F492540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1282 | 506 | 1264 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10433058|Ga0307516_104330581 |
| Length | 252 |
| Sequence | VVYDIPSPAEYDGRSPEGTRAGLGAARRSARGSDFGIFRQMIKVILCDDHALIRRGIRDTLSDAPDIEVIGEAGDYGELRTLMRDHTADVLVLDINLPGRSGLDVLHVLKDEGTAMRVLVVSMYPEDQYAIRALRAGAFGYVNKGGDPSLIVTAVRTVAQGRKYVTPEIAQMLVESLTTPAATNAHEKLSDRELQTLVMIASGKRLSDIAEELMLSPKTVSVYRARVLEKLGLTNNSEMTVYAIRNGLVGGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 8 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 9 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 10 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 11 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 12 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 13 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 14 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 15 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 16 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 17 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 18 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 23 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 25 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 129 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 130 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 239 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 240 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 249 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 275 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 292 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 293 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 294 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 295 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 296 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 297 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 298 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 299 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 303 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 304 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 305 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 306 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 307 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 308 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 309 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 310 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 311 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 312 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 313 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 314 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 315 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 316 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 317 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 318 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 319 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 320 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 321 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 322 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 323 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 324 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 325 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 326 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 327 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 328 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 329 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 330 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 334 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 335 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 336 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 337 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 338 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 339 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 340 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 341 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 342 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 343 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 344 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 347 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 405 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 406 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 407 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 408 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 412 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 413 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 414 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 415 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 416 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 417 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 418 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 419 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 420 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 421 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 422 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 423 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 424 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 425 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 426 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 436 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 437 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 438 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 439 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 440 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 441 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 442 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 443 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 444 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 445 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 446 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 447 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 448 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 451 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 452 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 453 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 454 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 455 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 458 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 463 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 471 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 474 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 478 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 480 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 481 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 482 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 483 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 484 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 485 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 486 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 487 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 488 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 489 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 490 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 491 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 492 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 494 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 501 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 503 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 504 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 505 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.52 |
| Metatranscriptomes | 0.08 |
| Isolates | 1.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.3 |
| Nodule | 0.39 |
| Rhizoplane | 3.12 |
| Rhizosphere | 71.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10019248 | 3300001979 | Bacteria | 2408 |
| 2 | JGI25156J39149_1002048 | 3300002705 | Bacteria | 7673 |
| 3 | JGI25156J39149_1002716 | 3300002705 | Bacteria | 6185 |
| 4 | JGI25156J39149_1007600 | 3300002705 | Bacteria | 2825 |
| 5 | JGI25156J39149_1017236 | 3300002705 | Bacteria | 1375 |
| 6 | JGI25154J39366_1000783 | 3300002738 | Bacteria | 14054 |
| 7 | JGI25157J39369_1000551 | 3300002741 | Bacteria | 22422 |
| 8 | JGI25164J39214_1005629 | 3300002772 | Bacteria | 1351 |
| 9 | JGI25152J39213_1000320 | 3300002773 | Bacteria | 30822 |
| 10 | JGI25150J39212_1022531 | 3300002774 | Bacteria | 946 |
| 11 | JGI25153J46596_10010193 | 3300003215 | Bacteria | 4273 |
| 12 | Ga0006770J48903_1062170 | 3300003305 | Bacteria | 802 |
| 13 | rootH1_10009161 | 3300003316 | Bacteria | 6408 |
| 14 | rootH2_10018416 | 3300003320 | Bacteria | 4692 |
| 15 | rootH2_10083264 | 3300003320 | Bacteria | 2870 |
| 16 | rootH2_10087210 | 3300003320 | Bacteria | 5013 |
| 17 | rootH1_10032898 | 3300003323 | Bacteria | 6131 |
| 18 | Ga0055539_1000766 | 3300003752 | Bacteria | 7778 |
| 19 | Ga0055539_1002353 | 3300003752 | Bacteria | 2944 |
| 20 | Ga0055533_1000053 | 3300003756 | Bacteria | 199478 |
| 21 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 22 | Ga0055525_1001506 | 3300003759 | Bacteria | 3997 |
| 23 | Ga0055535_1001169 | 3300003761 | Bacteria | 15351 |
| 24 | Ga0055535_1018710 | 3300003761 | Bacteria | 895 |
| 25 | Ga0055529_1000431 | 3300003763 | Bacteria | 42425 |
| 26 | Ga0055526_1002642 | 3300003771 | Bacteria | 11968 |
| 27 | Ga0055526_1002801 | 3300003771 | Bacteria | 11550 |
| 28 | Ga0055524_1000233 | 3300003775 | Bacteria | 58967 |
| 29 | Ga0055524_1001969 | 3300003775 | Bacteria | 11002 |
| 30 | Ga0055524_1013683 | 3300003775 | Bacteria | 3051 |
| 31 | Ga0055530_10006306 | 3300003791 | Bacteria | 5332 |
| 32 | Ga0055540_1000080 | 3300003792 | Bacteria | 111063 |
| 33 | Ga0055540_1032332 | 3300003792 | Bacteria | 1194 |
| 34 | Ga0055531_10000043 | 3300003794 | Bacteria | 133906 |
| 35 | Ga0055531_10005579 | 3300003794 | Bacteria | 7342 |
| 36 | Ga0055543_1004230 | 3300004625 | Bacteria | 3969 |
| 37 | Ga0055543_1024592 | 3300004625 | Bacteria | 1080 |
| 38 | Ga0065165_1000390 | 3300005262 | Bacteria | 71262 |
| 39 | Ga0065165_1001585 | 3300005262 | Bacteria | 23411 |
| 40 | Ga0065165_1003937 | 3300005262 | Bacteria | 9775 |
| 41 | Ga0065715_10184216 | 3300005293 | Bacteria | 1456 |
| 42 | Ga0065707_10186254 | 3300005295 | Bacteria | 1387 |
| 43 | Ga0070658_10040482 | 3300005327 | Bacteria | 3759 |
| 44 | Ga0070658_10076570 | 3300005327 | Bacteria | 2743 |
| 45 | Ga0070658_10091163 | 3300005327 | Bacteria | 2512 |
| 46 | Ga0070658_10750308 | 3300005327 | Bacteria | 847 |
| 47 | Ga0070676_10001571 | 3300005328 | Bacteria | 11600 |
| 48 | Ga0070676_10009968 | 3300005328 | Bacteria | 5142 |
| 49 | Ga0070676_10077944 | 3300005328 | Bacteria | 2004 |
| 50 | Ga0070676_10242371 | 3300005328 | Bacteria | 1200 |
| 51 | Ga0070683_100042121 | 3300005329 | Bacteria | 4204 |
| 52 | Ga0070683_100063563 | 3300005329 | Bacteria | 3433 |
| 53 | Ga0070690_100067742 | 3300005330 | Bacteria | 2313 |
| 54 | Ga0070690_100068766 | 3300005330 | Bacteria | 2297 |
| 55 | Ga0070690_100369620 | 3300005330 | Bacteria | 1046 |
| 56 | Ga0070670_100002895 | 3300005331 | Bacteria | 14202 |
| 57 | Ga0070670_100052223 | 3300005331 | Bacteria | 3511 |
| 58 | Ga0070670_100068319 | 3300005331 | Bacteria | 3050 |
| 59 | Ga0070670_100072274 | 3300005331 | Bacteria | 2962 |
| 60 | Ga0070670_100409113 | 3300005331 | Bacteria | 1198 |
| 61 | Ga0070677_10014841 | 3300005333 | Bacteria | 2750 |
| 62 | Ga0068869_100010255 | 3300005334 | Bacteria | 6104 |
| 63 | Ga0068869_100036073 | 3300005334 | Bacteria | 3509 |
| 64 | Ga0068869_100043229 | 3300005334 | Bacteria | 3235 |
| 65 | Ga0068869_100220220 | 3300005334 | Bacteria | 1504 |
| 66 | Ga0068869_100280110 | 3300005334 | Bacteria | 1341 |
| 67 | Ga0070666_10005627 | 3300005335 | Bacteria | 7688 |
| 68 | Ga0070666_10037731 | 3300005335 | Bacteria | 3214 |
| 69 | Ga0070666_10068676 | 3300005335 | Bacteria | 2409 |
| 70 | Ga0070680_100014127 | 3300005336 | Bacteria | 6236 |
| 71 | Ga0068868_100005991 | 3300005338 | Bacteria | 8583 |
| 72 | Ga0068868_100075106 | 3300005338 | Bacteria | 2701 |
| 73 | Ga0068868_100357881 | 3300005338 | Bacteria | 1251 |
| 74 | Ga0068868_100385495 | 3300005338 | Bacteria | 1207 |
| 75 | Ga0070660_100058136 | 3300005339 | Bacteria | 2998 |
| 76 | Ga0070660_100058999 | 3300005339 | Bacteria | 2976 |
| 77 | Ga0070660_100222427 | 3300005339 | Bacteria | 1534 |
| 78 | Ga0070660_100443902 | 3300005339 | Bacteria | 1076 |
| 79 | Ga0070687_100136435 | 3300005343 | Bacteria | 1423 |
| 80 | Ga0070687_100137107 | 3300005343 | Bacteria | 1420 |
| 81 | Ga0070661_100023474 | 3300005344 | Bacteria | 4421 |
| 82 | Ga0070661_100192346 | 3300005344 | Bacteria | 1556 |
| 83 | Ga0070661_100285421 | 3300005344 | Bacteria | 1281 |
| 84 | Ga0070692_10322102 | 3300005345 | Bacteria | 951 |
| 85 | Ga0070668_100005605 | 3300005347 | Bacteria | 9308 |
| 86 | Ga0070668_100142831 | 3300005347 | Bacteria | 1930 |
| 87 | Ga0070668_100271141 | 3300005347 | Bacteria | 1414 |
| 88 | Ga0070669_100015642 | 3300005353 | Bacteria | 5410 |
| 89 | Ga0070669_100020771 | 3300005353 | Bacteria | 4691 |
| 90 | Ga0070669_100026966 | 3300005353 | Bacteria | 4134 |
| 91 | Ga0070669_100126035 | 3300005353 | Bacteria | 1959 |
| 92 | Ga0070669_100242374 | 3300005353 | Bacteria | 1433 |
| 93 | Ga0070669_100252329 | 3300005353 | Bacteria | 1405 |
| 94 | Ga0070669_100455382 | 3300005353 | Bacteria | 1055 |
| 95 | Ga0070675_100021338 | 3300005354 | Bacteria | 5174 |
| 96 | Ga0070675_100025785 | 3300005354 | Bacteria | 4713 |
| 97 | Ga0070675_100029887 | 3300005354 | Bacteria | 4396 |
| 98 | Ga0070675_100035559 | 3300005354 | Bacteria | 4048 |
| 99 | Ga0070675_100036889 | 3300005354 | Bacteria | 3980 |
| 100 | Ga0070675_100074550 | 3300005354 | Bacteria | 2819 |
| 101 | Ga0070675_100101334 | 3300005354 | Bacteria | 2426 |
| 102 | Ga0070675_100121594 | 3300005354 | Bacteria | 2218 |
| 103 | Ga0070675_100564713 | 3300005354 | Bacteria | 1030 |
| 104 | Ga0070671_100002511 | 3300005355 | Bacteria | 14214 |
| 105 | Ga0070671_100014186 | 3300005355 | Bacteria | 6434 |
| 106 | Ga0070671_100017039 | 3300005355 | Bacteria | 5877 |
| 107 | Ga0070671_100050234 | 3300005355 | Bacteria | 3469 |
| 108 | Ga0070671_100053915 | 3300005355 | Bacteria | 3342 |
| 109 | Ga0070671_100056719 | 3300005355 | Bacteria | 3259 |
| 110 | Ga0070671_100134964 | 3300005355 | Bacteria | 2080 |
| 111 | Ga0070671_100170914 | 3300005355 | Bacteria | 1838 |
| 112 | Ga0070674_100017041 | 3300005356 | Bacteria | 4561 |
| 113 | Ga0070674_100036447 | 3300005356 | Bacteria | 3302 |
| 114 | Ga0070674_100429687 | 3300005356 | Bacteria | 1086 |
| 115 | Ga0070673_100001525 | 3300005364 | Bacteria | 13646 |
| 116 | Ga0070673_100005338 | 3300005364 | Bacteria | 8207 |
| 117 | Ga0070673_100012028 | 3300005364 | Bacteria | 5928 |
| 118 | Ga0070673_100090098 | 3300005364 | Bacteria | 2505 |
| 119 | Ga0070673_100097413 | 3300005364 | Bacteria | 2415 |
| 120 | Ga0070673_100246407 | 3300005364 | Bacteria | 1556 |
| 121 | Ga0070673_100773647 | 3300005364 | Bacteria | 885 |
| 122 | Ga0070688_100090969 | 3300005365 | Bacteria | 1994 |
| 123 | Ga0070688_100172768 | 3300005365 | Bacteria | 1493 |
| 124 | Ga0070659_100006770 | 3300005366 | Bacteria | 8291 |
| 125 | Ga0070659_100018804 | 3300005366 | Bacteria | 5216 |
| 126 | Ga0070659_100132044 | 3300005366 | Bacteria | 2028 |
| 127 | Ga0070659_100199327 | 3300005366 | Bacteria | 1647 |
| 128 | Ga0070667_100000702 | 3300005367 | Bacteria | 32315 |
| 129 | Ga0070667_100014692 | 3300005367 | Bacteria | 6467 |
| 130 | Ga0070667_100051164 | 3300005367 | Bacteria | 3482 |
| 131 | Ga0070667_100075701 | 3300005367 | Bacteria | 2874 |
| 132 | Ga0070667_100095534 | 3300005367 | Bacteria | 2563 |
| 133 | Ga0070700_100066458 | 3300005441 | Bacteria | 2289 |
| 134 | Ga0070700_100298003 | 3300005441 | Bacteria | 1176 |
| 135 | Ga0070663_100003281 | 3300005455 | Bacteria | 9317 |
| 136 | Ga0070678_100031660 | 3300005456 | Bacteria | 3652 |
| 137 | Ga0070678_100088709 | 3300005456 | Bacteria | 2365 |
| 138 | Ga0070678_100112182 | 3300005456 | Bacteria | 2135 |
| 139 | Ga0070678_100132721 | 3300005456 | Bacteria | 1981 |
| 140 | Ga0070678_100153184 | 3300005456 | Bacteria | 1859 |
| 141 | Ga0070678_100304969 | 3300005456 | Bacteria | 1354 |
| 142 | Ga0070678_100475515 | 3300005456 | Bacteria | 1099 |
| 143 | Ga0070662_100001681 | 3300005457 | Bacteria | 13600 |
| 144 | Ga0070662_100018885 | 3300005457 | Bacteria | 4672 |
| 145 | Ga0070662_100083930 | 3300005457 | Bacteria | 2379 |
| 146 | Ga0070662_100102524 | 3300005457 | Bacteria | 2168 |
| 147 | Ga0070662_100106906 | 3300005457 | Bacteria | 2126 |
| 148 | Ga0068867_100000329 | 3300005459 | Bacteria | 31296 |
| 149 | Ga0068867_100001329 | 3300005459 | Bacteria | 17124 |
| 150 | Ga0068867_100011396 | 3300005459 | Bacteria | 6273 |
| 151 | Ga0068867_100016329 | 3300005459 | Bacteria | 5271 |
| 152 | Ga0068867_100024678 | 3300005459 | Bacteria | 4309 |
| 153 | Ga0068867_100026671 | 3300005459 | Bacteria | 4149 |
| 154 | Ga0068867_100209582 | 3300005459 | Bacteria | 1564 |
| 155 | Ga0068867_100243934 | 3300005459 | Bacteria | 1458 |
| 156 | Ga0070685_10015464 | 3300005466 | Bacteria | 4055 |
| 157 | Ga0070685_10491459 | 3300005466 | Bacteria | 867 |
| 158 | Ga0070706_100003982 | 3300005467 | Bacteria | 14377 |
| 159 | Ga0070706_100100656 | 3300005467 | Bacteria | 2685 |
| 160 | Ga0070707_100509147 | 3300005468 | Bacteria | 1166 |
| 161 | Ga0070679_100002110 | 3300005530 | Bacteria | 17906 |
| 162 | Ga0070684_100252062 | 3300005535 | Bacteria | 1613 |
| 163 | Ga0068853_100080642 | 3300005539 | Bacteria | 2848 |
| 164 | Ga0068853_100086802 | 3300005539 | Bacteria | 2745 |
| 165 | Ga0068853_100187973 | 3300005539 | Bacteria | 1875 |
| 166 | Ga0070672_100002315 | 3300005543 | Bacteria | 12032 |
| 167 | Ga0070672_100002548 | 3300005543 | Bacteria | 11617 |
| 168 | Ga0070672_100002827 | 3300005543 | Bacteria | 11120 |
| 169 | Ga0070672_100043657 | 3300005543 | Bacteria | 3458 |
| 170 | Ga0070672_100054949 | 3300005543 | Bacteria | 3118 |
| 171 | Ga0070672_100065143 | 3300005543 | Bacteria | 2881 |
| 172 | Ga0070672_100188217 | 3300005543 | Bacteria | 1722 |
| 173 | Ga0070672_100245180 | 3300005543 | Bacteria | 1508 |
| 174 | Ga0070672_100277747 | 3300005543 | Bacteria | 1415 |
| 175 | Ga0070686_100031869 | 3300005544 | Bacteria | 3227 |
| 176 | Ga0070665_100002955 | 3300005548 | Bacteria | 18359 |
| 177 | Ga0070665_101182355 | 3300005548 | Bacteria | 776 |
| 178 | Ga0068855_100074071 | 3300005563 | Bacteria | 3955 |
| 179 | Ga0068855_100238851 | 3300005563 | Bacteria | 2031 |
| 180 | Ga0068855_100580319 | 3300005563 | Bacteria | 1211 |
| 181 | Ga0070664_100063519 | 3300005564 | Bacteria | 3148 |
| 182 | Ga0070664_100139645 | 3300005564 | Bacteria | 2133 |
| 183 | Ga0070664_100261584 | 3300005564 | Bacteria | 1557 |
| 184 | Ga0070664_100294446 | 3300005564 | Bacteria | 1465 |
| 185 | Ga0068857_100036400 | 3300005577 | Bacteria | 4360 |
| 186 | Ga0068857_100253539 | 3300005577 | Bacteria | 1613 |
| 187 | Ga0068857_100363086 | 3300005577 | Bacteria | 1342 |
| 188 | Ga0068854_100006268 | 3300005578 | Bacteria | 7558 |
| 189 | Ga0068854_100012676 | 3300005578 | Bacteria | 5522 |
| 190 | Ga0068854_100023755 | 3300005578 | Bacteria | 4190 |
| 191 | Ga0068854_100168900 | 3300005578 | Bacteria | 1700 |
| 192 | Ga0068854_100416033 | 3300005578 | Bacteria | 1116 |
| 193 | Ga0068856_100027796 | 3300005614 | Bacteria | 5518 |
| 194 | Ga0068856_100051194 | 3300005614 | Bacteria | 4072 |
| 195 | Ga0068856_100102898 | 3300005614 | Bacteria | 2850 |
| 196 | Ga0068856_100130455 | 3300005614 | Bacteria | 2518 |
| 197 | Ga0068856_100169431 | 3300005614 | Bacteria | 2196 |
| 198 | Ga0068856_100735324 | 3300005614 | Bacteria | 1007 |
| 199 | Ga0070702_100036625 | 3300005615 | Bacteria | 2719 |
| 200 | Ga0068852_100020253 | 3300005616 | Bacteria | 5287 |
| 201 | Ga0068852_100123887 | 3300005616 | Bacteria | 2370 |
| 202 | Ga0068852_100180734 | 3300005616 | Bacteria | 1983 |
| 203 | Ga0068852_100226765 | 3300005616 | Bacteria | 1779 |
| 204 | Ga0068852_100229098 | 3300005616 | Bacteria | 1770 |
| 205 | Ga0068852_100302447 | 3300005616 | Bacteria | 1549 |
| 206 | Ga0068852_100466896 | 3300005616 | Bacteria | 1252 |
| 207 | Ga0068852_100595266 | 3300005616 | Bacteria | 1110 |
| 208 | Ga0068852_100692491 | 3300005616 | Bacteria | 1029 |
| 209 | Ga0068852_100827867 | 3300005616 | Bacteria | 941 |
| 210 | Ga0068859_100005588 | 3300005617 | Bacteria | 12807 |
| 211 | Ga0068859_100058362 | 3300005617 | Bacteria | 3887 |
| 212 | Ga0068859_100069270 | 3300005617 | Bacteria | 3562 |
| 213 | Ga0068859_100071420 | 3300005617 | Bacteria | 3507 |
| 214 | Ga0068859_100964241 | 3300005617 | Bacteria | 936 |
| 215 | Ga0068864_100002234 | 3300005618 | Bacteria | 15999 |
| 216 | Ga0068864_100009938 | 3300005618 | Bacteria | 7848 |
| 217 | Ga0068864_100115868 | 3300005618 | Bacteria | 2390 |
| 218 | Ga0068864_100178778 | 3300005618 | Bacteria | 1939 |
| 219 | Ga0068864_100268253 | 3300005618 | Bacteria | 1590 |
| 220 | Ga0068864_100717192 | 3300005618 | Bacteria | 978 |
| 221 | Ga0068866_10008518 | 3300005718 | Bacteria | 4326 |
| 222 | Ga0068866_10148757 | 3300005718 | Bacteria | 1353 |
| 223 | Ga0068861_100001661 | 3300005719 | Bacteria | 14229 |
| 224 | Ga0068861_100004858 | 3300005719 | Bacteria | 9039 |
| 225 | Ga0068861_100006277 | 3300005719 | Bacteria | 8087 |
| 226 | Ga0068851_10183215 | 3300005834 | Bacteria | 1161 |
| 227 | Ga0068870_10028578 | 3300005840 | Bacteria | 2801 |
| 228 | Ga0068870_10093157 | 3300005840 | Bacteria | 1689 |
| 229 | Ga0068863_100004155 | 3300005841 | Bacteria | 14296 |
| 230 | Ga0068863_100042613 | 3300005841 | Bacteria | 4313 |
| 231 | Ga0068863_100081641 | 3300005841 | Bacteria | 3062 |
| 232 | Ga0068863_100278683 | 3300005841 | Bacteria | 1620 |
| 233 | Ga0068863_100301059 | 3300005841 | Bacteria | 1556 |
| 234 | Ga0068863_100582212 | 3300005841 | Bacteria | 1107 |
| 235 | Ga0068858_100002678 | 3300005842 | Bacteria | 17932 |
| 236 | Ga0068858_100053372 | 3300005842 | Bacteria | 3739 |
| 237 | Ga0068858_100126830 | 3300005842 | Bacteria | 2390 |
| 238 | Ga0068858_100134145 | 3300005842 | Bacteria | 2322 |
| 239 | Ga0068858_100640357 | 3300005842 | Bacteria | 1033 |
| 240 | Ga0068860_100000943 | 3300005843 | Bacteria | 32232 |
| 241 | Ga0068860_100005402 | 3300005843 | Bacteria | 12964 |
| 242 | Ga0068860_100012396 | 3300005843 | Bacteria | 8399 |
| 243 | Ga0068860_100112503 | 3300005843 | Bacteria | 2603 |
| 244 | Ga0068860_100248051 | 3300005843 | Bacteria | 1733 |
| 245 | Ga0068860_100265208 | 3300005843 | Bacteria | 1675 |
| 246 | Ga0068860_100273411 | 3300005843 | Bacteria | 1649 |
| 247 | Ga0068860_100604751 | 3300005843 | Bacteria | 1102 |
| 248 | Ga0068862_100008011 | 3300005844 | Bacteria | 8743 |
| 249 | Ga0068862_100018064 | 3300005844 | Bacteria | 5874 |
| 250 | Ga0068862_100038900 | 3300005844 | Bacteria | 4038 |
| 251 | Ga0075365_10071939 | 3300006038 | Bacteria | 2329 |
| 252 | Ga0075368_10001858 | 3300006042 | Bacteria | 6782 |
| 253 | Ga0075368_10010880 | 3300006042 | Bacteria | 3299 |
| 254 | Ga0075363_100005031 | 3300006048 | Bacteria | 5848 |
| 255 | Ga0075363_100019201 | 3300006048 | Bacteria | 3414 |
| 256 | Ga0075363_100023671 | 3300006048 | Bacteria | 3115 |
| 257 | Ga0075363_100311951 | 3300006048 | Bacteria | 914 |
| 258 | Ga0075364_10004616 | 3300006051 | Bacteria | 7939 |
| 259 | Ga0075364_10022968 | 3300006051 | Bacteria | 3945 |
| 260 | Ga0075362_10000760 | 3300006177 | Bacteria | 9596 |
| 261 | Ga0075362_10065172 | 3300006177 | Bacteria | 1654 |
| 262 | Ga0075362_10148162 | 3300006177 | Bacteria | 1125 |
| 263 | Ga0075362_10249295 | 3300006177 | Bacteria | 873 |
| 264 | Ga0075367_10003300 | 3300006178 | Bacteria | 7651 |
| 265 | Ga0075367_10009174 | 3300006178 | Bacteria | 5159 |
| 266 | Ga0075367_10033742 | 3300006178 | Bacteria | 2952 |
| 267 | Ga0075367_10037724 | 3300006178 | Bacteria | 2809 |
| 268 | Ga0075367_10045779 | 3300006178 | Bacteria | 2568 |
| 269 | Ga0075367_10149702 | 3300006178 | Bacteria | 1448 |
| 270 | Ga0075369_10017423 | 3300006186 | Bacteria | 2911 |
| 271 | Ga0075369_10024429 | 3300006186 | Bacteria | 2504 |
| 272 | Ga0075369_10024769 | 3300006186 | Bacteria | 2489 |
| 273 | Ga0075369_10075485 | 3300006186 | Bacteria | 1489 |
| 274 | Ga0075366_10004079 | 3300006195 | Bacteria | 7807 |
| 275 | Ga0075366_10005321 | 3300006195 | Bacteria | 6973 |
| 276 | Ga0075366_10009539 | 3300006195 | Bacteria | 5422 |
| 277 | Ga0075366_10012478 | 3300006195 | Bacteria | 4820 |
| 278 | Ga0075366_10013722 | 3300006195 | Bacteria | 4618 |
| 279 | Ga0075366_10014473 | 3300006195 | Bacteria | 4504 |
| 280 | Ga0075366_10045754 | 3300006195 | Bacteria | 2593 |
| 281 | Ga0075366_10051734 | 3300006195 | Bacteria | 2441 |
| 282 | Ga0075366_10073749 | 3300006195 | Bacteria | 2034 |
| 283 | Ga0075366_10085889 | 3300006195 | Bacteria | 1882 |
| 284 | Ga0075366_10093330 | 3300006195 | Bacteria | 1804 |
| 285 | Ga0075366_10107373 | 3300006195 | Bacteria | 1678 |
| 286 | Ga0075366_10233340 | 3300006195 | Bacteria | 1121 |
| 287 | Ga0075366_10290481 | 3300006195 | Bacteria | 1000 |
| 288 | Ga0075366_10308834 | 3300006195 | Bacteria | 968 |
| 289 | Ga0097621_100018003 | 3300006237 | Bacteria | 5383 |
| 290 | Ga0097621_100053400 | 3300006237 | Bacteria | 3294 |
| 291 | Ga0097621_100194564 | 3300006237 | Bacteria | 1758 |
| 292 | Ga0097621_100379711 | 3300006237 | Bacteria | 1262 |
| 293 | Ga0097621_100401297 | 3300006237 | Bacteria | 1227 |
| 294 | Ga0075370_10000898 | 3300006353 | Bacteria | 12202 |
| 295 | Ga0075370_10002264 | 3300006353 | Bacteria | 8863 |
| 296 | Ga0075370_10005659 | 3300006353 | Bacteria | 6237 |
| 297 | Ga0075370_10007605 | 3300006353 | Bacteria | 5526 |
| 298 | Ga0075370_10009378 | 3300006353 | Bacteria | 5078 |
| 299 | Ga0075370_10023788 | 3300006353 | Bacteria | 3378 |
| 300 | Ga0075370_10028431 | 3300006353 | Bacteria | 3108 |
| 301 | Ga0075370_10031310 | 3300006353 | Bacteria | 2969 |
| 302 | Ga0075370_10055486 | 3300006353 | Bacteria | 2251 |
| 303 | Ga0075370_10106881 | 3300006353 | Bacteria | 1623 |
| 304 | Ga0068871_100006199 | 3300006358 | Bacteria | 8432 |
| 305 | Ga0068871_100158783 | 3300006358 | Bacteria | 1932 |
| 306 | Ga0068871_100776908 | 3300006358 | Bacteria | 882 |
| 307 | Ga0075429_100008966 | 3300006880 | Bacteria | 8689 |
| 308 | Ga0068865_100004931 | 3300006881 | Bacteria | 8069 |
| 309 | Ga0068865_100010176 | 3300006881 | Bacteria | 5847 |
| 310 | Ga0068865_100083825 | 3300006881 | Bacteria | 2295 |
| 311 | Ga0068865_100294420 | 3300006881 | Bacteria | 1297 |
| 312 | Ga0068865_100440782 | 3300006881 | Bacteria | 1075 |
| 313 | Ga0097620_100005588 | 3300006931 | Bacteria | 12807 |
| 314 | Ga0097620_100058362 | 3300006931 | Bacteria | 3887 |
| 315 | Ga0097620_100069266 | 3300006931 | Bacteria | 3562 |
| 316 | Ga0097620_100071419 | 3300006931 | Bacteria | 3507 |
| 317 | Ga0097620_100964190 | 3300006931 | Bacteria | 936 |
| 318 | Ga0099823_1000163 | 3300006944 | Bacteria | 35759 |
| 319 | Ga0079104_1001201 | 3300006946 | Bacteria | 18424 |
| 320 | Ga0105240_10008979 | 3300009093 | Bacteria | 14207 |
| 321 | Ga0105240_10057797 | 3300009093 | Bacteria | 4844 |
| 322 | Ga0105240_10073187 | 3300009093 | Bacteria | 4232 |
| 323 | Ga0111539_10877273 | 3300009094 | Bacteria | 1044 |
| 324 | Ga0105245_10161208 | 3300009098 | Bacteria | 2128 |
| 325 | Ga0105245_10173555 | 3300009098 | Bacteria | 2054 |
| 326 | Ga0114129_10378952 | 3300009147 | Bacteria | 1869 |
| 327 | Ga0114129_10553197 | 3300009147 | Bacteria | 1496 |
| 328 | Ga0105243_10012059 | 3300009148 | Bacteria | 6535 |
| 329 | Ga0105243_10017616 | 3300009148 | Bacteria | 5402 |
| 330 | Ga0105243_10098123 | 3300009148 | Bacteria | 2426 |
| 331 | Ga0105243_10251151 | 3300009148 | Bacteria | 1579 |
| 332 | Ga0105243_10345824 | 3300009148 | Bacteria | 1364 |
| 333 | Ga0105243_10619323 | 3300009148 | Bacteria | 1044 |
| 334 | Ga0105241_10024407 | 3300009174 | Bacteria | 4489 |
| 335 | Ga0105242_10263050 | 3300009176 | Bacteria | 1559 |
| 336 | Ga0105248_10004768 | 3300009177 | Bacteria | 15007 |
| 337 | Ga0105248_10019801 | 3300009177 | Bacteria | 7453 |
| 338 | Ga0105248_10105860 | 3300009177 | Bacteria | 3171 |
| 339 | Ga0105248_10209128 | 3300009177 | Bacteria | 2198 |
| 340 | Ga0105248_10320278 | 3300009177 | Bacteria | 1746 |
| 341 | Ga0105248_10342136 | 3300009177 | Bacteria | 1684 |
| 342 | Ga0105248_10465645 | 3300009177 | Bacteria | 1425 |
| 343 | Ga0105248_10741216 | 3300009177 | Bacteria | 1108 |
| 344 | Ga0105237_10001800 | 3300009545 | Bacteria | 27691 |
| 345 | Ga0105237_10052281 | 3300009545 | Bacteria | 4101 |
| 346 | Ga0105237_10573843 | 3300009545 | Bacteria | 1135 |
| 347 | Ga0105238_10001620 | 3300009551 | Bacteria | 22525 |
| 348 | Ga0105238_10027838 | 3300009551 | Bacteria | 5760 |
| 349 | Ga0105238_10143142 | 3300009551 | Bacteria | 2367 |
| 350 | Ga0105249_10006344 | 3300009553 | Bacteria | 10278 |
| 351 | Ga0105249_10314165 | 3300009553 | Bacteria | 1576 |
| 352 | Ga0105249_10446991 | 3300009553 | Bacteria | 1331 |
| 353 | Ga0105239_10001185 | 3300010375 | Bacteria | 35747 |
| 354 | Ga0105239_10030763 | 3300010375 | Bacteria | 5904 |
| 355 | Ga0105239_10138092 | 3300010375 | Bacteria | 2714 |
| 356 | Ga0105239_10219559 | 3300010375 | Bacteria | 2132 |
| 357 | Ga0105246_10174447 | 3300011119 | Bacteria | 1649 |
| 358 | Ga0105246_10467817 | 3300011119 | Bacteria | 1063 |
| 359 | Ga0105246_10692620 | 3300011119 | Bacteria | 892 |
| 360 | Ga0157323_1010599 | 3300012495 | Bacteria | 728 |
| 361 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 362 | Ga0157327_1019006 | 3300012512 | Bacteria | 755 |
| 363 | Ga0157371_10041368 | 3300013102 | Bacteria | 3289 |
| 364 | Ga0157371_10200573 | 3300013102 | Bacteria | 1430 |
| 365 | Ga0157370_10577339 | 3300013104 | Bacteria | 1030 |
| 366 | Ga0157370_10772829 | 3300013104 | Bacteria | 875 |
| 367 | Ga0157374_10000271 | 3300013296 | Bacteria | 48054 |
| 368 | Ga0157374_10018242 | 3300013296 | Bacteria | 6191 |
| 369 | Ga0157374_10047499 | 3300013296 | Bacteria | 3981 |
| 370 | Ga0157374_10161847 | 3300013296 | Bacteria | 2180 |
| 371 | Ga0157374_10319887 | 3300013296 | Bacteria | 1537 |
| 372 | Ga0157374_10373898 | 3300013296 | Bacteria | 1419 |
| 373 | Ga0157374_10479019 | 3300013296 | Bacteria | 1248 |
| 374 | Ga0157378_10024112 | 3300013297 | Bacteria | 5352 |
| 375 | Ga0157378_10294779 | 3300013297 | Bacteria | 1568 |
| 376 | Ga0157378_10940126 | 3300013297 | Bacteria | 897 |
| 377 | Ga0157378_11185133 | 3300013297 | Bacteria | 803 |
| 378 | Ga0163162_10003029 | 3300013306 | Bacteria | 16054 |
| 379 | Ga0163162_10005745 | 3300013306 | Bacteria | 11999 |
| 380 | Ga0163162_10159345 | 3300013306 | Bacteria | 2378 |
| 381 | Ga0157372_10014771 | 3300013307 | Bacteria | 8358 |
| 382 | Ga0157372_10038743 | 3300013307 | Bacteria | 5260 |
| 383 | Ga0157375_10043212 | 3300013308 | Bacteria | 4368 |
| 384 | Ga0157375_10089804 | 3300013308 | Bacteria | 3129 |
| 385 | Ga0157375_10166099 | 3300013308 | Bacteria | 2352 |
| 386 | Ga0157375_10464303 | 3300013308 | Bacteria | 1431 |
| 387 | Ga0157375_10763574 | 3300013308 | Bacteria | 1117 |
| 388 | Ga0157375_10892202 | 3300013308 | Bacteria | 1033 |
| 389 | Ga0163163_10376138 | 3300014325 | Bacteria | 1478 |
| 390 | Ga0163163_10553095 | 3300014325 | Bacteria | 1213 |
| 391 | Ga0157380_10024608 | 3300014326 | Bacteria | 4558 |
| 392 | Ga0157380_10034917 | 3300014326 | Bacteria | 3881 |
| 393 | Ga0157380_10223993 | 3300014326 | Bacteria | 1684 |
| 394 | Ga0157380_10352006 | 3300014326 | Bacteria | 1378 |
| 395 | Ga0157377_10000170 | 3300014745 | Bacteria | 38897 |
| 396 | Ga0157377_10002946 | 3300014745 | Bacteria | 7611 |
| 397 | Ga0157377_10218351 | 3300014745 | Bacteria | 1219 |
| 398 | Ga0157379_10039596 | 3300014968 | Bacteria | 4205 |
| 399 | Ga0157379_10077702 | 3300014968 | Bacteria | 2972 |
| 400 | Ga0157379_10283447 | 3300014968 | Bacteria | 1508 |
| 401 | Ga0157379_10330250 | 3300014968 | Bacteria | 1393 |
| 402 | Ga0157379_10367708 | 3300014968 | Bacteria | 1318 |
| 403 | Ga0157376_10021326 | 3300014969 | Bacteria | 5031 |
| 404 | Ga0157376_10422279 | 3300014969 | Bacteria | 1294 |
| 405 | Ga0157376_10816629 | 3300014969 | Bacteria | 946 |
| 406 | Ga0157376_10851588 | 3300014969 | Bacteria | 927 |
| 407 | Ga0182007_10092630 | 3300015262 | Bacteria | 996 |
| 408 | Ga0163161_10016697 | 3300017792 | Bacteria | 5128 |
| 409 | Ga0163161_10053309 | 3300017792 | Bacteria | 2933 |
| 410 | Ga0163161_10128971 | 3300017792 | Bacteria | 1906 |
| 411 | Ga0163161_10291543 | 3300017792 | Bacteria | 1283 |
| 412 | Ga0213872_10000044 | 3300021361 | Bacteria | 114843 |
| 413 | Ga0213872_10000070 | 3300021361 | Bacteria | 91519 |
| 414 | Ga0213872_10000073 | 3300021361 | Bacteria | 91302 |
| 415 | Ga0213872_10000154 | 3300021361 | Bacteria | 63158 |
| 416 | Ga0213872_10022528 | 3300021361 | Bacteria | 2901 |
| 417 | Ga0213872_10046320 | 3300021361 | Bacteria | 1979 |
| 418 | Ga0213872_10091385 | 3300021361 | Bacteria | 1362 |
| 419 | Ga0213872_10114075 | 3300021361 | Bacteria | 1198 |
| 420 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 421 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 422 | Ga0209563_100080 | 3300025230 | Bacteria | 199504 |
| 423 | Ga0207427_101590 | 3300025231 | Bacteria | 7784 |
| 424 | Ga0209258_100072 | 3300025242 | Bacteria | 274355 |
| 425 | Ga0209258_102156 | 3300025242 | Bacteria | 5453 |
| 426 | Ga0207425_1004382 | 3300025245 | Bacteria | 4261 |
| 427 | Ga0209646_1000301 | 3300025246 | Bacteria | 40208 |
| 428 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 429 | Ga0209677_100130 | 3300025253 | Bacteria | 72879 |
| 430 | Ga0209677_103493 | 3300025253 | Bacteria | 5051 |
| 431 | Ga0209677_103696 | 3300025253 | Bacteria | 4801 |
| 432 | Ga0209759_1000214 | 3300025256 | Bacteria | 89311 |
| 433 | Ga0209759_1001031 | 3300025256 | Bacteria | 18709 |
| 434 | Ga0209759_1001266 | 3300025256 | Bacteria | 15217 |
| 435 | Ga0209759_1007152 | 3300025256 | Bacteria | 3637 |
| 436 | Ga0209759_1011143 | 3300025256 | Bacteria | 2579 |
| 437 | Ga0209759_1042771 | 3300025256 | Bacteria | 764 |
| 438 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 439 | Ga0209129_1027025 | 3300025258 | Bacteria | 986 |
| 440 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 441 | Ga0209673_1009613 | 3300025273 | Bacteria | 4159 |
| 442 | Ga0209673_1014163 | 3300025273 | Bacteria | 3099 |
| 443 | Ga0209673_1018104 | 3300025273 | Bacteria | 2574 |
| 444 | Ga0209673_1018827 | 3300025273 | Bacteria | 2497 |
| 445 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 446 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 447 | Ga0209758_1000307 | 3300025297 | Bacteria | 95192 |
| 448 | Ga0209758_1000524 | 3300025297 | Bacteria | 61366 |
| 449 | Ga0209050_1001300 | 3300025298 | Bacteria | 28170 |
| 450 | Ga0209050_1002883 | 3300025298 | Bacteria | 13584 |
| 451 | Ga0209050_1003609 | 3300025298 | Bacteria | 11221 |
| 452 | Ga0209050_1009714 | 3300025298 | Bacteria | 4874 |
| 453 | Ga0209050_1025737 | 3300025298 | Bacteria | 1990 |
| 454 | Ga0209256_1000203 | 3300025299 | Bacteria | 112500 |
| 455 | Ga0209256_1000675 | 3300025299 | Bacteria | 46128 |
| 456 | Ga0209256_1004060 | 3300025299 | Bacteria | 9517 |
| 457 | Ga0209051_1000035 | 3300025303 | Bacteria | 346999 |
| 458 | Ga0209051_1000981 | 3300025303 | Bacteria | 27697 |
| 459 | Ga0209051_1002155 | 3300025303 | Bacteria | 14606 |
| 460 | Ga0209051_1004799 | 3300025303 | Bacteria | 8153 |
| 461 | Ga0209051_1007290 | 3300025303 | Bacteria | 6069 |
| 462 | Ga0209051_1048679 | 3300025303 | Bacteria | 1435 |
| 463 | Ga0209257_1000182 | 3300025304 | Bacteria | 156672 |
| 464 | Ga0209257_1000346 | 3300025304 | Bacteria | 95662 |
| 465 | Ga0209257_1002753 | 3300025304 | Bacteria | 16625 |
| 466 | Ga0209257_1003470 | 3300025304 | Bacteria | 13469 |
| 467 | Ga0209257_1011718 | 3300025304 | Bacteria | 4172 |
| 468 | Ga0209257_1058206 | 3300025304 | Bacteria | 1060 |
| 469 | Ga0209257_1086438 | 3300025304 | Bacteria | 793 |
| 470 | Ga0207697_10283218 | 3300025315 | Bacteria | 735 |
| 471 | Ga0207682_10005109 | 3300025893 | Bacteria | 5376 |
| 472 | Ga0207682_10043472 | 3300025893 | Bacteria | 1839 |
| 473 | Ga0207682_10044919 | 3300025893 | Bacteria | 1812 |
| 474 | Ga0207682_10059945 | 3300025893 | Bacteria | 1591 |
| 475 | Ga0207682_10171003 | 3300025893 | Bacteria | 988 |
| 476 | Ga0207688_10218862 | 3300025901 | Bacteria | 1146 |
| 477 | Ga0207680_10003380 | 3300025903 | Bacteria | 7515 |
| 478 | Ga0207680_10010348 | 3300025903 | Bacteria | 4664 |
| 479 | Ga0207680_10571476 | 3300025903 | Bacteria | 808 |
| 480 | Ga0207645_10001208 | 3300025907 | Bacteria | 21313 |
| 481 | Ga0207645_10013147 | 3300025907 | Bacteria | 5590 |
| 482 | Ga0207645_10018896 | 3300025907 | Bacteria | 4527 |
| 483 | Ga0207645_10084162 | 3300025907 | Bacteria | 2041 |
| 484 | Ga0207645_10176396 | 3300025907 | Bacteria | 1402 |
| 485 | Ga0207643_10044744 | 3300025908 | Bacteria | 2499 |
| 486 | Ga0207705_10189880 | 3300025909 | Bacteria | 1553 |
| 487 | Ga0207705_10230832 | 3300025909 | Bacteria | 1408 |
| 488 | Ga0207705_10312019 | 3300025909 | Bacteria | 1207 |
| 489 | Ga0207684_10004653 | 3300025910 | Bacteria | 12885 |
| 490 | Ga0207684_10062899 | 3300025910 | Bacteria | 3151 |
| 491 | Ga0207654_10109211 | 3300025911 | Bacteria | 1718 |
| 492 | Ga0207707_10037822 | 3300025912 | Bacteria | 4217 |
| 493 | Ga0207707_10866141 | 3300025912 | Bacteria | 749 |
| 494 | Ga0207695_10010519 | 3300025913 | Bacteria | 11315 |
| 495 | Ga0207695_10018695 | 3300025913 | Bacteria | 8002 |
| 496 | Ga0207695_10211675 | 3300025913 | Bacteria | 1849 |
| 497 | Ga0207671_10001232 | 3300025914 | Bacteria | 30245 |
| 498 | Ga0207663_10221519 | 3300025916 | Bacteria | 1377 |
| 499 | Ga0207660_10013605 | 3300025917 | Bacteria | 5335 |
| 500 | Ga0207662_10061693 | 3300025918 | Bacteria | 2252 |
| 501 | Ga0207662_10495788 | 3300025918 | Bacteria | 840 |
| 502 | Ga0207657_10045869 | 3300025919 | Bacteria | 3831 |
| 503 | Ga0207657_10389533 | 3300025919 | Bacteria | 1096 |
| 504 | Ga0207657_10484026 | 3300025919 | Bacteria | 970 |
| 505 | Ga0207649_10004761 | 3300025920 | Bacteria | 7343 |
| 506 | Ga0207649_10017005 | 3300025920 | Bacteria | 4115 |
| 507 | Ga0207649_10183236 | 3300025920 | Bacteria | 1467 |
| 508 | Ga0207649_10342420 | 3300025920 | Bacteria | 1104 |
| 509 | Ga0207652_10046936 | 3300025921 | Bacteria | 3688 |
| 510 | Ga0207646_10163129 | 3300025922 | Bacteria | 2011 |
| 511 | Ga0207681_10000823 | 3300025923 | Bacteria | 20454 |
| 512 | Ga0207681_10056092 | 3300025923 | Bacteria | 2686 |
| 513 | Ga0207681_10061088 | 3300025923 | Bacteria | 2589 |
| 514 | Ga0207681_10125073 | 3300025923 | Bacteria | 1892 |
| 515 | Ga0207681_10615744 | 3300025923 | Bacteria | 898 |
| 516 | Ga0207694_10004625 | 3300025924 | Bacteria | 10717 |
| 517 | Ga0207650_10002985 | 3300025925 | Bacteria | 11671 |
| 518 | Ga0207650_10014909 | 3300025925 | Bacteria | 5408 |
| 519 | Ga0207650_10072923 | 3300025925 | Bacteria | 2585 |
| 520 | Ga0207650_10120999 | 3300025925 | Bacteria | 2038 |
| 521 | Ga0207659_10004461 | 3300025926 | Bacteria | 8473 |
| 522 | Ga0207659_10040286 | 3300025926 | Bacteria | 3265 |
| 523 | Ga0207659_10055387 | 3300025926 | Bacteria | 2836 |
| 524 | Ga0207659_10056078 | 3300025926 | Bacteria | 2820 |
| 525 | Ga0207659_10098047 | 3300025926 | Bacteria | 2203 |
| 526 | Ga0207659_10110233 | 3300025926 | Bacteria | 2091 |
| 527 | Ga0207659_10246622 | 3300025926 | Bacteria | 1447 |
| 528 | Ga0207659_10304617 | 3300025926 | Bacteria | 1310 |
| 529 | Ga0207659_10633182 | 3300025926 | Bacteria | 913 |
| 530 | Ga0207687_10155820 | 3300025927 | Bacteria | 1747 |
| 531 | Ga0207687_10256539 | 3300025927 | Bacteria | 1392 |
| 532 | Ga0207687_11068789 | 3300025927 | Bacteria | 693 |
| 533 | Ga0207644_10016116 | 3300025931 | Bacteria | 5027 |
| 534 | Ga0207644_10034103 | 3300025931 | Bacteria | 3561 |
| 535 | Ga0207644_10049492 | 3300025931 | Bacteria | 3009 |
| 536 | Ga0207644_10072900 | 3300025931 | Bacteria | 2516 |
| 537 | Ga0207644_11052198 | 3300025931 | Bacteria | 683 |
| 538 | Ga0207690_10005585 | 3300025932 | Bacteria | 7429 |
| 539 | Ga0207690_10091128 | 3300025932 | Bacteria | 2154 |
| 540 | Ga0207690_10099654 | 3300025932 | Bacteria | 2072 |
| 541 | Ga0207690_10203392 | 3300025932 | Bacteria | 1505 |
| 542 | Ga0207690_10211436 | 3300025932 | Bacteria | 1479 |
| 543 | Ga0207690_10381988 | 3300025932 | Bacteria | 1120 |
| 544 | Ga0207706_10002434 | 3300025933 | Bacteria | 18165 |
| 545 | Ga0207706_10013338 | 3300025933 | Bacteria | 7475 |
| 546 | Ga0207706_10013363 | 3300025933 | Bacteria | 7469 |
| 547 | Ga0207706_10033600 | 3300025933 | Bacteria | 4564 |
| 548 | Ga0207706_10082407 | 3300025933 | Bacteria | 2827 |
| 549 | Ga0207686_10064164 | 3300025934 | Bacteria | 2338 |
| 550 | Ga0207709_10003397 | 3300025935 | Bacteria | 9508 |
| 551 | Ga0207709_10034651 | 3300025935 | Bacteria | 2977 |
| 552 | Ga0207709_10057501 | 3300025935 | Bacteria | 2412 |
| 553 | Ga0207709_10088731 | 3300025935 | Bacteria | 2014 |
| 554 | Ga0207709_10405028 | 3300025935 | Bacteria | 1044 |
| 555 | Ga0207669_10003010 | 3300025937 | Bacteria | 7252 |
| 556 | Ga0207669_10086353 | 3300025937 | Bacteria | 2028 |
| 557 | Ga0207669_10093113 | 3300025937 | Bacteria | 1968 |
| 558 | Ga0207669_10101108 | 3300025937 | Bacteria | 1906 |
| 559 | Ga0207669_10542214 | 3300025937 | Bacteria | 937 |
| 560 | Ga0207704_10066913 | 3300025938 | Bacteria | 2258 |
| 561 | Ga0207704_10161990 | 3300025938 | Bacteria | 1593 |
| 562 | Ga0207704_10667310 | 3300025938 | Bacteria | 858 |
| 563 | Ga0207665_10079213 | 3300025939 | Bacteria | 2258 |
| 564 | Ga0207691_10001739 | 3300025940 | Bacteria | 21471 |
| 565 | Ga0207691_10004984 | 3300025940 | Bacteria | 12808 |
| 566 | Ga0207691_10005163 | 3300025940 | Bacteria | 12608 |
| 567 | Ga0207691_10022620 | 3300025940 | Bacteria | 5928 |
| 568 | Ga0207691_10057939 | 3300025940 | Bacteria | 3525 |
| 569 | Ga0207691_10149342 | 3300025940 | Bacteria | 2055 |
| 570 | Ga0207691_10253259 | 3300025940 | Bacteria | 1519 |
| 571 | Ga0207691_10264282 | 3300025940 | Bacteria | 1483 |
| 572 | Ga0207711_10020237 | 3300025941 | Bacteria | 5545 |
| 573 | Ga0207711_10045517 | 3300025941 | Bacteria | 3750 |
| 574 | Ga0207711_10125706 | 3300025941 | Bacteria | 2294 |
| 575 | Ga0207711_10142124 | 3300025941 | Bacteria | 2160 |
| 576 | Ga0207711_10407468 | 3300025941 | Bacteria | 1264 |
| 577 | Ga0207689_10000521 | 3300025942 | Bacteria | 36571 |
| 578 | Ga0207689_10020049 | 3300025942 | Bacteria | 5629 |
| 579 | Ga0207689_10063726 | 3300025942 | Bacteria | 3033 |
| 580 | Ga0207689_10499944 | 3300025942 | Bacteria | 1019 |
| 581 | Ga0207661_10009108 | 3300025944 | Bacteria | 7116 |
| 582 | Ga0207661_10034856 | 3300025944 | Bacteria | 3918 |
| 583 | Ga0207661_10275496 | 3300025944 | Bacteria | 1502 |
| 584 | Ga0207679_10000254 | 3300025945 | Bacteria | 40785 |
| 585 | Ga0207679_10034063 | 3300025945 | Bacteria | 3590 |
| 586 | Ga0207679_10064714 | 3300025945 | Bacteria | 2734 |
| 587 | Ga0207679_10194803 | 3300025945 | Bacteria | 1688 |
| 588 | Ga0207679_10741197 | 3300025945 | Bacteria | 893 |
| 589 | Ga0207667_10283879 | 3300025949 | Bacteria | 1691 |
| 590 | Ga0207667_10911987 | 3300025949 | Bacteria | 870 |
| 591 | Ga0207651_10035586 | 3300025960 | Bacteria | 3240 |
| 592 | Ga0207651_10040355 | 3300025960 | Bacteria | 3087 |
| 593 | Ga0207651_10060252 | 3300025960 | Bacteria | 2634 |
| 594 | Ga0207651_10061743 | 3300025960 | Bacteria | 2608 |
| 595 | Ga0207651_10085639 | 3300025960 | Bacteria | 2287 |
| 596 | Ga0207651_10094284 | 3300025960 | Bacteria | 2200 |
| 597 | Ga0207651_10104319 | 3300025960 | Bacteria | 2112 |
| 598 | Ga0207712_10005486 | 3300025961 | Bacteria | 8003 |
| 599 | Ga0207712_10103114 | 3300025961 | Bacteria | 2125 |
| 600 | Ga0207712_10653834 | 3300025961 | Bacteria | 914 |
| 601 | Ga0207668_10001265 | 3300025972 | Bacteria | 15064 |
| 602 | Ga0207668_10055113 | 3300025972 | Bacteria | 2762 |
| 603 | Ga0207668_10172966 | 3300025972 | Bacteria | 1696 |
| 604 | Ga0207668_10388023 | 3300025972 | Bacteria | 1177 |
| 605 | Ga0207668_10412953 | 3300025972 | Bacteria | 1144 |
| 606 | Ga0207640_10011366 | 3300025981 | Bacteria | 5040 |
| 607 | Ga0207640_10073229 | 3300025981 | Bacteria | 2314 |
| 608 | Ga0207640_10276764 | 3300025981 | Bacteria | 1316 |
| 609 | Ga0207658_10001833 | 3300025986 | Bacteria | 15912 |
| 610 | Ga0207658_10002477 | 3300025986 | Bacteria | 13477 |
| 611 | Ga0207658_10010320 | 3300025986 | Bacteria | 6349 |
| 612 | Ga0207658_10011682 | 3300025986 | Bacteria | 5979 |
| 613 | Ga0207658_10041908 | 3300025986 | Bacteria | 3318 |
| 614 | Ga0207658_10300910 | 3300025986 | Bacteria | 1382 |
| 615 | Ga0207658_10372914 | 3300025986 | Bacteria | 1248 |
| 616 | Ga0207658_10467989 | 3300025986 | Bacteria | 1118 |
| 617 | Ga0207658_10628131 | 3300025986 | Bacteria | 967 |
| 618 | Ga0207677_10055505 | 3300026023 | Bacteria | 2709 |
| 619 | Ga0207677_10113812 | 3300026023 | Bacteria | 2020 |
| 620 | Ga0207677_10569978 | 3300026023 | Bacteria | 989 |
| 621 | Ga0207677_10768681 | 3300026023 | Bacteria | 860 |
| 622 | Ga0207703_10004479 | 3300026035 | Bacteria | 11473 |
| 623 | Ga0207703_10005888 | 3300026035 | Bacteria | 9825 |
| 624 | Ga0207703_10265235 | 3300026035 | Bacteria | 1554 |
| 625 | Ga0207703_10317796 | 3300026035 | Bacteria | 1425 |
| 626 | Ga0207639_10070563 | 3300026041 | Bacteria | 2729 |
| 627 | Ga0207639_10117923 | 3300026041 | Bacteria | 2176 |
| 628 | Ga0207639_10171528 | 3300026041 | Bacteria | 1838 |
| 629 | Ga0207678_10002363 | 3300026067 | Bacteria | 17106 |
| 630 | Ga0207678_10033453 | 3300026067 | Bacteria | 4478 |
| 631 | Ga0207678_10783571 | 3300026067 | Bacteria | 841 |
| 632 | Ga0207708_10075580 | 3300026075 | Bacteria | 2583 |
| 633 | Ga0207708_10257200 | 3300026075 | Bacteria | 1408 |
| 634 | Ga0207702_10002302 | 3300026078 | Bacteria | 18280 |
| 635 | Ga0207702_10010277 | 3300026078 | Bacteria | 7841 |
| 636 | Ga0207702_10138217 | 3300026078 | Bacteria | 2201 |
| 637 | Ga0207702_10161962 | 3300026078 | Bacteria | 2044 |
| 638 | Ga0207641_10009403 | 3300026088 | Bacteria | 8054 |
| 639 | Ga0207641_10092184 | 3300026088 | Bacteria | 2653 |
| 640 | Ga0207641_10109722 | 3300026088 | Bacteria | 2444 |
| 641 | Ga0207641_10138439 | 3300026088 | Bacteria | 2193 |
| 642 | Ga0207641_10262979 | 3300026088 | Bacteria | 1616 |
| 643 | Ga0207641_10280693 | 3300026088 | Bacteria | 1566 |
| 644 | Ga0207641_10807170 | 3300026088 | Bacteria | 928 |
| 645 | Ga0207641_10821009 | 3300026088 | Bacteria | 920 |
| 646 | Ga0207648_10000439 | 3300026089 | Bacteria | 46028 |
| 647 | Ga0207648_10000748 | 3300026089 | Bacteria | 36506 |
| 648 | Ga0207648_10002159 | 3300026089 | Bacteria | 21380 |
| 649 | Ga0207648_10011657 | 3300026089 | Bacteria | 8274 |
| 650 | Ga0207648_10016586 | 3300026089 | Bacteria | 6725 |
| 651 | Ga0207648_10019952 | 3300026089 | Bacteria | 6048 |
| 652 | Ga0207676_10005849 | 3300026095 | Bacteria | 8690 |
| 653 | Ga0207676_10028252 | 3300026095 | Bacteria | 4188 |
| 654 | Ga0207676_10034901 | 3300026095 | Bacteria | 3811 |
| 655 | Ga0207676_10088207 | 3300026095 | Bacteria | 2539 |
| 656 | Ga0207676_10138574 | 3300026095 | Bacteria | 2079 |
| 657 | Ga0207676_10228543 | 3300026095 | Bacteria | 1662 |
| 658 | Ga0207676_10247857 | 3300026095 | Bacteria | 1602 |
| 659 | Ga0207676_10579331 | 3300026095 | Bacteria | 1075 |
| 660 | Ga0207674_10045241 | 3300026116 | Bacteria | 4529 |
| 661 | Ga0207674_10048860 | 3300026116 | Bacteria | 4329 |
| 662 | Ga0207674_10120277 | 3300026116 | Bacteria | 2594 |
| 663 | Ga0207674_10238182 | 3300026116 | Bacteria | 1767 |
| 664 | Ga0207674_10389598 | 3300026116 | Bacteria | 1347 |
| 665 | Ga0207675_100000428 | 3300026118 | Bacteria | 40700 |
| 666 | Ga0207675_100001184 | 3300026118 | Bacteria | 25976 |
| 667 | Ga0207675_100003876 | 3300026118 | Bacteria | 14539 |
| 668 | Ga0207675_100038266 | 3300026118 | Bacteria | 4476 |
| 669 | Ga0207683_10043392 | 3300026121 | Bacteria | 3930 |
| 670 | Ga0207683_10050350 | 3300026121 | Bacteria | 3648 |
| 671 | Ga0207683_10556024 | 3300026121 | Bacteria | 1061 |
| 672 | Ga0207698_10016580 | 3300026142 | Bacteria | 4971 |
| 673 | Ga0207698_10047782 | 3300026142 | Bacteria | 3245 |
| 674 | Ga0207698_10071717 | 3300026142 | Bacteria | 2750 |
| 675 | Ga0207698_10071922 | 3300026142 | Bacteria | 2746 |
| 676 | Ga0207698_10434669 | 3300026142 | Bacteria | 1263 |
| 677 | Ga0207698_10590525 | 3300026142 | Bacteria | 1094 |
| 678 | Ga0207698_10767313 | 3300026142 | Bacteria | 964 |
| 679 | Ga0207698_11141321 | 3300026142 | Bacteria | 793 |
| 680 | Ga0207698_11479949 | 3300026142 | Bacteria | 694 |
| 681 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 682 | Ga0209389_1015795 | 3300027296 | Bacteria | 6855 |
| 683 | Ga0209371_1009954 | 3300027312 | Bacteria | 2972 |
| 684 | Ga0209995_1021109 | 3300027471 | Bacteria | 1079 |
| 685 | Ga0209968_1000140 | 3300027526 | Bacteria | 12794 |
| 686 | Ga0209968_1046312 | 3300027526 | Bacteria | 749 |
| 687 | Ga0209970_1000593 | 3300027614 | Bacteria | 6304 |
| 688 | Ga0209983_1034722 | 3300027665 | Bacteria | 1081 |
| 689 | Ga0209966_1000388 | 3300027695 | Bacteria | 13148 |
| 690 | Ga0209813_10075187 | 3300027866 | Bacteria | 1106 |
| 691 | Ga0209974_10070507 | 3300027876 | Bacteria | 1192 |
| 692 | Ga0268266_10005969 | 3300028379 | Bacteria | 11257 |
| 693 | Ga0268265_10031835 | 3300028380 | Bacteria | 3813 |
| 694 | Ga0268265_10196163 | 3300028380 | Bacteria | 1747 |
| 695 | Ga0268265_10203267 | 3300028380 | Bacteria | 1720 |
| 696 | Ga0268264_10001228 | 3300028381 | Bacteria | 24612 |
| 697 | Ga0268264_10093598 | 3300028381 | Bacteria | 2596 |
| 698 | Ga0268264_10179915 | 3300028381 | Bacteria | 1919 |
| 699 | Ga0268264_10215157 | 3300028381 | Bacteria | 1766 |
| 700 | Ga0268264_10229682 | 3300028381 | Bacteria | 1713 |
| 701 | Ga0268264_10301245 | 3300028381 | Bacteria | 1509 |
| 702 | Ga0265336_10000014 | 3300028666 | Bacteria | 241247 |
| 703 | Ga0307517_10001591 | 3300028786 | Bacteria | 37812 |
| 704 | Ga0307517_10085334 | 3300028786 | Bacteria | 2646 |
| 705 | Ga0307517_10236485 | 3300028786 | Bacteria | 1089 |
| 706 | Ga0307515_10000103 | 3300028794 | Bacteria | 198308 |
| 707 | Ga0307515_10000184 | 3300028794 | Bacteria | 153952 |
| 708 | Ga0307515_10001431 | 3300028794 | Bacteria | 53956 |
| 709 | Ga0307515_10003451 | 3300028794 | Bacteria | 33263 |
| 710 | Ga0307515_10020933 | 3300028794 | Bacteria | 11625 |
| 711 | Ga0307515_10023725 | 3300028794 | Bacteria | 10733 |
| 712 | Ga0307515_10025369 | 3300028794 | Bacteria | 10259 |
| 713 | Ga0307515_10035551 | 3300028794 | Bacteria | 8099 |
| 714 | Ga0307515_10049534 | 3300028794 | Bacteria | 6315 |
| 715 | Ga0307515_10098333 | 3300028794 | Bacteria | 3565 |
| 716 | Ga0307515_10200202 | 3300028794 | Bacteria | 1875 |
| 717 | Ga0307515_10330553 | 3300028794 | Bacteria | 1183 |
| 718 | Ga0265324_10006660 | 3300029957 | Bacteria | 4776 |
| 719 | Ga0265324_10076828 | 3300029957 | Bacteria | 1136 |
| 720 | Ga0268256_1010113 | 3300030500 | Bacteria | 3078 |
| 721 | Ga0307511_10018336 | 3300030521 | Bacteria | 6690 |
| 722 | Ga0307512_10051321 | 3300030522 | Bacteria | 3301 |
| 723 | Ga0307512_10192219 | 3300030522 | Bacteria | 1123 |
| 724 | Ga0307512_10262906 | 3300030522 | Bacteria | 845 |
| 725 | Ga0265328_10010054 | 3300031239 | Bacteria | 3825 |
| 726 | Ga0265328_10013329 | 3300031239 | Bacteria | 3256 |
| 727 | Ga0265328_10013826 | 3300031239 | Bacteria | 3186 |
| 728 | Ga0265331_10002534 | 3300031250 | Bacteria | 12300 |
| 729 | Ga0265331_10032791 | 3300031250 | Bacteria | 2572 |
| 730 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 731 | Ga0265327_10000210 | 3300031251 | Bacteria | 122385 |
| 732 | Ga0265316_10000005 | 3300031344 | Bacteria | 304442 |
| 733 | Ga0307513_10003898 | 3300031456 | Bacteria | 20062 |
| 734 | Ga0307513_10020866 | 3300031456 | Bacteria | 7752 |
| 735 | Ga0307513_10043401 | 3300031456 | Bacteria | 4938 |
| 736 | Ga0307513_10057848 | 3300031456 | Bacteria | 4126 |
| 737 | Ga0307513_10068414 | 3300031456 | Bacteria | 3720 |
| 738 | Ga0307513_10130643 | 3300031456 | Bacteria | 2458 |
| 739 | Ga0307513_10202548 | 3300031456 | Bacteria | 1824 |
| 740 | Ga0307513_10213771 | 3300031456 | Bacteria | 1757 |
| 741 | Ga0307509_10002193 | 3300031507 | Bacteria | 32050 |
| 742 | Ga0307509_10004459 | 3300031507 | Bacteria | 20160 |
| 743 | Ga0307509_10020954 | 3300031507 | Bacteria | 7405 |
| 744 | Ga0307509_10058153 | 3300031507 | Bacteria | 4095 |
| 745 | Ga0307509_10063616 | 3300031507 | Bacteria | 3884 |
| 746 | Ga0307509_10111788 | 3300031507 | Bacteria | 2733 |
| 747 | Ga0307509_10148470 | 3300031507 | Bacteria | 2265 |
| 748 | Ga0307509_10151843 | 3300031507 | Bacteria | 2230 |
| 749 | Ga0307509_10248866 | 3300031507 | Bacteria | 1563 |
| 750 | Ga0307509_10434212 | 3300031507 | Bacteria | 1011 |
| 751 | Ga0307509_10523836 | 3300031507 | Bacteria | 866 |
| 752 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 753 | Ga0307408_100071579 | 3300031548 | Bacteria | 2564 |
| 754 | Ga0307408_100096944 | 3300031548 | Bacteria | 2239 |
| 755 | Ga0307408_100333780 | 3300031548 | Bacteria | 1281 |
| 756 | Ga0307408_100379381 | 3300031548 | Bacteria | 1208 |
| 757 | Ga0307408_100441135 | 3300031548 | Bacteria | 1127 |
| 758 | Ga0307408_100480910 | 3300031548 | Bacteria | 1083 |
| 759 | Ga0307508_10000368 | 3300031616 | Bacteria | 54659 |
| 760 | Ga0307508_10001683 | 3300031616 | Bacteria | 24515 |
| 761 | Ga0307508_10136626 | 3300031616 | Bacteria | 2055 |
| 762 | Ga0307508_10213462 | 3300031616 | Bacteria | 1530 |
| 763 | Ga0307514_10000711 | 3300031649 | Bacteria | 57628 |
| 764 | Ga0307514_10001565 | 3300031649 | Bacteria | 27095 |
| 765 | Ga0307514_10007399 | 3300031649 | Bacteria | 9463 |
| 766 | Ga0307514_10013419 | 3300031649 | Bacteria | 6800 |
| 767 | Ga0307514_10032642 | 3300031649 | Bacteria | 4163 |
| 768 | Ga0307514_10078141 | 3300031649 | Bacteria | 2459 |
| 769 | Ga0307514_10294174 | 3300031649 | Bacteria | 916 |
| 770 | Ga0316579_10046081 | 3300031691 | Bacteria | 2034 |
| 771 | Ga0307516_10003935 | 3300031730 | Bacteria | 18706 |
| 772 | Ga0307516_10004098 | 3300031730 | Bacteria | 18219 |
| 773 | Ga0307516_10004205 | 3300031730 | Bacteria | 17926 |
| 774 | Ga0307516_10005073 | 3300031730 | Bacteria | 15928 |
| 775 | Ga0307516_10074546 | 3300031730 | Bacteria | 3249 |
| 776 | Ga0307516_10160134 | 3300031730 | Bacteria | 2002 |
| 777 | Ga0307516_10163479 | 3300031730 | Bacteria | 1974 |
| 778 | Ga0307516_10251108 | 3300031730 | Bacteria | 1463 |
| 779 | Ga0307516_10433058 | 3300031730 | Bacteria | 972 |
| 780 | Ga0307405_10007014 | 3300031731 | Bacteria | 5600 |
| 781 | Ga0307405_10033534 | 3300031731 | Bacteria | 3047 |
| 782 | Ga0307405_10135837 | 3300031731 | Bacteria | 1707 |
| 783 | Ga0307405_10844576 | 3300031731 | Bacteria | 770 |
| 784 | Ga0307405_10956282 | 3300031731 | Bacteria | 728 |
| 785 | Ga0316577_10003732 | 3300031733 | Bacteria | 7749 |
| 786 | Ga0316577_10387931 | 3300031733 | Bacteria | 793 |
| 787 | Ga0307413_10156850 | 3300031824 | Bacteria | 1594 |
| 788 | Ga0307413_10747516 | 3300031824 | Bacteria | 817 |
| 789 | Ga0307410_10253681 | 3300031852 | Bacteria | 1369 |
| 790 | Ga0307410_10456452 | 3300031852 | Bacteria | 1043 |
| 791 | Ga0307406_10276559 | 3300031901 | Bacteria | 1278 |
| 792 | Ga0307406_10614595 | 3300031901 | Bacteria | 898 |
| 793 | Ga0307406_10721448 | 3300031901 | Bacteria | 834 |
| 794 | Ga0307407_10277777 | 3300031903 | Bacteria | 1159 |
| 795 | Ga0307412_10013904 | 3300031911 | Bacteria | 4732 |
| 796 | Ga0307412_10025761 | 3300031911 | Bacteria | 3647 |
| 797 | Ga0307412_10041419 | 3300031911 | Bacteria | 2985 |
| 798 | Ga0307412_10171142 | 3300031911 | Bacteria | 1624 |
| 799 | Ga0307412_10307831 | 3300031911 | Bacteria | 1255 |
| 800 | Ga0307412_10970365 | 3300031911 | Bacteria | 749 |
| 801 | Ga0307409_100002795 | 3300031995 | Bacteria | 9224 |
| 802 | Ga0307409_100006577 | 3300031995 | Bacteria | 6851 |
| 803 | Ga0307409_100449872 | 3300031995 | Bacteria | 1243 |
| 804 | Ga0307416_100008008 | 3300032002 | Bacteria | 6769 |
| 805 | Ga0307416_100175437 | 3300032002 | Bacteria | 2001 |
| 806 | Ga0307416_100346440 | 3300032002 | Bacteria | 1501 |
| 807 | Ga0307416_100972711 | 3300032002 | Bacteria | 951 |
| 808 | Ga0307416_101051971 | 3300032002 | Bacteria | 918 |
| 809 | Ga0307414_10105838 | 3300032004 | Bacteria | 2128 |
| 810 | Ga0307414_10131771 | 3300032004 | Bacteria | 1942 |
| 811 | Ga0307411_10021424 | 3300032005 | Bacteria | 3782 |
| 812 | Ga0307411_10156766 | 3300032005 | Bacteria | 1699 |
| 813 | Ga0307411_10189892 | 3300032005 | Bacteria | 1568 |
| 814 | Ga0307411_10563882 | 3300032005 | Bacteria | 974 |
| 815 | Ga0307415_100018631 | 3300032126 | Bacteria | 4197 |
| 816 | Ga0307415_100306267 | 3300032126 | Bacteria | 1318 |
| 817 | Ga0307507_10040160 | 3300033179 | Bacteria | 4706 |
| 818 | Ga0307507_10098806 | 3300033179 | Bacteria | 2455 |
| 819 | Ga0307510_10000290 | 3300033180 | Bacteria | 46315 |
| 820 | Ga0307510_10017949 | 3300033180 | Bacteria | 8337 |
| 821 | Ga0307510_10047591 | 3300033180 | Bacteria | 4592 |
| 822 | Ga0307510_10071009 | 3300033180 | Bacteria | 3472 |
| 823 | Ga0373948_0036937 | 3300034817 | Bacteria | 1008 |
| 824 | Ga0373926_0076098 | 3300035083 | Bacteria | 1237 |
| 825 | Ga0373929_0015023 | 3300035085 | Bacteria | 1502 |
| 826 | Ga0373934_0023865 | 3300035086 | Bacteria | 2364 |
| 827 | Ga0373944_0072545 | 3300035089 | Bacteria | 1124 |
| 828 | Ga0373951_0005569 | 3300035091 | Bacteria | 2921 |
| 829 | Ga0373923_0114744 | 3300035111 | Bacteria | 1199 |
| 830 | Ga0373932_0040585 | 3300035112 | Bacteria | 1341 |
| 831 | Ga0373936_0073989 | 3300035113 | Bacteria | 1409 |
| 832 | Ga0373939_0000052 | 3300035114 | Bacteria | 40835 |
| 833 | Ga0373945_0017131 | 3300035116 | Bacteria | 2452 |
| 834 | Ga0373956_0130505 | 3300035119 | Bacteria | 1176 |
| 835 | Ga0373960_0000046 | 3300035121 | Bacteria | 16294 |
| 836 | Ga0373960_0071648 | 3300035121 | Bacteria | 1073 |
| 837 | Ga0373943_0236197 | 3300035170 | Bacteria | 1023 |
| 838 | Ga0373946_0028979 | 3300035171 | Bacteria | 2200 |
| 839 | Ga0373955_0090201 | 3300035172 | Bacteria | 1746 |
| 840 | Ga0373942_0112013 | 3300035207 | Bacteria | 845 |
| 841 | Ga0373961_0067761 | 3300035241 | Bacteria | 1098 |
| 842 | Ga0373962_0060676 | 3300035242 | Bacteria | 1110 |
| 843 | Ga0316574_0225148 | 3300035398 | Bacteria | 1201 |
| 844 | Ga0373924_0007452 | 3300035410 | Bacteria | 3953 |
| 845 | Ga0373931_0000306 | 3300035691 | Bacteria | 20645 |
| 846 | Ga0373931_0005476 | 3300035691 | Bacteria | 5877 |
| 847 | Ga0373931_0022624 | 3300035691 | Bacteria | 3165 |
| 848 | Ga0373931_0051848 | 3300035691 | Bacteria | 2186 |
| 849 | Ga0373931_0108561 | 3300035691 | Bacteria | 1571 |
| 850 | Ga0373947_0062559 | 3300035725 | Bacteria | 2265 |
| 851 | Ga0373947_0073103 | 3300035725 | Bacteria | 2107 |
| 852 | Ga0373937_0635691 | 3300036401 | Bacteria | 1012 |
| 853 | Ga0373937_0760290 | 3300036401 | Bacteria | 916 |
| 854 | Ga0316584_0343258 | 3300036712 | Bacteria | 1073 |
| 855 | Ga0373925_0014193 | 3300037068 | Bacteria | 5764 |
| 856 | Ga0395899_0055205 | 3300037312 | Bacteria | 2939 |
| 857 | Ga0395900_0000234 | 3300037418 | Bacteria | 87083 |
| 858 | Ga0395898_0002077 | 3300037466 | Bacteria | 24918 |
| 859 | Ga0395898_0038952 | 3300037466 | Bacteria | 4707 |
| 860 | Ga0395898_0458094 | 3300037466 | Bacteria | 1214 |
| 861 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 862 | Ga0395905_0003377 | 3300037471 | Bacteria | 17102 |
| 863 | Ga0395905_0003411 | 3300037471 | Bacteria | 17002 |
| 864 | Ga0395905_0013883 | 3300037471 | Bacteria | 7706 |
| 865 | Ga0395905_0023686 | 3300037471 | Bacteria | 5796 |
| 866 | Ga0395905_0098886 | 3300037471 | Bacteria | 2740 |
| 867 | Ga0395905_0252928 | 3300037471 | Bacteria | 1646 |
| 868 | Ga0395905_0297698 | 3300037471 | Bacteria | 1500 |
| 869 | Ga0395901_0765087 | 3300038443 | Bacteria | 958 |
| 870 | Ga0436361_0443798 | 3300039447 | Bacteria | 17914 |
| 871 | Ga0436361_0530495 | 3300039447 | Bacteria | 101563 |
| 872 | Ga0436361_0714096 | 3300039447 | Bacteria | 3648 |
| 873 | Ga0436361_0735085 | 3300039447 | Bacteria | 1764 |
| 874 | Ga0436361_0736070 | 3300039447 | Bacteria | 84726 |
| 875 | Ga0436361_0886712 | 3300039447 | Bacteria | 114879 |
| 876 | Ga0436361_1123281 | 3300039447 | Bacteria | 2099 |
| 877 | Ga0436361_1146345 | 3300039447 | Bacteria | 5179 |
| 878 | Ga0436363_0219629 | 3300039450 | Bacteria | 2266 |
| 879 | Ga0439461_0003089 | 3300041410 | Bacteria | 2715 |
| 880 | Ga0451795_1122439 | 3300041456 | Bacteria | 859 |
| 881 | Ga0451800_0728199 | 3300041459 | Bacteria | 2366 |
| 882 | Ga0451800_1277183 | 3300041459 | Bacteria | 1987 |
| 883 | Ga0451804_0008258 | 3300041463 | Bacteria | 1460 |
| 884 | Ga0451804_0650180 | 3300041463 | Bacteria | 2010 |
| 885 | Ga0451841_0251967 | 3300041498 | Bacteria | 1323 |
| 886 | Ga0451845_0255285 | 3300041501 | Bacteria | 668 |
| 887 | Ga0451855_1813671 | 3300041511 | Bacteria | 1097 |
| 888 | Ga0451853_3187860 | 3300041512 | Bacteria | 1303 |
| 889 | Ga0439431_0037467 | 3300041997 | Bacteria | 1224 |
| 890 | Ga0439437_000789 | 3300042000 | Bacteria | 3242 |
| 891 | Ga0439445_0002228 | 3300042004 | Bacteria | 4302 |
| 892 | Ga0439448_0023434 | 3300042005 | Bacteria | 1926 |
| 893 | Ga0439449_0092752 | 3300042007 | Bacteria | 1115 |
| 894 | Ga0439454_000320 | 3300042011 | Bacteria | 3615 |
| 895 | Ga0439455_0073873 | 3300042012 | Bacteria | 919 |
| 896 | Ga0450911_000798 | 3300042115 | Bacteria | 8724 |
| 897 | Ga0450917_000257 | 3300042120 | Bacteria | 3909 |
| 898 | Ga0450920_006579 | 3300042122 | Bacteria | 2093 |
| 899 | Ga0450888_009728 | 3300042126 | Bacteria | 1103 |
| 900 | Ga0450890_000264 | 3300042127 | Bacteria | 7731 |
| 901 | Ga0450891_000152 | 3300042129 | Bacteria | 6473 |
| 902 | Ga0450892_003518 | 3300042130 | Bacteria | 1284 |
| 903 | Ga0450898_014614 | 3300042134 | Bacteria | 1322 |
| 904 | Ga0450902_002830 | 3300042137 | Bacteria | 2486 |
| 905 | Ga0450903_012132 | 3300042138 | Bacteria | 1379 |
| 906 | Ga0439446_0048361 | 3300042156 | Bacteria | 1266 |
| 907 | Ga0439446_0063298 | 3300042156 | Bacteria | 1121 |
| 908 | Ga0450909_041080 | 3300042185 | Bacteria | 712 |
| 909 | Ga0439459_0008070 | 3300042438 | Bacteria | 1791 |
| 910 | Ga0439464_0008819 | 3300042439 | Bacteria | 2644 |
| 911 | Ga0439464_0089683 | 3300042439 | Bacteria | 926 |
| 912 | Ga0439464_0113386 | 3300042439 | Bacteria | 831 |
| 913 | Ga0450916_000178 | 3300042530 | Bacteria | 4750 |
| 914 | Ga0450918_001808 | 3300042531 | Bacteria | 4168 |
| 915 | Ga0450893_0015032 | 3300042532 | Bacteria | 1303 |
| 916 | Ga0451577_0000303 | 3300042876 | Bacteria | 95840 |
| 917 | Ga0451577_0002225 | 3300042876 | Bacteria | 23610 |
| 918 | Ga0451577_0003841 | 3300042876 | Bacteria | 16330 |
| 919 | Ga0451577_0004580 | 3300042876 | Bacteria | 14527 |
| 920 | Ga0451577_0005835 | 3300042876 | Bacteria | 12457 |
| 921 | Ga0451577_0013164 | 3300042876 | Bacteria | 7752 |
| 922 | Ga0451577_0019759 | 3300042876 | Bacteria | 6190 |
| 923 | Ga0451577_0022062 | 3300042876 | Bacteria | 5817 |
| 924 | Ga0451577_0032453 | 3300042876 | Bacteria | 4704 |
| 925 | Ga0451577_0411673 | 3300042876 | Bacteria | 1227 |
| 926 | Ga0466969_0000028 | 3300044656 | Bacteria | 92394 |
| 927 | Ga0466969_0008493 | 3300044656 | Bacteria | 5448 |
| 928 | Ga0466969_0035623 | 3300044656 | Bacteria | 2516 |
| 929 | Ga0466969_0038616 | 3300044656 | Bacteria | 2401 |
| 930 | Ga0466972_0006558 | 3300044658 | Bacteria | 5849 |
| 931 | Ga0466972_0136163 | 3300044658 | Bacteria | 1156 |
| 932 | Ga0453683_0015947 | 3300044673 | Bacteria | 4855 |
| 933 | Ga0453683_0169899 | 3300044673 | Bacteria | 1381 |
| 934 | Ga0453683_0292855 | 3300044673 | Bacteria | 1041 |
| 935 | Ga0453683_0361107 | 3300044673 | Bacteria | 934 |
| 936 | Ga0453683_0366974 | 3300044673 | Bacteria | 926 |
| 937 | Ga0466965_0003252 | 3300044683 | Bacteria | 7106 |
| 938 | Ga0466965_0030115 | 3300044683 | Bacteria | 2643 |
| 939 | Ga0466965_0340859 | 3300044683 | Bacteria | 819 |
| 940 | Ga0466966_0005301 | 3300044684 | Bacteria | 8478 |
| 941 | Ga0466966_0051843 | 3300044684 | Bacteria | 2607 |
| 942 | Ga0466966_0087476 | 3300044684 | Bacteria | 1936 |
| 943 | Ga0466961_0003217 | 3300044693 | Bacteria | 10163 |
| 944 | Ga0466961_0004039 | 3300044693 | Bacteria | 9196 |
| 945 | Ga0466961_0019292 | 3300044693 | Bacteria | 4387 |
| 946 | Ga0466961_0273075 | 3300044693 | Bacteria | 1035 |
| 947 | Ga0466963_0000935 | 3300044694 | Bacteria | 14918 |
| 948 | Ga0466963_0236218 | 3300044694 | Bacteria | 1281 |
| 949 | Ga0466964_0024421 | 3300044706 | Bacteria | 2355 |
| 950 | Ga0453684_0000055 | 3300044712 | Bacteria | 532014 |
| 951 | Ga0453684_0000142 | 3300044712 | Bacteria | 316405 |
| 952 | Ga0453684_0000947 | 3300044712 | Bacteria | 95768 |
| 953 | Ga0453684_0006446 | 3300044712 | Bacteria | 22283 |
| 954 | Ga0453684_0047779 | 3300044712 | Bacteria | 5671 |
| 955 | Ga0453684_0056165 | 3300044712 | Bacteria | 5109 |
| 956 | Ga0453684_0059806 | 3300044712 | Bacteria | 4908 |
| 957 | Ga0453684_0072820 | 3300044712 | Bacteria | 4335 |
| 958 | Ga0453684_0110760 | 3300044712 | Bacteria | 3336 |
| 959 | Ga0453684_0308604 | 3300044712 | Unclassified | 1796 |
| 960 | Ga0453684_0331179 | 3300044712 | Bacteria | 1722 |
| 961 | Ga0466971_0005541 | 3300044719 | Bacteria | 5483 |
| 962 | Ga0466971_0168982 | 3300044719 | Bacteria | 1025 |
| 963 | Ga0466968_0019767 | 3300044735 | Bacteria | 2714 |
| 964 | Ga0466968_0061625 | 3300044735 | Bacteria | 1618 |
| 965 | Ga0466970_0015254 | 3300044765 | Bacteria | 3950 |
| 966 | Ga0466957_0007668 | 3300044842 | Bacteria | 6104 |
| 967 | Ga0466957_0022945 | 3300044842 | Bacteria | 3684 |
| 968 | Ga0466960_0005647 | 3300044901 | Bacteria | 4965 |
| 969 | Ga0466960_0076434 | 3300044901 | Bacteria | 1677 |
| 970 | Ga0466960_0084285 | 3300044901 | Bacteria | 1608 |
| 971 | Ga0466960_0256171 | 3300044901 | Bacteria | 973 |
| 972 | Ga0466959_0001550 | 3300045049 | Bacteria | 14139 |
| 973 | Ga0466959_0037485 | 3300045049 | Bacteria | 3582 |
| 974 | Ga0466959_0686504 | 3300045049 | Bacteria | 686 |
| 975 | Ga0451576_0000880 | 3300045051 | Bacteria | 57256 |
| 976 | Ga0451576_0003317 | 3300045051 | Bacteria | 22316 |
| 977 | Ga0451576_0007754 | 3300045051 | Bacteria | 12747 |
| 978 | Ga0451576_0021518 | 3300045051 | Bacteria | 7010 |
| 979 | Ga0451576_0072377 | 3300045051 | Bacteria | 3587 |
| 980 | Ga0451576_0366908 | 3300045051 | Bacteria | 1508 |
| 981 | Ga0451576_0636493 | 3300045051 | Bacteria | 1120 |
| 982 | Ga0466958_0015363 | 3300045836 | Bacteria | 4386 |
| 983 | Ga0466958_0023688 | 3300045836 | Bacteria | 3606 |
| 984 | Ga0466958_0382727 | 3300045836 | Bacteria | 907 |
| 985 | Ga0466967_0021184 | 3300045976 | Bacteria | 5272 |
| 986 | Ga0466967_0076045 | 3300045976 | Bacteria | 3019 |
| 987 | Ga0495592_0000758 | 3300046454 | Bacteria | 22458 |
| 988 | Ga0495592_0423289 | 3300046454 | Bacteria | 839 |
| 989 | Ga0495590_0004523 | 3300046457 | Bacteria | 5604 |
| 990 | Ga0495629_0058817 | 3300046459 | Bacteria | 2687 |
| 991 | Ga0495629_0170766 | 3300046459 | Bacteria | 1509 |
| 992 | Ga0495638_0078801 | 3300046460 | Bacteria | 2004 |
| 993 | Ga0495651_0223717 | 3300046462 | Bacteria | 1301 |
| 994 | Ga0495650_0018864 | 3300046471 | Bacteria | 3416 |
| 995 | Ga0495650_0052598 | 3300046471 | Bacteria | 1671 |
| 996 | Ga0495580_0028564 | 3300046472 | Bacteria | 4054 |
| 997 | Ga0495580_0403708 | 3300046472 | Bacteria | 921 |
| 998 | Ga0495639_0188546 | 3300046475 | Bacteria | 1006 |
| 999 | Ga0495662_0172547 | 3300046476 | Bacteria | 1066 |
| 1000 | Ga0495585_0009636 | 3300046492 | Bacteria | 5783 |
| 1001 | Ga0495583_0000350 | 3300046506 | Bacteria | 72716 |
| 1002 | Ga0495606_0004217 | 3300046507 | Bacteria | 14547 |
| 1003 | Ga0495606_0319309 | 3300046507 | Bacteria | 835 |
| 1004 | Ga0495610_0120867 | 3300046512 | Bacteria | 1148 |
| 1005 | Ga0495610_0132414 | 3300046512 | Bacteria | 1081 |
| 1006 | Ga0495610_0219234 | 3300046512 | Bacteria | 769 |
| 1007 | Ga0495620_0066992 | 3300046515 | Bacteria | 1478 |
| 1008 | Ga0495628_0096500 | 3300046516 | Bacteria | 2284 |
| 1009 | Ga0495630_0178524 | 3300046517 | Bacteria | 1619 |
| 1010 | Ga0495632_0004044 | 3300046519 | Bacteria | 10121 |
| 1011 | Ga0495632_0025809 | 3300046519 | Bacteria | 3103 |
| 1012 | Ga0495632_0058581 | 3300046519 | Bacteria | 1876 |
| 1013 | Ga0495632_0096251 | 3300046519 | Bacteria | 1398 |
| 1014 | Ga0495643_0125248 | 3300046522 | Bacteria | 1294 |
| 1015 | Ga0495648_0100293 | 3300046524 | Bacteria | 1600 |
| 1016 | Ga0495666_0094779 | 3300046526 | Bacteria | 1408 |
| 1017 | Ga0495652_0226567 | 3300046529 | Bacteria | 1401 |
| 1018 | Ga0495654_0002282 | 3300046530 | Bacteria | 12409 |
| 1019 | Ga0495586_0062991 | 3300046535 | Bacteria | 2019 |
| 1020 | Ga0495598_0055036 | 3300046537 | Bacteria | 1210 |
| 1021 | Ga0495621_0003869 | 3300046539 | Bacteria | 4159 |
| 1022 | Ga0495597_0027211 | 3300046542 | Bacteria | 2623 |
| 1023 | Ga0495597_0073969 | 3300046542 | Bacteria | 1464 |
| 1024 | Ga0495597_0122298 | 3300046542 | Bacteria | 1084 |
| 1025 | Ga0495597_0134519 | 3300046542 | Bacteria | 1023 |
| 1026 | Ga0495645_0161563 | 3300046543 | Bacteria | 1548 |
| 1027 | Ga0495645_0297267 | 3300046543 | Bacteria | 1056 |
| 1028 | Ga0495622_0258499 | 3300046557 | Bacteria | 765 |
| 1029 | Ga0495633_0164056 | 3300046558 | Bacteria | 1025 |
| 1030 | Ga0495656_0324462 | 3300046615 | Bacteria | 794 |
| 1031 | Ga0495668_0082116 | 3300046616 | Bacteria | 1768 |
| 1032 | Ga0495668_0228685 | 3300046616 | Bacteria | 1018 |
| 1033 | Ga0495634_0182064 | 3300046642 | Bacteria | 1315 |
| 1034 | Ga0495625_0002284 | 3300046660 | Bacteria | 21038 |
| 1035 | Ga0495625_0005026 | 3300046660 | Bacteria | 12271 |
| 1036 | Ga0495625_0018498 | 3300046660 | Bacteria | 5438 |
| 1037 | Ga0495625_0158084 | 3300046660 | Bacteria | 1520 |
| 1038 | Ga0495661_0180834 | 3300046665 | Bacteria | 1118 |
| 1039 | Ga0495646_0134148 | 3300046680 | Bacteria | 1391 |
| 1040 | Ga0495647_0036783 | 3300046681 | Bacteria | 1844 |
| 1041 | Ga0495647_0055813 | 3300046681 | Bacteria | 1547 |
| 1042 | Ga0495658_0009721 | 3300046683 | Bacteria | 4795 |
| 1043 | Ga0495658_0024713 | 3300046683 | Bacteria | 3203 |
| 1044 | Ga0495658_0079957 | 3300046683 | Bacteria | 1916 |
| 1045 | Ga0495658_0118772 | 3300046683 | Bacteria | 1597 |
| 1046 | Ga0495658_0206270 | 3300046683 | Bacteria | 1226 |
| 1047 | Ga0495669_0005767 | 3300046684 | Bacteria | 5164 |
| 1048 | Ga0495624_0144328 | 3300046690 | Bacteria | 1457 |
| 1049 | Ga0495670_0016246 | 3300046691 | Bacteria | 3658 |
| 1050 | Ga0495670_0243320 | 3300046691 | Bacteria | 958 |
| 1051 | Ga0495671_0318594 | 3300046692 | Bacteria | 747 |
| 1052 | Ga0495649_0000845 | 3300046694 | Bacteria | 24600 |
| 1053 | Ga0495589_0010997 | 3300046794 | Bacteria | 4698 |
| 1054 | Ga0495600_0228715 | 3300046809 | Bacteria | 1188 |
| 1055 | Ga0495660_0034083 | 3300046810 | Bacteria | 2851 |
| 1056 | Ga0495660_0055072 | 3300046810 | Bacteria | 2154 |
| 1057 | Ga0495674_0141275 | 3300047319 | Bacteria | 2024 |
| 1058 | Ga0495676_0201211 | 3300047321 | Bacteria | 1384 |
| 1059 | Ga0495687_000914 | 3300047443 | Bacteria | 30754 |
| 1060 | Ga0495687_022484 | 3300047443 | Bacteria | 3026 |
| 1061 | Ga0495673_0097251 | 3300047469 | Bacteria | 1195 |
| 1062 | Ga0495684_0281050 | 3300047471 | Bacteria | 1201 |
| 1063 | Ga0495684_0441577 | 3300047471 | Bacteria | 906 |
| 1064 | Ga0495686_0002064 | 3300047472 | Bacteria | 19764 |
| 1065 | Ga0495686_0036043 | 3300047472 | Bacteria | 3175 |
| 1066 | Ga0495686_0293870 | 3300047472 | Bacteria | 899 |
| 1067 | Ga0495614_0076511 | 3300048089 | Bacteria | 1447 |
| 1068 | Ga0496100_0105749 | 3300048903 | Bacteria | 1947 |
| 1069 | Ga0496101_0193368 | 3300048904 | Bacteria | 1571 |
| 1070 | Ga0496101_0491013 | 3300048904 | Bacteria | 970 |
| 1071 | Ga0496102_0018809 | 3300048905 | Bacteria | 6076 |
| 1072 | Ga0496102_0029296 | 3300048905 | Bacteria | 4926 |
| 1073 | Ga0496102_0087881 | 3300048905 | Bacteria | 2872 |
| 1074 | Ga0496104_0196556 | 3300048907 | Bacteria | 1929 |
| 1075 | Ga0496104_0199179 | 3300048907 | Bacteria | 1915 |
| 1076 | Ga0496104_0206468 | 3300048907 | Bacteria | 1876 |
| 1077 | Ga0496104_0521547 | 3300048907 | Bacteria | 1099 |
| 1078 | Ga0496105_0040297 | 3300048908 | Bacteria | 3851 |
| 1079 | Ga0496105_0066776 | 3300048908 | Bacteria | 2970 |
| 1080 | Ga0496105_0664932 | 3300048908 | Bacteria | 803 |
| 1081 | Ga0496106_0002082 | 3300048909 | Bacteria | 14992 |
| 1082 | Ga0496106_0011064 | 3300048909 | Bacteria | 6670 |
| 1083 | Ga0496106_0364633 | 3300048909 | Bacteria | 1161 |
| 1084 | Ga0496107_0058705 | 3300048910 | Bacteria | 2782 |
| 1085 | Ga0496108_0308711 | 3300048911 | Bacteria | 1378 |
| 1086 | Ga0496109_0031899 | 3300048912 | Bacteria | 4733 |
| 1087 | Ga0496109_0172715 | 3300048912 | Bacteria | 2028 |
| 1088 | Ga0496109_0191070 | 3300048912 | Bacteria | 1924 |
| 1089 | Ga0496109_0392819 | 3300048912 | Bacteria | 1311 |
| 1090 | Ga0496110_0037484 | 3300048913 | Bacteria | 4214 |
| 1091 | Ga0496110_0105616 | 3300048913 | Bacteria | 2527 |
| 1092 | Ga0496110_0984120 | 3300048913 | Bacteria | 751 |
| 1093 | Ga0496111_0175235 | 3300048914 | Bacteria | 1594 |
| 1094 | Ga0496112_0011296 | 3300048915 | Bacteria | 8147 |
| 1095 | Ga0496112_0148171 | 3300048915 | Bacteria | 2315 |
| 1096 | Ga0496113_0184490 | 3300048916 | Bacteria | 1654 |
| 1097 | Ga0496113_0436649 | 3300048916 | Bacteria | 1052 |
| 1098 | Ga0496114_0004709 | 3300048917 | Bacteria | 10616 |
| 1099 | Ga0496114_0118552 | 3300048917 | Bacteria | 2274 |
| 1100 | Ga0496114_0120807 | 3300048917 | Bacteria | 2253 |
| 1101 | Ga0496114_0249630 | 3300048917 | Bacteria | 1561 |
| 1102 | Ga0496115_0007508 | 3300048918 | Bacteria | 8026 |
| 1103 | Ga0496118_0065767 | 3300048921 | Bacteria | 2651 |
| 1104 | Ga0496121_0017965 | 3300048924 | Bacteria | 7170 |
| 1105 | Ga0496122_0130111 | 3300048925 | Bacteria | 1602 |
| 1106 | Ga0496122_0164935 | 3300048925 | Bacteria | 1345 |
| 1107 | Ga0496124_0001253 | 3300048927 | Bacteria | 38792 |
| 1108 | Ga0496124_0024540 | 3300048927 | Bacteria | 5478 |
| 1109 | Ga0496124_0165397 | 3300048927 | Bacteria | 1720 |
| 1110 | Ga0496125_0033740 | 3300048928 | Bacteria | 4523 |
| 1111 | Ga0496125_0042673 | 3300048928 | Bacteria | 3860 |
| 1112 | Ga0496125_0086553 | 3300048928 | Bacteria | 2369 |
| 1113 | Ga0496125_0179123 | 3300048928 | Bacteria | 1415 |
| 1114 | Ga0496126_0034601 | 3300048929 | Bacteria | 4744 |
| 1115 | Ga0501292_003863 | 3300049515 | Bacteria | 2023 |
| 1116 | Ga0501297_000622 | 3300049520 | Bacteria | 3197 |
| 1117 | Ga0501298_021543 | 3300049521 | Bacteria | 1208 |
| 1118 | Ga0501303_005764 | 3300049526 | Bacteria | 1065 |
| 1119 | Ga0501032_0222241 | 3300049569 | Bacteria | 1229 |
| 1120 | Ga0501034_0038599 | 3300049571 | Bacteria | 4836 |
| 1121 | Ga0501036_0154458 | 3300049572 | Bacteria | 1936 |
| 1122 | Ga0501043_0005029 | 3300049579 | Bacteria | 10700 |
| 1123 | Ga0501046_0006030 | 3300049580 | Bacteria | 10778 |
| 1124 | Ga0501046_0470263 | 3300049580 | Bacteria | 903 |
| 1125 | Ga0501047_0000069 | 3300049581 | Bacteria | 129231 |
| 1126 | Ga0501047_0538719 | 3300049581 | Bacteria | 992 |
| 1127 | Ga0501048_0051092 | 3300049582 | Bacteria | 2943 |
| 1128 | Ga0501048_0192413 | 3300049582 | Bacteria | 1446 |
| 1129 | Ga0501072_0488323 | 3300049588 | Bacteria | 974 |
| 1130 | Ga0501076_0558951 | 3300049592 | Bacteria | 944 |
| 1131 | Ga0501076_0739502 | 3300049592 | Bacteria | 812 |
| 1132 | Ga0501198_000014 | 3300049649 | Bacteria | 106940 |
| 1133 | Ga0501206_003976 | 3300049653 | Bacteria | 1879 |
| 1134 | Ga0501207_027951 | 3300049654 | Bacteria | 936 |
| 1135 | Ga0501208_050179 | 3300049655 | Bacteria | 794 |
| 1136 | Ga0501211_000534 | 3300049658 | Bacteria | 3728 |
| 1137 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 1138 | Ga0501222_019566 | 3300049662 | Bacteria | 904 |
| 1139 | Ga0501227_012640 | 3300049665 | Bacteria | 1851 |
| 1140 | Ga0501233_004919 | 3300049668 | Bacteria | 2469 |
| 1141 | Ga0501235_057419 | 3300049669 | Bacteria | 909 |
| 1142 | Ga0501252_012540 | 3300049682 | Bacteria | 1027 |
| 1143 | Ga0501253_000616 | 3300049683 | Bacteria | 3160 |
| 1144 | Ga0501253_073368 | 3300049683 | Bacteria | 760 |
| 1145 | Ga0501257_005139 | 3300049686 | Bacteria | 2880 |
| 1146 | Ga0501257_038050 | 3300049686 | Bacteria | 1175 |
| 1147 | Ga0501259_055906 | 3300049688 | Bacteria | 813 |
| 1148 | Ga0501221_001653 | 3300049704 | Bacteria | 3699 |
| 1149 | Ga0501079_0882934 | 3300049741 | Bacteria | 704 |
| 1150 | Ga0501232_000918 | 3300049757 | Bacteria | 2176 |
| 1151 | Ga0501262_004308 | 3300049759 | Bacteria | 1651 |
| 1152 | Ga0501265_003041 | 3300049762 | Bacteria | 1907 |
| 1153 | Ga0501265_027412 | 3300049762 | Bacteria | 803 |
| 1154 | Ga0501272_012285 | 3300049769 | Bacteria | 972 |
| 1155 | Ga0501273_018490 | 3300049770 | Bacteria | 928 |
| 1156 | Ga0501035_0102307 | 3300049822 | Bacteria | 2513 |
| 1157 | Ga0501035_0426257 | 3300049822 | Bacteria | 1101 |
| 1158 | Ga0501045_0066678 | 3300049824 | Bacteria | 2642 |
| 1159 | Ga0501226_007204 | 3300049853 | Bacteria | 1250 |
| 1160 | nmdc:mga03683_125525_c1 | 3300050489 | Bacteria | 1144 |
| 1161 | nmdc:mga03683_20583_c1 | 3300050489 | Bacteria | 2533 |
| 1162 | nmdc:mga03683_2130_c1 | 3300050489 | Bacteria | 6101 |
| 1163 | nmdc:mga03683_221524_c1 | 3300050489 | Bacteria | 873 |
| 1164 | nmdc:mga03683_3440_c1 | 3300050489 | Bacteria | 5110 |
| 1165 | nmdc:mga03683_48243_c1 | 3300050489 | Bacteria | 1769 |
| 1166 | nmdc:mga03n38_158500_c1 | 3300050490 | Bacteria | 1144 |
| 1167 | nmdc:mga03n38_53897_c1 | 3300050490 | Bacteria | 1806 |
| 1168 | nmdc:mga03n38_9279_c1 | 3300050490 | Bacteria | 3570 |
| 1169 | nmdc:mga00v17_15606_c1 | 3300050491 | Bacteria | 4265 |
| 1170 | nmdc:mga00v17_55125_c1 | 3300050491 | Bacteria | 2427 |
| 1171 | nmdc:mga0yw44_117492_c1 | 3300050492 | Bacteria | 1710 |
| 1172 | nmdc:mga0k408_11201_c1 | 3300050493 | Bacteria | 4876 |
| 1173 | nmdc:mga0k408_139607_c1 | 3300050493 | Bacteria | 1441 |
| 1174 | nmdc:mga0k408_162371_c1 | 3300050493 | Bacteria | 1331 |
| 1175 | nmdc:mga0k408_18066_c1 | 3300050493 | Bacteria | 3932 |
| 1176 | nmdc:mga0k408_1823_c1 | 3300050493 | Bacteria | 11436 |
| 1177 | nmdc:mga0k408_2121_c1 | 3300050493 | Bacteria | 10627 |
| 1178 | nmdc:mga0k408_247862_c1 | 3300050493 | Bacteria | 1064 |
| 1179 | nmdc:mga0k408_2568_c1 | 3300050493 | Bacteria | 9636 |
| 1180 | nmdc:mga0k408_3529_c1 | 3300050493 | Bacteria | 8261 |
| 1181 | nmdc:mga0k408_3796_c1 | 3300050493 | Bacteria | 8005 |
| 1182 | nmdc:mga0k408_395218_c1 | 3300050493 | Bacteria | 823 |
| 1183 | nmdc:mga0k408_431352_c1 | 3300050493 | Bacteria | 783 |
| 1184 | nmdc:mga0k408_478719_c1 | 3300050493 | Bacteria | 738 |
| 1185 | nmdc:mga0k408_5099_c1 | 3300050493 | Bacteria | 6957 |
| 1186 | nmdc:mga0k408_65024_c1 | 3300050493 | Bacteria | 2123 |
| 1187 | nmdc:mga0k408_69910_c1 | 3300050493 | Bacteria | 2049 |
| 1188 | nmdc:mga0k408_81526_c1 | 3300050493 | Bacteria | 1895 |
| 1189 | nmdc:mga0k408_97350_c1 | 3300050493 | Bacteria | 1733 |
| 1190 | nmdc:mga06z11_21621_c1 | 3300050494 | Bacteria | 2992 |
| 1191 | nmdc:mga06z11_23705_c1 | 3300050494 | Bacteria | 2887 |
| 1192 | nmdc:mga06z11_33392_c1 | 3300050494 | Bacteria | 2517 |
| 1193 | nmdc:mga04h51_122173_c1 | 3300050495 | Bacteria | 971 |
| 1194 | nmdc:mga04h51_16186_c1 | 3300050495 | Bacteria | 2162 |
| 1195 | nmdc:mga07m45_109980_c1 | 3300050496 | Bacteria | 1587 |
| 1196 | nmdc:mga07m45_13565_c1 | 3300050496 | Bacteria | 4328 |
| 1197 | nmdc:mga07m45_1396_c1 | 3300050496 | Bacteria | 11033 |
| 1198 | nmdc:mga07m45_149384_c1 | 3300050496 | Bacteria | 1355 |
| 1199 | nmdc:mga07m45_16974_c1 | 3300050496 | Bacteria | 3903 |
| 1200 | nmdc:mga07m45_169790_c1 | 3300050496 | Bacteria | 1268 |
| 1201 | nmdc:mga07m45_17516_c1 | 3300050496 | Bacteria | 1557 |
| 1202 | nmdc:mga07m45_4379_c1 | 3300050496 | Bacteria | 6912 |
| 1203 | nmdc:mga07m45_703_c1 | 3300050496 | Bacteria | 10085 |
| 1204 | nmdc:mga07m45_8060_c1 | 3300050496 | Bacteria | 5401 |
| 1205 | nmdc:mga07m45_8068_c1 | 3300050496 | Bacteria | 5399 |
| 1206 | nmdc:mga05p37_604576_c1 | 3300050507 | Bacteria | 1237 |
| 1207 | nmdc:mga09592_14154_c1 | 3300050508 | Bacteria | 6507 |
| 1208 | nmdc:mga0n895_1021423_c1 | 3300050512 | Bacteria | 807 |
| 1209 | nmdc:mga08x19_441838_c1 | 3300050514 | Bacteria | 915 |
| 1210 | nmdc:mga0sz30_24868_c1 | 3300050516 | Bacteria | 2447 |
| 1211 | nmdc:mga0sz30_44355_c1 | 3300050516 | Bacteria | 1873 |
| 1212 | Ga0495601_0156675 | 3300053077 | Bacteria | 1487 |
| 1213 | Ga0495601_0252829 | 3300053077 | Bacteria | 1151 |
| 1214 | Ga0495612_0179828 | 3300053078 | Bacteria | 928 |
| 1215 | Ga0500635_0000686 | 3300053080 | Bacteria | 8572 |
| 1216 | Ga0500635_0006628 | 3300053080 | Bacteria | 3100 |
| 1217 | Ga0495595_0151240 | 3300053084 | Bacteria | 1142 |
| 1218 | Ga0495619_0020424 | 3300053085 | Bacteria | 4218 |
| 1219 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 1220 | Ga0500643_078193 | 3300053087 | Bacteria | 911 |
| 1221 | Ga0500644_0022077 | 3300053088 | Bacteria | 1915 |
| 1222 | Ga0500644_0099687 | 3300053088 | Bacteria | 1102 |
| 1223 | Ga0500644_0110844 | 3300053088 | Bacteria | 1057 |
| 1224 | Ga0500583_0194321 | 3300053092 | Bacteria | 1009 |
| 1225 | Ga0500651_0004274 | 3300053093 | Bacteria | 7979 |
| 1226 | Ga0500651_0030735 | 3300053093 | Bacteria | 3381 |
| 1227 | Ga0500651_0066076 | 3300053093 | Bacteria | 2253 |
| 1228 | Ga0500650_0139028 | 3300053098 | Bacteria | 1126 |
| 1229 | Ga0500562_014154 | 3300053108 | Bacteria | 2042 |
| 1230 | Ga0500562_017531 | 3300053108 | Bacteria | 1847 |
| 1231 | Ga0500569_030765 | 3300053109 | Bacteria | 1505 |
| 1232 | Ga0500593_001497 | 3300053117 | Bacteria | 8383 |
| 1233 | Ga0500593_057174 | 3300053117 | Bacteria | 1721 |
| 1234 | Ga0500593_171330 | 3300053117 | Bacteria | 817 |
| 1235 | Ga0500594_0004520 | 3300053118 | Bacteria | 3067 |
| 1236 | Ga0500607_183554 | 3300053121 | Bacteria | 924 |
| 1237 | Ga0500623_080702 | 3300053127 | Bacteria | 1548 |
| 1238 | Ga0500628_033577 | 3300053129 | Bacteria | 1129 |
| 1239 | Ga0500642_0002917 | 3300053130 | Bacteria | 5088 |
| 1240 | Ga0500652_000046 | 3300053131 | Bacteria | 58476 |
| 1241 | Ga0500652_024874 | 3300053131 | Bacteria | 2290 |
| 1242 | Ga0500655_004813 | 3300053133 | Bacteria | 2429 |
| 1243 | Ga0500658_0001688 | 3300053134 | Bacteria | 8752 |
| 1244 | Ga0500559_0000717 | 3300053136 | Bacteria | 21775 |
| 1245 | Ga0500561_0011034 | 3300053137 | Bacteria | 1888 |
| 1246 | Ga0500568_0009618 | 3300053139 | Bacteria | 4580 |
| 1247 | Ga0500568_0013406 | 3300053139 | Bacteria | 3738 |
| 1248 | Ga0500577_0004010 | 3300053142 | Bacteria | 3856 |
| 1249 | Ga0500588_0014459 | 3300053146 | Bacteria | 2001 |
| 1250 | Ga0500590_004936 | 3300053148 | Bacteria | 6373 |
| 1251 | Ga0500604_0004410 | 3300053151 | Bacteria | 3737 |
| 1252 | Ga0500622_0000415 | 3300053156 | Bacteria | 40612 |
| 1253 | Ga0500622_0004562 | 3300053156 | Bacteria | 8637 |
| 1254 | Ga0500622_0009199 | 3300053156 | Bacteria | 5483 |
| 1255 | Ga0500622_0156237 | 3300053156 | Bacteria | 1073 |
| 1256 | Ga0500622_0172818 | 3300053156 | Bacteria | 1004 |
| 1257 | Ga0500636_0011589 | 3300053177 | Bacteria | 5162 |
| 1258 | Ga0500587_000461 | 3300053739 | Bacteria | 4841 |
| 1259 | Ga0500587_005832 | 3300053739 | Bacteria | 1647 |
| 1260 | Ga0590071_013876 | 3300059421 | Bacteria | 1888 |
| 1261 | Ga0590075_001938 | 3300059424 | Bacteria | 5006 |
| 1262 | Ga0501082_0289178 | 3300060353 | Bacteria | 1427 |
| 1263 | Ga0466962_0004095 | 3300061719 | Bacteria | 6983 |
| 1264 | Ga0466962_0017132 | 3300061719 | Bacteria | 3490 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2919704043 | 2919706921 | 205 |
| 2 | 3300048915 | Ga0496112_0148171 | Ga0496112_0148171_1065_1685 | 206 |
| 3 | iso_pu_bacteria | 2643221660 | 2644340939 | 206 |
| 4 | 3300035121 | Ga0373960_0071648 | Ga0373960_0071648_105_728 | 207 |
| 5 | 3300035398 | Ga0316574_0225148 | Ga0316574_0225148_486_1178 | 207 |
| 6 | 3300042876 | Ga0451577_0005835 | Ga0451577_0005835_3916_4545 | 207 |
| 7 | 3300044673 | Ga0453683_0366974 | Ga0453683_0366974_281_910 | 207 |
| 8 | 3300046535 | Ga0495586_0062991 | Ga0495586_0062991_1352_1999 | 207 |
| 9 | 3300049582 | Ga0501048_0192413 | Ga0501048_0192413_255_881 | 207 |
| 10 | iso_pu_bacteria | 2643221544 | 2643743892 | 207 |
| 11 | iso_pu_bacteria | 2643221585 | 2643933060 | 207 |
| 12 | iso_pu_bacteria | 2643221639 | 2644217202 | 207 |
| 13 | iso_pu_bacteria | 2643221646 | 2644259028 | 207 |
| 14 | iso_pu_bacteria | 2643221654 | 2644302785 | 207 |
| 15 | iso_pu_bacteria | 2643221656 | 2644314309 | 207 |
| 16 | iso_pu_bacteria | 2738541337 | 2739055769 | 207 |
| 17 | 3300013296 | Ga0157374_10000271 | Ga0157374_100002712 | 208 |
| 18 | 3300031250 | Ga0265331_10032791 | Ga0265331_100327912 | 208 |
| 19 | 3300034817 | Ga0373948_0036937 | Ga0373948_0036937_21_653 | 208 |
| 20 | 3300035691 | Ga0373931_0108561 | Ga0373931_0108561_346_978 | 208 |
| 21 | 3300044712 | Ga0453684_0000142 | Ga0453684_0000142_48462_49097 | 208 |
| 22 | 3300045051 | Ga0451576_0072377 | Ga0451576_0072377_184_816 | 208 |
| 23 | iso_pu_bacteria | 2585428057 | 2587730781 | 208 |
| 24 | iso_pu_bacteria | 2585428058 | 2587737201 | 208 |
| 25 | iso_pu_bacteria | 2585428062 | 2587756151 | 208 |
| 26 | iso_pu_bacteria | 2588253510 | 2588295770 | 208 |
| 27 | iso_pu_bacteria | 2643221592 | 2643966934 | 208 |
| 28 | iso_pu_bacteria | 2643221644 | 2644248177 | 208 |
| 29 | iso_pu_bacteria | 2643221648 | 2644273628 | 208 |
| 30 | iso_pu_bacteria | 2831864461 | 2831866096 | 208 |
| 31 | iso_pu_bacteria | 2886848708 | 2886852830 | 208 |
| 32 | 3300005333 | Ga0070677_10014841 | Ga0070677_100148413 | 209 |
| 33 | 3300005353 | Ga0070669_100015642 | Ga0070669_1000156426 | 209 |
| 34 | 3300005353 | Ga0070669_100455382 | Ga0070669_1004553822 | 209 |
| 35 | 3300005354 | Ga0070675_100036889 | Ga0070675_1000368893 | 209 |
| 36 | 3300005355 | Ga0070671_100002511 | Ga0070671_10000251118 | 209 |
| 37 | 3300005356 | Ga0070674_100429687 | Ga0070674_1004296872 | 209 |
| 38 | 3300005364 | Ga0070673_100090098 | Ga0070673_1000900982 | 209 |
| 39 | 3300005456 | Ga0070678_100112182 | Ga0070678_1001121823 | 209 |
| 40 | 3300005456 | Ga0070678_100475515 | Ga0070678_1004755152 | 209 |
| 41 | 3300005543 | Ga0070672_100043657 | Ga0070672_1000436572 | 209 |
| 42 | 3300005618 | Ga0068864_100178778 | Ga0068864_1001787782 | 209 |
| 43 | 3300005618 | Ga0068864_100717192 | Ga0068864_1007171922 | 209 |
| 44 | 3300005843 | Ga0068860_100248051 | Ga0068860_1002480513 | 209 |
| 45 | 3300006353 | Ga0075370_10055486 | Ga0075370_100554861 | 209 |
| 46 | 3300009177 | Ga0105248_10004768 | Ga0105248_100047689 | 209 |
| 47 | 3300012512 | Ga0157327_1019006 | Ga0157327_10190061 | 209 |
| 48 | 3300014326 | Ga0157380_10223993 | Ga0157380_102239932 | 209 |
| 49 | 3300025923 | Ga0207681_10125073 | Ga0207681_101250732 | 209 |
| 50 | 3300025923 | Ga0207681_10615744 | Ga0207681_106157442 | 209 |
| 51 | 3300025931 | Ga0207644_10049492 | Ga0207644_100494923 | 209 |
| 52 | 3300025937 | Ga0207669_10542214 | Ga0207669_105422142 | 209 |
| 53 | 3300025940 | Ga0207691_10057939 | Ga0207691_100579392 | 209 |
| 54 | 3300025941 | Ga0207711_10142124 | Ga0207711_101421242 | 209 |
| 55 | 3300025960 | Ga0207651_10060252 | Ga0207651_100602522 | 209 |
| 56 | 3300025972 | Ga0207668_10055113 | Ga0207668_100551132 | 209 |
| 57 | 3300026088 | Ga0207641_10109722 | Ga0207641_101097223 | 209 |
| 58 | 3300026095 | Ga0207676_10088207 | Ga0207676_100882072 | 209 |
| 59 | 3300026095 | Ga0207676_10247857 | Ga0207676_102478572 | 209 |
| 60 | 3300027471 | Ga0209995_1021109 | Ga0209995_10211091 | 209 |
| 61 | 3300027526 | Ga0209968_1000140 | Ga0209968_10001406 | 209 |
| 62 | 3300027526 | Ga0209968_1046312 | Ga0209968_10463121 | 209 |
| 63 | 3300027614 | Ga0209970_1000593 | Ga0209970_10005935 | 209 |
| 64 | 3300027665 | Ga0209983_1034722 | Ga0209983_10347222 | 209 |
| 65 | 3300027695 | Ga0209966_1000388 | Ga0209966_100038811 | 209 |
| 66 | 3300028381 | Ga0268264_10229682 | Ga0268264_102296822 | 209 |
| 67 | 3300028794 | Ga0307515_10003451 | Ga0307515_1000345111 | 209 |
| 68 | 3300028794 | Ga0307515_10049534 | Ga0307515_100495342 | 209 |
| 69 | 3300030522 | Ga0307512_10192219 | Ga0307512_101922192 | 209 |
| 70 | 3300031239 | Ga0265328_10013329 | Ga0265328_100133294 | 209 |
| 71 | 3300031239 | Ga0265328_10013826 | Ga0265328_100138262 | 209 |
| 72 | 3300031251 | Ga0265327_10000210 | Ga0265327_1000021073 | 209 |
| 73 | 3300031344 | Ga0265316_10000005 | Ga0265316_10000005136 | 209 |
| 74 | 3300031456 | Ga0307513_10043401 | Ga0307513_100434018 | 209 |
| 75 | 3300031456 | Ga0307513_10130643 | Ga0307513_101306432 | 209 |
| 76 | 3300031507 | Ga0307509_10151843 | Ga0307509_101518431 | 209 |
| 77 | 3300031548 | Ga0307408_100379381 | Ga0307408_1003793812 | 209 |
| 78 | 3300031649 | Ga0307514_10000711 | Ga0307514_1000071144 | 209 |
| 79 | 3300031691 | Ga0316579_10046081 | Ga0316579_100460812 | 209 |
| 80 | 3300031730 | Ga0307516_10004205 | Ga0307516_100042056 | 209 |
| 81 | 3300031731 | Ga0307405_10033534 | Ga0307405_100335342 | 209 |
| 82 | 3300031733 | Ga0316577_10003732 | Ga0316577_100037327 | 209 |
| 83 | 3300031733 | Ga0316577_10387931 | Ga0316577_103879311 | 209 |
| 84 | 3300031901 | Ga0307406_10614595 | Ga0307406_106145951 | 209 |
| 85 | 3300031911 | Ga0307412_10041419 | Ga0307412_100414192 | 209 |
| 86 | 3300031995 | Ga0307409_100449872 | Ga0307409_1004498722 | 209 |
| 87 | 3300032005 | Ga0307411_10189892 | Ga0307411_101898923 | 209 |
| 88 | 3300033180 | Ga0307510_10071009 | Ga0307510_100710095 | 209 |
| 89 | 3300036712 | Ga0316584_0343258 | Ga0316584_0343258_104_766 | 209 |
| 90 | 3300037471 | Ga0395905_0003411 | Ga0395905_0003411_12099_12728 | 209 |
| 91 | 3300038443 | Ga0395901_0765087 | Ga0395901_0765087_34_663 | 209 |
| 92 | 3300041459 | Ga0451800_1277183 | Ga0451800_1277183_29_658 | 209 |
| 93 | 3300042004 | Ga0439445_0002228 | Ga0439445_0002228_572_1201 | 209 |
| 94 | 3300042115 | Ga0450911_000798 | Ga0450911_000798_4807_5436 | 209 |
| 95 | 3300042876 | Ga0451577_0000303 | Ga0451577_0000303_65411_66040 | 209 |
| 96 | 3300042876 | Ga0451577_0013164 | Ga0451577_0013164_254_925 | 209 |
| 97 | 3300042876 | Ga0451577_0032453 | Ga0451577_0032453_3889_4518 | 209 |
| 98 | 3300044673 | Ga0453683_0015947 | Ga0453683_0015947_2170_2799 | 209 |
| 99 | 3300044712 | Ga0453684_0000055 | Ga0453684_0000055_358175_358846 | 209 |
| 100 | 3300044712 | Ga0453684_0000947 | Ga0453684_0000947_29801_30430 | 209 |
| 101 | 3300044712 | Ga0453684_0056165 | Ga0453684_0056165_41_670 | 209 |
| 102 | 3300045051 | Ga0451576_0000880 | Ga0451576_0000880_28103_28732 | 209 |
| 103 | 3300045051 | Ga0451576_0003317 | Ga0451576_0003317_15551_16180 | 209 |
| 104 | 3300046530 | Ga0495654_0002282 | Ga0495654_0002282_3468_4097 | 209 |
| 105 | 3300046539 | Ga0495621_0003869 | Ga0495621_0003869_3505_4137 | 209 |
| 106 | 3300046542 | Ga0495597_0122298 | Ga0495597_0122298_395_1024 | 209 |
| 107 | 3300048904 | Ga0496101_0491013 | Ga0496101_0491013_131_760 | 209 |
| 108 | 3300048907 | Ga0496104_0196556 | Ga0496104_0196556_532_1161 | 209 |
| 109 | 3300048908 | Ga0496105_0066776 | Ga0496105_0066776_1873_2502 | 209 |
| 110 | 3300048912 | Ga0496109_0031899 | Ga0496109_0031899_1890_2519 | 209 |
| 111 | 3300048912 | Ga0496109_0392819 | Ga0496109_0392819_43_672 | 209 |
| 112 | 3300048913 | Ga0496110_0037484 | Ga0496110_0037484_535_1164 | 209 |
| 113 | 3300048913 | Ga0496110_0105616 | Ga0496110_0105616_170_799 | 209 |
| 114 | 3300048914 | Ga0496111_0175235 | Ga0496111_0175235_48_677 | 209 |
| 115 | 3300048915 | Ga0496112_0011296 | Ga0496112_0011296_3306_3935 | 209 |
| 116 | 3300048916 | Ga0496113_0184490 | Ga0496113_0184490_925_1554 | 209 |
| 117 | 3300048917 | Ga0496114_0249630 | Ga0496114_0249630_338_967 | 209 |
| 118 | 3300048927 | Ga0496124_0024540 | Ga0496124_0024540_236_865 | 209 |
| 119 | 3300048928 | Ga0496125_0033740 | Ga0496125_0033740_442_1071 | 209 |
| 120 | 3300048928 | Ga0496125_0042673 | Ga0496125_0042673_3207_3836 | 209 |
| 121 | 3300048929 | Ga0496126_0034601 | Ga0496126_0034601_2118_2747 | 209 |
| 122 | 3300049571 | Ga0501034_0038599 | Ga0501034_0038599_3997_4626 | 209 |
| 123 | 3300049581 | Ga0501047_0538719 | Ga0501047_0538719_247_876 | 209 |
| 124 | 3300053087 | Ga0500643_078193 | Ga0500643_078193_77_706 | 209 |
| 125 | 3300053108 | Ga0500562_014154 | Ga0500562_014154_1230_1859 | 209 |
| 126 | 3300053109 | Ga0500569_030765 | Ga0500569_030765_673_1302 | 209 |
| 127 | 3300053117 | Ga0500593_057174 | Ga0500593_057174_660_1289 | 209 |
| 128 | 3300053137 | Ga0500561_0011034 | Ga0500561_0011034_1240_1869 | 209 |
| 129 | 3300059421 | Ga0590071_013876 | Ga0590071_013876_1197_1826 | 209 |
| 130 | 3300059424 | Ga0590075_001938 | Ga0590075_001938_1551_2183 | 209 |
| 131 | 3300003759 | Ga0055525_1000038 | Ga0055525_100003831 | 210 |
| 132 | 3300021361 | Ga0213872_10000044 | Ga0213872_100000445 | 210 |
| 133 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051241 | 210 |
| 134 | 3300031239 | Ga0265328_10010054 | Ga0265328_100100545 | 210 |
| 135 | 3300031250 | Ga0265331_10002534 | Ga0265331_100025342 | 210 |
| 136 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028182 | 210 |
| 137 | 3300031649 | Ga0307514_10001565 | Ga0307514_1000156515 | 210 |
| 138 | 3300039447 | Ga0436361_0886712 | Ga0436361_0886712_5020_5664 | 210 |
| 139 | 3300042876 | Ga0451577_0004580 | Ga0451577_0004580_11647_12285 | 210 |
| 140 | 3300042876 | Ga0451577_0019759 | Ga0451577_0019759_5189_5827 | 210 |
| 141 | 3300044712 | Ga0453684_0047779 | Ga0453684_0047779_173_811 | 210 |
| 142 | 3300044712 | Ga0453684_0308604 | Ga0453684_0308604_1053_1727 | 210 |
| 143 | 3300045051 | Ga0451576_0007754 | Ga0451576_0007754_6344_6982 | 210 |
| 144 | 3300048925 | Ga0496122_0130111 | Ga0496122_0130111_428_1072 | 210 |
| 145 | 3300002705 | JGI25156J39149_1002048 | JGI25156J39149_10020483 | 211 |
| 146 | 3300002705 | JGI25156J39149_1002716 | JGI25156J39149_10027164 | 211 |
| 147 | 3300002705 | JGI25156J39149_1007600 | JGI25156J39149_10076004 | 211 |
| 148 | 3300002705 | JGI25156J39149_1017236 | JGI25156J39149_10172361 | 211 |
| 149 | 3300002738 | JGI25154J39366_1000783 | JGI25154J39366_100078310 | 211 |
| 150 | 3300002741 | JGI25157J39369_1000551 | JGI25157J39369_100055118 | 211 |
| 151 | 3300002772 | JGI25164J39214_1005629 | JGI25164J39214_10056292 | 211 |
| 152 | 3300003305 | Ga0006770J48903_1062170 | Ga0006770J48903_10621701 | 211 |
| 153 | 3300003316 | rootH1_10009161 | rootH1_100091615 | 211 |
| 154 | 3300003320 | rootH2_10083264 | rootH2_100832642 | 211 |
| 155 | 3300003320 | rootH2_10087210 | rootH2_100872103 | 211 |
| 156 | 3300003323 | rootH1_10032898 | rootH1_100328985 | 211 |
| 157 | 3300003752 | Ga0055539_1000766 | Ga0055539_10007666 | 211 |
| 158 | 3300003752 | Ga0055539_1002353 | Ga0055539_10023532 | 211 |
| 159 | 3300003756 | Ga0055533_1000053 | Ga0055533_100005321 | 211 |
| 160 | 3300003759 | Ga0055525_1001506 | Ga0055525_10015063 | 211 |
| 161 | 3300003761 | Ga0055535_1001169 | Ga0055535_10011695 | 211 |
| 162 | 3300003761 | Ga0055535_1018710 | Ga0055535_10187102 | 211 |
| 163 | 3300003763 | Ga0055529_1000431 | Ga0055529_100043121 | 211 |
| 164 | 3300003792 | Ga0055540_1032332 | Ga0055540_10323321 | 211 |
| 165 | 3300003794 | Ga0055531_10000043 | Ga0055531_1000004366 | 211 |
| 166 | 3300005293 | Ga0065715_10184216 | Ga0065715_101842162 | 211 |
| 167 | 3300005327 | Ga0070658_10040482 | Ga0070658_100404822 | 211 |
| 168 | 3300005327 | Ga0070658_10076570 | Ga0070658_100765702 | 211 |
| 169 | 3300005327 | Ga0070658_10091163 | Ga0070658_100911633 | 211 |
| 170 | 3300005327 | Ga0070658_10750308 | Ga0070658_107503081 | 211 |
| 171 | 3300005328 | Ga0070676_10001571 | Ga0070676_100015715 | 211 |
| 172 | 3300005328 | Ga0070676_10009968 | Ga0070676_100099685 | 211 |
| 173 | 3300005328 | Ga0070676_10077944 | Ga0070676_100779442 | 211 |
| 174 | 3300005328 | Ga0070676_10242371 | Ga0070676_102423711 | 211 |
| 175 | 3300005329 | Ga0070683_100042121 | Ga0070683_1000421213 | 211 |
| 176 | 3300005329 | Ga0070683_100063563 | Ga0070683_1000635632 | 211 |
| 177 | 3300005330 | Ga0070690_100067742 | Ga0070690_1000677422 | 211 |
| 178 | 3300005330 | Ga0070690_100068766 | Ga0070690_1000687663 | 211 |
| 179 | 3300005330 | Ga0070690_100369620 | Ga0070690_1003696202 | 211 |
| 180 | 3300005331 | Ga0070670_100002895 | Ga0070670_1000028954 | 211 |
| 181 | 3300005331 | Ga0070670_100052223 | Ga0070670_1000522232 | 211 |
| 182 | 3300005331 | Ga0070670_100068319 | Ga0070670_1000683192 | 211 |
| 183 | 3300005331 | Ga0070670_100072274 | Ga0070670_1000722744 | 211 |
| 184 | 3300005331 | Ga0070670_100409113 | Ga0070670_1004091131 | 211 |
| 185 | 3300005334 | Ga0068869_100010255 | Ga0068869_1000102554 | 211 |
| 186 | 3300005334 | Ga0068869_100036073 | Ga0068869_1000360732 | 211 |
| 187 | 3300005334 | Ga0068869_100043229 | Ga0068869_1000432292 | 211 |
| 188 | 3300005334 | Ga0068869_100220220 | Ga0068869_1002202202 | 211 |
| 189 | 3300005335 | Ga0070666_10005627 | Ga0070666_100056272 | 211 |
| 190 | 3300005335 | Ga0070666_10037731 | Ga0070666_100377311 | 211 |
| 191 | 3300005335 | Ga0070666_10068676 | Ga0070666_100686763 | 211 |
| 192 | 3300005336 | Ga0070680_100014127 | Ga0070680_1000141275 | 211 |
| 193 | 3300005338 | Ga0068868_100005991 | Ga0068868_1000059912 | 211 |
| 194 | 3300005338 | Ga0068868_100075106 | Ga0068868_1000751061 | 211 |
| 195 | 3300005338 | Ga0068868_100357881 | Ga0068868_1003578812 | 211 |
| 196 | 3300005338 | Ga0068868_100385495 | Ga0068868_1003854951 | 211 |
| 197 | 3300005339 | Ga0070660_100058136 | Ga0070660_1000581364 | 211 |
| 198 | 3300005339 | Ga0070660_100058999 | Ga0070660_1000589992 | 211 |
| 199 | 3300005339 | Ga0070660_100222427 | Ga0070660_1002224272 | 211 |
| 200 | 3300005343 | Ga0070687_100136435 | Ga0070687_1001364352 | 211 |
| 201 | 3300005343 | Ga0070687_100137107 | Ga0070687_1001371072 | 211 |
| 202 | 3300005344 | Ga0070661_100023474 | Ga0070661_1000234743 | 211 |
| 203 | 3300005344 | Ga0070661_100192346 | Ga0070661_1001923462 | 211 |
| 204 | 3300005344 | Ga0070661_100285421 | Ga0070661_1002854212 | 211 |
| 205 | 3300005345 | Ga0070692_10322102 | Ga0070692_103221022 | 211 |
| 206 | 3300005347 | Ga0070668_100005605 | Ga0070668_1000056054 | 211 |
| 207 | 3300005347 | Ga0070668_100142831 | Ga0070668_1001428312 | 211 |
| 208 | 3300005347 | Ga0070668_100271141 | Ga0070668_1002711411 | 211 |
| 209 | 3300005353 | Ga0070669_100020771 | Ga0070669_1000207715 | 211 |
| 210 | 3300005353 | Ga0070669_100026966 | Ga0070669_1000269663 | 211 |
| 211 | 3300005353 | Ga0070669_100126035 | Ga0070669_1001260352 | 211 |
| 212 | 3300005353 | Ga0070669_100242374 | Ga0070669_1002423742 | 211 |
| 213 | 3300005354 | Ga0070675_100021338 | Ga0070675_1000213383 | 211 |
| 214 | 3300005354 | Ga0070675_100025785 | Ga0070675_1000257852 | 211 |
| 215 | 3300005354 | Ga0070675_100029887 | Ga0070675_1000298873 | 211 |
| 216 | 3300005354 | Ga0070675_100035559 | Ga0070675_1000355592 | 211 |
| 217 | 3300005354 | Ga0070675_100074550 | Ga0070675_1000745504 | 211 |
| 218 | 3300005354 | Ga0070675_100101334 | Ga0070675_1001013343 | 211 |
| 219 | 3300005354 | Ga0070675_100121594 | Ga0070675_1001215942 | 211 |
| 220 | 3300005354 | Ga0070675_100564713 | Ga0070675_1005647132 | 211 |
| 221 | 3300005355 | Ga0070671_100014186 | Ga0070671_1000141865 | 211 |
| 222 | 3300005355 | Ga0070671_100017039 | Ga0070671_1000170396 | 211 |
| 223 | 3300005355 | Ga0070671_100050234 | Ga0070671_1000502342 | 211 |
| 224 | 3300005355 | Ga0070671_100053915 | Ga0070671_1000539154 | 211 |
| 225 | 3300005355 | Ga0070671_100056719 | Ga0070671_1000567193 | 211 |
| 226 | 3300005355 | Ga0070671_100134964 | Ga0070671_1001349642 | 211 |
| 227 | 3300005355 | Ga0070671_100170914 | Ga0070671_1001709141 | 211 |
| 228 | 3300005356 | Ga0070674_100017041 | Ga0070674_1000170412 | 211 |
| 229 | 3300005356 | Ga0070674_100036447 | Ga0070674_1000364473 | 211 |
| 230 | 3300005364 | Ga0070673_100001525 | Ga0070673_10000152517 | 211 |
| 231 | 3300005364 | Ga0070673_100005338 | Ga0070673_1000053383 | 211 |
| 232 | 3300005364 | Ga0070673_100012028 | Ga0070673_1000120284 | 211 |
| 233 | 3300005364 | Ga0070673_100097413 | Ga0070673_1000974131 | 211 |
| 234 | 3300005364 | Ga0070673_100246407 | Ga0070673_1002464072 | 211 |
| 235 | 3300005364 | Ga0070673_100773647 | Ga0070673_1007736471 | 211 |
| 236 | 3300005365 | Ga0070688_100090969 | Ga0070688_1000909691 | 211 |
| 237 | 3300005365 | Ga0070688_100172768 | Ga0070688_1001727682 | 211 |
| 238 | 3300005366 | Ga0070659_100018804 | Ga0070659_1000188046 | 211 |
| 239 | 3300005366 | Ga0070659_100132044 | Ga0070659_1001320442 | 211 |
| 240 | 3300005366 | Ga0070659_100199327 | Ga0070659_1001993273 | 211 |
| 241 | 3300005367 | Ga0070667_100000702 | Ga0070667_10000070228 | 211 |
| 242 | 3300005367 | Ga0070667_100014692 | Ga0070667_1000146925 | 211 |
| 243 | 3300005367 | Ga0070667_100051164 | Ga0070667_1000511643 | 211 |
| 244 | 3300005367 | Ga0070667_100095534 | Ga0070667_1000955342 | 211 |
| 245 | 3300005441 | Ga0070700_100298003 | Ga0070700_1002980031 | 211 |
| 246 | 3300005455 | Ga0070663_100003281 | Ga0070663_1000032814 | 211 |
| 247 | 3300005456 | Ga0070678_100031660 | Ga0070678_1000316602 | 211 |
| 248 | 3300005456 | Ga0070678_100088709 | Ga0070678_1000887092 | 211 |
| 249 | 3300005456 | Ga0070678_100132721 | Ga0070678_1001327211 | 211 |
| 250 | 3300005456 | Ga0070678_100153184 | Ga0070678_1001531842 | 211 |
| 251 | 3300005456 | Ga0070678_100304969 | Ga0070678_1003049692 | 211 |
| 252 | 3300005457 | Ga0070662_100001681 | Ga0070662_1000016813 | 211 |
| 253 | 3300005457 | Ga0070662_100018885 | Ga0070662_1000188854 | 211 |
| 254 | 3300005457 | Ga0070662_100083930 | Ga0070662_1000839302 | 211 |
| 255 | 3300005457 | Ga0070662_100102524 | Ga0070662_1001025242 | 211 |
| 256 | 3300005457 | Ga0070662_100106906 | Ga0070662_1001069062 | 211 |
| 257 | 3300005459 | Ga0068867_100000329 | Ga0068867_1000003292 | 211 |
| 258 | 3300005459 | Ga0068867_100011396 | Ga0068867_1000113962 | 211 |
| 259 | 3300005459 | Ga0068867_100016329 | Ga0068867_1000163296 | 211 |
| 260 | 3300005459 | Ga0068867_100024678 | Ga0068867_1000246784 | 211 |
| 261 | 3300005459 | Ga0068867_100026671 | Ga0068867_1000266713 | 211 |
| 262 | 3300005459 | Ga0068867_100209582 | Ga0068867_1002095821 | 211 |
| 263 | 3300005459 | Ga0068867_100243934 | Ga0068867_1002439342 | 211 |
| 264 | 3300005466 | Ga0070685_10015464 | Ga0070685_100154644 | 211 |
| 265 | 3300005466 | Ga0070685_10491459 | Ga0070685_104914591 | 211 |
| 266 | 3300005467 | Ga0070706_100003982 | Ga0070706_10000398212 | 211 |
| 267 | 3300005467 | Ga0070706_100100656 | Ga0070706_1001006561 | 211 |
| 268 | 3300005468 | Ga0070707_100509147 | Ga0070707_1005091471 | 211 |
| 269 | 3300005530 | Ga0070679_100002110 | Ga0070679_1000021103 | 211 |
| 270 | 3300005535 | Ga0070684_100252062 | Ga0070684_1002520622 | 211 |
| 271 | 3300005539 | Ga0068853_100080642 | Ga0068853_1000806421 | 211 |
| 272 | 3300005539 | Ga0068853_100086802 | Ga0068853_1000868022 | 211 |
| 273 | 3300005539 | Ga0068853_100187973 | Ga0068853_1001879733 | 211 |
| 274 | 3300005543 | Ga0070672_100002315 | Ga0070672_1000023154 | 211 |
| 275 | 3300005543 | Ga0070672_100002548 | Ga0070672_10000254810 | 211 |
| 276 | 3300005543 | Ga0070672_100002827 | Ga0070672_1000028277 | 211 |
| 277 | 3300005543 | Ga0070672_100054949 | Ga0070672_1000549493 | 211 |
| 278 | 3300005543 | Ga0070672_100065143 | Ga0070672_1000651432 | 211 |
| 279 | 3300005543 | Ga0070672_100188217 | Ga0070672_1001882171 | 211 |
| 280 | 3300005543 | Ga0070672_100245180 | Ga0070672_1002451802 | 211 |
| 281 | 3300005543 | Ga0070672_100277747 | Ga0070672_1002777472 | 211 |
| 282 | 3300005544 | Ga0070686_100031869 | Ga0070686_1000318695 | 211 |
| 283 | 3300005548 | Ga0070665_100002955 | Ga0070665_10000295512 | 211 |
| 284 | 3300005548 | Ga0070665_101182355 | Ga0070665_1011823551 | 211 |
| 285 | 3300005563 | Ga0068855_100074071 | Ga0068855_1000740713 | 211 |
| 286 | 3300005563 | Ga0068855_100238851 | Ga0068855_1002388513 | 211 |
| 287 | 3300005564 | Ga0070664_100139645 | Ga0070664_1001396452 | 211 |
| 288 | 3300005564 | Ga0070664_100261584 | Ga0070664_1002615842 | 211 |
| 289 | 3300005564 | Ga0070664_100294446 | Ga0070664_1002944462 | 211 |
| 290 | 3300005577 | Ga0068857_100036400 | Ga0068857_1000364002 | 211 |
| 291 | 3300005577 | Ga0068857_100253539 | Ga0068857_1002535392 | 211 |
| 292 | 3300005577 | Ga0068857_100363086 | Ga0068857_1003630862 | 211 |
| 293 | 3300005578 | Ga0068854_100006268 | Ga0068854_1000062684 | 211 |
| 294 | 3300005578 | Ga0068854_100012676 | Ga0068854_1000126765 | 211 |
| 295 | 3300005578 | Ga0068854_100023755 | Ga0068854_1000237556 | 211 |
| 296 | 3300005578 | Ga0068854_100168900 | Ga0068854_1001689002 | 211 |
| 297 | 3300005578 | Ga0068854_100416033 | Ga0068854_1004160332 | 211 |
| 298 | 3300005614 | Ga0068856_100027796 | Ga0068856_1000277962 | 211 |
| 299 | 3300005614 | Ga0068856_100051194 | Ga0068856_1000511943 | 211 |
| 300 | 3300005614 | Ga0068856_100102898 | Ga0068856_1001028982 | 211 |
| 301 | 3300005614 | Ga0068856_100130455 | Ga0068856_1001304552 | 211 |
| 302 | 3300005614 | Ga0068856_100169431 | Ga0068856_1001694312 | 211 |
| 303 | 3300005614 | Ga0068856_100735324 | Ga0068856_1007353242 | 211 |
| 304 | 3300005615 | Ga0070702_100036625 | Ga0070702_1000366253 | 211 |
| 305 | 3300005616 | Ga0068852_100020253 | Ga0068852_1000202532 | 211 |
| 306 | 3300005616 | Ga0068852_100123887 | Ga0068852_1001238872 | 211 |
| 307 | 3300005616 | Ga0068852_100180734 | Ga0068852_1001807342 | 211 |
| 308 | 3300005616 | Ga0068852_100226765 | Ga0068852_1002267652 | 211 |
| 309 | 3300005616 | Ga0068852_100229098 | Ga0068852_1002290982 | 211 |
| 310 | 3300005616 | Ga0068852_100302447 | Ga0068852_1003024473 | 211 |
| 311 | 3300005616 | Ga0068852_100466896 | Ga0068852_1004668961 | 211 |
| 312 | 3300005616 | Ga0068852_100595266 | Ga0068852_1005952662 | 211 |
| 313 | 3300005616 | Ga0068852_100692491 | Ga0068852_1006924912 | 211 |
| 314 | 3300005616 | Ga0068852_100827867 | Ga0068852_1008278671 | 211 |
| 315 | 3300005617 | Ga0068859_100005588 | Ga0068859_10000558812 | 211 |
| 316 | 3300005617 | Ga0068859_100058362 | Ga0068859_1000583623 | 211 |
| 317 | 3300005617 | Ga0068859_100069270 | Ga0068859_1000692702 | 211 |
| 318 | 3300005617 | Ga0068859_100964241 | Ga0068859_1009642412 | 211 |
| 319 | 3300005618 | Ga0068864_100002234 | Ga0068864_1000022345 | 211 |
| 320 | 3300005618 | Ga0068864_100009938 | Ga0068864_1000099381 | 211 |
| 321 | 3300005618 | Ga0068864_100115868 | Ga0068864_1001158683 | 211 |
| 322 | 3300005618 | Ga0068864_100268253 | Ga0068864_1002682531 | 211 |
| 323 | 3300005718 | Ga0068866_10008518 | Ga0068866_100085182 | 211 |
| 324 | 3300005719 | Ga0068861_100001661 | Ga0068861_10000166111 | 211 |
| 325 | 3300005719 | Ga0068861_100004858 | Ga0068861_1000048582 | 211 |
| 326 | 3300005834 | Ga0068851_10183215 | Ga0068851_101832152 | 211 |
| 327 | 3300005840 | Ga0068870_10028578 | Ga0068870_100285783 | 211 |
| 328 | 3300005840 | Ga0068870_10093157 | Ga0068870_100931571 | 211 |
| 329 | 3300005841 | Ga0068863_100004155 | Ga0068863_1000041552 | 211 |
| 330 | 3300005841 | Ga0068863_100042613 | Ga0068863_1000426133 | 211 |
| 331 | 3300005841 | Ga0068863_100081641 | Ga0068863_1000816412 | 211 |
| 332 | 3300005841 | Ga0068863_100278683 | Ga0068863_1002786832 | 211 |
| 333 | 3300005841 | Ga0068863_100301059 | Ga0068863_1003010592 | 211 |
| 334 | 3300005841 | Ga0068863_100582212 | Ga0068863_1005822122 | 211 |
| 335 | 3300005842 | Ga0068858_100002678 | Ga0068858_1000026782 | 211 |
| 336 | 3300005842 | Ga0068858_100053372 | Ga0068858_1000533725 | 211 |
| 337 | 3300005842 | Ga0068858_100134145 | Ga0068858_1001341452 | 211 |
| 338 | 3300005842 | Ga0068858_100640357 | Ga0068858_1006403571 | 211 |
| 339 | 3300005843 | Ga0068860_100000943 | Ga0068860_10000094327 | 211 |
| 340 | 3300005843 | Ga0068860_100012396 | Ga0068860_1000123965 | 211 |
| 341 | 3300005843 | Ga0068860_100112503 | Ga0068860_1001125032 | 211 |
| 342 | 3300005843 | Ga0068860_100265208 | Ga0068860_1002652082 | 211 |
| 343 | 3300005843 | Ga0068860_100273411 | Ga0068860_1002734112 | 211 |
| 344 | 3300005843 | Ga0068860_100604751 | Ga0068860_1006047512 | 211 |
| 345 | 3300005844 | Ga0068862_100018064 | Ga0068862_1000180643 | 211 |
| 346 | 3300006038 | Ga0075365_10071939 | Ga0075365_100719392 | 211 |
| 347 | 3300006042 | Ga0075368_10001858 | Ga0075368_100018582 | 211 |
| 348 | 3300006042 | Ga0075368_10010880 | Ga0075368_100108802 | 211 |
| 349 | 3300006048 | Ga0075363_100019201 | Ga0075363_1000192012 | 211 |
| 350 | 3300006048 | Ga0075363_100023671 | Ga0075363_1000236713 | 211 |
| 351 | 3300006051 | Ga0075364_10004616 | Ga0075364_100046168 | 211 |
| 352 | 3300006051 | Ga0075364_10022968 | Ga0075364_100229682 | 211 |
| 353 | 3300006177 | Ga0075362_10000760 | Ga0075362_100007607 | 211 |
| 354 | 3300006177 | Ga0075362_10148162 | Ga0075362_101481622 | 211 |
| 355 | 3300006177 | Ga0075362_10249295 | Ga0075362_102492951 | 211 |
| 356 | 3300006178 | Ga0075367_10003300 | Ga0075367_100033006 | 211 |
| 357 | 3300006178 | Ga0075367_10009174 | Ga0075367_100091742 | 211 |
| 358 | 3300006178 | Ga0075367_10037724 | Ga0075367_100377242 | 211 |
| 359 | 3300006178 | Ga0075367_10045779 | Ga0075367_100457792 | 211 |
| 360 | 3300006178 | Ga0075367_10149702 | Ga0075367_101497021 | 211 |
| 361 | 3300006186 | Ga0075369_10017423 | Ga0075369_100174232 | 211 |
| 362 | 3300006186 | Ga0075369_10024769 | Ga0075369_100247692 | 211 |
| 363 | 3300006186 | Ga0075369_10075485 | Ga0075369_100754851 | 211 |
| 364 | 3300006195 | Ga0075366_10004079 | Ga0075366_100040792 | 211 |
| 365 | 3300006195 | Ga0075366_10009539 | Ga0075366_100095394 | 211 |
| 366 | 3300006195 | Ga0075366_10012478 | Ga0075366_100124782 | 211 |
| 367 | 3300006195 | Ga0075366_10013722 | Ga0075366_100137224 | 211 |
| 368 | 3300006195 | Ga0075366_10014473 | Ga0075366_100144735 | 211 |
| 369 | 3300006195 | Ga0075366_10051734 | Ga0075366_100517342 | 211 |
| 370 | 3300006195 | Ga0075366_10073749 | Ga0075366_100737492 | 211 |
| 371 | 3300006195 | Ga0075366_10093330 | Ga0075366_100933302 | 211 |
| 372 | 3300006195 | Ga0075366_10107373 | Ga0075366_101073732 | 211 |
| 373 | 3300006195 | Ga0075366_10233340 | Ga0075366_102333402 | 211 |
| 374 | 3300006195 | Ga0075366_10308834 | Ga0075366_103088342 | 211 |
| 375 | 3300006237 | Ga0097621_100018003 | Ga0097621_1000180036 | 211 |
| 376 | 3300006237 | Ga0097621_100053400 | Ga0097621_1000534002 | 211 |
| 377 | 3300006237 | Ga0097621_100194564 | Ga0097621_1001945642 | 211 |
| 378 | 3300006237 | Ga0097621_100379711 | Ga0097621_1003797112 | 211 |
| 379 | 3300006237 | Ga0097621_100401297 | Ga0097621_1004012971 | 211 |
| 380 | 3300006353 | Ga0075370_10002264 | Ga0075370_100022642 | 211 |
| 381 | 3300006353 | Ga0075370_10005659 | Ga0075370_100056594 | 211 |
| 382 | 3300006353 | Ga0075370_10009378 | Ga0075370_100093782 | 211 |
| 383 | 3300006353 | Ga0075370_10023788 | Ga0075370_100237883 | 211 |
| 384 | 3300006353 | Ga0075370_10028431 | Ga0075370_100284312 | 211 |
| 385 | 3300006353 | Ga0075370_10031310 | Ga0075370_100313102 | 211 |
| 386 | 3300006353 | Ga0075370_10106881 | Ga0075370_101068812 | 211 |
| 387 | 3300006358 | Ga0068871_100006199 | Ga0068871_1000061995 | 211 |
| 388 | 3300006358 | Ga0068871_100158783 | Ga0068871_1001587833 | 211 |
| 389 | 3300006358 | Ga0068871_100776908 | Ga0068871_1007769082 | 211 |
| 390 | 3300006880 | Ga0075429_100008966 | Ga0075429_1000089669 | 211 |
| 391 | 3300006881 | Ga0068865_100004931 | Ga0068865_10000493110 | 211 |
| 392 | 3300006881 | Ga0068865_100083825 | Ga0068865_1000838253 | 211 |
| 393 | 3300006881 | Ga0068865_100294420 | Ga0068865_1002944202 | 211 |
| 394 | 3300006881 | Ga0068865_100440782 | Ga0068865_1004407822 | 211 |
| 395 | 3300006931 | Ga0097620_100005588 | Ga0097620_1000055882 | 211 |
| 396 | 3300006931 | Ga0097620_100058362 | Ga0097620_1000583621 | 211 |
| 397 | 3300006931 | Ga0097620_100069266 | Ga0097620_1000692662 | 211 |
| 398 | 3300006931 | Ga0097620_100964190 | Ga0097620_1009641901 | 211 |
| 399 | 3300009093 | Ga0105240_10008979 | Ga0105240_100089798 | 211 |
| 400 | 3300009093 | Ga0105240_10057797 | Ga0105240_100577972 | 211 |
| 401 | 3300009093 | Ga0105240_10073187 | Ga0105240_100731875 | 211 |
| 402 | 3300009098 | Ga0105245_10161208 | Ga0105245_101612082 | 211 |
| 403 | 3300009098 | Ga0105245_10173555 | Ga0105245_101735552 | 211 |
| 404 | 3300009147 | Ga0114129_10378952 | Ga0114129_103789522 | 211 |
| 405 | 3300009147 | Ga0114129_10553197 | Ga0114129_105531972 | 211 |
| 406 | 3300009148 | Ga0105243_10012059 | Ga0105243_100120594 | 211 |
| 407 | 3300009148 | Ga0105243_10017616 | Ga0105243_100176162 | 211 |
| 408 | 3300009148 | Ga0105243_10098123 | Ga0105243_100981232 | 211 |
| 409 | 3300009148 | Ga0105243_10251151 | Ga0105243_102511512 | 211 |
| 410 | 3300009148 | Ga0105243_10619323 | Ga0105243_106193231 | 211 |
| 411 | 3300009174 | Ga0105241_10024407 | Ga0105241_100244073 | 211 |
| 412 | 3300009176 | Ga0105242_10263050 | Ga0105242_102630501 | 211 |
| 413 | 3300009177 | Ga0105248_10019801 | Ga0105248_1001980110 | 211 |
| 414 | 3300009177 | Ga0105248_10105860 | Ga0105248_101058602 | 211 |
| 415 | 3300009177 | Ga0105248_10209128 | Ga0105248_102091282 | 211 |
| 416 | 3300009177 | Ga0105248_10320278 | Ga0105248_103202783 | 211 |
| 417 | 3300009177 | Ga0105248_10342136 | Ga0105248_103421362 | 211 |
| 418 | 3300009177 | Ga0105248_10465645 | Ga0105248_104656453 | 211 |
| 419 | 3300009177 | Ga0105248_10741216 | Ga0105248_107412162 | 211 |
| 420 | 3300009545 | Ga0105237_10001800 | Ga0105237_100018003 | 211 |
| 421 | 3300009545 | Ga0105237_10052281 | Ga0105237_100522813 | 211 |
| 422 | 3300009545 | Ga0105237_10573843 | Ga0105237_105738432 | 211 |
| 423 | 3300009551 | Ga0105238_10001620 | Ga0105238_1000162011 | 211 |
| 424 | 3300009551 | Ga0105238_10027838 | Ga0105238_100278382 | 211 |
| 425 | 3300009551 | Ga0105238_10143142 | Ga0105238_101431422 | 211 |
| 426 | 3300009553 | Ga0105249_10006344 | Ga0105249_100063444 | 211 |
| 427 | 3300009553 | Ga0105249_10314165 | Ga0105249_103141652 | 211 |
| 428 | 3300009553 | Ga0105249_10446991 | Ga0105249_104469912 | 211 |
| 429 | 3300010375 | Ga0105239_10001185 | Ga0105239_1000118529 | 211 |
| 430 | 3300010375 | Ga0105239_10030763 | Ga0105239_100307634 | 211 |
| 431 | 3300010375 | Ga0105239_10138092 | Ga0105239_101380922 | 211 |
| 432 | 3300010375 | Ga0105239_10219559 | Ga0105239_102195592 | 211 |
| 433 | 3300011119 | Ga0105246_10174447 | Ga0105246_101744473 | 211 |
| 434 | 3300011119 | Ga0105246_10467817 | Ga0105246_104678171 | 211 |
| 435 | 3300011119 | Ga0105246_10692620 | Ga0105246_106926201 | 211 |
| 436 | 3300012495 | Ga0157323_1010599 | Ga0157323_10105991 | 211 |
| 437 | 3300013102 | Ga0157371_10041368 | Ga0157371_100413682 | 211 |
| 438 | 3300013102 | Ga0157371_10200573 | Ga0157371_102005731 | 211 |
| 439 | 3300013104 | Ga0157370_10577339 | Ga0157370_105773392 | 211 |
| 440 | 3300013104 | Ga0157370_10772829 | Ga0157370_107728291 | 211 |
| 441 | 3300013296 | Ga0157374_10018242 | Ga0157374_100182424 | 211 |
| 442 | 3300013296 | Ga0157374_10047499 | Ga0157374_100474994 | 211 |
| 443 | 3300013296 | Ga0157374_10161847 | Ga0157374_101618472 | 211 |
| 444 | 3300013296 | Ga0157374_10319887 | Ga0157374_103198872 | 211 |
| 445 | 3300013296 | Ga0157374_10373898 | Ga0157374_103738982 | 211 |
| 446 | 3300013296 | Ga0157374_10479019 | Ga0157374_104790192 | 211 |
| 447 | 3300013297 | Ga0157378_10294779 | Ga0157378_102947792 | 211 |
| 448 | 3300013297 | Ga0157378_10940126 | Ga0157378_109401261 | 211 |
| 449 | 3300013297 | Ga0157378_11185133 | Ga0157378_111851331 | 211 |
| 450 | 3300013306 | Ga0163162_10005745 | Ga0163162_1000574511 | 211 |
| 451 | 3300013306 | Ga0163162_10159345 | Ga0163162_101593454 | 211 |
| 452 | 3300013307 | Ga0157372_10014771 | Ga0157372_100147718 | 211 |
| 453 | 3300013307 | Ga0157372_10038743 | Ga0157372_100387432 | 211 |
| 454 | 3300013308 | Ga0157375_10043212 | Ga0157375_100432123 | 211 |
| 455 | 3300013308 | Ga0157375_10089804 | Ga0157375_100898043 | 211 |
| 456 | 3300013308 | Ga0157375_10166099 | Ga0157375_101660994 | 211 |
| 457 | 3300013308 | Ga0157375_10464303 | Ga0157375_104643032 | 211 |
| 458 | 3300013308 | Ga0157375_10763574 | Ga0157375_107635742 | 211 |
| 459 | 3300013308 | Ga0157375_10892202 | Ga0157375_108922022 | 211 |
| 460 | 3300014325 | Ga0163163_10376138 | Ga0163163_103761381 | 211 |
| 461 | 3300014325 | Ga0163163_10553095 | Ga0163163_105530952 | 211 |
| 462 | 3300014326 | Ga0157380_10024608 | Ga0157380_100246082 | 211 |
| 463 | 3300014326 | Ga0157380_10352006 | Ga0157380_103520062 | 211 |
| 464 | 3300014745 | Ga0157377_10000170 | Ga0157377_100001708 | 211 |
| 465 | 3300014745 | Ga0157377_10002946 | Ga0157377_100029466 | 211 |
| 466 | 3300014745 | Ga0157377_10218351 | Ga0157377_102183512 | 211 |
| 467 | 3300014968 | Ga0157379_10039596 | Ga0157379_100395962 | 211 |
| 468 | 3300014968 | Ga0157379_10077702 | Ga0157379_100777022 | 211 |
| 469 | 3300014968 | Ga0157379_10283447 | Ga0157379_102834472 | 211 |
| 470 | 3300014968 | Ga0157379_10330250 | Ga0157379_103302502 | 211 |
| 471 | 3300014968 | Ga0157379_10367708 | Ga0157379_103677082 | 211 |
| 472 | 3300014969 | Ga0157376_10021326 | Ga0157376_100213262 | 211 |
| 473 | 3300014969 | Ga0157376_10422279 | Ga0157376_104222792 | 211 |
| 474 | 3300014969 | Ga0157376_10816629 | Ga0157376_108166291 | 211 |
| 475 | 3300014969 | Ga0157376_10851588 | Ga0157376_108515881 | 211 |
| 476 | 3300015262 | Ga0182007_10092630 | Ga0182007_100926302 | 211 |
| 477 | 3300017792 | Ga0163161_10016697 | Ga0163161_100166975 | 211 |
| 478 | 3300017792 | Ga0163161_10053309 | Ga0163161_100533093 | 211 |
| 479 | 3300017792 | Ga0163161_10128971 | Ga0163161_101289712 | 211 |
| 480 | 3300021361 | Ga0213872_10000073 | Ga0213872_1000007347 | 211 |
| 481 | 3300021361 | Ga0213872_10000154 | Ga0213872_1000015449 | 211 |
| 482 | 3300021361 | Ga0213872_10022528 | Ga0213872_100225281 | 211 |
| 483 | 3300021361 | Ga0213872_10046320 | Ga0213872_100463202 | 211 |
| 484 | 3300021361 | Ga0213872_10091385 | Ga0213872_100913852 | 211 |
| 485 | 3300025226 | Ga0209674_100039 | Ga0209674_100039171 | 211 |
| 486 | 3300025230 | Ga0209563_100080 | Ga0209563_100080171 | 211 |
| 487 | 3300025231 | Ga0207427_101590 | Ga0207427_1015907 | 211 |
| 488 | 3300025242 | Ga0209258_100072 | Ga0209258_1000727 | 211 |
| 489 | 3300025242 | Ga0209258_102156 | Ga0209258_1021563 | 211 |
| 490 | 3300025246 | Ga0209646_1000301 | Ga0209646_100030136 | 211 |
| 491 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011180 | 211 |
| 492 | 3300025253 | Ga0209677_100130 | Ga0209677_10013010 | 211 |
| 493 | 3300025253 | Ga0209677_103493 | Ga0209677_1034934 | 211 |
| 494 | 3300025253 | Ga0209677_103696 | Ga0209677_1036962 | 211 |
| 495 | 3300025256 | Ga0209759_1000214 | Ga0209759_100021449 | 211 |
| 496 | 3300025256 | Ga0209759_1001031 | Ga0209759_10010314 | 211 |
| 497 | 3300025256 | Ga0209759_1001266 | Ga0209759_10012665 | 211 |
| 498 | 3300025256 | Ga0209759_1007152 | Ga0209759_10071523 | 211 |
| 499 | 3300025256 | Ga0209759_1011143 | Ga0209759_10111433 | 211 |
| 500 | 3300025256 | Ga0209759_1042771 | Ga0209759_10427711 | 211 |
| 501 | 3300025272 | Ga0209455_1000053 | Ga0209455_100005387 | 211 |
| 502 | 3300025298 | Ga0209050_1001300 | Ga0209050_10013005 | 211 |
| 503 | 3300025303 | Ga0209051_1002155 | Ga0209051_100215512 | 211 |
| 504 | 3300025303 | Ga0209051_1004799 | Ga0209051_10047992 | 211 |
| 505 | 3300025303 | Ga0209051_1007290 | Ga0209051_10072906 | 211 |
| 506 | 3300025304 | Ga0209257_1000182 | Ga0209257_100018257 | 211 |
| 507 | 3300025304 | Ga0209257_1011718 | Ga0209257_10117182 | 211 |
| 508 | 3300025304 | Ga0209257_1058206 | Ga0209257_10582061 | 211 |
| 509 | 3300025315 | Ga0207697_10283218 | Ga0207697_102832181 | 211 |
| 510 | 3300025893 | Ga0207682_10005109 | Ga0207682_100051096 | 211 |
| 511 | 3300025893 | Ga0207682_10043472 | Ga0207682_100434722 | 211 |
| 512 | 3300025893 | Ga0207682_10044919 | Ga0207682_100449193 | 211 |
| 513 | 3300025893 | Ga0207682_10059945 | Ga0207682_100599452 | 211 |
| 514 | 3300025901 | Ga0207688_10218862 | Ga0207688_102188621 | 211 |
| 515 | 3300025903 | Ga0207680_10003380 | Ga0207680_100033802 | 211 |
| 516 | 3300025903 | Ga0207680_10010348 | Ga0207680_100103483 | 211 |
| 517 | 3300025903 | Ga0207680_10571476 | Ga0207680_105714761 | 211 |
| 518 | 3300025907 | Ga0207645_10001208 | Ga0207645_100012085 | 211 |
| 519 | 3300025907 | Ga0207645_10013147 | Ga0207645_100131476 | 211 |
| 520 | 3300025907 | Ga0207645_10018896 | Ga0207645_100188962 | 211 |
| 521 | 3300025907 | Ga0207645_10176396 | Ga0207645_101763962 | 211 |
| 522 | 3300025908 | Ga0207643_10044744 | Ga0207643_100447442 | 211 |
| 523 | 3300025909 | Ga0207705_10189880 | Ga0207705_101898802 | 211 |
| 524 | 3300025909 | Ga0207705_10230832 | Ga0207705_102308322 | 211 |
| 525 | 3300025909 | Ga0207705_10312019 | Ga0207705_103120192 | 211 |
| 526 | 3300025910 | Ga0207684_10004653 | Ga0207684_100046536 | 211 |
| 527 | 3300025910 | Ga0207684_10062899 | Ga0207684_100628992 | 211 |
| 528 | 3300025911 | Ga0207654_10109211 | Ga0207654_101092113 | 211 |
| 529 | 3300025912 | Ga0207707_10037822 | Ga0207707_100378222 | 211 |
| 530 | 3300025912 | Ga0207707_10866141 | Ga0207707_108661411 | 211 |
| 531 | 3300025913 | Ga0207695_10010519 | Ga0207695_100105197 | 211 |
| 532 | 3300025913 | Ga0207695_10018695 | Ga0207695_100186952 | 211 |
| 533 | 3300025913 | Ga0207695_10211675 | Ga0207695_102116752 | 211 |
| 534 | 3300025914 | Ga0207671_10001232 | Ga0207671_1000123214 | 211 |
| 535 | 3300025916 | Ga0207663_10221519 | Ga0207663_102215192 | 211 |
| 536 | 3300025917 | Ga0207660_10013605 | Ga0207660_100136053 | 211 |
| 537 | 3300025918 | Ga0207662_10061693 | Ga0207662_100616932 | 211 |
| 538 | 3300025918 | Ga0207662_10495788 | Ga0207662_104957881 | 211 |
| 539 | 3300025919 | Ga0207657_10045869 | Ga0207657_100458695 | 211 |
| 540 | 3300025919 | Ga0207657_10484026 | Ga0207657_104840262 | 211 |
| 541 | 3300025920 | Ga0207649_10017005 | Ga0207649_100170052 | 211 |
| 542 | 3300025920 | Ga0207649_10183236 | Ga0207649_101832362 | 211 |
| 543 | 3300025920 | Ga0207649_10342420 | Ga0207649_103424202 | 211 |
| 544 | 3300025921 | Ga0207652_10046936 | Ga0207652_100469363 | 211 |
| 545 | 3300025922 | Ga0207646_10163129 | Ga0207646_101631292 | 211 |
| 546 | 3300025923 | Ga0207681_10000823 | Ga0207681_1000082320 | 211 |
| 547 | 3300025923 | Ga0207681_10056092 | Ga0207681_100560922 | 211 |
| 548 | 3300025923 | Ga0207681_10061088 | Ga0207681_100610883 | 211 |
| 549 | 3300025924 | Ga0207694_10004625 | Ga0207694_100046254 | 211 |
| 550 | 3300025925 | Ga0207650_10002985 | Ga0207650_100029853 | 211 |
| 551 | 3300025925 | Ga0207650_10014909 | Ga0207650_100149094 | 211 |
| 552 | 3300025925 | Ga0207650_10072923 | Ga0207650_100729233 | 211 |
| 553 | 3300025925 | Ga0207650_10120999 | Ga0207650_101209992 | 211 |
| 554 | 3300025926 | Ga0207659_10004461 | Ga0207659_100044615 | 211 |
| 555 | 3300025926 | Ga0207659_10040286 | Ga0207659_100402862 | 211 |
| 556 | 3300025926 | Ga0207659_10055387 | Ga0207659_100553873 | 211 |
| 557 | 3300025926 | Ga0207659_10056078 | Ga0207659_100560784 | 211 |
| 558 | 3300025926 | Ga0207659_10098047 | Ga0207659_100980472 | 211 |
| 559 | 3300025926 | Ga0207659_10110233 | Ga0207659_101102332 | 211 |
| 560 | 3300025926 | Ga0207659_10246622 | Ga0207659_102466221 | 211 |
| 561 | 3300025926 | Ga0207659_10304617 | Ga0207659_103046172 | 211 |
| 562 | 3300025926 | Ga0207659_10633182 | Ga0207659_106331822 | 211 |
| 563 | 3300025927 | Ga0207687_10155820 | Ga0207687_101558201 | 211 |
| 564 | 3300025927 | Ga0207687_10256539 | Ga0207687_102565392 | 211 |
| 565 | 3300025927 | Ga0207687_11068789 | Ga0207687_110687891 | 211 |
| 566 | 3300025931 | Ga0207644_10016116 | Ga0207644_100161165 | 211 |
| 567 | 3300025931 | Ga0207644_10034103 | Ga0207644_100341032 | 211 |
| 568 | 3300025931 | Ga0207644_10072900 | Ga0207644_100729003 | 211 |
| 569 | 3300025931 | Ga0207644_11052198 | Ga0207644_110521981 | 211 |
| 570 | 3300025932 | Ga0207690_10091128 | Ga0207690_100911282 | 211 |
| 571 | 3300025932 | Ga0207690_10099654 | Ga0207690_100996542 | 211 |
| 572 | 3300025932 | Ga0207690_10203392 | Ga0207690_102033921 | 211 |
| 573 | 3300025932 | Ga0207690_10211436 | Ga0207690_102114362 | 211 |
| 574 | 3300025932 | Ga0207690_10381988 | Ga0207690_103819881 | 211 |
| 575 | 3300025933 | Ga0207706_10002434 | Ga0207706_100024348 | 211 |
| 576 | 3300025933 | Ga0207706_10013338 | Ga0207706_100133382 | 211 |
| 577 | 3300025933 | Ga0207706_10013363 | Ga0207706_100133632 | 211 |
| 578 | 3300025933 | Ga0207706_10033600 | Ga0207706_100336004 | 211 |
| 579 | 3300025933 | Ga0207706_10082407 | Ga0207706_100824072 | 211 |
| 580 | 3300025934 | Ga0207686_10064164 | Ga0207686_100641642 | 211 |
| 581 | 3300025935 | Ga0207709_10003397 | Ga0207709_100033972 | 211 |
| 582 | 3300025935 | Ga0207709_10034651 | Ga0207709_100346511 | 211 |
| 583 | 3300025935 | Ga0207709_10057501 | Ga0207709_100575012 | 211 |
| 584 | 3300025935 | Ga0207709_10088731 | Ga0207709_100887313 | 211 |
| 585 | 3300025937 | Ga0207669_10003010 | Ga0207669_100030102 | 211 |
| 586 | 3300025937 | Ga0207669_10086353 | Ga0207669_100863532 | 211 |
| 587 | 3300025937 | Ga0207669_10093113 | Ga0207669_100931131 | 211 |
| 588 | 3300025937 | Ga0207669_10101108 | Ga0207669_101011082 | 211 |
| 589 | 3300025938 | Ga0207704_10066913 | Ga0207704_100669132 | 211 |
| 590 | 3300025938 | Ga0207704_10161990 | Ga0207704_101619902 | 211 |
| 591 | 3300025938 | Ga0207704_10667310 | Ga0207704_106673101 | 211 |
| 592 | 3300025939 | Ga0207665_10079213 | Ga0207665_100792134 | 211 |
| 593 | 3300025940 | Ga0207691_10001739 | Ga0207691_100017399 | 211 |
| 594 | 3300025940 | Ga0207691_10004984 | Ga0207691_1000498413 | 211 |
| 595 | 3300025940 | Ga0207691_10005163 | Ga0207691_1000516311 | 211 |
| 596 | 3300025940 | Ga0207691_10022620 | Ga0207691_100226202 | 211 |
| 597 | 3300025940 | Ga0207691_10149342 | Ga0207691_101493423 | 211 |
| 598 | 3300025940 | Ga0207691_10253259 | Ga0207691_102532591 | 211 |
| 599 | 3300025940 | Ga0207691_10264282 | Ga0207691_102642822 | 211 |
| 600 | 3300025941 | Ga0207711_10020237 | Ga0207711_100202372 | 211 |
| 601 | 3300025941 | Ga0207711_10045517 | Ga0207711_100455175 | 211 |
| 602 | 3300025941 | Ga0207711_10125706 | Ga0207711_101257062 | 211 |
| 603 | 3300025941 | Ga0207711_10407468 | Ga0207711_104074682 | 211 |
| 604 | 3300025942 | Ga0207689_10000521 | Ga0207689_1000052123 | 211 |
| 605 | 3300025942 | Ga0207689_10020049 | Ga0207689_100200493 | 211 |
| 606 | 3300025942 | Ga0207689_10063726 | Ga0207689_100637262 | 211 |
| 607 | 3300025944 | Ga0207661_10009108 | Ga0207661_100091083 | 211 |
| 608 | 3300025944 | Ga0207661_10034856 | Ga0207661_100348563 | 211 |
| 609 | 3300025944 | Ga0207661_10275496 | Ga0207661_102754962 | 211 |
| 610 | 3300025945 | Ga0207679_10064714 | Ga0207679_100647142 | 211 |
| 611 | 3300025945 | Ga0207679_10194803 | Ga0207679_101948032 | 211 |
| 612 | 3300025945 | Ga0207679_10741197 | Ga0207679_107411972 | 211 |
| 613 | 3300025949 | Ga0207667_10283879 | Ga0207667_102838792 | 211 |
| 614 | 3300025949 | Ga0207667_10911987 | Ga0207667_109119872 | 211 |
| 615 | 3300025960 | Ga0207651_10035586 | Ga0207651_100355864 | 211 |
| 616 | 3300025960 | Ga0207651_10040355 | Ga0207651_100403554 | 211 |
| 617 | 3300025960 | Ga0207651_10061743 | Ga0207651_100617431 | 211 |
| 618 | 3300025960 | Ga0207651_10085639 | Ga0207651_100856392 | 211 |
| 619 | 3300025960 | Ga0207651_10094284 | Ga0207651_100942841 | 211 |
| 620 | 3300025960 | Ga0207651_10104319 | Ga0207651_101043193 | 211 |
| 621 | 3300025961 | Ga0207712_10005486 | Ga0207712_100054864 | 211 |
| 622 | 3300025961 | Ga0207712_10653834 | Ga0207712_106538342 | 211 |
| 623 | 3300025972 | Ga0207668_10001265 | Ga0207668_100012653 | 211 |
| 624 | 3300025972 | Ga0207668_10172966 | Ga0207668_101729662 | 211 |
| 625 | 3300025972 | Ga0207668_10388023 | Ga0207668_103880232 | 211 |
| 626 | 3300025972 | Ga0207668_10412953 | Ga0207668_104129532 | 211 |
| 627 | 3300025981 | Ga0207640_10011366 | Ga0207640_100113662 | 211 |
| 628 | 3300025981 | Ga0207640_10073229 | Ga0207640_100732292 | 211 |
| 629 | 3300025981 | Ga0207640_10276764 | Ga0207640_102767642 | 211 |
| 630 | 3300025986 | Ga0207658_10001833 | Ga0207658_100018338 | 211 |
| 631 | 3300025986 | Ga0207658_10002477 | Ga0207658_1000247710 | 211 |
| 632 | 3300025986 | Ga0207658_10010320 | Ga0207658_100103205 | 211 |
| 633 | 3300025986 | Ga0207658_10011682 | Ga0207658_100116825 | 211 |
| 634 | 3300025986 | Ga0207658_10300910 | Ga0207658_103009102 | 211 |
| 635 | 3300025986 | Ga0207658_10372914 | Ga0207658_103729142 | 211 |
| 636 | 3300025986 | Ga0207658_10467989 | Ga0207658_104679892 | 211 |
| 637 | 3300025986 | Ga0207658_10628131 | Ga0207658_106281311 | 211 |
| 638 | 3300026023 | Ga0207677_10055505 | Ga0207677_100555052 | 211 |
| 639 | 3300026023 | Ga0207677_10113812 | Ga0207677_101138122 | 211 |
| 640 | 3300026023 | Ga0207677_10569978 | Ga0207677_105699782 | 211 |
| 641 | 3300026023 | Ga0207677_10768681 | Ga0207677_107686812 | 211 |
| 642 | 3300026035 | Ga0207703_10004479 | Ga0207703_1000447910 | 211 |
| 643 | 3300026035 | Ga0207703_10005888 | Ga0207703_100058882 | 211 |
| 644 | 3300026035 | Ga0207703_10265235 | Ga0207703_102652353 | 211 |
| 645 | 3300026041 | Ga0207639_10070563 | Ga0207639_100705632 | 211 |
| 646 | 3300026041 | Ga0207639_10117923 | Ga0207639_101179233 | 211 |
| 647 | 3300026041 | Ga0207639_10171528 | Ga0207639_101715282 | 211 |
| 648 | 3300026067 | Ga0207678_10002363 | Ga0207678_100023637 | 211 |
| 649 | 3300026067 | Ga0207678_10033453 | Ga0207678_100334532 | 211 |
| 650 | 3300026067 | Ga0207678_10783571 | Ga0207678_107835711 | 211 |
| 651 | 3300026075 | Ga0207708_10257200 | Ga0207708_102572002 | 211 |
| 652 | 3300026078 | Ga0207702_10002302 | Ga0207702_1000230210 | 211 |
| 653 | 3300026078 | Ga0207702_10010277 | Ga0207702_100102773 | 211 |
| 654 | 3300026078 | Ga0207702_10138217 | Ga0207702_101382172 | 211 |
| 655 | 3300026078 | Ga0207702_10161962 | Ga0207702_101619622 | 211 |
| 656 | 3300026088 | Ga0207641_10009403 | Ga0207641_1000940310 | 211 |
| 657 | 3300026088 | Ga0207641_10092184 | Ga0207641_100921842 | 211 |
| 658 | 3300026088 | Ga0207641_10138439 | Ga0207641_101384392 | 211 |
| 659 | 3300026088 | Ga0207641_10262979 | Ga0207641_102629793 | 211 |
| 660 | 3300026088 | Ga0207641_10280693 | Ga0207641_102806932 | 211 |
| 661 | 3300026088 | Ga0207641_10807170 | Ga0207641_108071702 | 211 |
| 662 | 3300026088 | Ga0207641_10821009 | Ga0207641_108210091 | 211 |
| 663 | 3300026089 | Ga0207648_10000748 | Ga0207648_100007486 | 211 |
| 664 | 3300026089 | Ga0207648_10002159 | Ga0207648_1000215910 | 211 |
| 665 | 3300026089 | Ga0207648_10011657 | Ga0207648_100116576 | 211 |
| 666 | 3300026089 | Ga0207648_10016586 | Ga0207648_100165862 | 211 |
| 667 | 3300026089 | Ga0207648_10019952 | Ga0207648_100199522 | 211 |
| 668 | 3300026095 | Ga0207676_10005849 | Ga0207676_100058491 | 211 |
| 669 | 3300026095 | Ga0207676_10028252 | Ga0207676_100282524 | 211 |
| 670 | 3300026095 | Ga0207676_10034901 | Ga0207676_100349012 | 211 |
| 671 | 3300026095 | Ga0207676_10138574 | Ga0207676_101385742 | 211 |
| 672 | 3300026095 | Ga0207676_10579331 | Ga0207676_105793312 | 211 |
| 673 | 3300026116 | Ga0207674_10045241 | Ga0207674_100452415 | 211 |
| 674 | 3300026116 | Ga0207674_10048860 | Ga0207674_100488604 | 211 |
| 675 | 3300026116 | Ga0207674_10120277 | Ga0207674_101202772 | 211 |
| 676 | 3300026116 | Ga0207674_10238182 | Ga0207674_102381822 | 211 |
| 677 | 3300026116 | Ga0207674_10389598 | Ga0207674_103895982 | 211 |
| 678 | 3300026118 | Ga0207675_100000428 | Ga0207675_10000042818 | 211 |
| 679 | 3300026118 | Ga0207675_100003876 | Ga0207675_1000038769 | 211 |
| 680 | 3300026118 | Ga0207675_100038266 | Ga0207675_1000382664 | 211 |
| 681 | 3300026121 | Ga0207683_10043392 | Ga0207683_100433921 | 211 |
| 682 | 3300026121 | Ga0207683_10050350 | Ga0207683_100503502 | 211 |
| 683 | 3300026121 | Ga0207683_10556024 | Ga0207683_105560241 | 211 |
| 684 | 3300026142 | Ga0207698_10016580 | Ga0207698_100165807 | 211 |
| 685 | 3300026142 | Ga0207698_10047782 | Ga0207698_100477822 | 211 |
| 686 | 3300026142 | Ga0207698_10071717 | Ga0207698_100717174 | 211 |
| 687 | 3300026142 | Ga0207698_10071922 | Ga0207698_100719223 | 211 |
| 688 | 3300026142 | Ga0207698_10434669 | Ga0207698_104346692 | 211 |
| 689 | 3300026142 | Ga0207698_10590525 | Ga0207698_105905252 | 211 |
| 690 | 3300026142 | Ga0207698_10767313 | Ga0207698_107673131 | 211 |
| 691 | 3300026142 | Ga0207698_11141321 | Ga0207698_111413212 | 211 |
| 692 | 3300026142 | Ga0207698_11479949 | Ga0207698_114799491 | 211 |
| 693 | 3300027866 | Ga0209813_10075187 | Ga0209813_100751872 | 211 |
| 694 | 3300028379 | Ga0268266_10005969 | Ga0268266_100059697 | 211 |
| 695 | 3300028380 | Ga0268265_10203267 | Ga0268265_102032672 | 211 |
| 696 | 3300028381 | Ga0268264_10001228 | Ga0268264_1000122813 | 211 |
| 697 | 3300028381 | Ga0268264_10179915 | Ga0268264_101799151 | 211 |
| 698 | 3300028381 | Ga0268264_10215157 | Ga0268264_102151572 | 211 |
| 699 | 3300028381 | Ga0268264_10301245 | Ga0268264_103012452 | 211 |
| 700 | 3300028666 | Ga0265336_10000014 | Ga0265336_10000014184 | 211 |
| 701 | 3300028786 | Ga0307517_10001591 | Ga0307517_1000159112 | 211 |
| 702 | 3300028786 | Ga0307517_10236485 | Ga0307517_102364852 | 211 |
| 703 | 3300028794 | Ga0307515_10000103 | Ga0307515_1000010392 | 211 |
| 704 | 3300028794 | Ga0307515_10000184 | Ga0307515_10000184120 | 211 |
| 705 | 3300028794 | Ga0307515_10001431 | Ga0307515_1000143149 | 211 |
| 706 | 3300028794 | Ga0307515_10020933 | Ga0307515_100209339 | 211 |
| 707 | 3300028794 | Ga0307515_10023725 | Ga0307515_100237255 | 211 |
| 708 | 3300028794 | Ga0307515_10025369 | Ga0307515_100253695 | 211 |
| 709 | 3300028794 | Ga0307515_10035551 | Ga0307515_100355512 | 211 |
| 710 | 3300028794 | Ga0307515_10098333 | Ga0307515_100983332 | 211 |
| 711 | 3300028794 | Ga0307515_10200202 | Ga0307515_102002022 | 211 |
| 712 | 3300028794 | Ga0307515_10330553 | Ga0307515_103305531 | 211 |
| 713 | 3300029957 | Ga0265324_10006660 | Ga0265324_100066606 | 211 |
| 714 | 3300029957 | Ga0265324_10076828 | Ga0265324_100768282 | 211 |
| 715 | 3300030521 | Ga0307511_10018336 | Ga0307511_100183365 | 211 |
| 716 | 3300030522 | Ga0307512_10051321 | Ga0307512_100513212 | 211 |
| 717 | 3300030522 | Ga0307512_10262906 | Ga0307512_102629061 | 211 |
| 718 | 3300031456 | Ga0307513_10003898 | Ga0307513_1000389819 | 211 |
| 719 | 3300031456 | Ga0307513_10057848 | Ga0307513_100578483 | 211 |
| 720 | 3300031456 | Ga0307513_10068414 | Ga0307513_100684142 | 211 |
| 721 | 3300031456 | Ga0307513_10213771 | Ga0307513_102137712 | 211 |
| 722 | 3300031507 | Ga0307509_10002193 | Ga0307509_100021932 | 211 |
| 723 | 3300031507 | Ga0307509_10004459 | Ga0307509_1000445919 | 211 |
| 724 | 3300031507 | Ga0307509_10020954 | Ga0307509_100209545 | 211 |
| 725 | 3300031507 | Ga0307509_10058153 | Ga0307509_100581535 | 211 |
| 726 | 3300031507 | Ga0307509_10063616 | Ga0307509_100636164 | 211 |
| 727 | 3300031507 | Ga0307509_10111788 | Ga0307509_101117882 | 211 |
| 728 | 3300031507 | Ga0307509_10148470 | Ga0307509_101484701 | 211 |
| 729 | 3300031507 | Ga0307509_10434212 | Ga0307509_104342122 | 211 |
| 730 | 3300031507 | Ga0307509_10523836 | Ga0307509_105238362 | 211 |
| 731 | 3300031548 | Ga0307408_100000023 | Ga0307408_1000000236 | 211 |
| 732 | 3300031548 | Ga0307408_100096944 | Ga0307408_1000969442 | 211 |
| 733 | 3300031548 | Ga0307408_100333780 | Ga0307408_1003337802 | 211 |
| 734 | 3300031548 | Ga0307408_100441135 | Ga0307408_1004411351 | 211 |
| 735 | 3300031548 | Ga0307408_100480910 | Ga0307408_1004809102 | 211 |
| 736 | 3300031616 | Ga0307508_10000368 | Ga0307508_1000036814 | 211 |
| 737 | 3300031616 | Ga0307508_10136626 | Ga0307508_101366262 | 211 |
| 738 | 3300031616 | Ga0307508_10213462 | Ga0307508_102134622 | 211 |
| 739 | 3300031649 | Ga0307514_10007399 | Ga0307514_1000739910 | 211 |
| 740 | 3300031649 | Ga0307514_10013419 | Ga0307514_100134195 | 211 |
| 741 | 3300031649 | Ga0307514_10032642 | Ga0307514_100326425 | 211 |
| 742 | 3300031649 | Ga0307514_10294174 | Ga0307514_102941741 | 211 |
| 743 | 3300031730 | Ga0307516_10004098 | Ga0307516_1000409821 | 211 |
| 744 | 3300031730 | Ga0307516_10005073 | Ga0307516_1000507313 | 211 |
| 745 | 3300031730 | Ga0307516_10074546 | Ga0307516_100745462 | 211 |
| 746 | 3300031730 | Ga0307516_10160134 | Ga0307516_101601342 | 211 |
| 747 | 3300031730 | Ga0307516_10163479 | Ga0307516_101634792 | 211 |
| 748 | 3300031730 | Ga0307516_10251108 | Ga0307516_102511081 | 211 |
| 749 | 3300031730 | Ga0307516_10433058 | Ga0307516_104330581 | 211 |
| 750 | 3300031731 | Ga0307405_10007014 | Ga0307405_100070143 | 211 |
| 751 | 3300031731 | Ga0307405_10135837 | Ga0307405_101358373 | 211 |
| 752 | 3300031731 | Ga0307405_10844576 | Ga0307405_108445761 | 211 |
| 753 | 3300031731 | Ga0307405_10956282 | Ga0307405_109562821 | 211 |
| 754 | 3300031824 | Ga0307413_10156850 | Ga0307413_101568502 | 211 |
| 755 | 3300031824 | Ga0307413_10747516 | Ga0307413_107475162 | 211 |
| 756 | 3300031852 | Ga0307410_10253681 | Ga0307410_102536812 | 211 |
| 757 | 3300031852 | Ga0307410_10456452 | Ga0307410_104564521 | 211 |
| 758 | 3300031901 | Ga0307406_10276559 | Ga0307406_102765591 | 211 |
| 759 | 3300031901 | Ga0307406_10721448 | Ga0307406_107214481 | 211 |
| 760 | 3300031903 | Ga0307407_10277777 | Ga0307407_102777772 | 211 |
| 761 | 3300031911 | Ga0307412_10013904 | Ga0307412_100139043 | 211 |
| 762 | 3300031911 | Ga0307412_10025761 | Ga0307412_100257612 | 211 |
| 763 | 3300031911 | Ga0307412_10171142 | Ga0307412_101711422 | 211 |
| 764 | 3300031911 | Ga0307412_10307831 | Ga0307412_103078311 | 211 |
| 765 | 3300031911 | Ga0307412_10970365 | Ga0307412_109703651 | 211 |
| 766 | 3300031995 | Ga0307409_100002795 | Ga0307409_1000027958 | 211 |
| 767 | 3300031995 | Ga0307409_100006577 | Ga0307409_1000065776 | 211 |
| 768 | 3300032002 | Ga0307416_100008008 | Ga0307416_1000080082 | 211 |
| 769 | 3300032002 | Ga0307416_100175437 | Ga0307416_1001754372 | 211 |
| 770 | 3300032002 | Ga0307416_100346440 | Ga0307416_1003464401 | 211 |
| 771 | 3300032002 | Ga0307416_100972711 | Ga0307416_1009727111 | 211 |
| 772 | 3300032004 | Ga0307414_10105838 | Ga0307414_101058382 | 211 |
| 773 | 3300032004 | Ga0307414_10131771 | Ga0307414_101317712 | 211 |
| 774 | 3300032005 | Ga0307411_10021424 | Ga0307411_100214242 | 211 |
| 775 | 3300032005 | Ga0307411_10156766 | Ga0307411_101567662 | 211 |
| 776 | 3300032005 | Ga0307411_10563882 | Ga0307411_105638822 | 211 |
| 777 | 3300032126 | Ga0307415_100018631 | Ga0307415_1000186312 | 211 |
| 778 | 3300032126 | Ga0307415_100306267 | Ga0307415_1003062672 | 211 |
| 779 | 3300033179 | Ga0307507_10098806 | Ga0307507_100988062 | 211 |
| 780 | 3300033180 | Ga0307510_10000290 | Ga0307510_1000029043 | 211 |
| 781 | 3300033180 | Ga0307510_10017949 | Ga0307510_100179492 | 211 |
| 782 | 3300033180 | Ga0307510_10047591 | Ga0307510_100475915 | 211 |
| 783 | 3300035085 | Ga0373929_0015023 | Ga0373929_0015023_498_1145 | 211 |
| 784 | 3300035086 | Ga0373934_0023865 | Ga0373934_0023865_660_1298 | 211 |
| 785 | 3300035089 | Ga0373944_0072545 | Ga0373944_0072545_453_1088 | 211 |
| 786 | 3300035091 | Ga0373951_0005569 | Ga0373951_0005569_923_1570 | 211 |
| 787 | 3300035111 | Ga0373923_0114744 | Ga0373923_0114744_60_698 | 211 |
| 788 | 3300035112 | Ga0373932_0040585 | Ga0373932_0040585_310_948 | 211 |
| 789 | 3300035113 | Ga0373936_0073989 | Ga0373936_0073989_754_1389 | 211 |
| 790 | 3300035114 | Ga0373939_0000052 | Ga0373939_0000052_20301_20948 | 211 |
| 791 | 3300035116 | Ga0373945_0017131 | Ga0373945_0017131_176_811 | 211 |
| 792 | 3300035119 | Ga0373956_0130505 | Ga0373956_0130505_159_794 | 211 |
| 793 | 3300035121 | Ga0373960_0000046 | Ga0373960_0000046_2929_3576 | 211 |
| 794 | 3300035170 | Ga0373943_0236197 | Ga0373943_0236197_107_745 | 211 |
| 795 | 3300035171 | Ga0373946_0028979 | Ga0373946_0028979_363_998 | 211 |
| 796 | 3300035172 | Ga0373955_0090201 | Ga0373955_0090201_895_1530 | 211 |
| 797 | 3300035207 | Ga0373942_0112013 | Ga0373942_0112013_102_740 | 211 |
| 798 | 3300035241 | Ga0373961_0067761 | Ga0373961_0067761_12_647 | 211 |
| 799 | 3300035242 | Ga0373962_0060676 | Ga0373962_0060676_20_655 | 211 |
| 800 | 3300035410 | Ga0373924_0007452 | Ga0373924_0007452_385_1020 | 211 |
| 801 | 3300035691 | Ga0373931_0000306 | Ga0373931_0000306_7847_8494 | 211 |
| 802 | 3300035691 | Ga0373931_0005476 | Ga0373931_0005476_1892_2527 | 211 |
| 803 | 3300035691 | Ga0373931_0022624 | Ga0373931_0022624_31_669 | 211 |
| 804 | 3300035691 | Ga0373931_0051848 | Ga0373931_0051848_858_1493 | 211 |
| 805 | 3300035725 | Ga0373947_0062559 | Ga0373947_0062559_635_1270 | 211 |
| 806 | 3300036401 | Ga0373937_0635691 | Ga0373937_0635691_351_986 | 211 |
| 807 | 3300036401 | Ga0373937_0760290 | Ga0373937_0760290_35_670 | 211 |
| 808 | 3300037312 | Ga0395899_0055205 | Ga0395899_0055205_1304_1942 | 211 |
| 809 | 3300037418 | Ga0395900_0000234 | Ga0395900_0000234_5964_6599 | 211 |
| 810 | 3300037466 | Ga0395898_0002077 | Ga0395898_0002077_5964_6599 | 211 |
| 811 | 3300037466 | Ga0395898_0038952 | Ga0395898_0038952_3741_4379 | 211 |
| 812 | 3300037466 | Ga0395898_0458094 | Ga0395898_0458094_485_1120 | 211 |
| 813 | 3300037471 | Ga0395905_0000071 | Ga0395905_0000071_51955_52602 | 211 |
| 814 | 3300037471 | Ga0395905_0003377 | Ga0395905_0003377_13828_14463 | 211 |
| 815 | 3300037471 | Ga0395905_0013883 | Ga0395905_0013883_4942_5580 | 211 |
| 816 | 3300037471 | Ga0395905_0023686 | Ga0395905_0023686_456_1091 | 211 |
| 817 | 3300037471 | Ga0395905_0098886 | Ga0395905_0098886_1495_2130 | 211 |
| 818 | 3300037471 | Ga0395905_0252928 | Ga0395905_0252928_461_1096 | 211 |
| 819 | 3300037471 | Ga0395905_0297698 | Ga0395905_0297698_827_1462 | 211 |
| 820 | 3300039447 | Ga0436361_0530495 | Ga0436361_0530495_50893_51540 | 211 |
| 821 | 3300039447 | Ga0436361_0714096 | Ga0436361_0714096_2182_2829 | 211 |
| 822 | 3300039447 | Ga0436361_0736070 | Ga0436361_0736070_40700_41347 | 211 |
| 823 | 3300039447 | Ga0436361_1123281 | Ga0436361_1123281_894_1529 | 211 |
| 824 | 3300039447 | Ga0436361_1146345 | Ga0436361_1146345_634_1281 | 211 |
| 825 | 3300039450 | Ga0436363_0219629 | Ga0436363_0219629_1545_2180 | 211 |
| 826 | 3300041410 | Ga0439461_0003089 | Ga0439461_0003089_249_896 | 211 |
| 827 | 3300041498 | Ga0451841_0251967 | Ga0451841_0251967_641_1276 | 211 |
| 828 | 3300041501 | Ga0451845_0255285 | Ga0451845_0255285_23_658 | 211 |
| 829 | 3300041512 | Ga0451853_3187860 | Ga0451853_3187860_121_756 | 211 |
| 830 | 3300041997 | Ga0439431_0037467 | Ga0439431_0037467_140_775 | 211 |
| 831 | 3300042000 | Ga0439437_000789 | Ga0439437_000789_979_1626 | 211 |
| 832 | 3300042005 | Ga0439448_0023434 | Ga0439448_0023434_638_1273 | 211 |
| 833 | 3300042007 | Ga0439449_0092752 | Ga0439449_0092752_113_751 | 211 |
| 834 | 3300042012 | Ga0439455_0073873 | Ga0439455_0073873_76_723 | 211 |
| 835 | 3300042120 | Ga0450917_000257 | Ga0450917_000257_280_927 | 211 |
| 836 | 3300042126 | Ga0450888_009728 | Ga0450888_009728_438_1085 | 211 |
| 837 | 3300042127 | Ga0450890_000264 | Ga0450890_000264_1720_2367 | 211 |
| 838 | 3300042129 | Ga0450891_000152 | Ga0450891_000152_647_1294 | 211 |
| 839 | 3300042130 | Ga0450892_003518 | Ga0450892_003518_609_1256 | 211 |
| 840 | 3300042134 | Ga0450898_014614 | Ga0450898_014614_655_1290 | 211 |
| 841 | 3300042137 | Ga0450902_002830 | Ga0450902_002830_487_1134 | 211 |
| 842 | 3300042138 | Ga0450903_012132 | Ga0450903_012132_192_839 | 211 |
| 843 | 3300042156 | Ga0439446_0063298 | Ga0439446_0063298_182_817 | 211 |
| 844 | 3300042185 | Ga0450909_041080 | Ga0450909_041080_28_666 | 211 |
| 845 | 3300042439 | Ga0439464_0008819 | Ga0439464_0008819_247_882 | 211 |
| 846 | 3300042439 | Ga0439464_0089683 | Ga0439464_0089683_49_684 | 211 |
| 847 | 3300042439 | Ga0439464_0113386 | Ga0439464_0113386_131_766 | 211 |
| 848 | 3300042530 | Ga0450916_000178 | Ga0450916_000178_1105_1752 | 211 |
| 849 | 3300042532 | Ga0450893_0015032 | Ga0450893_0015032_35_670 | 211 |
| 850 | 3300042876 | Ga0451577_0003841 | Ga0451577_0003841_12888_13529 | 211 |
| 851 | 3300042876 | Ga0451577_0022062 | Ga0451577_0022062_3729_4367 | 211 |
| 852 | 3300042876 | Ga0451577_0411673 | Ga0451577_0411673_480_1115 | 211 |
| 853 | 3300044656 | Ga0466969_0000028 | Ga0466969_0000028_50280_50915 | 211 |
| 854 | 3300044656 | Ga0466969_0008493 | Ga0466969_0008493_3504_4142 | 211 |
| 855 | 3300044656 | Ga0466969_0035623 | Ga0466969_0035623_1262_1897 | 211 |
| 856 | 3300044656 | Ga0466969_0038616 | Ga0466969_0038616_1744_2379 | 211 |
| 857 | 3300044658 | Ga0466972_0006558 | Ga0466972_0006558_4446_5081 | 211 |
| 858 | 3300044658 | Ga0466972_0136163 | Ga0466972_0136163_368_1003 | 211 |
| 859 | 3300044673 | Ga0453683_0169899 | Ga0453683_0169899_196_831 | 211 |
| 860 | 3300044673 | Ga0453683_0292855 | Ga0453683_0292855_138_773 | 211 |
| 861 | 3300044673 | Ga0453683_0361107 | Ga0453683_0361107_44_679 | 211 |
| 862 | 3300044683 | Ga0466965_0003252 | Ga0466965_0003252_3267_3905 | 211 |
| 863 | 3300044683 | Ga0466965_0030115 | Ga0466965_0030115_664_1299 | 211 |
| 864 | 3300044683 | Ga0466965_0340859 | Ga0466965_0340859_74_709 | 211 |
| 865 | 3300044684 | Ga0466966_0005301 | Ga0466966_0005301_1076_1714 | 211 |
| 866 | 3300044684 | Ga0466966_0051843 | Ga0466966_0051843_302_937 | 211 |
| 867 | 3300044684 | Ga0466966_0087476 | Ga0466966_0087476_207_842 | 211 |
| 868 | 3300044693 | Ga0466961_0003217 | Ga0466961_0003217_2269_2904 | 211 |
| 869 | 3300044693 | Ga0466961_0004039 | Ga0466961_0004039_8512_9150 | 211 |
| 870 | 3300044693 | Ga0466961_0019292 | Ga0466961_0019292_3674_4309 | 211 |
| 871 | 3300044693 | Ga0466961_0273075 | Ga0466961_0273075_213_848 | 211 |
| 872 | 3300044694 | Ga0466963_0000935 | Ga0466963_0000935_7540_8175 | 211 |
| 873 | 3300044694 | Ga0466963_0236218 | Ga0466963_0236218_409_1047 | 211 |
| 874 | 3300044706 | Ga0466964_0024421 | Ga0466964_0024421_516_1151 | 211 |
| 875 | 3300044712 | Ga0453684_0006446 | Ga0453684_0006446_2124_2759 | 211 |
| 876 | 3300044712 | Ga0453684_0059806 | Ga0453684_0059806_1291_1926 | 211 |
| 877 | 3300044712 | Ga0453684_0110760 | Ga0453684_0110760_2546_3187 | 211 |
| 878 | 3300044712 | Ga0453684_0331179 | Ga0453684_0331179_839_1477 | 211 |
| 879 | 3300044719 | Ga0466971_0005541 | Ga0466971_0005541_647_1285 | 211 |
| 880 | 3300044719 | Ga0466971_0168982 | Ga0466971_0168982_90_725 | 211 |
| 881 | 3300044735 | Ga0466968_0019767 | Ga0466968_0019767_756_1394 | 211 |
| 882 | 3300044735 | Ga0466968_0061625 | Ga0466968_0061625_329_964 | 211 |
| 883 | 3300044765 | Ga0466970_0015254 | Ga0466970_0015254_2342_2977 | 211 |
| 884 | 3300044842 | Ga0466957_0007668 | Ga0466957_0007668_2412_3047 | 211 |
| 885 | 3300044842 | Ga0466957_0022945 | Ga0466957_0022945_2735_3373 | 211 |
| 886 | 3300044901 | Ga0466960_0005647 | Ga0466960_0005647_1415_2050 | 211 |
| 887 | 3300044901 | Ga0466960_0076434 | Ga0466960_0076434_565_1200 | 211 |
| 888 | 3300044901 | Ga0466960_0084285 | Ga0466960_0084285_659_1294 | 211 |
| 889 | 3300044901 | Ga0466960_0256171 | Ga0466960_0256171_151_786 | 211 |
| 890 | 3300045049 | Ga0466959_0001550 | Ga0466959_0001550_11977_12615 | 211 |
| 891 | 3300045049 | Ga0466959_0037485 | Ga0466959_0037485_2912_3547 | 211 |
| 892 | 3300045049 | Ga0466959_0686504 | Ga0466959_0686504_27_662 | 211 |
| 893 | 3300045051 | Ga0451576_0021518 | Ga0451576_0021518_2647_3282 | 211 |
| 894 | 3300045051 | Ga0451576_0366908 | Ga0451576_0366908_567_1202 | 211 |
| 895 | 3300045051 | Ga0451576_0636493 | Ga0451576_0636493_472_1107 | 211 |
| 896 | 3300045836 | Ga0466958_0015363 | Ga0466958_0015363_3437_4075 | 211 |
| 897 | 3300045836 | Ga0466958_0023688 | Ga0466958_0023688_2300_2935 | 211 |
| 898 | 3300045836 | Ga0466958_0382727 | Ga0466958_0382727_67_702 | 211 |
| 899 | 3300045976 | Ga0466967_0021184 | Ga0466967_0021184_4355_4990 | 211 |
| 900 | 3300045976 | Ga0466967_0076045 | Ga0466967_0076045_1643_2281 | 211 |
| 901 | 3300046454 | Ga0495592_0000758 | Ga0495592_0000758_16044_16682 | 211 |
| 902 | 3300046454 | Ga0495592_0423289 | Ga0495592_0423289_45_680 | 211 |
| 903 | 3300046457 | Ga0495590_0004523 | Ga0495590_0004523_3760_4395 | 211 |
| 904 | 3300046459 | Ga0495629_0058817 | Ga0495629_0058817_1204_1839 | 211 |
| 905 | 3300046459 | Ga0495629_0170766 | Ga0495629_0170766_26_661 | 211 |
| 906 | 3300046462 | Ga0495651_0223717 | Ga0495651_0223717_331_966 | 211 |
| 907 | 3300046471 | Ga0495650_0018864 | Ga0495650_0018864_2522_3157 | 211 |
| 908 | 3300046471 | Ga0495650_0052598 | Ga0495650_0052598_339_974 | 211 |
| 909 | 3300046472 | Ga0495580_0028564 | Ga0495580_0028564_3020_3655 | 211 |
| 910 | 3300046475 | Ga0495639_0188546 | Ga0495639_0188546_359_994 | 211 |
| 911 | 3300046476 | Ga0495662_0172547 | Ga0495662_0172547_22_657 | 211 |
| 912 | 3300046492 | Ga0495585_0009636 | Ga0495585_0009636_1459_2094 | 211 |
| 913 | 3300046506 | Ga0495583_0000350 | Ga0495583_0000350_22690_23328 | 211 |
| 914 | 3300046507 | Ga0495606_0004217 | Ga0495606_0004217_4685_5323 | 211 |
| 915 | 3300046507 | Ga0495606_0319309 | Ga0495606_0319309_70_708 | 211 |
| 916 | 3300046512 | Ga0495610_0120867 | Ga0495610_0120867_433_1068 | 211 |
| 917 | 3300046515 | Ga0495620_0066992 | Ga0495620_0066992_45_683 | 211 |
| 918 | 3300046516 | Ga0495628_0096500 | Ga0495628_0096500_23_658 | 211 |
| 919 | 3300046517 | Ga0495630_0178524 | Ga0495630_0178524_340_978 | 211 |
| 920 | 3300046519 | Ga0495632_0004044 | Ga0495632_0004044_901_1539 | 211 |
| 921 | 3300046519 | Ga0495632_0096251 | Ga0495632_0096251_235_873 | 211 |
| 922 | 3300046524 | Ga0495648_0100293 | Ga0495648_0100293_272_910 | 211 |
| 923 | 3300046526 | Ga0495666_0094779 | Ga0495666_0094779_332_970 | 211 |
| 924 | 3300046529 | Ga0495652_0226567 | Ga0495652_0226567_643_1278 | 211 |
| 925 | 3300046537 | Ga0495598_0055036 | Ga0495598_0055036_407_1042 | 211 |
| 926 | 3300046542 | Ga0495597_0027211 | Ga0495597_0027211_33_671 | 211 |
| 927 | 3300046542 | Ga0495597_0073969 | Ga0495597_0073969_611_1249 | 211 |
| 928 | 3300046542 | Ga0495597_0134519 | Ga0495597_0134519_152_790 | 211 |
| 929 | 3300046543 | Ga0495645_0161563 | Ga0495645_0161563_452_1087 | 211 |
| 930 | 3300046543 | Ga0495645_0297267 | Ga0495645_0297267_200_835 | 211 |
| 931 | 3300046557 | Ga0495622_0258499 | Ga0495622_0258499_21_659 | 211 |
| 932 | 3300046558 | Ga0495633_0164056 | Ga0495633_0164056_104_739 | 211 |
| 933 | 3300046615 | Ga0495656_0324462 | Ga0495656_0324462_49_684 | 211 |
| 934 | 3300046616 | Ga0495668_0082116 | Ga0495668_0082116_807_1445 | 211 |
| 935 | 3300046616 | Ga0495668_0228685 | Ga0495668_0228685_227_865 | 211 |
| 936 | 3300046642 | Ga0495634_0182064 | Ga0495634_0182064_627_1262 | 211 |
| 937 | 3300046660 | Ga0495625_0005026 | Ga0495625_0005026_743_1381 | 211 |
| 938 | 3300046660 | Ga0495625_0018498 | Ga0495625_0018498_2389_3027 | 211 |
| 939 | 3300046660 | Ga0495625_0158084 | Ga0495625_0158084_508_1146 | 211 |
| 940 | 3300046665 | Ga0495661_0180834 | Ga0495661_0180834_243_881 | 211 |
| 941 | 3300046680 | Ga0495646_0134148 | Ga0495646_0134148_51_689 | 211 |
| 942 | 3300046681 | Ga0495647_0036783 | Ga0495647_0036783_90_725 | 211 |
| 943 | 3300046683 | Ga0495658_0009721 | Ga0495658_0009721_2915_3550 | 211 |
| 944 | 3300046683 | Ga0495658_0079957 | Ga0495658_0079957_1243_1878 | 211 |
| 945 | 3300046683 | Ga0495658_0118772 | Ga0495658_0118772_882_1517 | 211 |
| 946 | 3300046683 | Ga0495658_0206270 | Ga0495658_0206270_248_886 | 211 |
| 947 | 3300046684 | Ga0495669_0005767 | Ga0495669_0005767_2084_2722 | 211 |
| 948 | 3300046690 | Ga0495624_0144328 | Ga0495624_0144328_158_796 | 211 |
| 949 | 3300046691 | Ga0495670_0243320 | Ga0495670_0243320_266_901 | 211 |
| 950 | 3300046694 | Ga0495649_0000845 | Ga0495649_0000845_896_1534 | 211 |
| 951 | 3300046794 | Ga0495589_0010997 | Ga0495589_0010997_3144_3782 | 211 |
| 952 | 3300046809 | Ga0495600_0228715 | Ga0495600_0228715_217_852 | 211 |
| 953 | 3300046810 | Ga0495660_0034083 | Ga0495660_0034083_459_1097 | 211 |
| 954 | 3300046810 | Ga0495660_0055072 | Ga0495660_0055072_1443_2078 | 211 |
| 955 | 3300047319 | Ga0495674_0141275 | Ga0495674_0141275_833_1468 | 211 |
| 956 | 3300047321 | Ga0495676_0201211 | Ga0495676_0201211_327_965 | 211 |
| 957 | 3300047443 | Ga0495687_000914 | Ga0495687_000914_15153_15791 | 211 |
| 958 | 3300047443 | Ga0495687_022484 | Ga0495687_022484_374_1012 | 211 |
| 959 | 3300047469 | Ga0495673_0097251 | Ga0495673_0097251_547_1185 | 211 |
| 960 | 3300047471 | Ga0495684_0281050 | Ga0495684_0281050_345_980 | 211 |
| 961 | 3300047471 | Ga0495684_0441577 | Ga0495684_0441577_186_821 | 211 |
| 962 | 3300047472 | Ga0495686_0002064 | Ga0495686_0002064_1719_2357 | 211 |
| 963 | 3300047472 | Ga0495686_0036043 | Ga0495686_0036043_2510_3145 | 211 |
| 964 | 3300048089 | Ga0495614_0076511 | Ga0495614_0076511_518_1153 | 211 |
| 965 | 3300048903 | Ga0496100_0105749 | Ga0496100_0105749_842_1477 | 211 |
| 966 | 3300048904 | Ga0496101_0193368 | Ga0496101_0193368_240_878 | 211 |
| 967 | 3300048905 | Ga0496102_0087881 | Ga0496102_0087881_1299_1934 | 211 |
| 968 | 3300048907 | Ga0496104_0199179 | Ga0496104_0199179_1269_1904 | 211 |
| 969 | 3300048907 | Ga0496104_0206468 | Ga0496104_0206468_871_1506 | 211 |
| 970 | 3300048907 | Ga0496104_0521547 | Ga0496104_0521547_187_822 | 211 |
| 971 | 3300048908 | Ga0496105_0040297 | Ga0496105_0040297_1177_1812 | 211 |
| 972 | 3300048908 | Ga0496105_0664932 | Ga0496105_0664932_70_705 | 211 |
| 973 | 3300048909 | Ga0496106_0002082 | Ga0496106_0002082_10567_11202 | 211 |
| 974 | 3300048909 | Ga0496106_0011064 | Ga0496106_0011064_5955_6593 | 211 |
| 975 | 3300048909 | Ga0496106_0364633 | Ga0496106_0364633_478_1113 | 211 |
| 976 | 3300048910 | Ga0496107_0058705 | Ga0496107_0058705_1059_1694 | 211 |
| 977 | 3300048911 | Ga0496108_0308711 | Ga0496108_0308711_678_1313 | 211 |
| 978 | 3300048912 | Ga0496109_0172715 | Ga0496109_0172715_773_1408 | 211 |
| 979 | 3300048912 | Ga0496109_0191070 | Ga0496109_0191070_919_1554 | 211 |
| 980 | 3300048913 | Ga0496110_0984120 | Ga0496110_0984120_10_645 | 211 |
| 981 | 3300048916 | Ga0496113_0436649 | Ga0496113_0436649_312_950 | 211 |
| 982 | 3300048917 | Ga0496114_0118552 | Ga0496114_0118552_1007_1642 | 211 |
| 983 | 3300048917 | Ga0496114_0120807 | Ga0496114_0120807_1558_2193 | 211 |
| 984 | 3300048918 | Ga0496115_0007508 | Ga0496115_0007508_1372_2007 | 211 |
| 985 | 3300048921 | Ga0496118_0065767 | Ga0496118_0065767_1937_2572 | 211 |
| 986 | 3300048924 | Ga0496121_0017965 | Ga0496121_0017965_2509_3144 | 211 |
| 987 | 3300048925 | Ga0496122_0164935 | Ga0496122_0164935_76_711 | 211 |
| 988 | 3300048927 | Ga0496124_0001253 | Ga0496124_0001253_15970_16605 | 211 |
| 989 | 3300048927 | Ga0496124_0165397 | Ga0496124_0165397_725_1477 | 211 |
| 990 | 3300048928 | Ga0496125_0086553 | Ga0496125_0086553_269_904 | 211 |
| 991 | 3300048928 | Ga0496125_0179123 | Ga0496125_0179123_192_830 | 211 |
| 992 | 3300049515 | Ga0501292_003863 | Ga0501292_003863_374_1009 | 211 |
| 993 | 3300049520 | Ga0501297_000622 | Ga0501297_000622_2335_2982 | 211 |
| 994 | 3300049521 | Ga0501298_021543 | Ga0501298_021543_476_1123 | 211 |
| 995 | 3300049526 | Ga0501303_005764 | Ga0501303_005764_259_894 | 211 |
| 996 | 3300049569 | Ga0501032_0222241 | Ga0501032_0222241_14_649 | 211 |
| 997 | 3300049572 | Ga0501036_0154458 | Ga0501036_0154458_461_1102 | 211 |
| 998 | 3300049579 | Ga0501043_0005029 | Ga0501043_0005029_405_1040 | 211 |
| 999 | 3300049580 | Ga0501046_0006030 | Ga0501046_0006030_9837_10472 | 211 |
| 1000 | 3300049580 | Ga0501046_0470263 | Ga0501046_0470263_89_730 | 211 |
| 1001 | 3300049581 | Ga0501047_0000069 | Ga0501047_0000069_92428_93063 | 211 |
| 1002 | 3300049582 | Ga0501048_0051092 | Ga0501048_0051092_309_944 | 211 |
| 1003 | 3300049588 | Ga0501072_0488323 | Ga0501072_0488323_69_710 | 211 |
| 1004 | 3300049649 | Ga0501198_000014 | Ga0501198_000014_99139_99774 | 211 |
| 1005 | 3300049653 | Ga0501206_003976 | Ga0501206_003976_266_913 | 211 |
| 1006 | 3300049654 | Ga0501207_027951 | Ga0501207_027951_278_925 | 211 |
| 1007 | 3300049655 | Ga0501208_050179 | Ga0501208_050179_127_774 | 211 |
| 1008 | 3300049658 | Ga0501211_000534 | Ga0501211_000534_1639_2286 | 211 |
| 1009 | 3300049662 | Ga0501222_000008 | Ga0501222_000008_4710_5345 | 211 |
| 1010 | 3300049662 | Ga0501222_019566 | Ga0501222_019566_214_861 | 211 |
| 1011 | 3300049665 | Ga0501227_012640 | Ga0501227_012640_781_1428 | 211 |
| 1012 | 3300049668 | Ga0501233_004919 | Ga0501233_004919_289_936 | 211 |
| 1013 | 3300049669 | Ga0501235_057419 | Ga0501235_057419_198_845 | 211 |
| 1014 | 3300049682 | Ga0501252_012540 | Ga0501252_012540_140_787 | 211 |
| 1015 | 3300049683 | Ga0501253_000616 | Ga0501253_000616_673_1308 | 211 |
| 1016 | 3300049683 | Ga0501253_073368 | Ga0501253_073368_11_646 | 211 |
| 1017 | 3300049686 | Ga0501257_005139 | Ga0501257_005139_1233_1868 | 211 |
| 1018 | 3300049686 | Ga0501257_038050 | Ga0501257_038050_494_1129 | 211 |
| 1019 | 3300049688 | Ga0501259_055906 | Ga0501259_055906_54_701 | 211 |
| 1020 | 3300049704 | Ga0501221_001653 | Ga0501221_001653_2729_3376 | 211 |
| 1021 | 3300049757 | Ga0501232_000918 | Ga0501232_000918_95_742 | 211 |
| 1022 | 3300049759 | Ga0501262_004308 | Ga0501262_004308_690_1325 | 211 |
| 1023 | 3300049762 | Ga0501265_003041 | Ga0501265_003041_960_1595 | 211 |
| 1024 | 3300049762 | Ga0501265_027412 | Ga0501265_027412_58_693 | 211 |
| 1025 | 3300049769 | Ga0501272_012285 | Ga0501272_012285_314_961 | 211 |
| 1026 | 3300049770 | Ga0501273_018490 | Ga0501273_018490_248_886 | 211 |
| 1027 | 3300049822 | Ga0501035_0102307 | Ga0501035_0102307_554_1189 | 211 |
| 1028 | 3300049822 | Ga0501035_0426257 | Ga0501035_0426257_264_899 | 211 |
| 1029 | 3300049824 | Ga0501045_0066678 | Ga0501045_0066678_1766_2401 | 211 |
| 1030 | 3300049853 | Ga0501226_007204 | Ga0501226_007204_196_843 | 211 |
| 1031 | 3300050489 | nmdc:mga03683_125525_c1 | nmdc:mga03683_125525_c1_49_684 | 211 |
| 1032 | 3300050489 | nmdc:mga03683_2130_c1 | nmdc:mga03683_2130_c1_4778_5416 | 211 |
| 1033 | 3300050489 | nmdc:mga03683_221524_c1 | nmdc:mga03683_221524_c1_103_741 | 211 |
| 1034 | 3300050489 | nmdc:mga03683_3440_c1 | nmdc:mga03683_3440_c1_3217_3855 | 211 |
| 1035 | 3300050489 | nmdc:mga03683_48243_c1 | nmdc:mga03683_48243_c1_770_1408 | 211 |
| 1036 | 3300050490 | nmdc:mga03n38_158500_c1 | nmdc:mga03n38_158500_c1_315_953 | 211 |
| 1037 | 3300050490 | nmdc:mga03n38_53897_c1 | nmdc:mga03n38_53897_c1_562_1200 | 211 |
| 1038 | 3300050491 | nmdc:mga00v17_15606_c1 | nmdc:mga00v17_15606_c1_144_782 | 211 |
| 1039 | 3300050491 | nmdc:mga00v17_55125_c1 | nmdc:mga00v17_55125_c1_1032_1670 | 211 |
| 1040 | 3300050492 | nmdc:mga0yw44_117492_c1 | nmdc:mga0yw44_117492_c1_549_1187 | 211 |
| 1041 | 3300050493 | nmdc:mga0k408_11201_c1 | nmdc:mga0k408_11201_c1_2218_2856 | 211 |
| 1042 | 3300050493 | nmdc:mga0k408_139607_c1 | nmdc:mga0k408_139607_c1_340_987 | 211 |
| 1043 | 3300050493 | nmdc:mga0k408_162371_c1 | nmdc:mga0k408_162371_c1_622_1260 | 211 |
| 1044 | 3300050493 | nmdc:mga0k408_18066_c1 | nmdc:mga0k408_18066_c1_741_1379 | 211 |
| 1045 | 3300050493 | nmdc:mga0k408_1823_c1 | nmdc:mga0k408_1823_c1_8854_9492 | 211 |
| 1046 | 3300050493 | nmdc:mga0k408_2121_c1 | nmdc:mga0k408_2121_c1_4617_5255 | 211 |
| 1047 | 3300050493 | nmdc:mga0k408_2568_c1 | nmdc:mga0k408_2568_c1_7075_7713 | 211 |
| 1048 | 3300050493 | nmdc:mga0k408_3529_c1 | nmdc:mga0k408_3529_c1_5374_6012 | 211 |
| 1049 | 3300050493 | nmdc:mga0k408_3796_c1 | nmdc:mga0k408_3796_c1_687_1325 | 211 |
| 1050 | 3300050493 | nmdc:mga0k408_395218_c1 | nmdc:mga0k408_395218_c1_85_723 | 211 |
| 1051 | 3300050493 | nmdc:mga0k408_431352_c1 | nmdc:mga0k408_431352_c1_49_687 | 211 |
| 1052 | 3300050493 | nmdc:mga0k408_478719_c1 | nmdc:mga0k408_478719_c1_48_683 | 211 |
| 1053 | 3300050493 | nmdc:mga0k408_5099_c1 | nmdc:mga0k408_5099_c1_5459_6094 | 211 |
| 1054 | 3300050493 | nmdc:mga0k408_65024_c1 | nmdc:mga0k408_65024_c1_914_1552 | 211 |
| 1055 | 3300050493 | nmdc:mga0k408_97350_c1 | nmdc:mga0k408_97350_c1_763_1398 | 211 |
| 1056 | 3300050494 | nmdc:mga06z11_23705_c1 | nmdc:mga06z11_23705_c1_1552_2190 | 211 |
| 1057 | 3300050494 | nmdc:mga06z11_33392_c1 | nmdc:mga06z11_33392_c1_1203_1841 | 211 |
| 1058 | 3300050495 | nmdc:mga04h51_122173_c1 | nmdc:mga04h51_122173_c1_136_774 | 211 |
| 1059 | 3300050495 | nmdc:mga04h51_16186_c1 | nmdc:mga04h51_16186_c1_205_843 | 211 |
| 1060 | 3300050496 | nmdc:mga07m45_109980_c1 | nmdc:mga07m45_109980_c1_751_1389 | 211 |
| 1061 | 3300050496 | nmdc:mga07m45_13565_c1 | nmdc:mga07m45_13565_c1_782_1420 | 211 |
| 1062 | 3300050496 | nmdc:mga07m45_1396_c1 | nmdc:mga07m45_1396_c1_2154_2792 | 211 |
| 1063 | 3300050496 | nmdc:mga07m45_149384_c1 | nmdc:mga07m45_149384_c1_394_1032 | 211 |
| 1064 | 3300050496 | nmdc:mga07m45_16974_c1 | nmdc:mga07m45_16974_c1_1842_2480 | 211 |
| 1065 | 3300050496 | nmdc:mga07m45_169790_c1 | nmdc:mga07m45_169790_c1_400_1038 | 211 |
| 1066 | 3300050496 | nmdc:mga07m45_703_c1 | nmdc:mga07m45_703_c1_3519_4160 | 211 |
| 1067 | 3300050496 | nmdc:mga07m45_8060_c1 | nmdc:mga07m45_8060_c1_964_1602 | 211 |
| 1068 | 3300050496 | nmdc:mga07m45_8068_c1 | nmdc:mga07m45_8068_c1_2234_2872 | 211 |
| 1069 | 3300050507 | nmdc:mga05p37_604576_c1 | nmdc:mga05p37_604576_c1_374_1009 | 211 |
| 1070 | 3300050508 | nmdc:mga09592_14154_c1 | nmdc:mga09592_14154_c1_5081_5716 | 211 |
| 1071 | 3300050512 | nmdc:mga0n895_1021423_c1 | nmdc:mga0n895_1021423_c1_119_754 | 211 |
| 1072 | 3300050514 | nmdc:mga08x19_441838_c1 | nmdc:mga08x19_441838_c1_175_810 | 211 |
| 1073 | 3300050516 | nmdc:mga0sz30_24868_c1 | nmdc:mga0sz30_24868_c1_1300_1938 | 211 |
| 1074 | 3300050516 | nmdc:mga0sz30_44355_c1 | nmdc:mga0sz30_44355_c1_782_1420 | 211 |
| 1075 | 3300053077 | Ga0495601_0156675 | Ga0495601_0156675_425_1060 | 211 |
| 1076 | 3300053077 | Ga0495601_0252829 | Ga0495601_0252829_279_914 | 211 |
| 1077 | 3300053078 | Ga0495612_0179828 | Ga0495612_0179828_213_848 | 211 |
| 1078 | 3300053080 | Ga0500635_0000686 | Ga0500635_0000686_5843_6478 | 211 |
| 1079 | 3300053080 | Ga0500635_0006628 | Ga0500635_0006628_1560_2198 | 211 |
| 1080 | 3300053084 | Ga0495595_0151240 | Ga0495595_0151240_204_839 | 211 |
| 1081 | 3300053085 | Ga0495619_0020424 | Ga0495619_0020424_1573_2208 | 211 |
| 1082 | 3300053088 | Ga0500644_0022077 | Ga0500644_0022077_575_1213 | 211 |
| 1083 | 3300053092 | Ga0500583_0194321 | Ga0500583_0194321_345_983 | 211 |
| 1084 | 3300053093 | Ga0500651_0030735 | Ga0500651_0030735_691_1329 | 211 |
| 1085 | 3300053118 | Ga0500594_0004520 | Ga0500594_0004520_1224_1862 | 211 |
| 1086 | 3300053121 | Ga0500607_183554 | Ga0500607_183554_28_666 | 211 |
| 1087 | 3300053131 | Ga0500652_024874 | Ga0500652_024874_716_1381 | 211 |
| 1088 | 3300053134 | Ga0500658_0001688 | Ga0500658_0001688_2690_3328 | 211 |
| 1089 | 3300053136 | Ga0500559_0000717 | Ga0500559_0000717_8849_9487 | 211 |
| 1090 | 3300053139 | Ga0500568_0009618 | Ga0500568_0009618_373_1011 | 211 |
| 1091 | 3300053148 | Ga0500590_004936 | Ga0500590_004936_3314_3949 | 211 |
| 1092 | 3300053156 | Ga0500622_0004562 | Ga0500622_0004562_7237_7875 | 211 |
| 1093 | 3300053177 | Ga0500636_0011589 | Ga0500636_0011589_1785_2423 | 211 |
| 1094 | 3300053739 | Ga0500587_005832 | Ga0500587_005832_312_950 | 211 |
| 1095 | 3300060353 | Ga0501082_0289178 | Ga0501082_0289178_627_1268 | 211 |
| 1096 | 3300061719 | Ga0466962_0004095 | Ga0466962_0004095_1992_2630 | 211 |
| 1097 | 3300061719 | Ga0466962_0017132 | Ga0466962_0017132_954_1589 | 211 |
| 1098 | 3300001979 | JGI24740J21852_10019248 | JGI24740J21852_100192483 | 212 |
| 1099 | 3300002773 | JGI25152J39213_1000320 | JGI25152J39213_100032036 | 212 |
| 1100 | 3300002774 | JGI25150J39212_1022531 | JGI25150J39212_10225311 | 212 |
| 1101 | 3300003215 | JGI25153J46596_10010193 | JGI25153J46596_100101935 | 212 |
| 1102 | 3300003320 | rootH2_10018416 | rootH2_100184161 | 212 |
| 1103 | 3300003771 | Ga0055526_1002642 | Ga0055526_10026427 | 212 |
| 1104 | 3300003771 | Ga0055526_1002801 | Ga0055526_100280111 | 212 |
| 1105 | 3300003775 | Ga0055524_1000233 | Ga0055524_100023310 | 212 |
| 1106 | 3300003775 | Ga0055524_1001969 | Ga0055524_100196911 | 212 |
| 1107 | 3300003775 | Ga0055524_1013683 | Ga0055524_10136832 | 212 |
| 1108 | 3300003791 | Ga0055530_10006306 | Ga0055530_100063065 | 212 |
| 1109 | 3300003792 | Ga0055540_1000080 | Ga0055540_1000080102 | 212 |
| 1110 | 3300003794 | Ga0055531_10005579 | Ga0055531_100055795 | 212 |
| 1111 | 3300004625 | Ga0055543_1004230 | Ga0055543_10042304 | 212 |
| 1112 | 3300004625 | Ga0055543_1024592 | Ga0055543_10245922 | 212 |
| 1113 | 3300005262 | Ga0065165_1000390 | Ga0065165_100039052 | 212 |
| 1114 | 3300005262 | Ga0065165_1001585 | Ga0065165_100158522 | 212 |
| 1115 | 3300005262 | Ga0065165_1003937 | Ga0065165_10039371 | 212 |
| 1116 | 3300005295 | Ga0065707_10186254 | Ga0065707_101862541 | 212 |
| 1117 | 3300005334 | Ga0068869_100280110 | Ga0068869_1002801101 | 212 |
| 1118 | 3300005339 | Ga0070660_100443902 | Ga0070660_1004439022 | 212 |
| 1119 | 3300005353 | Ga0070669_100252329 | Ga0070669_1002523292 | 212 |
| 1120 | 3300005366 | Ga0070659_100006770 | Ga0070659_1000067704 | 212 |
| 1121 | 3300005367 | Ga0070667_100075701 | Ga0070667_1000757013 | 212 |
| 1122 | 3300005441 | Ga0070700_100066458 | Ga0070700_1000664583 | 212 |
| 1123 | 3300005459 | Ga0068867_100001329 | Ga0068867_10000132911 | 212 |
| 1124 | 3300005563 | Ga0068855_100580319 | Ga0068855_1005803192 | 212 |
| 1125 | 3300005564 | Ga0070664_100063519 | Ga0070664_1000635192 | 212 |
| 1126 | 3300005617 | Ga0068859_100071420 | Ga0068859_1000714205 | 212 |
| 1127 | 3300005718 | Ga0068866_10148757 | Ga0068866_101487572 | 212 |
| 1128 | 3300005719 | Ga0068861_100006277 | Ga0068861_1000062777 | 212 |
| 1129 | 3300005842 | Ga0068858_100126830 | Ga0068858_1001268303 | 212 |
| 1130 | 3300005843 | Ga0068860_100005402 | Ga0068860_1000054027 | 212 |
| 1131 | 3300005844 | Ga0068862_100008011 | Ga0068862_1000080115 | 212 |
| 1132 | 3300005844 | Ga0068862_100038900 | Ga0068862_1000389005 | 212 |
| 1133 | 3300006048 | Ga0075363_100005031 | Ga0075363_1000050315 | 212 |
| 1134 | 3300006048 | Ga0075363_100311951 | Ga0075363_1003119512 | 212 |
| 1135 | 3300006177 | Ga0075362_10065172 | Ga0075362_100651722 | 212 |
| 1136 | 3300006178 | Ga0075367_10033742 | Ga0075367_100337421 | 212 |
| 1137 | 3300006186 | Ga0075369_10024429 | Ga0075369_100244291 | 212 |
| 1138 | 3300006195 | Ga0075366_10005321 | Ga0075366_100053212 | 212 |
| 1139 | 3300006195 | Ga0075366_10045754 | Ga0075366_100457541 | 212 |
| 1140 | 3300006195 | Ga0075366_10085889 | Ga0075366_100858892 | 212 |
| 1141 | 3300006195 | Ga0075366_10290481 | Ga0075366_102904812 | 212 |
| 1142 | 3300006353 | Ga0075370_10000898 | Ga0075370_100008985 | 212 |
| 1143 | 3300006353 | Ga0075370_10007605 | Ga0075370_100076055 | 212 |
| 1144 | 3300006881 | Ga0068865_100010176 | Ga0068865_1000101766 | 212 |
| 1145 | 3300006931 | Ga0097620_100071419 | Ga0097620_1000714195 | 212 |
| 1146 | 3300006944 | Ga0099823_1000163 | Ga0099823_10001638 | 212 |
| 1147 | 3300006946 | Ga0079104_1001201 | Ga0079104_10012019 | 212 |
| 1148 | 3300009094 | Ga0111539_10877273 | Ga0111539_108772732 | 212 |
| 1149 | 3300009148 | Ga0105243_10345824 | Ga0105243_103458242 | 212 |
| 1150 | 3300012497 | Ga0157319_1000003 | Ga0157319_1000003323 | 212 |
| 1151 | 3300013297 | Ga0157378_10024112 | Ga0157378_100241126 | 212 |
| 1152 | 3300013306 | Ga0163162_10003029 | Ga0163162_100030297 | 212 |
| 1153 | 3300014326 | Ga0157380_10034917 | Ga0157380_100349173 | 212 |
| 1154 | 3300017792 | Ga0163161_10291543 | Ga0163161_102915431 | 212 |
| 1155 | 3300021361 | Ga0213872_10000070 | Ga0213872_1000007014 | 212 |
| 1156 | 3300021361 | Ga0213872_10114075 | Ga0213872_101140752 | 212 |
| 1157 | 3300025245 | Ga0207425_1004382 | Ga0207425_10043825 | 212 |
| 1158 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027385 | 212 |
| 1159 | 3300025258 | Ga0209129_1027025 | Ga0209129_10270252 | 212 |
| 1160 | 3300025273 | Ga0209673_1009613 | Ga0209673_10096135 | 212 |
| 1161 | 3300025273 | Ga0209673_1014163 | Ga0209673_10141634 | 212 |
| 1162 | 3300025273 | Ga0209673_1018104 | Ga0209673_10181042 | 212 |
| 1163 | 3300025273 | Ga0209673_1018827 | Ga0209673_10188272 | 212 |
| 1164 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014397 | 212 |
| 1165 | 3300025295 | Ga0209564_1000051 | Ga0209564_1000051128 | 212 |
| 1166 | 3300025297 | Ga0209758_1000307 | Ga0209758_100030753 | 212 |
| 1167 | 3300025297 | Ga0209758_1000524 | Ga0209758_100052450 | 212 |
| 1168 | 3300025298 | Ga0209050_1002883 | Ga0209050_10028833 | 212 |
| 1169 | 3300025298 | Ga0209050_1003609 | Ga0209050_10036099 | 212 |
| 1170 | 3300025298 | Ga0209050_1009714 | Ga0209050_10097145 | 212 |
| 1171 | 3300025298 | Ga0209050_1025737 | Ga0209050_10257372 | 212 |
| 1172 | 3300025299 | Ga0209256_1000203 | Ga0209256_1000203101 | 212 |
| 1173 | 3300025299 | Ga0209256_1000675 | Ga0209256_10006759 | 212 |
| 1174 | 3300025299 | Ga0209256_1004060 | Ga0209256_100406010 | 212 |
| 1175 | 3300025303 | Ga0209051_1000035 | Ga0209051_1000035101 | 212 |
| 1176 | 3300025303 | Ga0209051_1000981 | Ga0209051_100098129 | 212 |
| 1177 | 3300025303 | Ga0209051_1048679 | Ga0209051_10486791 | 212 |
| 1178 | 3300025304 | Ga0209257_1000346 | Ga0209257_100034660 | 212 |
| 1179 | 3300025304 | Ga0209257_1002753 | Ga0209257_10027535 | 212 |
| 1180 | 3300025304 | Ga0209257_1003470 | Ga0209257_100347012 | 212 |
| 1181 | 3300025304 | Ga0209257_1086438 | Ga0209257_10864381 | 212 |
| 1182 | 3300025893 | Ga0207682_10171003 | Ga0207682_101710032 | 212 |
| 1183 | 3300025907 | Ga0207645_10084162 | Ga0207645_100841623 | 212 |
| 1184 | 3300025919 | Ga0207657_10389533 | Ga0207657_103895331 | 212 |
| 1185 | 3300025920 | Ga0207649_10004761 | Ga0207649_100047613 | 212 |
| 1186 | 3300025932 | Ga0207690_10005585 | Ga0207690_100055854 | 212 |
| 1187 | 3300025935 | Ga0207709_10405028 | Ga0207709_104050282 | 212 |
| 1188 | 3300025942 | Ga0207689_10499944 | Ga0207689_104999442 | 212 |
| 1189 | 3300025945 | Ga0207679_10000254 | Ga0207679_1000025432 | 212 |
| 1190 | 3300025945 | Ga0207679_10034063 | Ga0207679_100340633 | 212 |
| 1191 | 3300025961 | Ga0207712_10103114 | Ga0207712_101031142 | 212 |
| 1192 | 3300025986 | Ga0207658_10041908 | Ga0207658_100419083 | 212 |
| 1193 | 3300026035 | Ga0207703_10317796 | Ga0207703_103177962 | 212 |
| 1194 | 3300026075 | Ga0207708_10075580 | Ga0207708_100755804 | 212 |
| 1195 | 3300026089 | Ga0207648_10000439 | Ga0207648_100004397 | 212 |
| 1196 | 3300026095 | Ga0207676_10228543 | Ga0207676_102285432 | 212 |
| 1197 | 3300026118 | Ga0207675_100001184 | Ga0207675_1000011847 | 212 |
| 1198 | 3300027111 | Ga0209281_1000076 | Ga0209281_100007688 | 212 |
| 1199 | 3300027296 | Ga0209389_1015795 | Ga0209389_10157955 | 212 |
| 1200 | 3300027312 | Ga0209371_1009954 | Ga0209371_10099542 | 212 |
| 1201 | 3300027876 | Ga0209974_10070507 | Ga0209974_100705072 | 212 |
| 1202 | 3300028380 | Ga0268265_10031835 | Ga0268265_100318352 | 212 |
| 1203 | 3300028380 | Ga0268265_10196163 | Ga0268265_101961631 | 212 |
| 1204 | 3300028381 | Ga0268264_10093598 | Ga0268264_100935983 | 212 |
| 1205 | 3300028786 | Ga0307517_10085334 | Ga0307517_100853341 | 212 |
| 1206 | 3300030500 | Ga0268256_1010113 | Ga0268256_10101132 | 212 |
| 1207 | 3300031456 | Ga0307513_10020866 | Ga0307513_100208666 | 212 |
| 1208 | 3300031456 | Ga0307513_10202548 | Ga0307513_102025482 | 212 |
| 1209 | 3300031507 | Ga0307509_10248866 | Ga0307509_102488662 | 212 |
| 1210 | 3300031548 | Ga0307408_100071579 | Ga0307408_1000715792 | 212 |
| 1211 | 3300031616 | Ga0307508_10001683 | Ga0307508_100016835 | 212 |
| 1212 | 3300031649 | Ga0307514_10078141 | Ga0307514_100781412 | 212 |
| 1213 | 3300031730 | Ga0307516_10003935 | Ga0307516_1000393516 | 212 |
| 1214 | 3300032002 | Ga0307416_101051971 | Ga0307416_1010519711 | 212 |
| 1215 | 3300033179 | Ga0307507_10040160 | Ga0307507_100401606 | 212 |
| 1216 | 3300035083 | Ga0373926_0076098 | Ga0373926_0076098_472_1134 | 212 |
| 1217 | 3300035725 | Ga0373947_0073103 | Ga0373947_0073103_409_1071 | 212 |
| 1218 | 3300037068 | Ga0373925_0014193 | Ga0373925_0014193_4988_5650 | 212 |
| 1219 | 3300039447 | Ga0436361_0443798 | Ga0436361_0443798_1309_1956 | 212 |
| 1220 | 3300039447 | Ga0436361_0735085 | Ga0436361_0735085_605_1252 | 212 |
| 1221 | 3300041456 | Ga0451795_1122439 | Ga0451795_1122439_152_793 | 212 |
| 1222 | 3300041459 | Ga0451800_0728199 | Ga0451800_0728199_127_768 | 212 |
| 1223 | 3300041463 | Ga0451804_0008258 | Ga0451804_0008258_580_1221 | 212 |
| 1224 | 3300041463 | Ga0451804_0650180 | Ga0451804_0650180_1207_1848 | 212 |
| 1225 | 3300041511 | Ga0451855_1813671 | Ga0451855_1813671_27_668 | 212 |
| 1226 | 3300042011 | Ga0439454_000320 | Ga0439454_000320_243_890 | 212 |
| 1227 | 3300042122 | Ga0450920_006579 | Ga0450920_006579_580_1218 | 212 |
| 1228 | 3300042156 | Ga0439446_0048361 | Ga0439446_0048361_144_782 | 212 |
| 1229 | 3300042438 | Ga0439459_0008070 | Ga0439459_0008070_624_1271 | 212 |
| 1230 | 3300042531 | Ga0450918_001808 | Ga0450918_001808_2951_3589 | 212 |
| 1231 | 3300042876 | Ga0451577_0002225 | Ga0451577_0002225_13303_13968 | 212 |
| 1232 | 3300044712 | Ga0453684_0072820 | Ga0453684_0072820_3207_3860 | 212 |
| 1233 | 3300046460 | Ga0495638_0078801 | Ga0495638_0078801_1333_1974 | 212 |
| 1234 | 3300046472 | Ga0495580_0403708 | Ga0495580_0403708_117_779 | 212 |
| 1235 | 3300046512 | Ga0495610_0132414 | Ga0495610_0132414_324_965 | 212 |
| 1236 | 3300046512 | Ga0495610_0219234 | Ga0495610_0219234_39_680 | 212 |
| 1237 | 3300046519 | Ga0495632_0025809 | Ga0495632_0025809_2261_2902 | 212 |
| 1238 | 3300046519 | Ga0495632_0058581 | Ga0495632_0058581_786_1427 | 212 |
| 1239 | 3300046522 | Ga0495643_0125248 | Ga0495643_0125248_253_894 | 212 |
| 1240 | 3300046660 | Ga0495625_0002284 | Ga0495625_0002284_427_1068 | 212 |
| 1241 | 3300046681 | Ga0495647_0055813 | Ga0495647_0055813_744_1406 | 212 |
| 1242 | 3300046683 | Ga0495658_0024713 | Ga0495658_0024713_375_1037 | 212 |
| 1243 | 3300046691 | Ga0495670_0016246 | Ga0495670_0016246_1122_1769 | 212 |
| 1244 | 3300046692 | Ga0495671_0318594 | Ga0495671_0318594_17_658 | 212 |
| 1245 | 3300047472 | Ga0495686_0293870 | Ga0495686_0293870_16_657 | 212 |
| 1246 | 3300048905 | Ga0496102_0018809 | Ga0496102_0018809_4010_4648 | 212 |
| 1247 | 3300048905 | Ga0496102_0029296 | Ga0496102_0029296_4143_4784 | 212 |
| 1248 | 3300048917 | Ga0496114_0004709 | Ga0496114_0004709_1093_1731 | 212 |
| 1249 | 3300049592 | Ga0501076_0558951 | Ga0501076_0558951_203_859 | 212 |
| 1250 | 3300049592 | Ga0501076_0739502 | Ga0501076_0739502_72_728 | 212 |
| 1251 | 3300049741 | Ga0501079_0882934 | Ga0501079_0882934_27_665 | 212 |
| 1252 | 3300050489 | nmdc:mga03683_20583_c1 | nmdc:mga03683_20583_c1_918_1574 | 212 |
| 1253 | 3300050490 | nmdc:mga03n38_9279_c1 | nmdc:mga03n38_9279_c1_256_897 | 212 |
| 1254 | 3300050493 | nmdc:mga0k408_247862_c1 | nmdc:mga0k408_247862_c1_400_1041 | 212 |
| 1255 | 3300050493 | nmdc:mga0k408_69910_c1 | nmdc:mga0k408_69910_c1_762_1409 | 212 |
| 1256 | 3300050493 | nmdc:mga0k408_81526_c1 | nmdc:mga0k408_81526_c1_234_875 | 212 |
| 1257 | 3300050494 | nmdc:mga06z11_21621_c1 | nmdc:mga06z11_21621_c1_1824_2465 | 212 |
| 1258 | 3300050496 | nmdc:mga07m45_17516_c1 | nmdc:mga07m45_17516_c1_885_1532 | 212 |
| 1259 | 3300050496 | nmdc:mga07m45_4379_c1 | nmdc:mga07m45_4379_c1_3284_3925 | 212 |
| 1260 | 3300053086 | Ga0500578_0000006 | Ga0500578_0000006_46094_46735 | 212 |
| 1261 | 3300053088 | Ga0500644_0099687 | Ga0500644_0099687_241_882 | 212 |
| 1262 | 3300053088 | Ga0500644_0110844 | Ga0500644_0110844_370_1011 | 212 |
| 1263 | 3300053093 | Ga0500651_0004274 | Ga0500651_0004274_4997_5638 | 212 |
| 1264 | 3300053093 | Ga0500651_0066076 | Ga0500651_0066076_907_1548 | 212 |
| 1265 | 3300053098 | Ga0500650_0139028 | Ga0500650_0139028_333_974 | 212 |
| 1266 | 3300053108 | Ga0500562_017531 | Ga0500562_017531_207_848 | 212 |
| 1267 | 3300053117 | Ga0500593_001497 | Ga0500593_001497_3170_3811 | 212 |
| 1268 | 3300053117 | Ga0500593_171330 | Ga0500593_171330_19_660 | 212 |
| 1269 | 3300053127 | Ga0500623_080702 | Ga0500623_080702_655_1296 | 212 |
| 1270 | 3300053129 | Ga0500628_033577 | Ga0500628_033577_285_926 | 212 |
| 1271 | 3300053130 | Ga0500642_0002917 | Ga0500642_0002917_4336_4977 | 212 |
| 1272 | 3300053131 | Ga0500652_000046 | Ga0500652_000046_3362_4003 | 212 |
| 1273 | 3300053133 | Ga0500655_004813 | Ga0500655_004813_895_1536 | 212 |
| 1274 | 3300053139 | Ga0500568_0013406 | Ga0500568_0013406_297_938 | 212 |
| 1275 | 3300053142 | Ga0500577_0004010 | Ga0500577_0004010_3028_3669 | 212 |
| 1276 | 3300053146 | Ga0500588_0014459 | Ga0500588_0014459_1337_1978 | 212 |
| 1277 | 3300053151 | Ga0500604_0004410 | Ga0500604_0004410_2009_2650 | 212 |
| 1278 | 3300053156 | Ga0500622_0000415 | Ga0500622_0000415_12788_13429 | 212 |
| 1279 | 3300053156 | Ga0500622_0009199 | Ga0500622_0009199_2074_2721 | 212 |
| 1280 | 3300053156 | Ga0500622_0156237 | Ga0500622_0156237_108_749 | 212 |
| 1281 | 3300053156 | Ga0500622_0172818 | Ga0500622_0172818_205_846 | 212 |
| 1282 | 3300053739 | Ga0500587_000461 | Ga0500587_000461_557_1198 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9726 | 146 | 209 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9687 | 146 | 209 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9611 | 147 | 209 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9553 | 146 | 211 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9526 | 146 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9797 | 149 | 207 | 1.10.10.10 |
| 4if4B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9492 | 146 | 211 | 1.10.10.10 |
| 4if4D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.949 | 145 | 211 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.948 | 149 | 206 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.948 | 149 | 206 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H6EJE6-F1-model_v4 | Response regulator UvrY | 0.9396 | 1 | 211 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A2H6EJE6-F1-model_v4 | Response regulator UvrY | 0.9353 | 1 | 211 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A662BIV3-F1-model_v4 | DNA-binding response regulator | 0.9266 | 1 | 143 |
GO:0000160
GO:0003677 |
| AF-A0A2S7TR62-F1-model_v4 | DNA-binding response regulator | 0.9126 | 2 | 208 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A4Q3WAF0-F1-model_v4 | Response regulator transcription factor | 0.9111 | 1 | 136 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar