ga0081455_106791341 | 149 |
| 209 | 3300005983 | Ga0081540_1006384 | Ga0081540_10063845 | 149 |
| 210 | 3300005983 | Ga0081540_1122615 | Ga0081540_11226152 | 149 |
| 211 | 3300005985 | Ga0081539_10002873 | Ga0081539_100028735 | 149 |
| 212 | 3300005985 | Ga0081539_10005502 | Ga0081539_1000550213 | 149 |
| 213 | 3300006028 | Ga0070717_10005916 | Ga0070717_100059163 | 149 |
| 214 | 3300006028 | Ga0070717_10023231 | Ga0070717_100232312 | 149 |
| 215 | 3300006028 | Ga0070717_10770812 | Ga0070717_107708121 | 149 |
| 216 | 3300006028 | Ga0070717_11477289 | Ga0070717_114772891 | 149 |
| 217 | 3300006163 | Ga0070715_10000547 | Ga0070715_100005472 | 149 |
| 218 | 3300006163 | Ga0070715_10016713 | Ga0070715_100167132 | 149 |
| 219 | 3300006173 | Ga0070716_100011977 | Ga0070716_1000119771 | 149 |
| 220 | 3300006175 | Ga0070712_100017518 | Ga0070712_1000175182 | 149 |
| 221 | 3300006175 | Ga0070712_100018807 | Ga0070712_1000188074 | 149 |
| 222 | 3300006175 | Ga0070712_100023644 | Ga0070712_1000236444 | 149 |
| 223 | 3300006175 | Ga0070712_100576012 | Ga0070712_1005760121 | 149 |
| 224 | 3300006237 | Ga0097621_100720388 | Ga0097621_1007203881 | 149 |
| 225 | 3300006358 | Ga0068871_100007707 | Ga0068871_1000077079 | 149 |
| 226 | 3300006358 | Ga0068871_100225830 | Ga0068871_1002258303 | 149 |
| 227 | 3300006358 | Ga0068871_100293750 | Ga0068871_1002937502 | 149 |
| 228 | 3300006844 | Ga0075428_100058891 | Ga0075428_1000588912 | 149 |
| 229 | 3300006844 | Ga0075428_100682551 | Ga0075428_1006825511 | 149 |
| 230 | 3300006844 | Ga0075428_100872540 | Ga0075428_1008725402 | 149 |
| 231 | 3300006846 | Ga0075430_100955344 | Ga0075430_1009553441 | 149 |
| 232 | 3300006847 | Ga0075431_100214819 | Ga0075431_1002148192 | 149 |
| 233 | 3300006852 | Ga0075433_10251602 | Ga0075433_102516022 | 149 |
| 234 | 3300006852 | Ga0075433_10353902 | Ga0075433_103539022 | 149 |
| 235 | 3300006852 | Ga0075433_10581390 | Ga0075433_105813902 | 149 |
| 236 | 3300006852 | Ga0075433_10816622 | Ga0075433_108166222 | 149 |
| 237 | 3300006852 | Ga0075433_11404369 | Ga0075433_114043691 | 149 |
| 238 | 3300006871 | Ga0075434_100007883 | Ga0075434_1000078833 | 149 |
| 239 | 3300006871 | Ga0075434_100619985 | Ga0075434_1006199852 | 149 |
| 240 | 3300006871 | Ga0075434_100725952 | Ga0075434_1007259522 | 149 |
| 241 | 3300006880 | Ga0075429_100266247 | Ga0075429_1002662472 | 149 |
| 242 | 3300006881 | Ga0068865_100153223 | Ga0068865_1001532232 | 149 |
| 243 | 3300006914 | Ga0075436_100013985 | Ga0075436_1000139853 | 149 |
| 244 | 3300006914 | Ga0075436_100177325 | Ga0075436_1001773253 | 149 |
| 245 | 3300006931 | Ga0097620_100830363 | Ga0097620_1008303631 | 149 |
| 246 | 3300007076 | Ga0075435_100042872 | Ga0075435_1000428725 | 149 |
| 247 | 3300007076 | Ga0075435_100212215 | Ga0075435_1002122153 | 149 |
| 248 | 3300007076 | Ga0075435_100659062 | Ga0075435_1006590621 | 149 |
| 249 | 3300007076 | Ga0075435_100730778 | Ga0075435_1007307782 | 149 |
| 250 | 3300009093 | Ga0105240_10022932 | Ga0105240_100229321 | 149 |
| 251 | 3300009093 | Ga0105240_10369245 | Ga0105240_103692453 | 149 |
| 252 | 3300009094 | Ga0111539_10056167 | Ga0111539_100561676 | 149 |
| 253 | 3300009094 | Ga0111539_10139905 | Ga0111539_101399055 | 149 |
| 254 | 3300009094 | Ga0111539_10523278 | Ga0111539_105232782 | 149 |
| 255 | 3300009094 | Ga0111539_10695973 | Ga0111539_106959732 | 149 |
| 256 | 3300009094 | Ga0111539_10765654 | Ga0111539_107656542 | 149 |
| 257 | 3300009098 | Ga0105245_10066849 | Ga0105245_100668492 | 149 |
| 258 | 3300009098 | Ga0105245_10239116 | Ga0105245_102391162 | 149 |
| 259 | 3300009147 | Ga0114129_10084137 | Ga0114129_100841372 | 149 |
| 260 | 3300009147 | Ga0114129_10105057 | Ga0114129_101050571 | 149 |
| 261 | 3300009147 | Ga0114129_10297667 | Ga0114129_102976672 | 149 |
| 262 | 3300009147 | Ga0114129_11533003 | Ga0114129_115330032 | 149 |
| 263 | 3300009147 | Ga0114129_11916082 | Ga0114129_119160821 | 149 |
| 264 | 3300009147 | Ga0114129_11996118 | Ga0114129_119961182 | 149 |
| 265 | 3300009148 | Ga0105243_10047204 | Ga0105243_100472043 | 149 |
| 266 | 3300009148 | Ga0105243_10089760 | Ga0105243_100897602 | 149 |
| 267 | 3300009148 | Ga0105243_10225630 | Ga0105243_102256302 | 149 |
| 268 | 3300009174 | Ga0105241_10155054 | Ga0105241_101550541 | 149 |
| 269 | 3300009174 | Ga0105241_10289162 | Ga0105241_102891622 | 149 |
| 270 | 3300009176 | Ga0105242_10232162 | Ga0105242_102321622 | 149 |
| 271 | 3300009177 | Ga0105248_10861225 | Ga0105248_108612252 | 149 |
| 272 | 3300009177 | Ga0105248_10926106 | Ga0105248_109261062 | 149 |
| 273 | 3300009551 | Ga0105238_10636068 | Ga0105238_106360681 | 149 |
| 274 | 3300009551 | Ga0105238_11044875 | Ga0105238_110448752 | 149 |
| 275 | 3300009553 | Ga0105249_10037375 | Ga0105249_100373752 | 149 |
| 276 | 3300010375 | Ga0105239_10299013 | Ga0105239_102990133 | 149 |
| 277 | 3300010375 | Ga0105239_10569539 | Ga0105239_105695392 | 149 |
| 278 | 3300010375 | Ga0105239_10602377 | Ga0105239_106023771 | 149 |
| 279 | 3300011119 | Ga0105246_10383420 | Ga0105246_103834201 | 149 |
| 280 | 3300012492 | Ga0157335_1003378 | Ga0157335_10033782 | 149 |
| 281 | 3300012495 | Ga0157323_1030873 | Ga0157323_10308731 | 149 |
| 282 | 3300012502 | Ga0157347_1035647 | Ga0157347_10356471 | 149 |
| 283 | 3300012505 | Ga0157339_1018751 | Ga0157339_10187511 | 149 |
| 284 | 3300013100 | Ga0157373_10867427 | Ga0157373_108674271 | 149 |
| 285 | 3300013104 | Ga0157370_10012656 | Ga0157370_100126562 | 149 |
| 286 | 3300013104 | Ga0157370_10015330 | Ga0157370_100153309 | 149 |
| 287 | 3300013105 | Ga0157369_10007224 | Ga0157369_1000722414 | 149 |
| 288 | 3300013105 | Ga0157369_10014831 | Ga0157369_100148312 | 149 |
| 289 | 3300013105 | Ga0157369_10085150 | Ga0157369_100851501 | 149 |
| 290 | 3300013105 | Ga0157369_10195732 | Ga0157369_101957322 | 149 |
| 291 | 3300013105 | Ga0157369_11080692 | Ga0157369_110806922 | 149 |
| 292 | 3300013296 | Ga0157374_11261068 | Ga0157374_112610681 | 149 |
| 293 | 3300013297 | Ga0157378_10345765 | Ga0157378_103457652 | 149 |
| 294 | 3300013306 | Ga0163162_10043186 | Ga0163162_100431863 | 149 |
| 295 | 3300013306 | Ga0163162_10790275 | Ga0163162_107902753 | 149 |
| 296 | 3300013307 | Ga0157372_11533161 | Ga0157372_115331611 | 149 |
| 297 | 3300013308 | Ga0157375_10084328 | Ga0157375_100843281 | 149 |
| 298 | 3300013308 | Ga0157375_10925021 | Ga0157375_109250211 | 149 |
| 299 | 3300014325 | Ga0163163_10095497 | Ga0163163_100954972 | 149 |
| 300 | 3300014325 | Ga0163163_10400628 | Ga0163163_104006282 | 149 |
| 301 | 3300014325 | Ga0163163_11614892 | Ga0163163_116148921 | 149 |
| 302 | 3300014326 | Ga0157380_10793471 | Ga0157380_107934711 | 149 |
| 303 | 3300014497 | Ga0182008_10001177 | Ga0182008_1000117726 | 149 |
| 304 | 3300014745 | Ga0157377_10547068 | Ga0157377_105470682 | 149 |
| 305 | 3300014745 | Ga0157377_10774238 | Ga0157377_107742381 | 149 |
| 306 | 3300014968 | Ga0157379_10322581 | Ga0157379_103225812 | 149 |
| 307 | 3300014968 | Ga0157379_10392585 | Ga0157379_103925852 | 149 |
| 308 | 3300014969 | Ga0157376_10024024 | Ga0157376_100240243 | 149 |
| 309 | 3300014969 | Ga0157376_12076602 | Ga0157376_120766021 | 149 |
| 310 | 3300014969 | Ga0157376_12847310 | Ga0157376_128473101 | 149 |
| 311 | 3300015261 | Ga0182006_1006406 | Ga0182006_10064068 | 149 |
| 312 | 3300015265 | Ga0182005_1246970 | Ga0182005_12469701 | 149 |
| 313 | 3300017792 | Ga0163161_10056959 | Ga0163161_100569592 | 149 |
| 314 | 3300017792 | Ga0163161_11054400 | Ga0163161_110544002 | 149 |
| 315 | 3300020069 | Ga0197907_10115781 | Ga0197907_101157811 | 149 |
| 316 | 3300020069 | Ga0197907_10259069 | Ga0197907_102590691 | 149 |
| 317 | 3300020069 | Ga0197907_10646087 | Ga0197907_106460871 | 149 |
| 318 | 3300020069 | Ga0197907_10816011 | Ga0197907_108160112 | 149 |
| 319 | 3300020069 | Ga0197907_10946676 | Ga0197907_109466761 | 149 |
| 320 | 3300020069 | Ga0197907_10989329 | Ga0197907_109893291 | 149 |
| 321 | 3300020069 | Ga0197907_10991756 | Ga0197907_109917562 | 149 |
| 322 | 3300020069 | Ga0197907_11235414 | Ga0197907_112354141 | 149 |
| 323 | 3300020070 | Ga0206356_11081805 | Ga0206356_1108180510 | 149 |
| 324 | 3300020070 | Ga0206356_11440917 | Ga0206356_114409171 | 149 |
| 325 | 3300020070 | Ga0206356_11539823 | Ga0206356_115398232 | 149 |
| 326 | 3300020070 | Ga0206356_11829134 | Ga0206356_118291341 | 149 |
| 327 | 3300020075 | Ga0206349_1032949 | Ga0206349_10329492 | 149 |
| 328 | 3300020075 | Ga0206349_1354224 | Ga0206349_13542241 | 149 |
| 329 | 3300020075 | Ga0206349_1781439 | Ga0206349_17814391 | 149 |
| 330 | 3300020076 | Ga0206355_1618283 | Ga0206355_16182831 | 149 |
| 331 | 3300020077 | Ga0206351_10087162 | Ga0206351_100871621 | 149 |
| 332 | 3300020077 | Ga0206351_10101498 | Ga0206351_101014981 | 149 |
| 333 | 3300020077 | Ga0206351_10280456 | Ga0206351_102804561 | 149 |
| 334 | 3300020077 | Ga0206351_10906755 | Ga0206351_109067551 | 149 |
| 335 | 3300020078 | Ga0206352_10598490 | Ga0206352_105984902 | 149 |
| 336 | 3300020078 | Ga0206352_10901676 | Ga0206352_109016761 | 149 |
| 337 | 3300020080 | Ga0206350_10440665 | Ga0206350_104406651 | 149 |
| 338 | 3300020080 | Ga0206350_10450772 | Ga0206350_104507721 | 149 |
| 339 | 3300020080 | Ga0206350_11170503 | Ga0206350_111705031 | 149 |
| 340 | 3300020080 | Ga0206350_11310057 | Ga0206350_113100571 | 149 |
| 341 | 3300020080 | Ga0206350_11330243 | Ga0206350_113302431 | 149 |
| 342 | 3300020081 | Ga0206354_10319059 | Ga0206354_103190592 | 149 |
| 343 | 3300020081 | Ga0206354_10365229 | Ga0206354_103652292 | 149 |
| 344 | 3300020081 | Ga0206354_10750390 | Ga0206354_107503901 | 149 |
| 345 | 3300020081 | Ga0206354_10951817 | Ga0206354_109518177 | 149 |
| 346 | 3300020082 | Ga0206353_10032922 | Ga0206353_100329223 | 149 |
| 347 | 3300020082 | Ga0206353_10535060 | Ga0206353_105350602 | 149 |
| 348 | 3300020082 | Ga0206353_10752732 | Ga0206353_107527329 | 149 |
| 349 | 3300020082 | Ga0206353_11042009 | Ga0206353_110420091 | 149 |
| 350 | 3300020082 | Ga0206353_11226669 | Ga0206353_112266692 | 149 |
| 351 | 3300020082 | Ga0206353_12050204 | Ga0206353_120502042 | 149 |
| 352 | 3300022467 | Ga0224712_10013713 | Ga0224712_100137133 | 149 |
| 353 | 3300022467 | Ga0224712_10052056 | Ga0224712_100520562 | 149 |
| 354 | 3300022467 | Ga0224712_10121293 | Ga0224712_101212932 | 149 |
| 355 | 3300022467 | Ga0224712_10123476 | Ga0224712_101234762 | 149 |
| 356 | 3300022467 | Ga0224712_10161701 | Ga0224712_101617012 | 149 |
| 357 | 3300022467 | Ga0224712_10218063 | Ga0224712_102180632 | 149 |
| 358 | 3300022467 | Ga0224712_10287472 | Ga0224712_102874722 | 149 |
| 359 | 3300022467 | Ga0224712_10337006 | Ga0224712_103370062 | 149 |
| 360 | 3300022467 | Ga0224712_10474398 | Ga0224712_104743981 | 149 |
| 361 | 3300025898 | Ga0207692_10006102 | Ga0207692_100061025 | 149 |
| 362 | 3300025898 | Ga0207692_10007669 | Ga0207692_100076692 | 149 |
| 363 | 3300025898 | Ga0207692_10037623 | Ga0207692_100376232 | 149 |
| 364 | 3300025901 | Ga0207688_10183390 | Ga0207688_101833902 | 149 |
| 365 | 3300025901 | Ga0207688_10257601 | Ga0207688_102576012 | 149 |
| 366 | 3300025901 | Ga0207688_10378901 | Ga0207688_103789011 | 149 |
| 367 | 3300025904 | Ga0207647_10290690 | Ga0207647_102906902 | 149 |
| 368 | 3300025905 | Ga0207685_10003503 | Ga0207685_100035033 | 149 |
| 369 | 3300025905 | Ga0207685_10107047 | Ga0207685_101070472 | 149 |
| 370 | 3300025906 | Ga0207699_10003899 | Ga0207699_100038993 | 149 |
| 371 | 3300025906 | Ga0207699_10343782 | Ga0207699_103437822 | 149 |
| 372 | 3300025906 | Ga0207699_10421329 | Ga0207699_104213292 | 149 |
| 373 | 3300025906 | Ga0207699_11100056 | Ga0207699_111000561 | 149 |
| 374 | 3300025909 | Ga0207705_10084855 | Ga0207705_100848552 | 149 |
| 375 | 3300025909 | Ga0207705_10210842 | Ga0207705_102108423 | 149 |
| 376 | 3300025911 | Ga0207654_10207302 | Ga0207654_102073021 | 149 |
| 377 | 3300025911 | Ga0207654_10948484 | Ga0207654_109484841 | 149 |
| 378 | 3300025912 | Ga0207707_10016358 | Ga0207707_100163583 | 149 |
| 379 | 3300025912 | Ga0207707_10020322 | Ga0207707_100203223 | 149 |
| 380 | 3300025912 | Ga0207707_10049357 | Ga0207707_100493572 | 149 |
| 381 | 3300025912 | Ga0207707_10162341 | Ga0207707_101623412 | 149 |
| 382 | 3300025912 | Ga0207707_10221587 | Ga0207707_102215871 | 149 |
| 383 | 3300025913 | Ga0207695_10019003 | Ga0207695_100190035 | 149 |
| 384 | 3300025913 | Ga0207695_10113884 | Ga0207695_101138842 | 149 |
| 385 | 3300025913 | Ga0207695_10502715 | Ga0207695_105027151 | 149 |
| 386 | 3300025913 | Ga0207695_10602076 | Ga0207695_106020761 | 149 |
| 387 | 3300025915 | Ga0207693_10001363 | Ga0207693_100013635 | 149 |
| 388 | 3300025915 | Ga0207693_10004643 | Ga0207693_1000464310 | 149 |
| 389 | 3300025916 | Ga0207663_10006026 | Ga0207663_100060262 | 149 |
| 390 | 3300025916 | Ga0207663_10033555 | Ga0207663_100335552 | 149 |
| 391 | 3300025917 | Ga0207660_10038322 | Ga0207660_100383222 | 149 |
| 392 | 3300025917 | Ga0207660_10055618 | Ga0207660_100556183 | 149 |
| 393 | 3300025917 | Ga0207660_10086730 | Ga0207660_100867301 | 149 |
| 394 | 3300025917 | Ga0207660_10141637 | Ga0207660_101416372 | 149 |
| 395 | 3300025919 | Ga0207657_10007552 | Ga0207657_100075528 | 149 |
| 396 | 3300025919 | Ga0207657_10011057 | Ga0207657_100110574 | 149 |
| 397 | 3300025919 | Ga0207657_10017756 | Ga0207657_100177565 | 149 |
| 398 | 3300025919 | Ga0207657_10026504 | Ga0207657_100265042 | 149 |
| 399 | 3300025919 | Ga0207657_10029871 | Ga0207657_100298715 | 149 |
| 400 | 3300025919 | Ga0207657_10114680 | Ga0207657_101146804 | 149 |
| 401 | 3300025919 | Ga0207657_11157163 | Ga0207657_111571631 | 149 |
| 402 | 3300025920 | Ga0207649_10250280 | Ga0207649_102502802 | 149 |
| 403 | 3300025920 | Ga0207649_10338527 | Ga0207649_103385271 | 149 |
| 404 | 3300025920 | Ga0207649_10532375 | Ga0207649_105323751 | 149 |
| 405 | 3300025920 | Ga0207649_10942008 | Ga0207649_109420081 | 149 |
| 406 | 3300025921 | Ga0207652_10043343 | Ga0207652_100433432 | 149 |
| 407 | 3300025921 | Ga0207652_10071212 | Ga0207652_100712125 | 149 |
| 408 | 3300025921 | Ga0207652_10154373 | Ga0207652_101543732 | 149 |
| 409 | 3300025921 | Ga0207652_10658753 | Ga0207652_106587531 | 149 |
| 410 | 3300025921 | Ga0207652_10705771 | Ga0207652_107057711 | 149 |
| 411 | 3300025921 | Ga0207652_10770337 | Ga0207652_107703372 | 149 |
| 412 | 3300025921 | Ga0207652_10963621 | Ga0207652_109636211 | 149 |
| 413 | 3300025922 | Ga0207646_10000835 | Ga0207646_1000083531 | 149 |
| 414 | 3300025922 | Ga0207646_10047954 | Ga0207646_100479543 | 149 |
| 415 | 3300025926 | Ga0207659_10375683 | Ga0207659_103756831 | 149 |
| 416 | 3300025927 | Ga0207687_10021405 | Ga0207687_100214052 | 149 |
| 417 | 3300025927 | Ga0207687_10032474 | Ga0207687_100324742 | 149 |
| 418 | 3300025927 | Ga0207687_10046895 | Ga0207687_100468952 | 149 |
| 419 | 3300025927 | Ga0207687_10625599 | Ga0207687_106255991 | 149 |
| 420 | 3300025928 | Ga0207700_10006703 | Ga0207700_100067035 | 149 |
| 421 | 3300025928 | Ga0207700_10540118 | Ga0207700_105401182 | 149 |
| 422 | 3300025928 | Ga0207700_10760032 | Ga0207700_107600322 | 149 |
| 423 | 3300025929 | Ga0207664_10001898 | Ga0207664_1000189810 | 149 |
| 424 | 3300025929 | Ga0207664_10004348 | Ga0207664_100043488 | 149 |
| 425 | 3300025929 | Ga0207664_10033378 | Ga0207664_100333782 | 149 |
| 426 | 3300025929 | Ga0207664_10033903 | Ga0207664_100339032 | 149 |
| 427 | 3300025929 | Ga0207664_10059181 | Ga0207664_100591812 | 149 |
| 428 | 3300025929 | Ga0207664_10358747 | Ga0207664_103587472 | 149 |
| 429 | 3300025929 | Ga0207664_10520905 | Ga0207664_105209051 | 149 |
| 430 | 3300025929 | Ga0207664_10644985 | Ga0207664_106449852 | 149 |
| 431 | 3300025929 | Ga0207664_11184350 | Ga0207664_111843501 | 149 |
| 432 | 3300025931 | Ga0207644_10114987 | Ga0207644_101149872 | 149 |
| 433 | 3300025931 | Ga0207644_10126411 | Ga0207644_101264111 | 149 |
| 434 | 3300025931 | Ga0207644_10178644 | Ga0207644_101786442 | 149 |
| 435 | 3300025932 | Ga0207690_10621537 | Ga0207690_106215371 | 149 |
| 436 | 3300025932 | Ga0207690_10748280 | Ga0207690_107482802 | 149 |
| 437 | 3300025933 | Ga0207706_10005427 | Ga0207706_100054273 | 149 |
| 438 | 3300025933 | Ga0207706_10082183 | Ga0207706_100821835 | 149 |
| 439 | 3300025934 | Ga0207686_10070397 | Ga0207686_100703972 | 149 |
| 440 | 3300025934 | Ga0207686_10133288 | Ga0207686_101332883 | 149 |
| 441 | 3300025935 | Ga0207709_10186250 | Ga0207709_101862502 | 149 |
| 442 | 3300025935 | Ga0207709_10189755 | Ga0207709_101897552 | 149 |
| 443 | 3300025935 | Ga0207709_10200666 | Ga0207709_102006662 | 149 |
| 444 | 3300025935 | Ga0207709_10346166 | Ga0207709_103461661 | 149 |
| 445 | 3300025935 | Ga0207709_11727160 | Ga0207709_117271601 | 149 |
| 446 | 3300025936 | Ga0207670_11661705 | Ga0207670_116617051 | 149 |
| 447 | 3300025937 | Ga0207669_11194783 | Ga0207669_111947832 | 149 |
| 448 | 3300025938 | Ga0207704_11437701 | Ga0207704_114377011 | 149 |
| 449 | 3300025939 | Ga0207665_10000336 | Ga0207665_1000033629 | 149 |
| 450 | 3300025939 | Ga0207665_10000544 | Ga0207665_1000054426 | 149 |
| 451 | 3300025940 | Ga0207691_10220556 | Ga0207691_102205562 | 149 |
| 452 | 3300025940 | Ga0207691_10271825 | Ga0207691_102718252 | 149 |
| 453 | 3300025941 | Ga0207711_10512130 | Ga0207711_105121301 | 149 |
| 454 | 3300025944 | Ga0207661_10021154 | Ga0207661_100211542 | 149 |
| 455 | 3300025944 | Ga0207661_10296968 | Ga0207661_102969682 | 149 |
| 456 | 3300025944 | Ga0207661_10306710 | Ga0207661_103067101 | 149 |
| 457 | 3300025944 | Ga0207661_10603661 | Ga0207661_106036612 | 149 |
| 458 | 3300025944 | Ga0207661_10632484 | Ga0207661_106324841 | 149 |
| 459 | 3300025944 | Ga0207661_11100825 | Ga0207661_111008251 | 149 |
| 460 | 3300025945 | Ga0207679_10064814 | Ga0207679_100648141 | 149 |
| 461 | 3300025945 | Ga0207679_10613734 | Ga0207679_106137342 | 149 |
| 462 | 3300025945 | Ga0207679_11619643 | Ga0207679_116196431 | 149 |
| 463 | 3300025949 | Ga0207667_10014908 | Ga0207667_100149086 | 149 |
| 464 | 3300025949 | Ga0207667_10083012 | Ga0207667_100830125 | 149 |
| 465 | 3300025949 | Ga0207667_10239430 | Ga0207667_102394303 | 149 |
| 466 | 3300025949 | Ga0207667_10534994 | Ga0207667_105349942 | 149 |
| 467 | 3300025949 | Ga0207667_10543452 | Ga0207667_105434522 | 149 |
| 468 | 3300025949 | Ga0207667_12101688 | Ga0207667_121016881 | 149 |
| 469 | 3300025960 | Ga0207651_11272980 | Ga0207651_112729801 | 149 |
| 470 | 3300025960 | Ga0207651_11904528 | Ga0207651_119045281 | 149 |
| 471 | 3300025961 | Ga0207712_11297924 | Ga0207712_112979241 | 149 |
| 472 | 3300025972 | Ga0207668_10209388 | Ga0207668_102093881 | 149 |
| 473 | 3300025981 | Ga0207640_11046123 | Ga0207640_110461232 | 149 |
| 474 | 3300025981 | Ga0207640_11115840 | Ga0207640_111158402 | 149 |
| 475 | 3300025981 | Ga0207640_11751756 | Ga0207640_117517561 | 149 |
| 476 | 3300026023 | Ga0207677_10034168 | Ga0207677_100341685 | 149 |
| 477 | 3300026023 | Ga0207677_10062174 | Ga0207677_100621742 | 149 |
| 478 | 3300026023 | Ga0207677_10099391 | Ga0207677_100993914 | 149 |
| 479 | 3300026023 | Ga0207677_10556308 | Ga0207677_105563081 | 149 |
| 480 | 3300026041 | Ga0207639_10215981 | Ga0207639_102159812 | 149 |
| 481 | 3300026041 | Ga0207639_10241743 | Ga0207639_102417432 | 149 |
| 482 | 3300026041 | Ga0207639_10394626 | Ga0207639_103946262 | 149 |
| 483 | 3300026067 | Ga0207678_10012544 | Ga0207678_100125441 | 149 |
| 484 | 3300026067 | Ga0207678_10145954 | Ga0207678_101459541 | 149 |
| 485 | 3300026075 | Ga0207708_10317014 | Ga0207708_103170142 | 149 |
| 486 | 3300026078 | Ga0207702_10018302 | Ga0207702_100183022 | 149 |
| 487 | 3300026078 | Ga0207702_10028564 | Ga0207702_100285642 | 149 |
| 488 | 3300026078 | Ga0207702_10181504 | Ga0207702_101815042 | 149 |
| 489 | 3300026078 | Ga0207702_10368069 | Ga0207702_103680692 | 149 |
| 490 | 3300026078 | Ga0207702_10462149 | Ga0207702_104621492 | 149 |
| 491 | 3300026078 | Ga0207702_10787693 | Ga0207702_107876932 | 149 |
| 492 | 3300026078 | Ga0207702_11711937 | Ga0207702_117119371 | 149 |
| 493 | 3300026089 | Ga0207648_10319604 | Ga0207648_103196043 | 149 |
| 494 | 3300026089 | Ga0207648_10732853 | Ga0207648_107328531 | 149 |
| 495 | 3300026116 | Ga0207674_10175861 | Ga0207674_101758613 | 149 |
| 496 | 3300026116 | Ga0207674_10846048 | Ga0207674_108460482 | 149 |
| 497 | 3300026118 | Ga0207675_100003932 | Ga0207675_10000393212 | 149 |
| 498 | 3300026118 | Ga0207675_100716536 | Ga0207675_1007165362 | 149 |
| 499 | 3300026118 | Ga0207675_100897940 | Ga0207675_1008979401 | 149 |
| 500 | 3300026121 | Ga0207683_10006496 | Ga0207683_1000649612 | 149 |
| 501 | 3300026121 | Ga0207683_10038385 | Ga0207683_100383852 | 149 |
| 502 | 3300026121 | Ga0207683_10192049 | Ga0207683_101920492 | 149 |
| 503 | 3300027717 | Ga0209998_10042363 | Ga0209998_100423631 | 149 |
| 504 | 3300027907 | Ga0207428_10011552 | Ga0207428_100115527 | 149 |
| 505 | 3300028379 | Ga0268266_10487858 | Ga0268266_104878581 | 149 |
| 506 | 3300028563 | Ga0265319_1001184 | Ga0265319_10011849 | 149 |
| 507 | 3300028577 | Ga0265318_10008728 | Ga0265318_100087282 | 149 |
| 508 | 3300028654 | Ga0265322_10008319 | Ga0265322_100083192 | 149 |
| 509 | 3300028800 | Ga0265338_10021756 | Ga0265338_100217564 | 149 |
| 510 | 3300031235 | Ga0265330_10014203 | Ga0265330_100142034 | 149 |
| 511 | 3300031238 | Ga0265332_10088592 | Ga0265332_100885922 | 149 |
| 512 | 3300031239 | Ga0265328_10097022 | Ga0265328_100970221 | 149 |
| 513 | 3300031240 | Ga0265320_10100948 | Ga0265320_101009482 | 149 |
| 514 | 3300031242 | Ga0265329_10082352 | Ga0265329_100823521 | 149 |
| 515 | 3300031247 | Ga0265340_10043102 | Ga0265340_100431023 | 149 |
| 516 | 3300031249 | Ga0265339_10005422 | Ga0265339_100054222 | 149 |
| 517 | 3300031250 | Ga0265331_10042749 | Ga0265331_100427492 | 149 |
| 518 | 3300031251 | Ga0265327_10027941 | Ga0265327_100279413 | 149 |
| 519 | 3300031344 | Ga0265316_10139407 | Ga0265316_101394072 | 149 |
| 520 | 3300031344 | Ga0265316_10438782 | Ga0265316_104387822 | 149 |
| 521 | 3300031711 | Ga0265314_10037065 | Ga0265314_100370652 | 149 |
| 522 | 3300031711 | Ga0265314_10183910 | Ga0265314_101839102 | 149 |
| 523 | 3300031712 | Ga0265342_10031739 | Ga0265342_100317394 | 149 |
| 524 | 3300031731 | Ga0307405_11474539 | Ga0307405_114745391 | 149 |
| 525 | 3300031824 | Ga0307413_10013094 | Ga0307413_100130945 | 149 |
| 526 | 3300031852 | Ga0307410_10106281 | Ga0307410_101062812 | 149 |
| 527 | 3300031901 | Ga0307406_10217630 | Ga0307406_102176301 | 149 |
| 528 | 3300031901 | Ga0307406_10437392 | Ga0307406_104373921 | 149 |
| 529 | 3300031903 | Ga0307407_10017436 | Ga0307407_100174363 | 149 |
| 530 | 3300031995 | Ga0307409_100073101 | Ga0307409_1000731012 | 149 |
| 531 | 3300031995 | Ga0307409_100080946 | Ga0307409_1000809465 | 149 |
| 532 | 3300031995 | Ga0307409_100539139 | Ga0307409_1005391392 | 149 |
| 533 | 3300032002 | Ga0307416_100083403 | Ga0307416_1000834032 | 149 |
| 534 | 3300032002 | Ga0307416_100501233 | Ga0307416_1005012332 | 149 |
| 535 | 3300032002 | Ga0307416_100656259 | Ga0307416_1006562592 | 149 |
| 536 | 3300032004 | Ga0307414_11412582 | Ga0307414_114125822 | 149 |
| 537 | 3300032005 | Ga0307411_10140631 | Ga0307411_101406312 | 149 |
| 538 | 3300032126 | Ga0307415_100056494 | Ga0307415_1000564943 | 149 |
| 539 | 3300034819 | Ga0373958_0035589 | Ga0373958_0035589_474_923 | 149 |
| 540 | 3300035084 | Ga0373928_0041857 | Ga0373928_0041857_17_466 | 149 |
| 541 | 3300035085 | Ga0373929_0005112 | Ga0373929_0005112_1496_1945 | 149 |
| 542 | 3300035088 | Ga0373940_0055264 | Ga0373940_0055264_159_608 | 149 |
| 543 | 3300035089 | Ga0373944_0050180 | Ga0373944_0050180_775_1224 | 149 |
| 544 | 3300035090 | Ga0373949_0090444 | Ga0373949_0090444_346_795 | 149 |
| 545 | 3300035092 | Ga0373952_0043091 | Ga0373952_0043091_381_830 | 149 |
| 546 | 3300035113 | Ga0373936_0033789 | Ga0373936_0033789_701_1150 | 149 |
| 547 | 3300035113 | Ga0373936_0072951 | Ga0373936_0072951_549_998 | 149 |
| 548 | 3300035114 | Ga0373939_0045219 | Ga0373939_0045219_437_886 | 149 |
| 549 | 3300035170 | Ga0373943_0000813 | Ga0373943_0000813_8938_9387 | 149 |
| 550 | 3300035170 | Ga0373943_0105490 | Ga0373943_0105490_735_1184 | 149 |
| 551 | 3300035170 | Ga0373943_0111041 | Ga0373943_0111041_115_564 | 149 |
| 552 | 3300035171 | Ga0373946_0150740 | Ga0373946_0150740_77_526 | 149 |
| 553 | 3300035241 | Ga0373961_0052040 | Ga0373961_0052040_342_791 | 149 |
| 554 | 3300035242 | Ga0373962_0055198 | Ga0373962_0055198_597_1046 | 149 |
| 555 | 3300035691 | Ga0373931_0032081 | Ga0373931_0032081_235_684 | 149 |
| 556 | 3300035691 | Ga0373931_0211437 | Ga0373931_0211437_32_481 | 149 |
| 557 | 3300035691 | Ga0373931_0245511 | Ga0373931_0245511_481_930 | 149 |
| 558 | 3300035692 | Ga0373935_0235506 | Ga0373935_0235506_535_984 | 149 |
| 559 | 3300035725 | Ga0373947_0006490 | Ga0373947_0006490_4773_5222 | 149 |
| 560 | 3300035725 | Ga0373947_0009782 | Ga0373947_0009782_3310_3759 | 149 |
| 561 | 3300035725 | Ga0373947_0047281 | Ga0373947_0047281_168_617 | 149 |
| 562 | 3300035725 | Ga0373947_0072999 | Ga0373947_0072999_266_715 | 149 |
| 563 | 3300037068 | Ga0373925_0000812 | Ga0373925_0000812_7914_8363 | 149 |
| 564 | 3300037068 | Ga0373925_0699626 | Ga0373925_0699626_14_463 | 149 |
| 565 | 3300037068 | Ga0373925_0718463 | Ga0373925_0718463_77_526 | 149 |
| 566 | 3300037312 | Ga0395899_0044946 | Ga0395899_0044946_1643_2092 | 149 |
| 567 | 3300037418 | Ga0395900_0006320 | Ga0395900_0006320_8802_9251 | 149 |
| 568 | 3300037418 | Ga0395900_0032020 | Ga0395900_0032020_685_1134 | 149 |
| 569 | 3300037418 | Ga0395900_0037264 | Ga0395900_0037264_3699_4148 | 149 |
| 570 | 3300037418 | Ga0395900_0144086 | Ga0395900_0144086_1948_2397 | 149 |
| 571 | 3300037418 | Ga0395900_0184989 | Ga0395900_0184989_398_856 | 149 |
| 572 | 3300037418 | Ga0395900_0293118 | Ga0395900_0293118_179_628 | 149 |
| 573 | 3300037418 | Ga0395900_0719696 | Ga0395900_0719696_328_777 | 149 |
| 574 | 3300037418 | Ga0395900_0836344 | Ga0395900_0836344_184_633 | 149 |
| 575 | 3300037418 | Ga0395900_0893922 | Ga0395900_0893922_219_668 | 149 |
| 576 | 3300037418 | Ga0395900_1094394 | Ga0395900_1094394_235_684 | 149 |
| 577 | 3300037466 | Ga0395898_0025315 | Ga0395898_0025315_53_502 | 149 |
| 578 | 3300037466 | Ga0395898_0062235 | Ga0395898_0062235_718_1167 | 149 |
| 579 | 3300037466 | Ga0395898_0084924 | Ga0395898_0084924_2360_2809 | 149 |
| 580 | 3300037466 | Ga0395898_0129714 | Ga0395898_0129714_88_537 | 149 |
| 581 | 3300037466 | Ga0395898_0203263 | Ga0395898_0203263_659_1108 | 149 |
| 582 | 3300037466 | Ga0395898_0361399 | Ga0395898_0361399_300_749 | 149 |
| 583 | 3300037466 | Ga0395898_0472905 | Ga0395898_0472905_218_667 | 149 |
| 584 | 3300037466 | Ga0395898_0491584 | Ga0395898_0491584_279_731 | 149 |
| 585 | 3300037466 | Ga0395898_0508994 | Ga0395898_0508994_143_616 | 149 |
| 586 | 3300037466 | Ga0395898_1159276 | Ga0395898_1159276_64_513 | 149 |
| 587 | 3300037471 | Ga0395905_0007521 | Ga0395905_0007521_4008_4457 | 149 |
| 588 | 3300037471 | Ga0395905_0286410 | Ga0395905_0286410_382_831 | 149 |
| 589 | 3300037471 | Ga0395905_0651964 | Ga0395905_0651964_14_463 | 149 |
| 590 | 3300038443 | Ga0395901_0022292 | Ga0395901_0022292_223_672 | 149 |
| 591 | 3300038443 | Ga0395901_0057131 | Ga0395901_0057131_1826_2275 | 149 |
| 592 | 3300038443 | Ga0395901_0065114 | Ga0395901_0065114_243_692 | 149 |
| 593 | 3300038443 | Ga0395901_0107100 | Ga0395901_0107100_1983_2432 | 149 |
| 594 | 3300038443 | Ga0395901_0108700 | Ga0395901_0108700_1946_2404 | 149 |
| 595 | 3300038443 | Ga0395901_0299293 | Ga0395901_0299293_396_845 | 149 |
| 596 | 3300038443 | Ga0395901_0388518 | Ga0395901_0388518_862_1311 | 149 |
| 597 | 3300038443 | Ga0395901_0569344 | Ga0395901_0569344_329_778 | 149 |
| 598 | 3300039437 | Ga0436365_1172237 | Ga0436365_1172237_57_506 | 149 |
| 599 | 3300039438 | Ga0436360_0769076 | Ga0436360_0769076_260_709 | 149 |
| 600 | 3300039453 | Ga0436362_1228474 | Ga0436362_1228474_80_529 | 149 |
| 601 | 3300041443 | Ga0451789_1134997 | Ga0451789_1134997_141_590 | 149 |
| 602 | 3300041496 | Ga0451839_0248092 | Ga0451839_0248092_64_513 | 149 |
| 603 | 3300042005 | Ga0439448_0002325 | Ga0439448_0002325_3234_3683 | 149 |
| 604 | 3300042012 | Ga0439455_0021157 | Ga0439455_0021157_431_880 | 149 |
| 605 | 3300042157 | Ga0439458_0024096 | Ga0439458_0024096_373_822 | 149 |
| 606 | 3300042437 | Ga0439444_0037767 | Ga0439444_0037767_55_504 | 149 |
| 607 | 3300044673 | Ga0453683_0249518 | Ga0453683_0249518_397_846 | 149 |
| 608 | 3300044694 | Ga0466963_0000744 | Ga0466963_0000744_12073_12522 | 149 |
| 609 | 3300044694 | Ga0466963_0002408 | Ga0466963_0002408_8592_9041 | 149 |
| 610 | 3300044694 | Ga0466963_0031510 | Ga0466963_0031510_2304_2753 | 149 |
| 611 | 3300044694 | Ga0466963_0153414 | Ga0466963_0153414_31_480 | 149 |
| 612 | 3300044694 | Ga0466963_0709525 | Ga0466963_0709525_37_486 | 149 |
| 613 | 3300044706 | Ga0466964_0134102 | Ga0466964_0134102_577_1026 | 149 |
| 614 | 3300044842 | Ga0466957_0014432 | Ga0466957_0014432_921_1376 | 149 |
| 615 | 3300044842 | Ga0466957_0121909 | Ga0466957_0121909_716_1165 | 149 |
| 616 | 3300044842 | Ga0466957_0582636 | Ga0466957_0582636_290_739 | 149 |
| 617 | 3300044901 | Ga0466960_0016942 | Ga0466960_0016942_1426_1875 | 149 |
| 618 | 3300045049 | Ga0466959_0631493 | Ga0466959_0631493_146_601 | 149 |
| 619 | 3300045051 | Ga0451576_0037970 | Ga0451576_0037970_149_598 | 149 |
| 620 | 3300045836 | Ga0466958_0003510 | Ga0466958_0003510_757_1212 | 149 |
| 621 | 3300045836 | Ga0466958_0357947 | Ga0466958_0357947_44_493 | 149 |
| 622 | 3300045836 | Ga0466958_0428879 | Ga0466958_0428879_378_830 | 149 |
| 623 | 3300045976 | Ga0466967_0005287 | Ga0466967_0005287_1694_2143 | 149 |
| 624 | 3300045976 | Ga0466967_0033110 | Ga0466967_0033110_2954_3403 | 149 |
| 625 | 3300045976 | Ga0466967_0036315 | Ga0466967_0036315_872_1321 | 149 |
| 626 | 3300045976 | Ga0466967_0119834 | Ga0466967_0119834_1771_2220 | 149 |
| 627 | 3300045976 | Ga0466967_0125019 | Ga0466967_0125019_121_570 | 149 |
| 628 | 3300045976 | Ga0466967_0250303 | Ga0466967_0250303_1001_1450 | 149 |
| 629 | 3300045976 | Ga0466967_0477364 | Ga0466967_0477364_364_813 | 149 |
| 630 | 3300045976 | Ga0466967_0858164 | Ga0466967_0858164_388_837 | 149 |
| 631 | 3300045976 | Ga0466967_1141361 | Ga0466967_1141361_221_670 | 149 |
| 632 | 3300045976 | Ga0466967_2385549 | Ga0466967_2385549_49_498 | 149 |
| 633 | 3300046455 | Ga0495603_0005797 | Ga0495603_0005797_210_659 | 149 |
| 634 | 3300046455 | Ga0495603_0042538 | Ga0495603_0042538_2155_2604 | 149 |
| 635 | 3300046457 | Ga0495590_0163177 | Ga0495590_0163177_18_467 | 149 |
| 636 | 3300046459 | Ga0495629_0148342 | Ga0495629_0148342_1150_1599 | 149 |
| 637 | 3300046459 | Ga0495629_0157980 | Ga0495629_0157980_158_607 | 149 |
| 638 | 3300046459 | Ga0495629_0187479 | Ga0495629_0187479_285_734 | 149 |
| 639 | 3300046461 | Ga0495641_0011587 | Ga0495641_0011587_1058_1507 | 149 |
| 640 | 3300046461 | Ga0495641_0036634 | Ga0495641_0036634_1744_2193 | 149 |
| 641 | 3300046461 | Ga0495641_0170249 | Ga0495641_0170249_502_951 | 149 |
| 642 | 3300046462 | Ga0495651_0716744 | Ga0495651_0716744_38_487 | 149 |
| 643 | 3300046472 | Ga0495580_0001957 | Ga0495580_0001957_4059_4508 | 149 |
| 644 | 3300046473 | Ga0495582_0092659 | Ga0495582_0092659_1003_1452 | 149 |
| 645 | 3300046473 | Ga0495582_0095145 | Ga0495582_0095145_65_514 | 149 |
| 646 | 3300046474 | Ga0495605_0273339 | Ga0495605_0273339_218_667 | 149 |
| 647 | 3300046475 | Ga0495639_0000699 | Ga0495639_0000699_13825_14274 | 149 |
| 648 | 3300046475 | Ga0495639_0529372 | Ga0495639_0529372_107_556 | 149 |
| 649 | 3300046475 | Ga0495639_0564318 | Ga0495639_0564318_58_507 | 149 |
| 650 | 3300046476 | Ga0495662_0048384 | Ga0495662_0048384_582_1031 | 149 |
| 651 | 3300046477 | Ga0495664_0009726 | Ga0495664_0009726_3431_3880 | 149 |
| 652 | 3300046491 | Ga0495584_0104789 | Ga0495584_0104789_150_599 | 149 |
| 653 | 3300046499 | Ga0495594_0001276 | Ga0495594_0001276_5688_6137 | 149 |
| 654 | 3300046500 | Ga0495596_0052304 | Ga0495596_0052304_502_951 | 149 |
| 655 | 3300046500 | Ga0495596_0079524 | Ga0495596_0079524_149_598 | 149 |
| 656 | 3300046501 | Ga0495607_0192209 | Ga0495607_0192209_394_843 | 149 |
| 657 | 3300046514 | Ga0495618_0036416 | Ga0495618_0036416_1617_2066 | 149 |
| 658 | 3300046517 | Ga0495630_0001491 | Ga0495630_0001491_6813_7262 | 149 |
| 659 | 3300046517 | Ga0495630_0172845 | Ga0495630_0172845_767_1216 | 149 |
| 660 | 3300046520 | Ga0495637_0052345 | Ga0495637_0052345_262_711 | 149 |
| 661 | 3300046523 | Ga0495644_0045114 | Ga0495644_0045114_470_919 | 149 |
| 662 | 3300046523 | Ga0495644_0222836 | Ga0495644_0222836_14_463 | 149 |
| 663 | 3300046526 | Ga0495666_0000298 | Ga0495666_0000298_7978_8427 | 149 |
| 664 | 3300046526 | Ga0495666_0003426 | Ga0495666_0003426_1035_1484 | 149 |
| 665 | 3300046529 | Ga0495652_0113884 | Ga0495652_0113884_1512_1961 | 149 |
| 666 | 3300046531 | Ga0495665_0051507 | Ga0495665_0051507_582_1031 | 149 |
| 667 | 3300046533 | Ga0495640_0050221 | Ga0495640_0050221_1972_2421 | 149 |
| 668 | 3300046533 | Ga0495640_0287575 | Ga0495640_0287575_408_857 | 149 |
| 669 | 3300046535 | Ga0495586_0011405 | Ga0495586_0011405_4214_4663 | 149 |
| 670 | 3300046535 | Ga0495586_0098296 | Ga0495586_0098296_890_1339 | 149 |
| 671 | 3300046538 | Ga0495609_0115922 | Ga0495609_0115922_183_632 | 149 |
| 672 | 3300046538 | Ga0495609_0140262 | Ga0495609_0140262_40_489 | 149 |
| 673 | 3300046539 | Ga0495621_0191120 | Ga0495621_0191120_53_502 | 149 |
| 674 | 3300046615 | Ga0495656_0176238 | Ga0495656_0176238_474_923 | 149 |
| 675 | 3300046642 | Ga0495634_0062554 | Ga0495634_0062554_1787_2236 | 149 |
| 676 | 3300046642 | Ga0495634_0215920 | Ga0495634_0215920_488_937 | 149 |
| 677 | 3300046648 | Ga0495611_0317855 | Ga0495611_0317855_56_505 | 149 |
| 678 | 3300046663 | Ga0495635_0011220 | Ga0495635_0011220_2822_3271 | 149 |
| 679 | 3300046663 | Ga0495635_0540260 | Ga0495635_0540260_293_742 | 149 |
| 680 | 3300046664 | Ga0495659_0148606 | Ga0495659_0148606_83_532 | 149 |
| 681 | 3300046674 | Ga0495588_0048749 | Ga0495588_0048749_1287_1736 | 149 |
| 682 | 3300046674 | Ga0495588_0422380 | Ga0495588_0422380_88_537 | 149 |
| 683 | 3300046678 | Ga0495599_0121005 | Ga0495599_0121005_413_862 | 149 |
| 684 | 3300046681 | Ga0495647_0001206 | Ga0495647_0001206_2898_3347 | 149 |
| 685 | 3300046683 | Ga0495658_0080498 | Ga0495658_0080498_1150_1599 | 149 |
| 686 | 3300046683 | Ga0495658_0134588 | Ga0495658_0134588_572_1021 | 149 |
| 687 | 3300046683 | Ga0495658_0169670 | Ga0495658_0169670_24_473 | 149 |
| 688 | 3300046683 | Ga0495658_0357905 | Ga0495658_0357905_19_468 | 149 |
| 689 | 3300046689 | Ga0495613_0172299 | Ga0495613_0172299_1022_1471 | 149 |
| 690 | 3300046689 | Ga0495613_0313738 | Ga0495613_0313738_207_656 | 149 |
| 691 | 3300046690 | Ga0495624_0007376 | Ga0495624_0007376_5949_6398 | 149 |
| 692 | 3300046691 | Ga0495670_0429045 | Ga0495670_0429045_251_700 | 149 |
| 693 | 3300046691 | Ga0495670_0786783 | Ga0495670_0786783_56_505 | 149 |
| 694 | 3300046692 | Ga0495671_0255484 | Ga0495671_0255484_259_708 | 149 |
| 695 | 3300047315 | Ga0495581_0004047 | Ga0495581_0004047_3559_4008 | 149 |
| 696 | 3300047315 | Ga0495581_0340955 | Ga0495581_0340955_14_463 | 149 |
| 697 | 3300047318 | Ga0495636_0213749 | Ga0495636_0213749_256_705 | 149 |
| 698 | 3300047319 | Ga0495674_0027631 | Ga0495674_0027631_3479_3928 | 149 |
| 699 | 3300047321 | Ga0495676_0006956 | Ga0495676_0006956_5821_6270 | 149 |
| 700 | 3300047321 | Ga0495676_0018911 | Ga0495676_0018911_5237_5686 | 149 |
| 701 | 3300047321 | Ga0495676_0119176 | Ga0495676_0119176_21_470 | 149 |
| 702 | 3300047321 | Ga0495676_0375113 | Ga0495676_0375113_56_505 | 149 |
| 703 | 3300047447 | Ga0495685_015551 | Ga0495685_015551_1741_2190 | 149 |
| 704 | 3300047471 | Ga0495684_0101058 | Ga0495684_0101058_1150_1599 | 149 |
| 705 | 3300047673 | Ga0495593_0004815 | Ga0495593_0004815_104_553 | 149 |
| 706 | 3300047673 | Ga0495593_0436893 | Ga0495593_0436893_112_561 | 149 |
| 707 | 3300048089 | Ga0495614_0001813 | Ga0495614_0001813_6088_6537 | 149 |
| 708 | 3300048090 | Ga0495615_0296562 | Ga0495615_0296562_50_499 | 149 |
| 709 | 3300048091 | Ga0495626_0379213 | Ga0495626_0379213_30_479 | 149 |
| 710 | 3300048903 | Ga0496100_0003025 | Ga0496100_0003025_3897_4346 | 149 |
| 711 | 3300048903 | Ga0496100_0073572 | Ga0496100_0073572_635_1084 | 149 |
| 712 | 3300048903 | Ga0496100_0775513 | Ga0496100_0775513_133_582 | 149 |
| 713 | 3300048903 | Ga0496100_0905530 | Ga0496100_0905530_72_521 | 149 |
| 714 | 3300048904 | Ga0496101_0007189 | Ga0496101_0007189_4649_5098 | 149 |
| 715 | 3300048904 | Ga0496101_0054758 | Ga0496101_0054758_172_621 | 149 |
| 716 | 3300048904 | Ga0496101_0098101 | Ga0496101_0098101_355_804 | 149 |
| 717 | 3300048904 | Ga0496101_0140288 | Ga0496101_0140288_186_635 | 149 |
| 718 | 3300048904 | Ga0496101_0204261 | Ga0496101_0204261_229_678 | 149 |
| 719 | 3300048904 | Ga0496101_0332581 | Ga0496101_0332581_160_609 | 149 |
| 720 | 3300048904 | Ga0496101_0426100 | Ga0496101_0426100_319_768 | 149 |
| 721 | 3300048905 | Ga0496102_0005234 | Ga0496102_0005234_2575_3024 | 149 |
| 722 | 3300048905 | Ga0496102_0043823 | Ga0496102_0043823_2779_3228 | 149 |
| 723 | 3300048905 | Ga0496102_0107787 | Ga0496102_0107787_1578_2027 | 149 |
| 724 | 3300048905 | Ga0496102_0257836 | Ga0496102_0257836_289_738 | 149 |
| 725 | 3300048905 | Ga0496102_0535820 | Ga0496102_0535820_584_1033 | 149 |
| 726 | 3300048906 | Ga0496103_0006523 | Ga0496103_0006523_1195_1644 | 149 |
| 727 | 3300048906 | Ga0496103_0059182 | Ga0496103_0059182_392_841 | 149 |
| 728 | 3300048906 | Ga0496103_0314659 | Ga0496103_0314659_534_983 | 149 |
| 729 | 3300048906 | Ga0496103_0387789 | Ga0496103_0387789_317_766 | 149 |
| 730 | 3300048907 | Ga0496104_0000465 | Ga0496104_0000465_7703_8152 | 149 |
| 731 | 3300048907 | Ga0496104_0001293 | Ga0496104_0001293_13805_14254 | 149 |
| 732 | 3300048907 | Ga0496104_0004690 | Ga0496104_0004690_10212_10661 | 149 |
| 733 | 3300048907 | Ga0496104_0057628 | Ga0496104_0057628_3132_3581 | 149 |
| 734 | 3300048907 | Ga0496104_0064939 | Ga0496104_0064939_2779_3228 | 149 |
| 735 | 3300048907 | Ga0496104_0097732 | Ga0496104_0097732_883_1332 | 149 |
| 736 | 3300048907 | Ga0496104_0914245 | Ga0496104_0914245_109_558 | 149 |
| 737 | 3300048907 | Ga0496104_1047916 | Ga0496104_1047916_144_593 | 149 |
| 738 | 3300048908 | Ga0496105_0000567 | Ga0496105_0000567_17775_18224 | 149 |
| 739 | 3300048908 | Ga0496105_0001494 | Ga0496105_0001494_2397_2846 | 149 |
| 740 | 3300048908 | Ga0496105_0033728 | Ga0496105_0033728_3433_3882 | 149 |
| 741 | 3300048908 | Ga0496105_0051157 | Ga0496105_0051157_1919_2368 | 149 |
| 742 | 3300048908 | Ga0496105_0187235 | Ga0496105_0187235_1109_1558 | 149 |
| 743 | 3300048908 | Ga0496105_0438616 | Ga0496105_0438616_21_470 | 149 |
| 744 | 3300048909 | Ga0496106_0003242 | Ga0496106_0003242_5328_5777 | 149 |
| 745 | 3300048909 | Ga0496106_0007756 | Ga0496106_0007756_2018_2467 | 149 |
| 746 | 3300048909 | Ga0496106_0049191 | Ga0496106_0049191_2107_2556 | 149 |
| 747 | 3300048909 | Ga0496106_0081483 | Ga0496106_0081483_222_671 | 149 |
| 748 | 3300048909 | Ga0496106_0788218 | Ga0496106_0788218_188_637 | 149 |
| 749 | 3300048910 | Ga0496107_0001702 | Ga0496107_0001702_5203_5652 | 149 |
| 750 | 3300048910 | Ga0496107_0009067 | Ga0496107_0009067_2557_3006 | 149 |
| 751 | 3300048910 | Ga0496107_0220077 | Ga0496107_0220077_132_581 | 149 |
| 752 | 3300048910 | Ga0496107_0335020 | Ga0496107_0335020_307_756 | 149 |
| 753 | 3300048910 | Ga0496107_0667953 | Ga0496107_0667953_278_727 | 149 |
| 754 | 3300048910 | Ga0496107_1091240 | Ga0496107_1091240_48_497 | 149 |
| 755 | 3300048911 | Ga0496108_0001327 | Ga0496108_0001327_18800_19249 | 149 |
| 756 | 3300048911 | Ga0496108_0001889 | Ga0496108_0001889_257_706 | 149 |
| 757 | 3300048911 | Ga0496108_0009890 | Ga0496108_0009890_5112_5561 | 149 |
| 758 | 3300048911 | Ga0496108_0018453 | Ga0496108_0018453_3985_4434 | 149 |
| 759 | 3300048911 | Ga0496108_0030309 | Ga0496108_0030309_758_1207 | 149 |
| 760 | 3300048911 | Ga0496108_0384046 | Ga0496108_0384046_188_637 | 149 |
| 761 | 3300048911 | Ga0496108_0406643 | Ga0496108_0406643_206_655 | 149 |
| 762 | 3300048912 | Ga0496109_0002664 | Ga0496109_0002664_6247_6696 | 149 |
| 763 | 3300048912 | Ga0496109_0011893 | Ga0496109_0011893_6669_7118 | 149 |
| 764 | 3300048912 | Ga0496109_0024484 | Ga0496109_0024484_160_609 | 149 |
| 765 | 3300048912 | Ga0496109_0071267 | Ga0496109_0071267_2114_2563 | 149 |
| 766 | 3300048912 | Ga0496109_0077082 | Ga0496109_0077082_1471_1920 | 149 |
| 767 | 3300048912 | Ga0496109_0423908 | Ga0496109_0423908_684_1133 | 149 |
| 768 | 3300048913 | Ga0496110_0000607 | Ga0496110_0000607_8524_8973 | 149 |
| 769 | 3300048913 | Ga0496110_0000686 | Ga0496110_0000686_21122_21571 | 149 |
| 770 | 3300048913 | Ga0496110_0001231 | Ga0496110_0001231_4791_5240 | 149 |
| 771 | 3300048913 | Ga0496110_0002554 | Ga0496110_0002554_142_591 | 149 |
| 772 | 3300048913 | Ga0496110_0007796 | Ga0496110_0007796_5915_6364 | 149 |
| 773 | 3300048913 | Ga0496110_0028638 | Ga0496110_0028638_166_615 | 149 |
| 774 | 3300048913 | Ga0496110_0490635 | Ga0496110_0490635_155_604 | 149 |
| 775 | 3300048913 | Ga0496110_1638309 | Ga0496110_1638309_64_513 | 149 |
| 776 | 3300048914 | Ga0496111_0000143 | Ga0496111_0000143_27143_27592 | 149 |
| 777 | 3300048914 | Ga0496111_0001049 | Ga0496111_0001049_14636_15085 | 149 |
| 778 | 3300048914 | Ga0496111_0002012 | Ga0496111_0002012_5479_5928 | 149 |
| 779 | 3300048914 | Ga0496111_0021403 | Ga0496111_0021403_4039_4488 | 149 |
| 780 | 3300048914 | Ga0496111_0028084 | Ga0496111_0028084_646_1095 | 149 |
| 781 | 3300048914 | Ga0496111_0054535 | Ga0496111_0054535_2244_2693 | 149 |
| 782 | 3300048914 | Ga0496111_0087209 | Ga0496111_0087209_1825_2274 | 149 |
| 783 | 3300048915 | Ga0496112_0008601 | Ga0496112_0008601_8406_8855 | 149 |
| 784 | 3300048915 | Ga0496112_0018951 | Ga0496112_0018951_915_1364 | 149 |
| 785 | 3300048915 | Ga0496112_0021571 | Ga0496112_0021571_4457_4906 | 149 |
| 786 | 3300048915 | Ga0496112_0042473 | Ga0496112_0042473_3284_3733 | 149 |
| 787 | 3300048915 | Ga0496112_0066637 | Ga0496112_0066637_2629_3078 | 149 |
| 788 | 3300048915 | Ga0496112_0079007 | Ga0496112_0079007_1919_2368 | 149 |
| 789 | 3300048915 | Ga0496112_0282221 | Ga0496112_0282221_57_506 | 149 |
| 790 | 3300048915 | Ga0496112_1335654 | Ga0496112_1335654_107_556 | 149 |
| 791 | 3300048916 | Ga0496113_0000470 | Ga0496113_0000470_2910_3359 | 149 |
| 792 | 3300048916 | Ga0496113_0002207 | Ga0496113_0002207_4108_4557 | 149 |
| 793 | 3300048916 | Ga0496113_0013465 | Ga0496113_0013465_4065_4514 | 149 |
| 794 | 3300048916 | Ga0496113_0029986 | Ga0496113_0029986_306_755 | 149 |
| 795 | 3300048916 | Ga0496113_0039515 | Ga0496113_0039515_80_529 | 149 |
| 796 | 3300048916 | Ga0496113_0623371 | Ga0496113_0623371_190_639 | 149 |
| 797 | 3300048917 | Ga0496114_0007895 | Ga0496114_0007895_2758_3207 | 149 |
| 798 | 3300048917 | Ga0496114_0027671 | Ga0496114_0027671_2718_3167 | 149 |
| 799 | 3300048917 | Ga0496114_0028575 | Ga0496114_0028575_588_1037 | 149 |
| 800 | 3300048917 | Ga0496114_0056780 | Ga0496114_0056780_2076_2525 | 149 |
| 801 | 3300048917 | Ga0496114_0123569 | Ga0496114_0123569_401_850 | 149 |
| 802 | 3300048917 | Ga0496114_0218353 | Ga0496114_0218353_95_544 | 149 |
| 803 | 3300048917 | Ga0496114_0246748 | Ga0496114_0246748_125_574 | 149 |
| 804 | 3300048917 | Ga0496114_0327959 | Ga0496114_0327959_605_1054 | 149 |
| 805 | 3300048917 | Ga0496114_0478742 | Ga0496114_0478742_431_880 | 149 |
| 806 | 3300048918 | Ga0496115_0010231 | Ga0496115_0010231_3419_3868 | 149 |
| 807 | 3300048918 | Ga0496115_0121230 | Ga0496115_0121230_1259_1708 | 149 |
| 808 | 3300048918 | Ga0496115_0174698 | Ga0496115_0174698_1138_1587 | 149 |
| 809 | 3300048918 | Ga0496115_0555712 | Ga0496115_0555712_162_611 | 149 |
| 810 | 3300048918 | Ga0496115_0571458 | Ga0496115_0571458_225_674 | 149 |
| 811 | 3300048918 | Ga0496115_0631093 | Ga0496115_0631093_378_827 | 149 |
| 812 | 3300049127 | Ga0501306_060129 | Ga0501306_060129_67_525 | 149 |
| 813 | 3300049128 | Ga0501308_055440 | Ga0501308_055440_82_540 | 149 |
| 814 | 3300049129 | Ga0501309_043998 | Ga0501309_043998_165_623 | 149 |
| 815 | 3300049130 | Ga0501310_023288 | Ga0501310_023288_259_717 | 149 |
| 816 | 3300049161 | Ga0501305_096812 | Ga0501305_096812_67_525 | 149 |
| 817 | 3300049531 | Ga0501315_069655 | Ga0501315_069655_65_523 | 149 |
| 818 | 3300049532 | Ga0501316_067455 | Ga0501316_067455_23_481 | 149 |
| 819 | 3300049539 | Ga0501323_026410 | Ga0501323_026410_65_523 | 149 |
| 820 | 3300049568 | Ga0501031_0032228 | Ga0501031_0032228_1822_2271 | 149 |
| 821 | 3300049569 | Ga0501032_0083039 | Ga0501032_0083039_746_1195 | 149 |
| 822 | 3300049570 | Ga0501033_0201019 | Ga0501033_0201019_380_829 | 149 |
| 823 | 3300049572 | Ga0501036_0017361 | Ga0501036_0017361_3325_3774 | 149 |
| 824 | 3300049572 | Ga0501036_0337426 | Ga0501036_0337426_299_748 | 149 |
| 825 | 3300049573 | Ga0501037_0301661 | Ga0501037_0301661_329_778 | 149 |
| 826 | 3300049574 | Ga0501038_0179785 | Ga0501038_0179785_1003_1452 | 149 |
| 827 | 3300049575 | Ga0501039_0020102 | Ga0501039_0020102_3225_3674 | 149 |
| 828 | 3300049576 | Ga0501040_0011235 | Ga0501040_0011235_3341_3790 | 149 |
| 829 | 3300049577 | Ga0501041_0033827 | Ga0501041_0033827_483_932 | 149 |
| 830 | 3300049578 | Ga0501042_0109780 | Ga0501042_0109780_1522_1971 | 149 |
| 831 | 3300049578 | Ga0501042_0213008 | Ga0501042_0213008_330_779 | 149 |
| 832 | 3300049579 | Ga0501043_0068569 | Ga0501043_0068569_1980_2429 | 149 |
| 833 | 3300049580 | Ga0501046_0034103 | Ga0501046_0034103_1189_1638 | 149 |
| 834 | 3300049580 | Ga0501046_0157286 | Ga0501046_0157286_576_1025 | 149 |
| 835 | 3300049581 | Ga0501047_0063063 | Ga0501047_0063063_2170_2619 | 149 |
| 836 | 3300049582 | Ga0501048_0006233 | Ga0501048_0006233_5761_6210 | 149 |
| 837 | 3300049583 | Ga0501067_0016472 | Ga0501067_0016472_2675_3124 | 149 |
| 838 | 3300049583 | Ga0501067_0215463 | Ga0501067_0215463_547_996 | 149 |
| 839 | 3300049583 | Ga0501067_0297180 | Ga0501067_0297180_138_587 | 149 |
| 840 | 3300049584 | Ga0501068_0010140 | Ga0501068_0010140_2207_2656 | 149 |
| 841 | 3300049585 | Ga0501069_0035516 | Ga0501069_0035516_2138_2587 | 149 |
| 842 | 3300049585 | Ga0501069_0189362 | Ga0501069_0189362_603_1052 | 149 |
| 843 | 3300049586 | Ga0501070_0003032 | Ga0501070_0003032_632_1081 | 149 |
| 844 | 3300049586 | Ga0501070_0244857 | Ga0501070_0244857_136_585 | 149 |
| 845 | 3300049586 | Ga0501070_0981713 | Ga0501070_0981713_23_472 | 149 |
| 846 | 3300049587 | Ga0501071_0006130 | Ga0501071_0006130_5515_5964 | 149 |
| 847 | 3300049588 | Ga0501072_0040149 | Ga0501072_0040149_1372_1821 | 149 |
| 848 | 3300049589 | Ga0501073_0180700 | Ga0501073_0180700_262_711 | 149 |
| 849 | 3300049589 | Ga0501073_0346123 | Ga0501073_0346123_533_982 | 149 |
| 850 | 3300049590 | Ga0501074_0169548 | Ga0501074_0169548_397_846 | 149 |
| 851 | 3300049590 | Ga0501074_0333684 | Ga0501074_0333684_576_1025 | 149 |
| 852 | 3300049591 | Ga0501075_0021603 | Ga0501075_0021603_1076_1525 | 149 |
| 853 | 3300049592 | Ga0501076_0057189 | Ga0501076_0057189_794_1243 | 149 |
| 854 | 3300049592 | Ga0501076_0222880 | Ga0501076_0222880_644_1093 | 149 |
| 855 | 3300049593 | Ga0501077_0018208 | Ga0501077_0018208_2848_3297 | 149 |
| 856 | 3300049593 | Ga0501077_0277573 | Ga0501077_0277573_82_531 | 149 |
| 857 | 3300049649 | Ga0501198_068694 | Ga0501198_068694_93_551 | 149 |
| 858 | 3300049741 | Ga0501079_0025083 | Ga0501079_0025083_2426_2875 | 149 |
| 859 | 3300049741 | Ga0501079_0157032 | Ga0501079_0157032_544_993 | 149 |
| 860 | 3300049742 | Ga0501080_0037881 | Ga0501080_0037881_987_1436 | 149 |
| 861 | 3300049742 | Ga0501080_0185783 | Ga0501080_0185783_1069_1518 | 149 |
| 862 | 3300049743 | Ga0501081_0005943 | Ga0501081_0005943_3295_3744 | 149 |
| 863 | 3300049743 | Ga0501081_0027124 | Ga0501081_0027124_2599_3048 | 149 |
| 864 | 3300049743 | Ga0501081_0881278 | Ga0501081_0881278_11_460 | 149 |
| 865 | 3300049743 | Ga0501081_1198079 | Ga0501081_1198079_66_515 | 149 |
| 866 | 3300049762 | Ga0501265_027997 | Ga0501265_027997_190_648 | 149 |
| 867 | 3300049822 | Ga0501035_0093061 | Ga0501035_0093061_14_463 | 149 |
| 868 | 3300049823 | Ga0501044_0320999 | Ga0501044_0320999_242_691 | 149 |
| 869 | 3300049824 | Ga0501045_0016680 | Ga0501045_0016680_1904_2353 | 149 |
| 870 | 3300049824 | Ga0501045_0277173 | Ga0501045_0277173_201_650 | 149 |
| 871 | 3300049824 | Ga0501045_0435296 | Ga0501045_0435296_230_679 | 149 |
| 872 | 3300050507 | nmdc:mga05p37_14477_c1 | nmdc:mga05p37_14477_c1_1417_1890 | 149 |
| 873 | 3300050508 | nmdc:mga09592_184067_c1 | nmdc:mga09592_184067_c1_371_820 | 149 |
| 874 | 3300050508 | nmdc:mga09592_242266_c1 | nmdc:mga09592_242266_c1_346_819 | 149 |
| 875 | 3300050511 | nmdc:mga08y16_133018_c1 | nmdc:mga08y16_133018_c1_677_1126 | 149 |
| 876 | 3300050511 | nmdc:mga08y16_1892509_c1 | nmdc:mga08y16_1892509_c1_14_463 | 149 |
| 877 | 3300050511 | nmdc:mga08y16_425406_c1 | nmdc:mga08y16_425406_c1_518_967 | 149 |
| 878 | 3300050512 | nmdc:mga0n895_1242399_c1 | nmdc:mga0n895_1242399_c1_136_585 | 149 |
| 879 | 3300050512 | nmdc:mga0n895_1537_c1 | nmdc:mga0n895_1537_c1_15044_15493 | 149 |
| 880 | 3300050512 | nmdc:mga0n895_611918_c1 | nmdc:mga0n895_611918_c1_161_610 | 149 |
| 881 | 3300050512 | nmdc:mga0n895_906346_c1 | nmdc:mga0n895_906346_c1_238_687 | 149 |
| 882 | 3300050513 | nmdc:mga0rr50_1704978_c1 | nmdc:mga0rr50_1704978_c1_35_484 | 149 |
| 883 | 3300050513 | nmdc:mga0rr50_189532_c1 | nmdc:mga0rr50_189532_c1_246_695 | 149 |
| 884 | 3300050513 | nmdc:mga0rr50_3988_c1 | nmdc:mga0rr50_3988_c1_2772_3221 | 149 |
| 885 | 3300050513 | nmdc:mga0rr50_45176_c1 | nmdc:mga0rr50_45176_c1_1452_1901 | 149 |
| 886 | 3300050513 | nmdc:mga0rr50_545237_c1 | nmdc:mga0rr50_545237_c1_398_847 | 149 |
| 887 | 3300050514 | nmdc:mga08x19_110110_c1 | nmdc:mga08x19_110110_c1_831_1280 | 149 |
| 888 | 3300050515 | nmdc:mga0a205_1355381_c1 | nmdc:mga0a205_1355381_c1_28_477 | 149 |
| 889 | 3300050515 | nmdc:mga0a205_615555_c1 | nmdc:mga0a205_615555_c1_195_644 | 149 |
| 890 | 3300050515 | nmdc:mga0a205_70334_c1 | nmdc:mga0a205_70334_c1_2684_3133 | 149 |
| 891 | 3300050515 | nmdc:mga0a205_9777_c1 | nmdc:mga0a205_9777_c1_461_910 | 149 |
| 892 | 3300053077 | Ga0495601_0012146 | Ga0495601_0012146_454_903 | 149 |
| 893 | 3300053078 | Ga0495612_0014933 | Ga0495612_0014933_1337_1786 | 149 |
| 894 | 3300053083 | Ga0495655_0121409 | Ga0495655_0121409_286_735 | 149 |
| 895 | 3300053084 | Ga0495595_0300059 | Ga0495595_0300059_306_755 | 149 |
| 896 | 3300053085 | Ga0495619_0002360 | Ga0495619_0002360_5456_5905 | 149 |
| 897 | 3300054114 | Ga0501084_0011070 | Ga0501084_0011070_5041_5490 | 149 |
| 898 | 3300054114 | Ga0501084_0065323 | Ga0501084_0065323_1564_2013 | 149 |
| 899 | 3300059490 | Ga0587066_073763 | Ga0587066_073763_190_639 | 149 |
| 900 | 3300059503 | Ga0587080_028064 | Ga0587080_028064_142_591 | 149 |
| 901 | 3300059504 | Ga0587082_139217 | Ga0587082_139217_92_541 | 149 |
| 902 | 3300059505 | Ga0587083_0123187 | Ga0587083_0123187_62_511 | 149 |
| 903 | 3300059506 | Ga0587085_062516 | Ga0587085_062516_70_519 | 149 |
| 904 | 3300059507 | Ga0587086_098774 | Ga0587086_098774_27_476 | 149 |
| 905 | 3300059605 | Ga0587106_109255 | Ga0587106_109255_58_510 | 149 |
| 906 | 3300059605 | Ga0587106_127851 | Ga0587106_127851_68_517 | 149 |
| 907 | 3300059608 | Ga0587129_014405 | Ga0587129_014405_149_598 | 149 |
| 908 | 3300059630 | Ga0587128_104308 | Ga0587128_104308_102_551 | 149 |
| 909 | 3300059640 | Ga0587067_170253 | Ga0587067_170253_69_518 | 149 |
| 910 | 3300059652 | Ga0587107_110129 | Ga0587107_110129_15_464 | 149 |
| 911 | 3300059655 | Ga0587114_035893 | Ga0587114_035893_314_763 | 149 |
| 912 | 3300059655 | Ga0587114_074001 | Ga0587114_074001_154_603 | 149 |
| 913 | 3300060346 | Ga0587111_0213790 | Ga0587111_0213790_47_496 | 149 |
| 914 | 3300060353 | Ga0501082_0059270 | Ga0501082_0059270_1147_1596 | 149 |
| 915 | 3300060353 | Ga0501082_0790364 | Ga0501082_0790364_231_680 | 149 |
| 916 | 3300061719 | Ga0466962_0015403 | Ga0466962_0015403_312_767 | 149 |
| 917 | 3300061719 | Ga0466962_0099199 | Ga0466962_0099199_820_1269 | 149 |
| 918 | 3300061734 | Ga0530510_0004115 | Ga0530510_0004115_2307_2756 | 149 |
| 919 | 3300061734 | Ga0530510_0560488 | Ga0530510_0560488_194_643 | 149 |
| 920 | 3300005344 | Ga0070661_100140084 | Ga0070661_1001400842 | 150 |
| 921 | 3300005434 | Ga0070709_10386241 | Ga0070709_103862412 | 150 |
| 922 | 3300005455 | Ga0070663_100867727 | Ga0070663_1008677272 | 150 |
| 923 | 3300006178 | Ga0075367_10704883 | Ga0075367_107048831 | 150 |
| 924 | 3300009098 | Ga0105245_10012395 | Ga0105245_100123956 | 150 |
| 925 | 3300009098 | Ga0105245_10502889 | Ga0105245_105028892 | 150 |
| 926 | 3300009177 | Ga0105248_10296570 | Ga0105248_102965703 | 150 |
| 927 | 3300014325 | Ga0163163_10233481 | Ga0163163_102334813 | 150 |
| 928 | 3300014969 | Ga0157376_12418025 | Ga0157376_124180251 | 150 |
| 929 | 3300015262 | Ga0182007_10151282 | Ga0182007_101512821 | 150 |
| 930 | 3300025915 | Ga0207693_10040137 | Ga0207693_100401373 | 150 |
| 931 | 3300028379 | Ga0268266_11240317 | Ga0268266_112403171 | 150 |
| 932 | 3300031251 | Ga0265327_10040289 | Ga0265327_100402893 | 150 |
| 933 | 3300031548 | Ga0307408_100881441 | Ga0307408_1008814411 | 150 |
| 934 | 3300031731 | Ga0307405_10685370 | Ga0307405_106853702 | 150 |
| 935 | 3300037312 | Ga0395899_0089674 | Ga0395899_0089674_77_529 | 150 |
| 936 | 3300037418 | Ga0395900_0002249 | Ga0395900_0002249_5476_5928 | 150 |
| 937 | 3300037418 | Ga0395900_0003362 | Ga0395900_0003362_2912_3364 | 150 |
| 938 | 3300037418 | Ga0395900_0006716 | Ga0395900_0006716_4746_5201 | 150 |
| 939 | 3300037418 | Ga0395900_0007766 | Ga0395900_0007766_3525_3980 | 150 |
| 940 | 3300037418 | Ga0395900_0102290 | Ga0395900_0102290_1868_2320 | 150 |
| 941 | 3300037466 | Ga0395898_0001213 | Ga0395898_0001213_27169_27621 | 150 |
| 942 | 3300037466 | Ga0395898_0020563 | Ga0395898_0020563_85_537 | 150 |
| 943 | 3300037466 | Ga0395898_0028831 | Ga0395898_0028831_93_548 | 150 |
| 944 | 3300037466 | Ga0395898_0110958 | Ga0395898_0110958_89_541 | 150 |
| 945 | 3300037466 | Ga0395898_0133413 | Ga0395898_0133413_392_844 | 150 |
| 946 | 3300037466 | Ga0395898_0729085 | Ga0395898_0729085_464_916 | 150 |
| 947 | 3300037466 | Ga0395898_0918769 | Ga0395898_0918769_145_600 | 150 |
| 948 | 3300037466 | Ga0395898_1896003 | Ga0395898_1896003_41_493 | 150 |
| 949 | 3300037471 | Ga0395905_0004783 | Ga0395905_0004783_2586_3038 | 150 |
| 950 | 3300037471 | Ga0395905_0006777 | Ga0395905_0006777_7792_8244 | 150 |
| 951 | 3300037471 | Ga0395905_0011439 | Ga0395905_0011439_472_927 | 150 |
| 952 | 3300037471 | Ga0395905_0061123 | Ga0395905_0061123_32_484 | 150 |
| 953 | 3300037471 | Ga0395905_0463257 | Ga0395905_0463257_550_1005 | 150 |
| 954 | 3300038443 | Ga0395901_0000809 | Ga0395901_0000809_9230_9682 | 150 |
| 955 | 3300038443 | Ga0395901_0006756 | Ga0395901_0006756_6963_7415 | 150 |
| 956 | 3300038443 | Ga0395901_0006980 | Ga0395901_0006980_5090_5545 | 150 |
| 957 | 3300038443 | Ga0395901_0074149 | Ga0395901_0074149_258_710 | 150 |
| 958 | 3300038443 | Ga0395901_0077280 | Ga0395901_0077280_2454_2906 | 150 |
| 959 | 3300038443 | Ga0395901_0101550 | Ga0395901_0101550_59_514 | 150 |
| 960 | 3300038443 | Ga0395901_0558716 | Ga0395901_0558716_50_502 | 150 |
| 961 | 3300041443 | Ga0451789_0993490 | Ga0451789_0993490_74_526 | 150 |
| 962 | 3300041459 | Ga0451800_1121739 | Ga0451800_1121739_267_719 | 150 |
| 963 | 3300046474 | Ga0495605_0246811 | Ga0495605_0246811_203_655 | 150 |
| 964 | 3300046491 | Ga0495584_0420765 | Ga0495584_0420765_63_515 | 150 |
| 965 | 3300046500 | Ga0495596_0267132 | Ga0495596_0267132_85_537 | 150 |
| 966 | 3300046511 | Ga0495608_0848061 | Ga0495608_0848061_34_486 | 150 |
| 967 | 3300046518 | Ga0495631_0260207 | Ga0495631_0260207_12_464 | 150 |
| 968 | 3300046518 | Ga0495631_0357429 | Ga0495631_0357429_79_531 | 150 |
| 969 | 3300046525 | Ga0495663_0002901 | Ga0495663_0002901_1538_1990 | 150 |
| 970 | 3300046664 | Ga0495659_0005869 | Ga0495659_0005869_2113_2565 | 150 |
| 971 | 3300046684 | Ga0495669_0640959 | Ga0495669_0640959_19_471 | 150 |
| 972 | 3300046794 | Ga0495589_0386230 | Ga0495589_0386230_62_514 | 150 |
| 973 | 3300047444 | Ga0495675_0794262 | Ga0495675_0794262_33_485 | 150 |
| 974 | 3300047446 | Ga0495679_087273 | Ga0495679_087273_19_471 | 150 |
| 975 | 3300047471 | Ga0495684_0468980 | Ga0495684_0468980_163_624 | 150 |
| 976 | 3300048903 | Ga0496100_0112371 | Ga0496100_0112371_313_765 | 150 |
| 977 | 3300048904 | Ga0496101_0044862 | Ga0496101_0044862_1216_1668 | 150 |
| 978 | 3300048904 | Ga0496101_0095461 | Ga0496101_0095461_829_1281 | 150 |
| 979 | 3300048906 | Ga0496103_0014934 | Ga0496103_0014934_466_918 | 150 |
| 980 | 3300048906 | Ga0496103_0256971 | Ga0496103_0256971_96_548 | 150 |
| 981 | 3300048907 | Ga0496104_1377422 | Ga0496104_1377422_70_522 | 150 |
| 982 | 3300048908 | Ga0496105_0446533 | Ga0496105_0446533_434_886 | 150 |
| 983 | 3300048909 | Ga0496106_1255153 | Ga0496106_1255153_110_562 | 150 |
| 984 | 3300048910 | Ga0496107_0583830 | Ga0496107_0583830_238_690 | 150 |
| 985 | 3300048911 | Ga0496108_0010249 | Ga0496108_0010249_4747_5199 | 150 |
| 986 | 3300048911 | Ga0496108_0593903 | Ga0496108_0593903_61_513 | 150 |
| 987 | 3300048912 | Ga0496109_0003753 | Ga0496109_0003753_8624_9076 | 150 |
| 988 | 3300048912 | Ga0496109_0368632 | Ga0496109_0368632_633_1085 | 150 |
| 989 | 3300048913 | Ga0496110_0041397 | Ga0496110_0041397_980_1432 | 150 |
| 990 | 3300048913 | Ga0496110_0260112 | Ga0496110_0260112_604_1056 | 150 |
| 991 | 3300048913 | Ga0496110_0299571 | Ga0496110_0299571_915_1367 | 150 |
| 992 | 3300048914 | Ga0496111_0000268 | Ga0496111_0000268_16709_17161 | 150 |
| 993 | 3300048915 | Ga0496112_0044452 | Ga0496112_0044452_3328_3780 | 150 |
| 994 | 3300048915 | Ga0496112_1805120 | Ga0496112_1805120_22_474 | 150 |
| 995 | 3300048916 | Ga0496113_0070947 | Ga0496113_0070947_1829_2281 | 150 |
| 996 | 3300048916 | Ga0496113_0220859 | Ga0496113_0220859_63_515 | 150 |
| 997 | 3300048917 | Ga0496114_0043115 | Ga0496114_0043115_516_968 | 150 |
| 998 | 3300048917 | Ga0496114_0748186 | Ga0496114_0748186_260_712 | 150 |
| 999 | 3300050492 | nmdc:mga0yw44_170136_c1 | nmdc:mga0yw44_170136_c1_282_734 | 150 |
| 1000 | 3300050492 | nmdc:mga0yw44_995252_c1 | nmdc:mga0yw44_995252_c1_65_517 | 150 |
| 1001 | 3300050507 | nmdc:mga05p37_741755_c1 | nmdc:mga05p37_741755_c1_406_861 | 150 |
| 1002 | 3300059490 | Ga0587066_155087 | Ga0587066_155087_60_512 | 150 |
| 1003 | 3300059493 | Ga0587077_077747 | Ga0587077_077747_250_702 | 150 |
| 1004 | 3300059605 | Ga0587106_050627 | Ga0587106_050627_144_596 | 150 |
| 1005 | 3300059622 | Ga0587099_029092 | Ga0587099_029092_118_570 | 150 |
| 1006 | 3300059630 | Ga0587128_068964 | Ga0587128_068964_183_635 | 150 |
| 1007 | 3300059652 | Ga0587107_090601 | Ga0587107_090601_62_514 | 150 |
| 1008 | 3300059655 | Ga0587114_098672 | Ga0587114_098672_51_503 | 150 |
| 1009 | 3300060344 | Ga0587071_121864 | Ga0587071_121864_58_510 | 150 |
| 1010 | 3300025915 | Ga0207693_10599205 | Ga0207693_105992052 | 151 |
| 1011 | 3300026067 | Ga0207678_10303312 | Ga0207678_103033122 | 151 |
| 1012 | 3300050508 | nmdc:mga09592_409810_c1 | nmdc:mga09592_409810_c1_19_531 | 151 |
| 1013 | 3300050509 | nmdc:mga0qj67_497499_c1 | nmdc:mga0qj67_497499_c1_218_730 | 151 |
| 1014 | 3300005329 | Ga0070683_100616578 | Ga0070683_1006165781 | 152 |
| 1015 | 3300005338 | Ga0068868_100962164 | Ga0068868_1009621641 | 152 |
| 1016 | 3300005354 | Ga0070675_100249193 | Ga0070675_1002491932 | 152 |
| 1017 | 3300005356 | Ga0070674_100119094 | Ga0070674_1001190942 | 152 |
| 1018 | 3300005438 | Ga0070701_10340226 | Ga0070701_103402261 | 152 |
| 1019 | 3300005466 | Ga0070685_10079715 | Ga0070685_100797151 | 152 |
| 1020 | 3300005518 | Ga0070699_100082900 | Ga0070699_1000829004 | 152 |
| 1021 | 3300005549 | Ga0070704_100761258 | Ga0070704_1007612581 | 152 |
| 1022 | 3300005615 | Ga0070702_100428554 | Ga0070702_1004285542 | 152 |
| 1023 | 3300009148 | Ga0105243_10075049 | Ga0105243_100750494 | 152 |
| 1024 | 3300012515 | Ga0157338_1057235 | Ga0157338_10572351 | 152 |
| 1025 | 3300014325 | Ga0163163_10177243 | Ga0163163_101772431 | 152 |
| 1026 | 3300014326 | Ga0157380_10219626 | Ga0157380_102196262 | 152 |
| 1027 | 3300025926 | Ga0207659_10045709 | Ga0207659_100457093 | 152 |
| 1028 | 3300025927 | Ga0207687_10948390 | Ga0207687_109483901 | 152 |
| 1029 | 3300025929 | Ga0207664_10945917 | Ga0207664_109459171 | 152 |
| 1030 | 3300025935 | Ga0207709_10079938 | Ga0207709_100799382 | 152 |
| 1031 | 3300025937 | Ga0207669_10220113 | Ga0207669_102201132 | 152 |
| 1032 | 3300025942 | Ga0207689_10355326 | Ga0207689_103553262 | 152 |
| 1033 | 3300026088 | Ga0207641_11034157 | Ga0207641_110341571 | 152 |
| 1034 | 3300028379 | Ga0268266_10626469 | Ga0268266_106264692 | 152 |
| 1035 | 3300031595 | Ga0265313_10171330 | Ga0265313_101713302 | 152 |
| 1036 | 3300031824 | Ga0307413_10133173 | Ga0307413_101331732 | 152 |
| 1037 | 3300031824 | Ga0307413_10208002 | Ga0307413_102080022 | 152 |
| 1038 | 3300031852 | Ga0307410_11069234 | Ga0307410_110692342 | 152 |
| 1039 | 3300031901 | Ga0307406_10491808 | Ga0307406_104918081 | 152 |
| 1040 | 3300031903 | Ga0307407_11433451 | Ga0307407_114334511 | 152 |
| 1041 | 3300032002 | Ga0307416_100227725 | Ga0307416_1002277252 | 152 |
| 1042 | 3300032002 | Ga0307416_100385547 | Ga0307416_1003855472 | 152 |
| 1043 | 3300032002 | Ga0307416_100640371 | Ga0307416_1006403712 | 152 |
| 1044 | 3300032002 | Ga0307416_101965094 | Ga0307416_1019650941 | 152 |
| 1045 | 3300032126 | Ga0307415_100303402 | Ga0307415_1003034022 | 152 |
| 1046 | 3300042004 | Ga0439445_0025872 | Ga0439445_0025872_318_779 | 152 |
| 1047 | 3300042145 | Ga0450906_059770 | Ga0450906_059770_88_549 | 152 |
| 1048 | 3300042146 | Ga0450907_014954 | Ga0450907_014954_491_952 | 152 |
| 1049 | 3300042147 | Ga0450910_052409 | Ga0450910_052409_56_517 | 152 |
| 1050 | 3300042435 | Ga0439434_0062341 | Ga0439434_0062341_417_878 | 152 |
| 1051 | 3300042531 | Ga0450918_058941 | Ga0450918_058941_76_537 | 152 |
| 1052 | 3300046518 | Ga0495631_0160449 | Ga0495631_0160449_74_535 | 152 |
| 1053 | 3300046518 | Ga0495631_0206952 | Ga0495631_0206952_157_618 | 152 |
| 1054 | 3300046523 | Ga0495644_0072877 | Ga0495644_0072877_197_658 | 152 |
| 1055 | 3300046615 | Ga0495656_0316474 | Ga0495656_0316474_15_476 | 152 |
| 1056 | 3300046615 | Ga0495656_0384359 | Ga0495656_0384359_149_610 | 152 |
| 1057 | 3300048090 | Ga0495615_0098767 | Ga0495615_0098767_286_747 | 152 |
| 1058 | 3300049531 | Ga0501315_075734 | Ga0501315_075734_40_501 | 152 |
| 1059 | 3300049533 | Ga0501317_081759 | Ga0501317_081759_60_521 | 152 |
| 1060 | 3300049568 | Ga0501031_0020421 | Ga0501031_0020421_235_696 | 152 |
| 1061 | 3300049569 | Ga0501032_0106525 | Ga0501032_0106525_86_547 | 152 |
| 1062 | 3300049570 | Ga0501033_0299050 | Ga0501033_0299050_16_477 | 152 |
| 1063 | 3300049572 | Ga0501036_0008154 | Ga0501036_0008154_2595_3056 | 152 |
| 1064 | 3300049573 | Ga0501037_0072648 | Ga0501037_0072648_1420_1881 | 152 |
| 1065 | 3300049574 | Ga0501038_0075580 | Ga0501038_0075580_2147_2608 | 152 |
| 1066 | 3300049574 | Ga0501038_0463156 | Ga0501038_0463156_29_490 | 152 |
| 1067 | 3300049575 | Ga0501039_0022610 | Ga0501039_0022610_2087_2548 | 152 |
| 1068 | 3300049576 | Ga0501040_0029428 | Ga0501040_0029428_1156_1617 | 152 |
| 1069 | 3300049577 | Ga0501041_0025936 | Ga0501041_0025936_2089_2550 | 152 |
| 1070 | 3300049578 | Ga0501042_0004455 | Ga0501042_0004455_4268_4729 | 152 |
| 1071 | 3300049580 | Ga0501046_0045758 | Ga0501046_0045758_473_934 | 152 |
| 1072 | 3300049582 | Ga0501048_0026410 | Ga0501048_0026410_2290_2751 | 152 |
| 1073 | 3300049585 | Ga0501069_0090960 | Ga0501069_0090960_132_593 | 152 |
| 1074 | 3300049587 | Ga0501071_0015906 | Ga0501071_0015906_2364_2825 | 152 |
| 1075 | 3300049588 | Ga0501072_0005956 | Ga0501072_0005956_2543_3004 | 152 |
| 1076 | 3300049589 | Ga0501073_0363800 | Ga0501073_0363800_171_632 | 152 |
| 1077 | 3300049590 | Ga0501074_0250499 | Ga0501074_0250499_294_755 | 152 |
| 1078 | 3300049592 | Ga0501076_0073176 | Ga0501076_0073176_784_1245 | 152 |
| 1079 | 3300049741 | Ga0501079_0027705 | Ga0501079_0027705_2371_2832 | 152 |
| 1080 | 3300049741 | Ga0501079_1082212 | Ga0501079_1082212_109_570 | 152 |
| 1081 | 3300049743 | Ga0501081_0034980 | Ga0501081_0034980_549_1010 | 152 |
| 1082 | 3300049774 | Ga0501278_018503 | Ga0501278_018503_105_566 | 152 |
| 1083 | 3300049824 | Ga0501045_0049757 | Ga0501045_0049757_556_1017 | 152 |
| 1084 | 3300054114 | Ga0501084_0007712 | Ga0501084_0007712_1120_1581 | 152 |
| 1085 | 3300059423 | Ga0590074_048561 | Ga0590074_048561_174_635 | 152 |
| 1086 | 3300059424 | Ga0590075_021758 | Ga0590075_021758_671_1132 | 152 |
| 1087 | 3300059424 | Ga0590075_027704 | Ga0590075_027704_298_759 | 152 |
| 1088 | 3300059426 | Ga0590077_077850 | Ga0590077_077850_111_572 | 152 |
| 1089 | 3300060353 | Ga0501082_0047529 | Ga0501082_0047529_1872_2333 | 152 |
| 1090 | 3300060353 | Ga0501082_0728445 | Ga0501082_0728445_254_715 | 152 |
| 1091 | 3300061734 | Ga0530510_0004914 | Ga0530510_0004914_5909_6370 | 152 |
| 1092 | 3300005564 | Ga0070664_100671501 | Ga0070664_1006715012 | 153 |
| 1093 | 3300009093 | Ga0105240_10013540 | Ga0105240_100135403 | 153 |
| 1094 | 3300009545 | Ga0105237_10061228 | Ga0105237_100612283 | 153 |
| 1095 | 3300013307 | Ga0157372_10048315 | Ga0157372_100483155 | 153 |
| 1096 | 3300020069 | Ga0197907_10040416 | Ga0197907_100404162 | 153 |
| 1097 | 3300020070 | Ga0206356_10504429 | Ga0206356_105044292 | 153 |
| 1098 | 3300020075 | Ga0206349_1571039 | Ga0206349_15710391 | 153 |
| 1099 | 3300020076 | Ga0206355_1313739 | Ga0206355_13137392 | 153 |
| 1100 | 3300020080 | Ga0206350_10918953 | Ga0206350_109189532 | 153 |
| 1101 | 3300020082 | Ga0206353_11321372 | Ga0206353_113213721 | 153 |
| 1102 | 3300022467 | Ga0224712_10142503 | Ga0224712_101425032 | 153 |
| 1103 | 3300025913 | Ga0207695_10013582 | Ga0207695_100135827 | 153 |
| 1104 | 3300025919 | Ga0207657_10250020 | Ga0207657_102500203 | 153 |
| 1105 | 3300026089 | Ga0207648_10026457 | Ga0207648_100264576 | 153 |
| 1106 | 3300028800 | Ga0265338_10071275 | Ga0265338_100712754 | 153 |
| 1107 | 3300032126 | Ga0307415_101298074 | Ga0307415_1012980741 | 153 |
| 1108 | 3300036401 | Ga0373937_1032637 | Ga0373937_1032637_123_584 | 153 |
| 1109 | 3300038443 | Ga0395901_1394686 | Ga0395901_1394686_35_496 | 153 |
| 1110 | 3300044683 | Ga0466965_0279540 | Ga0466965_0279540_82_543 | 153 |
| 1111 | 3300044684 | Ga0466966_0041164 | Ga0466966_0041164_720_1181 | 153 |
| 1112 | 3300044693 | Ga0466961_0024090 | Ga0466961_0024090_1471_1932 | 153 |
| 1113 | 3300044693 | Ga0466961_0202950 | Ga0466961_0202950_615_1076 | 153 |
| 1114 | 3300044694 | Ga0466963_0006073 | Ga0466963_0006073_144_605 | 153 |
| 1115 | 3300044706 | Ga0466964_0065227 | Ga0466964_0065227_962_1423 | 153 |
| 1116 | 3300044735 | Ga0466968_0024637 | Ga0466968_0024637_684_1145 | 153 |
| 1117 | 3300044842 | Ga0466957_0021324 | Ga0466957_0021324_852_1313 | 153 |
| 1118 | 3300044842 | Ga0466957_0024900 | Ga0466957_0024900_2674_3135 | 153 |
| 1119 | 3300044842 | Ga0466957_0146888 | Ga0466957_0146888_890_1351 | 153 |
| 1120 | 3300045049 | Ga0466959_0033845 | Ga0466959_0033845_2466_2927 | 153 |
| 1121 | 3300045836 | Ga0466958_0002356 | Ga0466958_0002356_7694_8155 | 153 |
| 1122 | 3300045836 | Ga0466958_0004437 | Ga0466958_0004437_4965_5426 | 153 |
| 1123 | 3300045976 | Ga0466967_0794600 | Ga0466967_0794600_391_852 | 153 |
| 1124 | 3300049583 | Ga0501067_0085329 | Ga0501067_0085329_982_1443 | 153 |
| 1125 | 3300059492 | Ga0587073_0148781 | Ga0587073_0148781_175_636 | 153 |
| 1126 | 3300061719 | Ga0466962_0011131 | Ga0466962_0011131_1152_1613 | 153 |
| 1127 | 3300061719 | Ga0466962_0111257 | Ga0466962_0111257_212_673 | 153 |
| 1128 | 3300006852 | Ga0075433_10005721 | Ga0075433_100057216 | 154 |
| 1129 | 3300006871 | Ga0075434_100002659 | Ga0075434_1000026598 | 154 |
| 1130 | 3300007076 | Ga0075435_100002008 | Ga0075435_1000020088 | 154 |
| 1131 | 3300009174 | Ga0105241_10829768 | Ga0105241_108297682 | 154 |
| 1132 | 3300027876 | Ga0209974_10060311 | Ga0209974_100603112 | 154 |
| 1133 | 3300027907 | Ga0207428_10273354 | Ga0207428_102733542 | 154 |
| 1134 | 3300028563 | Ga0265319_1047886 | Ga0265319_10478862 | 154 |
| 1135 | 3300028577 | Ga0265318_10041967 | Ga0265318_100419671 | 154 |
| 1136 | 3300035171 | Ga0373946_0241158 | Ga0373946_0241158_194_658 | 154 |
| 1137 | 3300035241 | Ga0373961_0075692 | Ga0373961_0075692_147_611 | 154 |
| 1138 | 3300035695 | Ga0373927_0041489 | Ga0373927_0041489_81_545 | 154 |
| 1139 | 3300035725 | Ga0373947_0030406 | Ga0373947_0030406_2214_2678 | 154 |
| 1140 | 3300037068 | Ga0373925_0196937 | Ga0373925_0196937_115_579 | 154 |
| 1141 | 3300044842 | Ga0466957_0266953 | Ga0466957_0266953_638_1102 | 154 |
| 1142 | 3300045836 | Ga0466958_0274513 | Ga0466958_0274513_111_575 | 154 |
| 1143 | 3300045976 | Ga0466967_0283936 | Ga0466967_0283936_407_871 | 154 |
| 1144 | 3300047315 | Ga0495581_0155844 | Ga0495581_0155844_33_497 | 154 |
| 1145 | 3300047321 | Ga0495676_0019336 | Ga0495676_0019336_1319_1783 | 154 |
| 1146 | 3300048915 | Ga0496112_0148963 | Ga0496112_0148963_1679_2143 | 154 |
| 1147 | 3300028800 | Ga0265338_10005686 | Ga0265338_100056865 | 155 |
| 1148 | 3300028800 | Ga0265338_10049336 | Ga0265338_100493362 | 155 |
| 1149 | 3300031595 | Ga0265313_10054249 | Ga0265313_100542492 | 155 |
| 1150 | 3300059493 | Ga0587077_223962 | Ga0587077_223962_16_483 | 155 |
| 1151 | 3300003203 | JGI25406J46586_10142367 | JGI25406J46586_101423671 | 156 |
| 1152 | 3300005330 | Ga0070690_100176178 | Ga0070690_1001761782 | 156 |
| 1153 | 3300005335 | Ga0070666_10035265 | Ga0070666_100352652 | 156 |
| 1154 | 3300005337 | Ga0070682_100001302 | Ga0070682_10000130210 | 156 |
| 1155 | 3300005338 | Ga0068868_100640378 | Ga0068868_1006403781 | 156 |
| 1156 | 3300005339 | Ga0070660_100085859 | Ga0070660_1000858592 | 156 |
| 1157 | 3300005341 | Ga0070691_10127175 | Ga0070691_101271752 | 156 |
| 1158 | 3300005343 | Ga0070687_100070312 | Ga0070687_1000703122 | 156 |
| 1159 | 3300005354 | Ga0070675_100087510 | Ga0070675_1000875103 | 156 |
| 1160 | 3300005355 | Ga0070671_100072418 | Ga0070671_1000724182 | 156 |
| 1161 | 3300005356 | Ga0070674_100038392 | Ga0070674_1000383922 | 156 |
| 1162 | 3300005365 | Ga0070688_100001012 | Ga0070688_10000101214 | 156 |
| 1163 | 3300005366 | Ga0070659_100022325 | Ga0070659_1000223253 | 156 |
| 1164 | 3300005437 | Ga0070710_10025685 | Ga0070710_100256855 | 156 |
| 1165 | 3300005438 | Ga0070701_10004495 | Ga0070701_100044953 | 156 |
| 1166 | 3300005439 | Ga0070711_100482290 | Ga0070711_1004822901 | 156 |
| 1167 | 3300005440 | Ga0070705_100050391 | Ga0070705_1000503912 | 156 |
| 1168 | 3300005441 | Ga0070700_100003038 | Ga0070700_1000030381 | 156 |
| 1169 | 3300005444 | Ga0070694_100016536 | Ga0070694_1000165366 | 156 |
| 1170 | 3300005445 | Ga0070708_100014812 | Ga0070708_1000148121 | 156 |
| 1171 | 3300005445 | Ga0070708_100864005 | Ga0070708_1008640051 | 156 |
| 1172 | 3300005455 | Ga0070663_100074698 | Ga0070663_1000746982 | 156 |
| 1173 | 3300005456 | Ga0070678_100001535 | Ga0070678_1000015352 | 156 |
| 1174 | 3300005456 | Ga0070678_100975265 | Ga0070678_1009752651 | 156 |
| 1175 | 3300005458 | Ga0070681_10522189 | Ga0070681_105221892 | 156 |
| 1176 | 3300005459 | Ga0068867_100008961 | Ga0068867_1000089611 | 156 |
| 1177 | 3300005466 | Ga0070685_10100491 | Ga0070685_101004911 | 156 |
| 1178 | 3300005467 | Ga0070706_100036752 | Ga0070706_1000367524 | 156 |
| 1179 | 3300005467 | Ga0070706_100044922 | Ga0070706_1000449222 | 156 |
| 1180 | 3300005467 | Ga0070706_100277171 | Ga0070706_1002771712 | 156 |
| 1181 | 3300005468 | Ga0070707_100043213 | Ga0070707_1000432137 | 156 |
| 1182 | 3300005468 | Ga0070707_100079618 | Ga0070707_1000796183 | 156 |
| 1183 | 3300005471 | Ga0070698_100017750 | Ga0070698_1000177505 | 156 |
| 1184 | 3300005471 | Ga0070698_100106515 | Ga0070698_1001065152 | 156 |
| 1185 | 3300005518 | Ga0070699_100057336 | Ga0070699_1000573365 | 156 |
| 1186 | 3300005536 | Ga0070697_100144998 | Ga0070697_1001449982 | 156 |
| 1187 | 3300005539 | Ga0068853_100033631 | Ga0068853_1000336313 | 156 |
| 1188 | 3300005543 | Ga0070672_100098064 | Ga0070672_1000980642 | 156 |
| 1189 | 3300005544 | Ga0070686_100000601 | Ga0070686_10000060115 | 156 |
| 1190 | 3300005544 | Ga0070686_100338468 | Ga0070686_1003384681 | 156 |
| 1191 | 3300005545 | Ga0070695_100048362 | Ga0070695_1000483622 | 156 |
| 1192 | 3300005546 | Ga0070696_100004604 | Ga0070696_1000046042 | 156 |
| 1193 | 3300005547 | Ga0070693_100018284 | Ga0070693_1000182843 | 156 |
| 1194 | 3300005548 | Ga0070665_100023330 | Ga0070665_1000233302 | 156 |
| 1195 | 3300005549 | Ga0070704_100013972 | Ga0070704_1000139723 | 156 |
| 1196 | 3300005578 | Ga0068854_100266352 | Ga0068854_1002663522 | 156 |
| 1197 | 3300005615 | Ga0070702_100001307 | Ga0070702_1000013073 | 156 |
| 1198 | 3300005616 | Ga0068852_100144997 | Ga0068852_1001449972 | 156 |
| 1199 | 3300005617 | Ga0068859_100142576 | Ga0068859_1001425762 | 156 |
| 1200 | 3300005618 | Ga0068864_100393932 | Ga0068864_1003939322 | 156 |
| 1201 | 3300005718 | Ga0068866_10001893 | Ga0068866_100018933 | 156 |
| 1202 | 3300005719 | Ga0068861_100051803 | Ga0068861_1000518035 | 156 |
| 1203 | 3300005843 | Ga0068860_100060561 | Ga0068860_1000605612 | 156 |
| 1204 | 3300005937 | Ga0081455_10194196 | Ga0081455_101941963 | 156 |
| 1205 | 3300005985 | Ga0081539_10064603 | Ga0081539_100646032 | 156 |
| 1206 | 3300006028 | Ga0070717_10028663 | Ga0070717_100286634 | 156 |
| 1207 | 3300006038 | Ga0075365_10004466 | Ga0075365_100044663 | 156 |
| 1208 | 3300006173 | Ga0070716_100068231 | Ga0070716_1000682312 | 156 |
| 1209 | 3300006175 | Ga0070712_100025620 | Ga0070712_1000256202 | 156 |
| 1210 | 3300006237 | Ga0097621_100047104 | Ga0097621_1000471042 | 156 |
| 1211 | 3300006358 | Ga0068871_100021840 | Ga0068871_1000218401 | 156 |
| 1212 | 3300006852 | Ga0075433_10009447 | Ga0075433_100094474 | 156 |
| 1213 | 3300006881 | Ga0068865_100005218 | Ga0068865_1000052187 | 156 |
| 1214 | 3300006914 | Ga0075436_100028807 | Ga0075436_1000288072 | 156 |
| 1215 | 3300006931 | Ga0097620_100142577 | Ga0097620_1001425772 | 156 |
| 1216 | 3300009094 | Ga0111539_10012599 | Ga0111539_100125992 | 156 |
| 1217 | 3300009147 | Ga0114129_10063624 | Ga0114129_100636242 | 156 |
| 1218 | 3300009147 | Ga0114129_10103975 | Ga0114129_101039753 | 156 |
| 1219 | 3300020070 | Ga0206356_11574066 | Ga0206356_115740661 | 156 |
| 1220 | 3300022467 | Ga0224712_10285055 | Ga0224712_102850552 | 156 |
| 1221 | 3300025898 | Ga0207692_10017198 | Ga0207692_100171985 | 156 |
| 1222 | 3300025898 | Ga0207692_10154077 | Ga0207692_101540772 | 156 |
| 1223 | 3300025899 | Ga0207642_10002179 | Ga0207642_100021792 | 156 |
| 1224 | 3300025903 | Ga0207680_10015996 | Ga0207680_100159965 | 156 |
| 1225 | 3300025904 | Ga0207647_10033839 | Ga0207647_100338396 | 156 |
| 1226 | 3300025910 | Ga0207684_10049468 | Ga0207684_100494683 | 156 |
| 1227 | 3300025910 | Ga0207684_10469504 | Ga0207684_104695042 | 156 |
| 1228 | 3300025911 | Ga0207654_10302127 | Ga0207654_103021272 | 156 |
| 1229 | 3300025914 | Ga0207671_10135658 | Ga0207671_101356582 | 156 |
| 1230 | 3300025915 | Ga0207693_10000778 | Ga0207693_1000077814 | 156 |
| 1231 | 3300025916 | Ga0207663_10014147 | Ga0207663_100141472 | 156 |
| 1232 | 3300025918 | Ga0207662_10030100 | Ga0207662_100301002 | 156 |
| 1233 | 3300025919 | Ga0207657_10033669 | Ga0207657_100336692 | 156 |
| 1234 | 3300025922 | Ga0207646_10000865 | Ga0207646_1000086528 | 156 |
| 1235 | 3300025922 | Ga0207646_10045627 | Ga0207646_100456273 | 156 |
| 1236 | 3300025927 | Ga0207687_10011371 | Ga0207687_100113712 | 156 |
| 1237 | 3300025928 | Ga0207700_10187624 | Ga0207700_101876242 | 156 |
| 1238 | 3300025931 | Ga0207644_10155769 | Ga0207644_101557692 | 156 |
| 1239 | 3300025932 | Ga0207690_10011765 | Ga0207690_100117653 | 156 |
| 1240 | 3300025934 | Ga0207686_10006786 | Ga0207686_100067866 | 156 |
| 1241 | 3300025935 | Ga0207709_10000655 | Ga0207709_1000065519 | 156 |
| 1242 | 3300025935 | Ga0207709_10454922 | Ga0207709_104549222 | 156 |
| 1243 | 3300025936 | Ga0207670_10014398 | Ga0207670_100143985 | 156 |
| 1244 | 3300025938 | Ga0207704_10002843 | Ga0207704_100028436 | 156 |
| 1245 | 3300025940 | Ga0207691_10023027 | Ga0207691_100230277 | 156 |
| 1246 | 3300025940 | Ga0207691_10771984 | Ga0207691_107719841 | 156 |
| 1247 | 3300025941 | Ga0207711_10065303 | Ga0207711_100653031 | 156 |
| 1248 | 3300025960 | Ga0207651_10112845 | Ga0207651_101128451 | 156 |
| 1249 | 3300025981 | Ga0207640_10290492 | Ga0207640_102904921 | 156 |
| 1250 | 3300026023 | Ga0207677_10630170 | Ga0207677_106301702 | 156 |
| 1251 | 3300026041 | Ga0207639_10041612 | Ga0207639_100416122 | 156 |
| 1252 | 3300026067 | Ga0207678_10006293 | Ga0207678_100062932 | 156 |
| 1253 | 3300026075 | Ga0207708_10000468 | Ga0207708_1000046816 | 156 |
| 1254 | 3300026075 | Ga0207708_10509060 | Ga0207708_105090601 | 156 |
| 1255 | 3300026089 | Ga0207648_10000801 | Ga0207648_1000080128 | 156 |
| 1256 | 3300026095 | Ga0207676_10068223 | Ga0207676_100682235 | 156 |
| 1257 | 3300026118 | Ga0207675_100011585 | Ga0207675_1000115855 | 156 |
| 1258 | 3300026121 | Ga0207683_10000041 | Ga0207683_1000004160 | 156 |
| 1259 | 3300026142 | Ga0207698_10159015 | Ga0207698_101590152 | 156 |
| 1260 | 3300028379 | Ga0268266_10316526 | Ga0268266_103165262 | 156 |
| 1261 | 3300028381 | Ga0268264_10666097 | Ga0268264_106660972 | 156 |
| 1262 | 3300037312 | Ga0395899_0005142 | Ga0395899_0005142_4249_4719 | 156 |
| 1263 | 3300037312 | Ga0395899_0086273 | Ga0395899_0086273_829_1314 | 156 |
| 1264 | 3300037418 | Ga0395900_0001655 | Ga0395900_0001655_6177_6647 | 156 |
| 1265 | 3300037418 | Ga0395900_0017894 | Ga0395900_0017894_1712_2182 | 156 |
| 1266 | 3300037418 | Ga0395900_0027097 | Ga0395900_0027097_4107_4577 | 156 |
| 1267 | 3300037418 | Ga0395900_0181058 | Ga0395900_0181058_198_683 | 156 |
| 1268 | 3300037466 | Ga0395898_0060749 | Ga0395898_0060749_1018_1488 | 156 |
| 1269 | 3300037466 | Ga0395898_0149816 | Ga0395898_0149816_1421_1891 | 156 |
| 1270 | 3300037466 | Ga0395898_0564518 | Ga0395898_0564518_551_1021 | 156 |
| 1271 | 3300037471 | Ga0395905_0020345 | Ga0395905_0020345_1568_2038 | 156 |
| 1272 | 3300037471 | Ga0395905_0129527 | Ga0395905_0129527_26_496 | 156 |
| 1273 | 3300037471 | Ga0395905_0642720 | Ga0395905_0642720_26_496 | 156 |
| 1274 | 3300037471 | Ga0395905_1181163 | Ga0395905_1181163_143_613 | 156 |
| 1275 | 3300038443 | Ga0395901_0009659 | Ga0395901_0009659_8041_8511 | 156 |
| 1276 | 3300038443 | Ga0395901_0060705 | Ga0395901_0060705_2297_2767 | 156 |
| 1277 | 3300038443 | Ga0395901_0077973 | Ga0395901_0077973_1234_1704 | 156 |
| 1278 | 3300038443 | Ga0395901_0413074 | Ga0395901_0413074_688_1158 | 156 |
| 1279 | 3300046500 | Ga0495596_0040412 | Ga0495596_0040412_49_519 | 156 |
| 1280 | 3300046525 | Ga0495663_0003885 | Ga0495663_0003885_3441_3911 | 156 |
| 1281 | 3300046538 | Ga0495609_0049150 | Ga0495609_0049150_442_912 | 156 |
| 1282 | 3300046558 | Ga0495633_0470538 | Ga0495633_0470538_47_517 | 156 |
| 1283 | 3300046615 | Ga0495656_0010427 | Ga0495656_0010427_2616_3086 | 156 |
| 1284 | 3300046664 | Ga0495659_0016342 | Ga0495659_0016342_106_576 | 156 |
| 1285 | 3300046691 | Ga0495670_0114120 | Ga0495670_0114120_781_1251 | 156 |
| 1286 | 3300046794 | Ga0495589_0037338 | Ga0495589_0037338_32_502 | 156 |
| 1287 | 3300047318 | Ga0495636_0109586 | Ga0495636_0109586_260_730 | 156 |
| 1288 | 3300048914 | Ga0496111_0126911 | Ga0496111_0126911_645_1115 | 156 |
| 1289 | 3300050507 | nmdc:mga05p37_40586_c1 | nmdc:mga05p37_40586_c1_1181_1651 | 156 |
| 1290 | 3300050507 | nmdc:mga05p37_87023_c1 | nmdc:mga05p37_87023_c1_2084_2554 | 156 |
| 1291 | 3300050512 | nmdc:mga0n895_45890_c1 | nmdc:mga0n895_45890_c1_2994_3464 | 156 |
| 1292 | 3300050513 | nmdc:mga0rr50_76299_c1 | nmdc:mga0rr50_76299_c1_1027_1497 | 156 |
| 1293 | 3300050514 | nmdc:mga08x19_593749_c1 | nmdc:mga08x19_593749_c1_61_531 | 156 |
| 1294 | 3300050515 | nmdc:mga0a205_53447_c1 | nmdc:mga0a205_53447_c1_3326_3796 | 156 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ek2-assembly1.cif.gz_A | cryo-em structure of vccn1 in lipid nanodisc | 0.5113 | 6 | 110 |
| 6z1r-assembly1.cif.gz_L | bovine atp synthase f1-peripheral stalk domain, state 2 | 0.5113 | 15 | 99 |
| 6ziq-assembly1.cif.gz_N | bovine atp synthase stator domain, state 1 | 0.4975 | 15 | 99 |
| 7ui2-assembly1.cif.gz_A | the crystal structure of 15kda phlebotomus papatasi salivary protein ppsp15. | 0.4963 | 23 | 97 |
| 7ek3-assembly1.cif.gz_A | cryo-em structure of vccn1 y332a mutant in lipid nanodisc | 0.4831 | 6 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10QG0_190_247_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5815 | 44 | 102 | 1.25.10.10 |
| af_Q3E9B4_162_219_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5715 | 46 | 102 | 1.25.10.10 |
| af_Q10LS2_233_292_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5711 | 50 | 101 | 1.25.10.10 |
| af_A0A1D6MF66_318_375_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5703 | 46 | 102 | 1.25.10.10 |
| af_Q9ZU65_234_291_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.57 | 46 | 102 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538GLN0-F1-model_v4 | Uncharacterized protein | 0.7399 | 1 | 156 |
|
| AF-A0A538GLN0-F1-model_v4 | Uncharacterized protein | 0.7354 | 1 | 156 |
|
| AF-A0A538GKP2-F1-model_v4 | Uncharacterized protein | 0.7232 | 10 | 156 |
|
| AF-A0A538GKP2-F1-model_v4 | Uncharacterized protein | 0.7089 | 10 | 156 |
|
| AF-A0A7V9P7A3-F1-model_v4 | Uncharacterized protein | 0.7053 | 31 | 155 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar