F492540

General Info

Members Datasets Scaffolds Average Seq Length
1282 506 1264 212

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10433058|Ga0307516_104330581
Length 252
Sequence VVYDIPSPAEYDGRSPEGTRAGLGAARRSARGSDFGIFRQMIKVILCDDHALIRRGIRDTLSDAPDIEVIGEAGDYGELRTLMRDHTADVLVLDINLPGRSGLDVLHVLKDEGTAMRVLVVSMYPEDQYAIRALRAGAFGYVNKGGDPSLIVTAVRTVAQGRKYVTPEIAQMLVESLTTPAATNAHEKLSDRELQTLVMIASGKRLSDIAEELMLSPKTVSVYRARVLEKLGLTNNSEMTVYAIRNGLVGGE

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
9 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
13 2643221656 Pelomonas sp. Root405 Isolate Unclassified
14 2643221660 Methylibium sp. Root1272 Isolate Unclassified
15 2738541337 Pelomonas sp. BT06 Isolate Unclassified
16 2831864461 Roseateles noduli HZ7 Isolate Nodule
17 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
18 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
129 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
130 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
221 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
222 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
237 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
238 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
239 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
240 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
249 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
270 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
275 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
282 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
283 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
297 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
298 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
299 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
300 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
301 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
302 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
303 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
304 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
305 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
306 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
307 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
308 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
309 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
310 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
311 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
312 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
313 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
314 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
315 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
316 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
317 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
318 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
319 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
320 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
321 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
322 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
323 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
324 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
325 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
326 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
327 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
328 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
329 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
330 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
340 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
350 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
351 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
352 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
353 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
354 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
355 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
358 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
362 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
371 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
372 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
373 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
374 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
375 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
376 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
377 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
378 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
379 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
380 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
388 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
391 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
392 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
393 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
423 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
424 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
425 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
435 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
436 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
437 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
438 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
439 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
440 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
441 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
442 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
443 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
444 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
445 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
446 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
447 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
448 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
451 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
452 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
453 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
454 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
455 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
458 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
459 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
460 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
461 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
462 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
470 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
471 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
472 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
473 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
474 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
475 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
476 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
477 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
482 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
483 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
484 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
485 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
486 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
487 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
488 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
489 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
490 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
491 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
492 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
493 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
494 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
498 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
501 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
502 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
503 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
504 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0.08
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.3
Nodule 0.39
Rhizoplane 3.12
Rhizosphere 71.45
Stem 0
Stem Tuber 0
Unclassified 8.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019248 3300001979 Bacteria 2408
2 JGI25156J39149_1002048 3300002705 Bacteria 7673
3 JGI25156J39149_1002716 3300002705 Bacteria 6185
4 JGI25156J39149_1007600 3300002705 Bacteria 2825
5 JGI25156J39149_1017236 3300002705 Bacteria 1375
6 JGI25154J39366_1000783 3300002738 Bacteria 14054
7 JGI25157J39369_1000551 3300002741 Bacteria 22422
8 JGI25164J39214_1005629 3300002772 Bacteria 1351
9 JGI25152J39213_1000320 3300002773 Bacteria 30822
10 JGI25150J39212_1022531 3300002774 Bacteria 946
11 JGI25153J46596_10010193 3300003215 Bacteria 4273
12 Ga0006770J48903_1062170 3300003305 Bacteria 802
13 rootH1_10009161 3300003316 Bacteria 6408
14 rootH2_10018416 3300003320 Bacteria 4692
15 rootH2_10083264 3300003320 Bacteria 2870
16 rootH2_10087210 3300003320 Bacteria 5013
17 rootH1_10032898 3300003323 Bacteria 6131
18 Ga0055539_1000766 3300003752 Bacteria 7778
19 Ga0055539_1002353 3300003752 Bacteria 2944
20 Ga0055533_1000053 3300003756 Bacteria 199478
21 Ga0055525_1000038 3300003759 Bacteria 297540
22 Ga0055525_1001506 3300003759 Bacteria 3997
23 Ga0055535_1001169 3300003761 Bacteria 15351
24 Ga0055535_1018710 3300003761 Bacteria 895
25 Ga0055529_1000431 3300003763 Bacteria 42425
26 Ga0055526_1002642 3300003771 Bacteria 11968
27 Ga0055526_1002801 3300003771 Bacteria 11550
28 Ga0055524_1000233 3300003775 Bacteria 58967
29 Ga0055524_1001969 3300003775 Bacteria 11002
30 Ga0055524_1013683 3300003775 Bacteria 3051
31 Ga0055530_10006306 3300003791 Bacteria 5332
32 Ga0055540_1000080 3300003792 Bacteria 111063
33 Ga0055540_1032332 3300003792 Bacteria 1194
34 Ga0055531_10000043 3300003794 Bacteria 133906
35 Ga0055531_10005579 3300003794 Bacteria 7342
36 Ga0055543_1004230 3300004625 Bacteria 3969
37 Ga0055543_1024592 3300004625 Bacteria 1080
38 Ga0065165_1000390 3300005262 Bacteria 71262
39 Ga0065165_1001585 3300005262 Bacteria 23411
40 Ga0065165_1003937 3300005262 Bacteria 9775
41 Ga0065715_10184216 3300005293 Bacteria 1456
42 Ga0065707_10186254 3300005295 Bacteria 1387
43 Ga0070658_10040482 3300005327 Bacteria 3759
44 Ga0070658_10076570 3300005327 Bacteria 2743
45 Ga0070658_10091163 3300005327 Bacteria 2512
46 Ga0070658_10750308 3300005327 Bacteria 847
47 Ga0070676_10001571 3300005328 Bacteria 11600
48 Ga0070676_10009968 3300005328 Bacteria 5142
49 Ga0070676_10077944 3300005328 Bacteria 2004
50 Ga0070676_10242371 3300005328 Bacteria 1200
51 Ga0070683_100042121 3300005329 Bacteria 4204
52 Ga0070683_100063563 3300005329 Bacteria 3433
53 Ga0070690_100067742 3300005330 Bacteria 2313
54 Ga0070690_100068766 3300005330 Bacteria 2297
55 Ga0070690_100369620 3300005330 Bacteria 1046
56 Ga0070670_100002895 3300005331 Bacteria 14202
57 Ga0070670_100052223 3300005331 Bacteria 3511
58 Ga0070670_100068319 3300005331 Bacteria 3050
59 Ga0070670_100072274 3300005331 Bacteria 2962
60 Ga0070670_100409113 3300005331 Bacteria 1198
61 Ga0070677_10014841 3300005333 Bacteria 2750
62 Ga0068869_100010255 3300005334 Bacteria 6104
63 Ga0068869_100036073 3300005334 Bacteria 3509
64 Ga0068869_100043229 3300005334 Bacteria 3235
65 Ga0068869_100220220 3300005334 Bacteria 1504
66 Ga0068869_100280110 3300005334 Bacteria 1341
67 Ga0070666_10005627 3300005335 Bacteria 7688
68 Ga0070666_10037731 3300005335 Bacteria 3214
69 Ga0070666_10068676 3300005335 Bacteria 2409
70 Ga0070680_100014127 3300005336 Bacteria 6236
71 Ga0068868_100005991 3300005338 Bacteria 8583
72 Ga0068868_100075106 3300005338 Bacteria 2701
73 Ga0068868_100357881 3300005338 Bacteria 1251
74 Ga0068868_100385495 3300005338 Bacteria 1207
75 Ga0070660_100058136 3300005339 Bacteria 2998
76 Ga0070660_100058999 3300005339 Bacteria 2976
77 Ga0070660_100222427 3300005339 Bacteria 1534
78 Ga0070660_100443902 3300005339 Bacteria 1076
79 Ga0070687_100136435 3300005343 Bacteria 1423
80 Ga0070687_100137107 3300005343 Bacteria 1420
81 Ga0070661_100023474 3300005344 Bacteria 4421
82 Ga0070661_100192346 3300005344 Bacteria 1556
83 Ga0070661_100285421 3300005344 Bacteria 1281
84 Ga0070692_10322102 3300005345 Bacteria 951
85 Ga0070668_100005605 3300005347 Bacteria 9308
86 Ga0070668_100142831 3300005347 Bacteria 1930
87 Ga0070668_100271141 3300005347 Bacteria 1414
88 Ga0070669_100015642 3300005353 Bacteria 5410
89 Ga0070669_100020771 3300005353 Bacteria 4691
90 Ga0070669_100026966 3300005353 Bacteria 4134
91 Ga0070669_100126035 3300005353 Bacteria 1959
92 Ga0070669_100242374 3300005353 Bacteria 1433
93 Ga0070669_100252329 3300005353 Bacteria 1405
94 Ga0070669_100455382 3300005353 Bacteria 1055
95 Ga0070675_100021338 3300005354 Bacteria 5174
96 Ga0070675_100025785 3300005354 Bacteria 4713
97 Ga0070675_100029887 3300005354 Bacteria 4396
98 Ga0070675_100035559 3300005354 Bacteria 4048
99 Ga0070675_100036889 3300005354 Bacteria 3980
100 Ga0070675_100074550 3300005354 Bacteria 2819
101 Ga0070675_100101334 3300005354 Bacteria 2426
102 Ga0070675_100121594 3300005354 Bacteria 2218
103 Ga0070675_100564713 3300005354 Bacteria 1030
104 Ga0070671_100002511 3300005355 Bacteria 14214
105 Ga0070671_100014186 3300005355 Bacteria 6434
106 Ga0070671_100017039 3300005355 Bacteria 5877
107 Ga0070671_100050234 3300005355 Bacteria 3469
108 Ga0070671_100053915 3300005355 Bacteria 3342
109 Ga0070671_100056719 3300005355 Bacteria 3259
110 Ga0070671_100134964 3300005355 Bacteria 2080
111 Ga0070671_100170914 3300005355 Bacteria 1838
112 Ga0070674_100017041 3300005356 Bacteria 4561
113 Ga0070674_100036447 3300005356 Bacteria 3302
114 Ga0070674_100429687 3300005356 Bacteria 1086
115 Ga0070673_100001525 3300005364 Bacteria 13646
116 Ga0070673_100005338 3300005364 Bacteria 8207
117 Ga0070673_100012028 3300005364 Bacteria 5928
118 Ga0070673_100090098 3300005364 Bacteria 2505
119 Ga0070673_100097413 3300005364 Bacteria 2415
120 Ga0070673_100246407 3300005364 Bacteria 1556
121 Ga0070673_100773647 3300005364 Bacteria 885
122 Ga0070688_100090969 3300005365 Bacteria 1994
123 Ga0070688_100172768 3300005365 Bacteria 1493
124 Ga0070659_100006770 3300005366 Bacteria 8291
125 Ga0070659_100018804 3300005366 Bacteria 5216
126 Ga0070659_100132044 3300005366 Bacteria 2028
127 Ga0070659_100199327 3300005366 Bacteria 1647
128 Ga0070667_100000702 3300005367 Bacteria 32315
129 Ga0070667_100014692 3300005367 Bacteria 6467
130 Ga0070667_100051164 3300005367 Bacteria 3482
131 Ga0070667_100075701 3300005367 Bacteria 2874
132 Ga0070667_100095534 3300005367 Bacteria 2563
133 Ga0070700_100066458 3300005441 Bacteria 2289
134 Ga0070700_100298003 3300005441 Bacteria 1176
135 Ga0070663_100003281 3300005455 Bacteria 9317
136 Ga0070678_100031660 3300005456 Bacteria 3652
137 Ga0070678_100088709 3300005456 Bacteria 2365
138 Ga0070678_100112182 3300005456 Bacteria 2135
139 Ga0070678_100132721 3300005456 Bacteria 1981
140 Ga0070678_100153184 3300005456 Bacteria 1859
141 Ga0070678_100304969 3300005456 Bacteria 1354
142 Ga0070678_100475515 3300005456 Bacteria 1099
143 Ga0070662_100001681 3300005457 Bacteria 13600
144 Ga0070662_100018885 3300005457 Bacteria 4672
145 Ga0070662_100083930 3300005457 Bacteria 2379
146 Ga0070662_100102524 3300005457 Bacteria 2168
147 Ga0070662_100106906 3300005457 Bacteria 2126
148 Ga0068867_100000329 3300005459 Bacteria 31296
149 Ga0068867_100001329 3300005459 Bacteria 17124
150 Ga0068867_100011396 3300005459 Bacteria 6273
151 Ga0068867_100016329 3300005459 Bacteria 5271
152 Ga0068867_100024678 3300005459 Bacteria 4309
153 Ga0068867_100026671 3300005459 Bacteria 4149
154 Ga0068867_100209582 3300005459 Bacteria 1564
155 Ga0068867_100243934 3300005459 Bacteria 1458
156 Ga0070685_10015464 3300005466 Bacteria 4055
157 Ga0070685_10491459 3300005466 Bacteria 867
158 Ga0070706_100003982 3300005467 Bacteria 14377
159 Ga0070706_100100656 3300005467 Bacteria 2685
160 Ga0070707_100509147 3300005468 Bacteria 1166
161 Ga0070679_100002110 3300005530 Bacteria 17906
162 Ga0070684_100252062 3300005535 Bacteria 1613
163 Ga0068853_100080642 3300005539 Bacteria 2848
164 Ga0068853_100086802 3300005539 Bacteria 2745
165 Ga0068853_100187973 3300005539 Bacteria 1875
166 Ga0070672_100002315 3300005543 Bacteria 12032
167 Ga0070672_100002548 3300005543 Bacteria 11617
168 Ga0070672_100002827 3300005543 Bacteria 11120
169 Ga0070672_100043657 3300005543 Bacteria 3458
170 Ga0070672_100054949 3300005543 Bacteria 3118
171 Ga0070672_100065143 3300005543 Bacteria 2881
172 Ga0070672_100188217 3300005543 Bacteria 1722
173 Ga0070672_100245180 3300005543 Bacteria 1508
174 Ga0070672_100277747 3300005543 Bacteria 1415
175 Ga0070686_100031869 3300005544 Bacteria 3227
176 Ga0070665_100002955 3300005548 Bacteria 18359
177 Ga0070665_101182355 3300005548 Bacteria 776
178 Ga0068855_100074071 3300005563 Bacteria 3955
179 Ga0068855_100238851 3300005563 Bacteria 2031
180 Ga0068855_100580319 3300005563 Bacteria 1211
181 Ga0070664_100063519 3300005564 Bacteria 3148
182 Ga0070664_100139645 3300005564 Bacteria 2133
183 Ga0070664_100261584 3300005564 Bacteria 1557
184 Ga0070664_100294446 3300005564 Bacteria 1465
185 Ga0068857_100036400 3300005577 Bacteria 4360
186 Ga0068857_100253539 3300005577 Bacteria 1613
187 Ga0068857_100363086 3300005577 Bacteria 1342
188 Ga0068854_100006268 3300005578 Bacteria 7558
189 Ga0068854_100012676 3300005578 Bacteria 5522
190 Ga0068854_100023755 3300005578 Bacteria 4190
191 Ga0068854_100168900 3300005578 Bacteria 1700
192 Ga0068854_100416033 3300005578 Bacteria 1116
193 Ga0068856_100027796 3300005614 Bacteria 5518
194 Ga0068856_100051194 3300005614 Bacteria 4072
195 Ga0068856_100102898 3300005614 Bacteria 2850
196 Ga0068856_100130455 3300005614 Bacteria 2518
197 Ga0068856_100169431 3300005614 Bacteria 2196
198 Ga0068856_100735324 3300005614 Bacteria 1007
199 Ga0070702_100036625 3300005615 Bacteria 2719
200 Ga0068852_100020253 3300005616 Bacteria 5287
201 Ga0068852_100123887 3300005616 Bacteria 2370
202 Ga0068852_100180734 3300005616 Bacteria 1983
203 Ga0068852_100226765 3300005616 Bacteria 1779
204 Ga0068852_100229098 3300005616 Bacteria 1770
205 Ga0068852_100302447 3300005616 Bacteria 1549
206 Ga0068852_100466896 3300005616 Bacteria 1252
207 Ga0068852_100595266 3300005616 Bacteria 1110
208 Ga0068852_100692491 3300005616 Bacteria 1029
209 Ga0068852_100827867 3300005616 Bacteria 941
210 Ga0068859_100005588 3300005617 Bacteria 12807
211 Ga0068859_100058362 3300005617 Bacteria 3887
212 Ga0068859_100069270 3300005617 Bacteria 3562
213 Ga0068859_100071420 3300005617 Bacteria 3507
214 Ga0068859_100964241 3300005617 Bacteria 936
215 Ga0068864_100002234 3300005618 Bacteria 15999
216 Ga0068864_100009938 3300005618 Bacteria 7848
217 Ga0068864_100115868 3300005618 Bacteria 2390
218 Ga0068864_100178778 3300005618 Bacteria 1939
219 Ga0068864_100268253 3300005618 Bacteria 1590
220 Ga0068864_100717192 3300005618 Bacteria 978
221 Ga0068866_10008518 3300005718 Bacteria 4326
222 Ga0068866_10148757 3300005718 Bacteria 1353
223 Ga0068861_100001661 3300005719 Bacteria 14229
224 Ga0068861_100004858 3300005719 Bacteria 9039
225 Ga0068861_100006277 3300005719 Bacteria 8087
226 Ga0068851_10183215 3300005834 Bacteria 1161
227 Ga0068870_10028578 3300005840 Bacteria 2801
228 Ga0068870_10093157 3300005840 Bacteria 1689
229 Ga0068863_100004155 3300005841 Bacteria 14296
230 Ga0068863_100042613 3300005841 Bacteria 4313
231 Ga0068863_100081641 3300005841 Bacteria 3062
232 Ga0068863_100278683 3300005841 Bacteria 1620
233 Ga0068863_100301059 3300005841 Bacteria 1556
234 Ga0068863_100582212 3300005841 Bacteria 1107
235 Ga0068858_100002678 3300005842 Bacteria 17932
236 Ga0068858_100053372 3300005842 Bacteria 3739
237 Ga0068858_100126830 3300005842 Bacteria 2390
238 Ga0068858_100134145 3300005842 Bacteria 2322
239 Ga0068858_100640357 3300005842 Bacteria 1033
240 Ga0068860_100000943 3300005843 Bacteria 32232
241 Ga0068860_100005402 3300005843 Bacteria 12964
242 Ga0068860_100012396 3300005843 Bacteria 8399
243 Ga0068860_100112503 3300005843 Bacteria 2603
244 Ga0068860_100248051 3300005843 Bacteria 1733
245 Ga0068860_100265208 3300005843 Bacteria 1675
246 Ga0068860_100273411 3300005843 Bacteria 1649
247 Ga0068860_100604751 3300005843 Bacteria 1102
248 Ga0068862_100008011 3300005844 Bacteria 8743
249 Ga0068862_100018064 3300005844 Bacteria 5874
250 Ga0068862_100038900 3300005844 Bacteria 4038
251 Ga0075365_10071939 3300006038 Bacteria 2329
252 Ga0075368_10001858 3300006042 Bacteria 6782
253 Ga0075368_10010880 3300006042 Bacteria 3299
254 Ga0075363_100005031 3300006048 Bacteria 5848
255 Ga0075363_100019201 3300006048 Bacteria 3414
256 Ga0075363_100023671 3300006048 Bacteria 3115
257 Ga0075363_100311951 3300006048 Bacteria 914
258 Ga0075364_10004616 3300006051 Bacteria 7939
259 Ga0075364_10022968 3300006051 Bacteria 3945
260 Ga0075362_10000760 3300006177 Bacteria 9596
261 Ga0075362_10065172 3300006177 Bacteria 1654
262 Ga0075362_10148162 3300006177 Bacteria 1125
263 Ga0075362_10249295 3300006177 Bacteria 873
264 Ga0075367_10003300 3300006178 Bacteria 7651
265 Ga0075367_10009174 3300006178 Bacteria 5159
266 Ga0075367_10033742 3300006178 Bacteria 2952
267 Ga0075367_10037724 3300006178 Bacteria 2809
268 Ga0075367_10045779 3300006178 Bacteria 2568
269 Ga0075367_10149702 3300006178 Bacteria 1448
270 Ga0075369_10017423 3300006186 Bacteria 2911
271 Ga0075369_10024429 3300006186 Bacteria 2504
272 Ga0075369_10024769 3300006186 Bacteria 2489
273 Ga0075369_10075485 3300006186 Bacteria 1489
274 Ga0075366_10004079 3300006195 Bacteria 7807
275 Ga0075366_10005321 3300006195 Bacteria 6973
276 Ga0075366_10009539 3300006195 Bacteria 5422
277 Ga0075366_10012478 3300006195 Bacteria 4820
278 Ga0075366_10013722 3300006195 Bacteria 4618
279 Ga0075366_10014473 3300006195 Bacteria 4504
280 Ga0075366_10045754 3300006195 Bacteria 2593
281 Ga0075366_10051734 3300006195 Bacteria 2441
282 Ga0075366_10073749 3300006195 Bacteria 2034
283 Ga0075366_10085889 3300006195 Bacteria 1882
284 Ga0075366_10093330 3300006195 Bacteria 1804
285 Ga0075366_10107373 3300006195 Bacteria 1678
286 Ga0075366_10233340 3300006195 Bacteria 1121
287 Ga0075366_10290481 3300006195 Bacteria 1000
288 Ga0075366_10308834 3300006195 Bacteria 968
289 Ga0097621_100018003 3300006237 Bacteria 5383
290 Ga0097621_100053400 3300006237 Bacteria 3294
291 Ga0097621_100194564 3300006237 Bacteria 1758
292 Ga0097621_100379711 3300006237 Bacteria 1262
293 Ga0097621_100401297 3300006237 Bacteria 1227
294 Ga0075370_10000898 3300006353 Bacteria 12202
295 Ga0075370_10002264 3300006353 Bacteria 8863
296 Ga0075370_10005659 3300006353 Bacteria 6237
297 Ga0075370_10007605 3300006353 Bacteria 5526
298 Ga0075370_10009378 3300006353 Bacteria 5078
299 Ga0075370_10023788 3300006353 Bacteria 3378
300 Ga0075370_10028431 3300006353 Bacteria 3108
301 Ga0075370_10031310 3300006353 Bacteria 2969
302 Ga0075370_10055486 3300006353 Bacteria 2251
303 Ga0075370_10106881 3300006353 Bacteria 1623
304 Ga0068871_100006199 3300006358 Bacteria 8432
305 Ga0068871_100158783 3300006358 Bacteria 1932
306 Ga0068871_100776908 3300006358 Bacteria 882
307 Ga0075429_100008966 3300006880 Bacteria 8689
308 Ga0068865_100004931 3300006881 Bacteria 8069
309 Ga0068865_100010176 3300006881 Bacteria 5847
310 Ga0068865_100083825 3300006881 Bacteria 2295
311 Ga0068865_100294420 3300006881 Bacteria 1297
312 Ga0068865_100440782 3300006881 Bacteria 1075
313 Ga0097620_100005588 3300006931 Bacteria 12807
314 Ga0097620_100058362 3300006931 Bacteria 3887
315 Ga0097620_100069266 3300006931 Bacteria 3562
316 Ga0097620_100071419 3300006931 Bacteria 3507
317 Ga0097620_100964190 3300006931 Bacteria 936
318 Ga0099823_1000163 3300006944 Bacteria 35759
319 Ga0079104_1001201 3300006946 Bacteria 18424
320 Ga0105240_10008979 3300009093 Bacteria 14207
321 Ga0105240_10057797 3300009093 Bacteria 4844
322 Ga0105240_10073187 3300009093 Bacteria 4232
323 Ga0111539_10877273 3300009094 Bacteria 1044
324 Ga0105245_10161208 3300009098 Bacteria 2128
325 Ga0105245_10173555 3300009098 Bacteria 2054
326 Ga0114129_10378952 3300009147 Bacteria 1869
327 Ga0114129_10553197 3300009147 Bacteria 1496
328 Ga0105243_10012059 3300009148 Bacteria 6535
329 Ga0105243_10017616 3300009148 Bacteria 5402
330 Ga0105243_10098123 3300009148 Bacteria 2426
331 Ga0105243_10251151 3300009148 Bacteria 1579
332 Ga0105243_10345824 3300009148 Bacteria 1364
333 Ga0105243_10619323 3300009148 Bacteria 1044
334 Ga0105241_10024407 3300009174 Bacteria 4489
335 Ga0105242_10263050 3300009176 Bacteria 1559
336 Ga0105248_10004768 3300009177 Bacteria 15007
337 Ga0105248_10019801 3300009177 Bacteria 7453
338 Ga0105248_10105860 3300009177 Bacteria 3171
339 Ga0105248_10209128 3300009177 Bacteria 2198
340 Ga0105248_10320278 3300009177 Bacteria 1746
341 Ga0105248_10342136 3300009177 Bacteria 1684
342 Ga0105248_10465645 3300009177 Bacteria 1425
343 Ga0105248_10741216 3300009177 Bacteria 1108
344 Ga0105237_10001800 3300009545 Bacteria 27691
345 Ga0105237_10052281 3300009545 Bacteria 4101
346 Ga0105237_10573843 3300009545 Bacteria 1135
347 Ga0105238_10001620 3300009551 Bacteria 22525
348 Ga0105238_10027838 3300009551 Bacteria 5760
349 Ga0105238_10143142 3300009551 Bacteria 2367
350 Ga0105249_10006344 3300009553 Bacteria 10278
351 Ga0105249_10314165 3300009553 Bacteria 1576
352 Ga0105249_10446991 3300009553 Bacteria 1331
353 Ga0105239_10001185 3300010375 Bacteria 35747
354 Ga0105239_10030763 3300010375 Bacteria 5904
355 Ga0105239_10138092 3300010375 Bacteria 2714
356 Ga0105239_10219559 3300010375 Bacteria 2132
357 Ga0105246_10174447 3300011119 Bacteria 1649
358 Ga0105246_10467817 3300011119 Bacteria 1063
359 Ga0105246_10692620 3300011119 Bacteria 892
360 Ga0157323_1010599 3300012495 Bacteria 728
361 Ga0157319_1000003 3300012497 Bacteria 397199
362 Ga0157327_1019006 3300012512 Bacteria 755
363 Ga0157371_10041368 3300013102 Bacteria 3289
364 Ga0157371_10200573 3300013102 Bacteria 1430
365 Ga0157370_10577339 3300013104 Bacteria 1030
366 Ga0157370_10772829 3300013104 Bacteria 875
367 Ga0157374_10000271 3300013296 Bacteria 48054
368 Ga0157374_10018242 3300013296 Bacteria 6191
369 Ga0157374_10047499 3300013296 Bacteria 3981
370 Ga0157374_10161847 3300013296 Bacteria 2180
371 Ga0157374_10319887 3300013296 Bacteria 1537
372 Ga0157374_10373898 3300013296 Bacteria 1419
373 Ga0157374_10479019 3300013296 Bacteria 1248
374 Ga0157378_10024112 3300013297 Bacteria 5352
375 Ga0157378_10294779 3300013297 Bacteria 1568
376 Ga0157378_10940126 3300013297 Bacteria 897
377 Ga0157378_11185133 3300013297 Bacteria 803
378 Ga0163162_10003029 3300013306 Bacteria 16054
379 Ga0163162_10005745 3300013306 Bacteria 11999
380 Ga0163162_10159345 3300013306 Bacteria 2378
381 Ga0157372_10014771 3300013307 Bacteria 8358
382 Ga0157372_10038743 3300013307 Bacteria 5260
383 Ga0157375_10043212 3300013308 Bacteria 4368
384 Ga0157375_10089804 3300013308 Bacteria 3129
385 Ga0157375_10166099 3300013308 Bacteria 2352
386 Ga0157375_10464303 3300013308 Bacteria 1431
387 Ga0157375_10763574 3300013308 Bacteria 1117
388 Ga0157375_10892202 3300013308 Bacteria 1033
389 Ga0163163_10376138 3300014325 Bacteria 1478
390 Ga0163163_10553095 3300014325 Bacteria 1213
391 Ga0157380_10024608 3300014326 Bacteria 4558
392 Ga0157380_10034917 3300014326 Bacteria 3881
393 Ga0157380_10223993 3300014326 Bacteria 1684
394 Ga0157380_10352006 3300014326 Bacteria 1378
395 Ga0157377_10000170 3300014745 Bacteria 38897
396 Ga0157377_10002946 3300014745 Bacteria 7611
397 Ga0157377_10218351 3300014745 Bacteria 1219
398 Ga0157379_10039596 3300014968 Bacteria 4205
399 Ga0157379_10077702 3300014968 Bacteria 2972
400 Ga0157379_10283447 3300014968 Bacteria 1508
401 Ga0157379_10330250 3300014968 Bacteria 1393
402 Ga0157379_10367708 3300014968 Bacteria 1318
403 Ga0157376_10021326 3300014969 Bacteria 5031
404 Ga0157376_10422279 3300014969 Bacteria 1294
405 Ga0157376_10816629 3300014969 Bacteria 946
406 Ga0157376_10851588 3300014969 Bacteria 927
407 Ga0182007_10092630 3300015262 Bacteria 996
408 Ga0163161_10016697 3300017792 Bacteria 5128
409 Ga0163161_10053309 3300017792 Bacteria 2933
410 Ga0163161_10128971 3300017792 Bacteria 1906
411 Ga0163161_10291543 3300017792 Bacteria 1283
412 Ga0213872_10000044 3300021361 Bacteria 114843
413 Ga0213872_10000070 3300021361 Bacteria 91519
414 Ga0213872_10000073 3300021361 Bacteria 91302
415 Ga0213872_10000154 3300021361 Bacteria 63158
416 Ga0213872_10022528 3300021361 Bacteria 2901
417 Ga0213872_10046320 3300021361 Bacteria 1979
418 Ga0213872_10091385 3300021361 Bacteria 1362
419 Ga0213872_10114075 3300021361 Bacteria 1198
420 Ga0209674_100039 3300025226 Bacteria 402292
421 Ga0209563_100005 3300025230 Bacteria 1774893
422 Ga0209563_100080 3300025230 Bacteria 199504
423 Ga0207427_101590 3300025231 Bacteria 7784
424 Ga0209258_100072 3300025242 Bacteria 274355
425 Ga0209258_102156 3300025242 Bacteria 5453
426 Ga0207425_1004382 3300025245 Bacteria 4261
427 Ga0209646_1000301 3300025246 Bacteria 40208
428 Ga0209026_1000011 3300025250 Bacteria 507291
429 Ga0209677_100130 3300025253 Bacteria 72879
430 Ga0209677_103493 3300025253 Bacteria 5051
431 Ga0209677_103696 3300025253 Bacteria 4801
432 Ga0209759_1000214 3300025256 Bacteria 89311
433 Ga0209759_1001031 3300025256 Bacteria 18709
434 Ga0209759_1001266 3300025256 Bacteria 15217
435 Ga0209759_1007152 3300025256 Bacteria 3637
436 Ga0209759_1011143 3300025256 Bacteria 2579
437 Ga0209759_1042771 3300025256 Bacteria 764
438 Ga0209129_1000027 3300025258 Bacteria 409587
439 Ga0209129_1027025 3300025258 Bacteria 986
440 Ga0209455_1000053 3300025272 Bacteria 365949
441 Ga0209673_1009613 3300025273 Bacteria 4159
442 Ga0209673_1014163 3300025273 Bacteria 3099
443 Ga0209673_1018104 3300025273 Bacteria 2574
444 Ga0209673_1018827 3300025273 Bacteria 2497
445 Ga0209564_1000014 3300025295 Bacteria 621501
446 Ga0209564_1000051 3300025295 Bacteria 357748
447 Ga0209758_1000307 3300025297 Bacteria 95192
448 Ga0209758_1000524 3300025297 Bacteria 61366
449 Ga0209050_1001300 3300025298 Bacteria 28170
450 Ga0209050_1002883 3300025298 Bacteria 13584
451 Ga0209050_1003609 3300025298 Bacteria 11221
452 Ga0209050_1009714 3300025298 Bacteria 4874
453 Ga0209050_1025737 3300025298 Bacteria 1990
454 Ga0209256_1000203 3300025299 Bacteria 112500
455 Ga0209256_1000675 3300025299 Bacteria 46128
456 Ga0209256_1004060 3300025299 Bacteria 9517
457 Ga0209051_1000035 3300025303 Bacteria 346999
458 Ga0209051_1000981 3300025303 Bacteria 27697
459 Ga0209051_1002155 3300025303 Bacteria 14606
460 Ga0209051_1004799 3300025303 Bacteria 8153
461 Ga0209051_1007290 3300025303 Bacteria 6069
462 Ga0209051_1048679 3300025303 Bacteria 1435
463 Ga0209257_1000182 3300025304 Bacteria 156672
464 Ga0209257_1000346 3300025304 Bacteria 95662
465 Ga0209257_1002753 3300025304 Bacteria 16625
466 Ga0209257_1003470 3300025304 Bacteria 13469
467 Ga0209257_1011718 3300025304 Bacteria 4172
468 Ga0209257_1058206 3300025304 Bacteria 1060
469 Ga0209257_1086438 3300025304 Bacteria 793
470 Ga0207697_10283218 3300025315 Bacteria 735
471 Ga0207682_10005109 3300025893 Bacteria 5376
472 Ga0207682_10043472 3300025893 Bacteria 1839
473 Ga0207682_10044919 3300025893 Bacteria 1812
474 Ga0207682_10059945 3300025893 Bacteria 1591
475 Ga0207682_10171003 3300025893 Bacteria 988
476 Ga0207688_10218862 3300025901 Bacteria 1146
477 Ga0207680_10003380 3300025903 Bacteria 7515
478 Ga0207680_10010348 3300025903 Bacteria 4664
479 Ga0207680_10571476 3300025903 Bacteria 808
480 Ga0207645_10001208 3300025907 Bacteria 21313
481 Ga0207645_10013147 3300025907 Bacteria 5590
482 Ga0207645_10018896 3300025907 Bacteria 4527
483 Ga0207645_10084162 3300025907 Bacteria 2041
484 Ga0207645_10176396 3300025907 Bacteria 1402
485 Ga0207643_10044744 3300025908 Bacteria 2499
486 Ga0207705_10189880 3300025909 Bacteria 1553
487 Ga0207705_10230832 3300025909 Bacteria 1408
488 Ga0207705_10312019 3300025909 Bacteria 1207
489 Ga0207684_10004653 3300025910 Bacteria 12885
490 Ga0207684_10062899 3300025910 Bacteria 3151
491 Ga0207654_10109211 3300025911 Bacteria 1718
492 Ga0207707_10037822 3300025912 Bacteria 4217
493 Ga0207707_10866141 3300025912 Bacteria 749
494 Ga0207695_10010519 3300025913 Bacteria 11315
495 Ga0207695_10018695 3300025913 Bacteria 8002
496 Ga0207695_10211675 3300025913 Bacteria 1849
497 Ga0207671_10001232 3300025914 Bacteria 30245
498 Ga0207663_10221519 3300025916 Bacteria 1377
499 Ga0207660_10013605 3300025917 Bacteria 5335
500 Ga0207662_10061693 3300025918 Bacteria 2252
501 Ga0207662_10495788 3300025918 Bacteria 840
502 Ga0207657_10045869 3300025919 Bacteria 3831
503 Ga0207657_10389533 3300025919 Bacteria 1096
504 Ga0207657_10484026 3300025919 Bacteria 970
505 Ga0207649_10004761 3300025920 Bacteria 7343
506 Ga0207649_10017005 3300025920 Bacteria 4115
507 Ga0207649_10183236 3300025920 Bacteria 1467
508 Ga0207649_10342420 3300025920 Bacteria 1104
509 Ga0207652_10046936 3300025921 Bacteria 3688
510 Ga0207646_10163129 3300025922 Bacteria 2011
511 Ga0207681_10000823 3300025923 Bacteria 20454
512 Ga0207681_10056092 3300025923 Bacteria 2686
513 Ga0207681_10061088 3300025923 Bacteria 2589
514 Ga0207681_10125073 3300025923 Bacteria 1892
515 Ga0207681_10615744 3300025923 Bacteria 898
516 Ga0207694_10004625 3300025924 Bacteria 10717
517 Ga0207650_10002985 3300025925 Bacteria 11671
518 Ga0207650_10014909 3300025925 Bacteria 5408
519 Ga0207650_10072923 3300025925 Bacteria 2585
520 Ga0207650_10120999 3300025925 Bacteria 2038
521 Ga0207659_10004461 3300025926 Bacteria 8473
522 Ga0207659_10040286 3300025926 Bacteria 3265
523 Ga0207659_10055387 3300025926 Bacteria 2836
524 Ga0207659_10056078 3300025926 Bacteria 2820
525 Ga0207659_10098047 3300025926 Bacteria 2203
526 Ga0207659_10110233 3300025926 Bacteria 2091
527 Ga0207659_10246622 3300025926 Bacteria 1447
528 Ga0207659_10304617 3300025926 Bacteria 1310
529 Ga0207659_10633182 3300025926 Bacteria 913
530 Ga0207687_10155820 3300025927 Bacteria 1747
531 Ga0207687_10256539 3300025927 Bacteria 1392
532 Ga0207687_11068789 3300025927 Bacteria 693
533 Ga0207644_10016116 3300025931 Bacteria 5027
534 Ga0207644_10034103 3300025931 Bacteria 3561
535 Ga0207644_10049492 3300025931 Bacteria 3009
536 Ga0207644_10072900 3300025931 Bacteria 2516
537 Ga0207644_11052198 3300025931 Bacteria 683
538 Ga0207690_10005585 3300025932 Bacteria 7429
539 Ga0207690_10091128 3300025932 Bacteria 2154
540 Ga0207690_10099654 3300025932 Bacteria 2072
541 Ga0207690_10203392 3300025932 Bacteria 1505
542 Ga0207690_10211436 3300025932 Bacteria 1479
543 Ga0207690_10381988 3300025932 Bacteria 1120
544 Ga0207706_10002434 3300025933 Bacteria 18165
545 Ga0207706_10013338 3300025933 Bacteria 7475
546 Ga0207706_10013363 3300025933 Bacteria 7469
547 Ga0207706_10033600 3300025933 Bacteria 4564
548 Ga0207706_10082407 3300025933 Bacteria 2827
549 Ga0207686_10064164 3300025934 Bacteria 2338
550 Ga0207709_10003397 3300025935 Bacteria 9508
551 Ga0207709_10034651 3300025935 Bacteria 2977
552 Ga0207709_10057501 3300025935 Bacteria 2412
553 Ga0207709_10088731 3300025935 Bacteria 2014
554 Ga0207709_10405028 3300025935 Bacteria 1044
555 Ga0207669_10003010 3300025937 Bacteria 7252
556 Ga0207669_10086353 3300025937 Bacteria 2028
557 Ga0207669_10093113 3300025937 Bacteria 1968
558 Ga0207669_10101108 3300025937 Bacteria 1906
559 Ga0207669_10542214 3300025937 Bacteria 937
560 Ga0207704_10066913 3300025938 Bacteria 2258
561 Ga0207704_10161990 3300025938 Bacteria 1593
562 Ga0207704_10667310 3300025938 Bacteria 858
563 Ga0207665_10079213 3300025939 Bacteria 2258
564 Ga0207691_10001739 3300025940 Bacteria 21471
565 Ga0207691_10004984 3300025940 Bacteria 12808
566 Ga0207691_10005163 3300025940 Bacteria 12608
567 Ga0207691_10022620 3300025940 Bacteria 5928
568 Ga0207691_10057939 3300025940 Bacteria 3525
569 Ga0207691_10149342 3300025940 Bacteria 2055
570 Ga0207691_10253259 3300025940 Bacteria 1519
571 Ga0207691_10264282 3300025940 Bacteria 1483
572 Ga0207711_10020237 3300025941 Bacteria 5545
573 Ga0207711_10045517 3300025941 Bacteria 3750
574 Ga0207711_10125706 3300025941 Bacteria 2294
575 Ga0207711_10142124 3300025941 Bacteria 2160
576 Ga0207711_10407468 3300025941 Bacteria 1264
577 Ga0207689_10000521 3300025942 Bacteria 36571
578 Ga0207689_10020049 3300025942 Bacteria 5629
579 Ga0207689_10063726 3300025942 Bacteria 3033
580 Ga0207689_10499944 3300025942 Bacteria 1019
581 Ga0207661_10009108 3300025944 Bacteria 7116
582 Ga0207661_10034856 3300025944 Bacteria 3918
583 Ga0207661_10275496 3300025944 Bacteria 1502
584 Ga0207679_10000254 3300025945 Bacteria 40785
585 Ga0207679_10034063 3300025945 Bacteria 3590
586 Ga0207679_10064714 3300025945 Bacteria 2734
587 Ga0207679_10194803 3300025945 Bacteria 1688
588 Ga0207679_10741197 3300025945 Bacteria 893
589 Ga0207667_10283879 3300025949 Bacteria 1691
590 Ga0207667_10911987 3300025949 Bacteria 870
591 Ga0207651_10035586 3300025960 Bacteria 3240
592 Ga0207651_10040355 3300025960 Bacteria 3087
593 Ga0207651_10060252 3300025960 Bacteria 2634
594 Ga0207651_10061743 3300025960 Bacteria 2608
595 Ga0207651_10085639 3300025960 Bacteria 2287
596 Ga0207651_10094284 3300025960 Bacteria 2200
597 Ga0207651_10104319 3300025960 Bacteria 2112
598 Ga0207712_10005486 3300025961 Bacteria 8003
599 Ga0207712_10103114 3300025961 Bacteria 2125
600 Ga0207712_10653834 3300025961 Bacteria 914
601 Ga0207668_10001265 3300025972 Bacteria 15064
602 Ga0207668_10055113 3300025972 Bacteria 2762
603 Ga0207668_10172966 3300025972 Bacteria 1696
604 Ga0207668_10388023 3300025972 Bacteria 1177
605 Ga0207668_10412953 3300025972 Bacteria 1144
606 Ga0207640_10011366 3300025981 Bacteria 5040
607 Ga0207640_10073229 3300025981 Bacteria 2314
608 Ga0207640_10276764 3300025981 Bacteria 1316
609 Ga0207658_10001833 3300025986 Bacteria 15912
610 Ga0207658_10002477 3300025986 Bacteria 13477
611 Ga0207658_10010320 3300025986 Bacteria 6349
612 Ga0207658_10011682 3300025986 Bacteria 5979
613 Ga0207658_10041908 3300025986 Bacteria 3318
614 Ga0207658_10300910 3300025986 Bacteria 1382
615 Ga0207658_10372914 3300025986 Bacteria 1248
616 Ga0207658_10467989 3300025986 Bacteria 1118
617 Ga0207658_10628131 3300025986 Bacteria 967
618 Ga0207677_10055505 3300026023 Bacteria 2709
619 Ga0207677_10113812 3300026023 Bacteria 2020
620 Ga0207677_10569978 3300026023 Bacteria 989
621 Ga0207677_10768681 3300026023 Bacteria 860
622 Ga0207703_10004479 3300026035 Bacteria 11473
623 Ga0207703_10005888 3300026035 Bacteria 9825
624 Ga0207703_10265235 3300026035 Bacteria 1554
625 Ga0207703_10317796 3300026035 Bacteria 1425
626 Ga0207639_10070563 3300026041 Bacteria 2729
627 Ga0207639_10117923 3300026041 Bacteria 2176
628 Ga0207639_10171528 3300026041 Bacteria 1838
629 Ga0207678_10002363 3300026067 Bacteria 17106
630 Ga0207678_10033453 3300026067 Bacteria 4478
631 Ga0207678_10783571 3300026067 Bacteria 841
632 Ga0207708_10075580 3300026075 Bacteria 2583
633 Ga0207708_10257200 3300026075 Bacteria 1408
634 Ga0207702_10002302 3300026078 Bacteria 18280
635 Ga0207702_10010277 3300026078 Bacteria 7841
636 Ga0207702_10138217 3300026078 Bacteria 2201
637 Ga0207702_10161962 3300026078 Bacteria 2044
638 Ga0207641_10009403 3300026088 Bacteria 8054
639 Ga0207641_10092184 3300026088 Bacteria 2653
640 Ga0207641_10109722 3300026088 Bacteria 2444
641 Ga0207641_10138439 3300026088 Bacteria 2193
642 Ga0207641_10262979 3300026088 Bacteria 1616
643 Ga0207641_10280693 3300026088 Bacteria 1566
644 Ga0207641_10807170 3300026088 Bacteria 928
645 Ga0207641_10821009 3300026088 Bacteria 920
646 Ga0207648_10000439 3300026089 Bacteria 46028
647 Ga0207648_10000748 3300026089 Bacteria 36506
648 Ga0207648_10002159 3300026089 Bacteria 21380
649 Ga0207648_10011657 3300026089 Bacteria 8274
650 Ga0207648_10016586 3300026089 Bacteria 6725
651 Ga0207648_10019952 3300026089 Bacteria 6048
652 Ga0207676_10005849 3300026095 Bacteria 8690
653 Ga0207676_10028252 3300026095 Bacteria 4188
654 Ga0207676_10034901 3300026095 Bacteria 3811
655 Ga0207676_10088207 3300026095 Bacteria 2539
656 Ga0207676_10138574 3300026095 Bacteria 2079
657 Ga0207676_10228543 3300026095 Bacteria 1662
658 Ga0207676_10247857 3300026095 Bacteria 1602
659 Ga0207676_10579331 3300026095 Bacteria 1075
660 Ga0207674_10045241 3300026116 Bacteria 4529
661 Ga0207674_10048860 3300026116 Bacteria 4329
662 Ga0207674_10120277 3300026116 Bacteria 2594
663 Ga0207674_10238182 3300026116 Bacteria 1767
664 Ga0207674_10389598 3300026116 Bacteria 1347
665 Ga0207675_100000428 3300026118 Bacteria 40700
666 Ga0207675_100001184 3300026118 Bacteria 25976
667 Ga0207675_100003876 3300026118 Bacteria 14539
668 Ga0207675_100038266 3300026118 Bacteria 4476
669 Ga0207683_10043392 3300026121 Bacteria 3930
670 Ga0207683_10050350 3300026121 Bacteria 3648
671 Ga0207683_10556024 3300026121 Bacteria 1061
672 Ga0207698_10016580 3300026142 Bacteria 4971
673 Ga0207698_10047782 3300026142 Bacteria 3245
674 Ga0207698_10071717 3300026142 Bacteria 2750
675 Ga0207698_10071922 3300026142 Bacteria 2746
676 Ga0207698_10434669 3300026142 Bacteria 1263
677 Ga0207698_10590525 3300026142 Bacteria 1094
678 Ga0207698_10767313 3300026142 Bacteria 964
679 Ga0207698_11141321 3300026142 Bacteria 793
680 Ga0207698_11479949 3300026142 Bacteria 694
681 Ga0209281_1000076 3300027111 Bacteria 263350
682 Ga0209389_1015795 3300027296 Bacteria 6855
683 Ga0209371_1009954 3300027312 Bacteria 2972
684 Ga0209995_1021109 3300027471 Bacteria 1079
685 Ga0209968_1000140 3300027526 Bacteria 12794
686 Ga0209968_1046312 3300027526 Bacteria 749
687 Ga0209970_1000593 3300027614 Bacteria 6304
688 Ga0209983_1034722 3300027665 Bacteria 1081
689 Ga0209966_1000388 3300027695 Bacteria 13148
690 Ga0209813_10075187 3300027866 Bacteria 1106
691 Ga0209974_10070507 3300027876 Bacteria 1192
692 Ga0268266_10005969 3300028379 Bacteria 11257
693 Ga0268265_10031835 3300028380 Bacteria 3813
694 Ga0268265_10196163 3300028380 Bacteria 1747
695 Ga0268265_10203267 3300028380 Bacteria 1720
696 Ga0268264_10001228 3300028381 Bacteria 24612
697 Ga0268264_10093598 3300028381 Bacteria 2596
698 Ga0268264_10179915 3300028381 Bacteria 1919
699 Ga0268264_10215157 3300028381 Bacteria 1766
700 Ga0268264_10229682 3300028381 Bacteria 1713
701 Ga0268264_10301245 3300028381 Bacteria 1509
702 Ga0265336_10000014 3300028666 Bacteria 241247
703 Ga0307517_10001591 3300028786 Bacteria 37812
704 Ga0307517_10085334 3300028786 Bacteria 2646
705 Ga0307517_10236485 3300028786 Bacteria 1089
706 Ga0307515_10000103 3300028794 Bacteria 198308
707 Ga0307515_10000184 3300028794 Bacteria 153952
708 Ga0307515_10001431 3300028794 Bacteria 53956
709 Ga0307515_10003451 3300028794 Bacteria 33263
710 Ga0307515_10020933 3300028794 Bacteria 11625
711 Ga0307515_10023725 3300028794 Bacteria 10733
712 Ga0307515_10025369 3300028794 Bacteria 10259
713 Ga0307515_10035551 3300028794 Bacteria 8099
714 Ga0307515_10049534 3300028794 Bacteria 6315
715 Ga0307515_10098333 3300028794 Bacteria 3565
716 Ga0307515_10200202 3300028794 Bacteria 1875
717 Ga0307515_10330553 3300028794 Bacteria 1183
718 Ga0265324_10006660 3300029957 Bacteria 4776
719 Ga0265324_10076828 3300029957 Bacteria 1136
720 Ga0268256_1010113 3300030500 Bacteria 3078
721 Ga0307511_10018336 3300030521 Bacteria 6690
722 Ga0307512_10051321 3300030522 Bacteria 3301
723 Ga0307512_10192219 3300030522 Bacteria 1123
724 Ga0307512_10262906 3300030522 Bacteria 845
725 Ga0265328_10010054 3300031239 Bacteria 3825
726 Ga0265328_10013329 3300031239 Bacteria 3256
727 Ga0265328_10013826 3300031239 Bacteria 3186
728 Ga0265331_10002534 3300031250 Bacteria 12300
729 Ga0265331_10032791 3300031250 Bacteria 2572
730 Ga0265327_10000028 3300031251 Bacteria 361066
731 Ga0265327_10000210 3300031251 Bacteria 122385
732 Ga0265316_10000005 3300031344 Bacteria 304442
733 Ga0307513_10003898 3300031456 Bacteria 20062
734 Ga0307513_10020866 3300031456 Bacteria 7752
735 Ga0307513_10043401 3300031456 Bacteria 4938
736 Ga0307513_10057848 3300031456 Bacteria 4126
737 Ga0307513_10068414 3300031456 Bacteria 3720
738 Ga0307513_10130643 3300031456 Bacteria 2458
739 Ga0307513_10202548 3300031456 Bacteria 1824
740 Ga0307513_10213771 3300031456 Bacteria 1757
741 Ga0307509_10002193 3300031507 Bacteria 32050
742 Ga0307509_10004459 3300031507 Bacteria 20160
743 Ga0307509_10020954 3300031507 Bacteria 7405
744 Ga0307509_10058153 3300031507 Bacteria 4095
745 Ga0307509_10063616 3300031507 Bacteria 3884
746 Ga0307509_10111788 3300031507 Bacteria 2733
747 Ga0307509_10148470 3300031507 Bacteria 2265
748 Ga0307509_10151843 3300031507 Bacteria 2230
749 Ga0307509_10248866 3300031507 Bacteria 1563
750 Ga0307509_10434212 3300031507 Bacteria 1011
751 Ga0307509_10523836 3300031507 Bacteria 866
752 Ga0307408_100000023 3300031548 Bacteria 295931
753 Ga0307408_100071579 3300031548 Bacteria 2564
754 Ga0307408_100096944 3300031548 Bacteria 2239
755 Ga0307408_100333780 3300031548 Bacteria 1281
756 Ga0307408_100379381 3300031548 Bacteria 1208
757 Ga0307408_100441135 3300031548 Bacteria 1127
758 Ga0307408_100480910 3300031548 Bacteria 1083
759 Ga0307508_10000368 3300031616 Bacteria 54659
760 Ga0307508_10001683 3300031616 Bacteria 24515
761 Ga0307508_10136626 3300031616 Bacteria 2055
762 Ga0307508_10213462 3300031616 Bacteria 1530
763 Ga0307514_10000711 3300031649 Bacteria 57628
764 Ga0307514_10001565 3300031649 Bacteria 27095
765 Ga0307514_10007399 3300031649 Bacteria 9463
766 Ga0307514_10013419 3300031649 Bacteria 6800
767 Ga0307514_10032642 3300031649 Bacteria 4163
768 Ga0307514_10078141 3300031649 Bacteria 2459
769 Ga0307514_10294174 3300031649 Bacteria 916
770 Ga0316579_10046081 3300031691 Bacteria 2034
771 Ga0307516_10003935 3300031730 Bacteria 18706
772 Ga0307516_10004098 3300031730 Bacteria 18219
773 Ga0307516_10004205 3300031730 Bacteria 17926
774 Ga0307516_10005073 3300031730 Bacteria 15928
775 Ga0307516_10074546 3300031730 Bacteria 3249
776 Ga0307516_10160134 3300031730 Bacteria 2002
777 Ga0307516_10163479 3300031730 Bacteria 1974
778 Ga0307516_10251108 3300031730 Bacteria 1463
779 Ga0307516_10433058 3300031730 Bacteria 972
780 Ga0307405_10007014 3300031731 Bacteria 5600
781 Ga0307405_10033534 3300031731 Bacteria 3047
782 Ga0307405_10135837 3300031731 Bacteria 1707
783 Ga0307405_10844576 3300031731 Bacteria 770
784 Ga0307405_10956282 3300031731 Bacteria 728
785 Ga0316577_10003732 3300031733 Bacteria 7749
786 Ga0316577_10387931 3300031733 Bacteria 793
787 Ga0307413_10156850 3300031824 Bacteria 1594
788 Ga0307413_10747516 3300031824 Bacteria 817
789 Ga0307410_10253681 3300031852 Bacteria 1369
790 Ga0307410_10456452 3300031852 Bacteria 1043
791 Ga0307406_10276559 3300031901 Bacteria 1278
792 Ga0307406_10614595 3300031901 Bacteria 898
793 Ga0307406_10721448 3300031901 Bacteria 834
794 Ga0307407_10277777 3300031903 Bacteria 1159
795 Ga0307412_10013904 3300031911 Bacteria 4732
796 Ga0307412_10025761 3300031911 Bacteria 3647
797 Ga0307412_10041419 3300031911 Bacteria 2985
798 Ga0307412_10171142 3300031911 Bacteria 1624
799 Ga0307412_10307831 3300031911 Bacteria 1255
800 Ga0307412_10970365 3300031911 Bacteria 749
801 Ga0307409_100002795 3300031995 Bacteria 9224
802 Ga0307409_100006577 3300031995 Bacteria 6851
803 Ga0307409_100449872 3300031995 Bacteria 1243
804 Ga0307416_100008008 3300032002 Bacteria 6769
805 Ga0307416_100175437 3300032002 Bacteria 2001
806 Ga0307416_100346440 3300032002 Bacteria 1501
807 Ga0307416_100972711 3300032002 Bacteria 951
808 Ga0307416_101051971 3300032002 Bacteria 918
809 Ga0307414_10105838 3300032004 Bacteria 2128
810 Ga0307414_10131771 3300032004 Bacteria 1942
811 Ga0307411_10021424 3300032005 Bacteria 3782
812 Ga0307411_10156766 3300032005 Bacteria 1699
813 Ga0307411_10189892 3300032005 Bacteria 1568
814 Ga0307411_10563882 3300032005 Bacteria 974
815 Ga0307415_100018631 3300032126 Bacteria 4197
816 Ga0307415_100306267 3300032126 Bacteria 1318
817 Ga0307507_10040160 3300033179 Bacteria 4706
818 Ga0307507_10098806 3300033179 Bacteria 2455
819 Ga0307510_10000290 3300033180 Bacteria 46315
820 Ga0307510_10017949 3300033180 Bacteria 8337
821 Ga0307510_10047591 3300033180 Bacteria 4592
822 Ga0307510_10071009 3300033180 Bacteria 3472
823 Ga0373948_0036937 3300034817 Bacteria 1008
824 Ga0373926_0076098 3300035083 Bacteria 1237
825 Ga0373929_0015023 3300035085 Bacteria 1502
826 Ga0373934_0023865 3300035086 Bacteria 2364
827 Ga0373944_0072545 3300035089 Bacteria 1124
828 Ga0373951_0005569 3300035091 Bacteria 2921
829 Ga0373923_0114744 3300035111 Bacteria 1199
830 Ga0373932_0040585 3300035112 Bacteria 1341
831 Ga0373936_0073989 3300035113 Bacteria 1409
832 Ga0373939_0000052 3300035114 Bacteria 40835
833 Ga0373945_0017131 3300035116 Bacteria 2452
834 Ga0373956_0130505 3300035119 Bacteria 1176
835 Ga0373960_0000046 3300035121 Bacteria 16294
836 Ga0373960_0071648 3300035121 Bacteria 1073
837 Ga0373943_0236197 3300035170 Bacteria 1023
838 Ga0373946_0028979 3300035171 Bacteria 2200
839 Ga0373955_0090201 3300035172 Bacteria 1746
840 Ga0373942_0112013 3300035207 Bacteria 845
841 Ga0373961_0067761 3300035241 Bacteria 1098
842 Ga0373962_0060676 3300035242 Bacteria 1110
843 Ga0316574_0225148 3300035398 Bacteria 1201
844 Ga0373924_0007452 3300035410 Bacteria 3953
845 Ga0373931_0000306 3300035691 Bacteria 20645
846 Ga0373931_0005476 3300035691 Bacteria 5877
847 Ga0373931_0022624 3300035691 Bacteria 3165
848 Ga0373931_0051848 3300035691 Bacteria 2186
849 Ga0373931_0108561 3300035691 Bacteria 1571
850 Ga0373947_0062559 3300035725 Bacteria 2265
851 Ga0373947_0073103 3300035725 Bacteria 2107
852 Ga0373937_0635691 3300036401 Bacteria 1012
853 Ga0373937_0760290 3300036401 Bacteria 916
854 Ga0316584_0343258 3300036712 Bacteria 1073
855 Ga0373925_0014193 3300037068 Bacteria 5764
856 Ga0395899_0055205 3300037312 Bacteria 2939
857 Ga0395900_0000234 3300037418 Bacteria 87083
858 Ga0395898_0002077 3300037466 Bacteria 24918
859 Ga0395898_0038952 3300037466 Bacteria 4707
860 Ga0395898_0458094 3300037466 Bacteria 1214
861 Ga0395905_0000071 3300037471 Bacteria 174580
862 Ga0395905_0003377 3300037471 Bacteria 17102
863 Ga0395905_0003411 3300037471 Bacteria 17002
864 Ga0395905_0013883 3300037471 Bacteria 7706
865 Ga0395905_0023686 3300037471 Bacteria 5796
866 Ga0395905_0098886 3300037471 Bacteria 2740
867 Ga0395905_0252928 3300037471 Bacteria 1646
868 Ga0395905_0297698 3300037471 Bacteria 1500
869 Ga0395901_0765087 3300038443 Bacteria 958
870 Ga0436361_0443798 3300039447 Bacteria 17914
871 Ga0436361_0530495 3300039447 Bacteria 101563
872 Ga0436361_0714096 3300039447 Bacteria 3648
873 Ga0436361_0735085 3300039447 Bacteria 1764
874 Ga0436361_0736070 3300039447 Bacteria 84726
875 Ga0436361_0886712 3300039447 Bacteria 114879
876 Ga0436361_1123281 3300039447 Bacteria 2099
877 Ga0436361_1146345 3300039447 Bacteria 5179
878 Ga0436363_0219629 3300039450 Bacteria 2266
879 Ga0439461_0003089 3300041410 Bacteria 2715
880 Ga0451795_1122439 3300041456 Bacteria 859
881 Ga0451800_0728199 3300041459 Bacteria 2366
882 Ga0451800_1277183 3300041459 Bacteria 1987
883 Ga0451804_0008258 3300041463 Bacteria 1460
884 Ga0451804_0650180 3300041463 Bacteria 2010
885 Ga0451841_0251967 3300041498 Bacteria 1323
886 Ga0451845_0255285 3300041501 Bacteria 668
887 Ga0451855_1813671 3300041511 Bacteria 1097
888 Ga0451853_3187860 3300041512 Bacteria 1303
889 Ga0439431_0037467 3300041997 Bacteria 1224
890 Ga0439437_000789 3300042000 Bacteria 3242
891 Ga0439445_0002228 3300042004 Bacteria 4302
892 Ga0439448_0023434 3300042005 Bacteria 1926
893 Ga0439449_0092752 3300042007 Bacteria 1115
894 Ga0439454_000320 3300042011 Bacteria 3615
895 Ga0439455_0073873 3300042012 Bacteria 919
896 Ga0450911_000798 3300042115 Bacteria 8724
897 Ga0450917_000257 3300042120 Bacteria 3909
898 Ga0450920_006579 3300042122 Bacteria 2093
899 Ga0450888_009728 3300042126 Bacteria 1103
900 Ga0450890_000264 3300042127 Bacteria 7731
901 Ga0450891_000152 3300042129 Bacteria 6473
902 Ga0450892_003518 3300042130 Bacteria 1284
903 Ga0450898_014614 3300042134 Bacteria 1322
904 Ga0450902_002830 3300042137 Bacteria 2486
905 Ga0450903_012132 3300042138 Bacteria 1379
906 Ga0439446_0048361 3300042156 Bacteria 1266
907 Ga0439446_0063298 3300042156 Bacteria 1121
908 Ga0450909_041080 3300042185 Bacteria 712
909 Ga0439459_0008070 3300042438 Bacteria 1791
910 Ga0439464_0008819 3300042439 Bacteria 2644
911 Ga0439464_0089683 3300042439 Bacteria 926
912 Ga0439464_0113386 3300042439 Bacteria 831
913 Ga0450916_000178 3300042530 Bacteria 4750
914 Ga0450918_001808 3300042531 Bacteria 4168
915 Ga0450893_0015032 3300042532 Bacteria 1303
916 Ga0451577_0000303 3300042876 Bacteria 95840
917 Ga0451577_0002225 3300042876 Bacteria 23610
918 Ga0451577_0003841 3300042876 Bacteria 16330
919 Ga0451577_0004580 3300042876 Bacteria 14527
920 Ga0451577_0005835 3300042876 Bacteria 12457
921 Ga0451577_0013164 3300042876 Bacteria 7752
922 Ga0451577_0019759 3300042876 Bacteria 6190
923 Ga0451577_0022062 3300042876 Bacteria 5817
924 Ga0451577_0032453 3300042876 Bacteria 4704
925 Ga0451577_0411673 3300042876 Bacteria 1227
926 Ga0466969_0000028 3300044656 Bacteria 92394
927 Ga0466969_0008493 3300044656 Bacteria 5448
928 Ga0466969_0035623 3300044656 Bacteria 2516
929 Ga0466969_0038616 3300044656 Bacteria 2401
930 Ga0466972_0006558 3300044658 Bacteria 5849
931 Ga0466972_0136163 3300044658 Bacteria 1156
932 Ga0453683_0015947 3300044673 Bacteria 4855
933 Ga0453683_0169899 3300044673 Bacteria 1381
934 Ga0453683_0292855 3300044673 Bacteria 1041
935 Ga0453683_0361107 3300044673 Bacteria 934
936 Ga0453683_0366974 3300044673 Bacteria 926
937 Ga0466965_0003252 3300044683 Bacteria 7106
938 Ga0466965_0030115 3300044683 Bacteria 2643
939 Ga0466965_0340859 3300044683 Bacteria 819
940 Ga0466966_0005301 3300044684 Bacteria 8478
941 Ga0466966_0051843 3300044684 Bacteria 2607
942 Ga0466966_0087476 3300044684 Bacteria 1936
943 Ga0466961_0003217 3300044693 Bacteria 10163
944 Ga0466961_0004039 3300044693 Bacteria 9196
945 Ga0466961_0019292 3300044693 Bacteria 4387
946 Ga0466961_0273075 3300044693 Bacteria 1035
947 Ga0466963_0000935 3300044694 Bacteria 14918
948 Ga0466963_0236218 3300044694 Bacteria 1281
949 Ga0466964_0024421 3300044706 Bacteria 2355
950 Ga0453684_0000055 3300044712 Bacteria 532014
951 Ga0453684_0000142 3300044712 Bacteria 316405
952 Ga0453684_0000947 3300044712 Bacteria 95768
953 Ga0453684_0006446 3300044712 Bacteria 22283
954 Ga0453684_0047779 3300044712 Bacteria 5671
955 Ga0453684_0056165 3300044712 Bacteria 5109
956 Ga0453684_0059806 3300044712 Bacteria 4908
957 Ga0453684_0072820 3300044712 Bacteria 4335
958 Ga0453684_0110760 3300044712 Bacteria 3336
959 Ga0453684_0308604 3300044712 Unclassified 1796
960 Ga0453684_0331179 3300044712 Bacteria 1722
961 Ga0466971_0005541 3300044719 Bacteria 5483
962 Ga0466971_0168982 3300044719 Bacteria 1025
963 Ga0466968_0019767 3300044735 Bacteria 2714
964 Ga0466968_0061625 3300044735 Bacteria 1618
965 Ga0466970_0015254 3300044765 Bacteria 3950
966 Ga0466957_0007668 3300044842 Bacteria 6104
967 Ga0466957_0022945 3300044842 Bacteria 3684
968 Ga0466960_0005647 3300044901 Bacteria 4965
969 Ga0466960_0076434 3300044901 Bacteria 1677
970 Ga0466960_0084285 3300044901 Bacteria 1608
971 Ga0466960_0256171 3300044901 Bacteria 973
972 Ga0466959_0001550 3300045049 Bacteria 14139
973 Ga0466959_0037485 3300045049 Bacteria 3582
974 Ga0466959_0686504 3300045049 Bacteria 686
975 Ga0451576_0000880 3300045051 Bacteria 57256
976 Ga0451576_0003317 3300045051 Bacteria 22316
977 Ga0451576_0007754 3300045051 Bacteria 12747
978 Ga0451576_0021518 3300045051 Bacteria 7010
979 Ga0451576_0072377 3300045051 Bacteria 3587
980 Ga0451576_0366908 3300045051 Bacteria 1508
981 Ga0451576_0636493 3300045051 Bacteria 1120
982 Ga0466958_0015363 3300045836 Bacteria 4386
983 Ga0466958_0023688 3300045836 Bacteria 3606
984 Ga0466958_0382727 3300045836 Bacteria 907
985 Ga0466967_0021184 3300045976 Bacteria 5272
986 Ga0466967_0076045 3300045976 Bacteria 3019
987 Ga0495592_0000758 3300046454 Bacteria 22458
988 Ga0495592_0423289 3300046454 Bacteria 839
989 Ga0495590_0004523 3300046457 Bacteria 5604
990 Ga0495629_0058817 3300046459 Bacteria 2687
991 Ga0495629_0170766 3300046459 Bacteria 1509
992 Ga0495638_0078801 3300046460 Bacteria 2004
993 Ga0495651_0223717 3300046462 Bacteria 1301
994 Ga0495650_0018864 3300046471 Bacteria 3416
995 Ga0495650_0052598 3300046471 Bacteria 1671
996 Ga0495580_0028564 3300046472 Bacteria 4054
997 Ga0495580_0403708 3300046472 Bacteria 921
998 Ga0495639_0188546 3300046475 Bacteria 1006
999 Ga0495662_0172547 3300046476 Bacteria 1066
1000 Ga0495585_0009636 3300046492 Bacteria 5783
1001 Ga0495583_0000350 3300046506 Bacteria 72716
1002 Ga0495606_0004217 3300046507 Bacteria 14547
1003 Ga0495606_0319309 3300046507 Bacteria 835
1004 Ga0495610_0120867 3300046512 Bacteria 1148
1005 Ga0495610_0132414 3300046512 Bacteria 1081
1006 Ga0495610_0219234 3300046512 Bacteria 769
1007 Ga0495620_0066992 3300046515 Bacteria 1478
1008 Ga0495628_0096500 3300046516 Bacteria 2284
1009 Ga0495630_0178524 3300046517 Bacteria 1619
1010 Ga0495632_0004044 3300046519 Bacteria 10121
1011 Ga0495632_0025809 3300046519 Bacteria 3103
1012 Ga0495632_0058581 3300046519 Bacteria 1876
1013 Ga0495632_0096251 3300046519 Bacteria 1398
1014 Ga0495643_0125248 3300046522 Bacteria 1294
1015 Ga0495648_0100293 3300046524 Bacteria 1600
1016 Ga0495666_0094779 3300046526 Bacteria 1408
1017 Ga0495652_0226567 3300046529 Bacteria 1401
1018 Ga0495654_0002282 3300046530 Bacteria 12409
1019 Ga0495586_0062991 3300046535 Bacteria 2019
1020 Ga0495598_0055036 3300046537 Bacteria 1210
1021 Ga0495621_0003869 3300046539 Bacteria 4159
1022 Ga0495597_0027211 3300046542 Bacteria 2623
1023 Ga0495597_0073969 3300046542 Bacteria 1464
1024 Ga0495597_0122298 3300046542 Bacteria 1084
1025 Ga0495597_0134519 3300046542 Bacteria 1023
1026 Ga0495645_0161563 3300046543 Bacteria 1548
1027 Ga0495645_0297267 3300046543 Bacteria 1056
1028 Ga0495622_0258499 3300046557 Bacteria 765
1029 Ga0495633_0164056 3300046558 Bacteria 1025
1030 Ga0495656_0324462 3300046615 Bacteria 794
1031 Ga0495668_0082116 3300046616 Bacteria 1768
1032 Ga0495668_0228685 3300046616 Bacteria 1018
1033 Ga0495634_0182064 3300046642 Bacteria 1315
1034 Ga0495625_0002284 3300046660 Bacteria 21038
1035 Ga0495625_0005026 3300046660 Bacteria 12271
1036 Ga0495625_0018498 3300046660 Bacteria 5438
1037 Ga0495625_0158084 3300046660 Bacteria 1520
1038 Ga0495661_0180834 3300046665 Bacteria 1118
1039 Ga0495646_0134148 3300046680 Bacteria 1391
1040 Ga0495647_0036783 3300046681 Bacteria 1844
1041 Ga0495647_0055813 3300046681 Bacteria 1547
1042 Ga0495658_0009721 3300046683 Bacteria 4795
1043 Ga0495658_0024713 3300046683 Bacteria 3203
1044 Ga0495658_0079957 3300046683 Bacteria 1916
1045 Ga0495658_0118772 3300046683 Bacteria 1597
1046 Ga0495658_0206270 3300046683 Bacteria 1226
1047 Ga0495669_0005767 3300046684 Bacteria 5164
1048 Ga0495624_0144328 3300046690 Bacteria 1457
1049 Ga0495670_0016246 3300046691 Bacteria 3658
1050 Ga0495670_0243320 3300046691 Bacteria 958
1051 Ga0495671_0318594 3300046692 Bacteria 747
1052 Ga0495649_0000845 3300046694 Bacteria 24600
1053 Ga0495589_0010997 3300046794 Bacteria 4698
1054 Ga0495600_0228715 3300046809 Bacteria 1188
1055 Ga0495660_0034083 3300046810 Bacteria 2851
1056 Ga0495660_0055072 3300046810 Bacteria 2154
1057 Ga0495674_0141275 3300047319 Bacteria 2024
1058 Ga0495676_0201211 3300047321 Bacteria 1384
1059 Ga0495687_000914 3300047443 Bacteria 30754
1060 Ga0495687_022484 3300047443 Bacteria 3026
1061 Ga0495673_0097251 3300047469 Bacteria 1195
1062 Ga0495684_0281050 3300047471 Bacteria 1201
1063 Ga0495684_0441577 3300047471 Bacteria 906
1064 Ga0495686_0002064 3300047472 Bacteria 19764
1065 Ga0495686_0036043 3300047472 Bacteria 3175
1066 Ga0495686_0293870 3300047472 Bacteria 899
1067 Ga0495614_0076511 3300048089 Bacteria 1447
1068 Ga0496100_0105749 3300048903 Bacteria 1947
1069 Ga0496101_0193368 3300048904 Bacteria 1571
1070 Ga0496101_0491013 3300048904 Bacteria 970
1071 Ga0496102_0018809 3300048905 Bacteria 6076
1072 Ga0496102_0029296 3300048905 Bacteria 4926
1073 Ga0496102_0087881 3300048905 Bacteria 2872
1074 Ga0496104_0196556 3300048907 Bacteria 1929
1075 Ga0496104_0199179 3300048907 Bacteria 1915
1076 Ga0496104_0206468 3300048907 Bacteria 1876
1077 Ga0496104_0521547 3300048907 Bacteria 1099
1078 Ga0496105_0040297 3300048908 Bacteria 3851
1079 Ga0496105_0066776 3300048908 Bacteria 2970
1080 Ga0496105_0664932 3300048908 Bacteria 803
1081 Ga0496106_0002082 3300048909 Bacteria 14992
1082 Ga0496106_0011064 3300048909 Bacteria 6670
1083 Ga0496106_0364633 3300048909 Bacteria 1161
1084 Ga0496107_0058705 3300048910 Bacteria 2782
1085 Ga0496108_0308711 3300048911 Bacteria 1378
1086 Ga0496109_0031899 3300048912 Bacteria 4733
1087 Ga0496109_0172715 3300048912 Bacteria 2028
1088 Ga0496109_0191070 3300048912 Bacteria 1924
1089 Ga0496109_0392819 3300048912 Bacteria 1311
1090 Ga0496110_0037484 3300048913 Bacteria 4214
1091 Ga0496110_0105616 3300048913 Bacteria 2527
1092 Ga0496110_0984120 3300048913 Bacteria 751
1093 Ga0496111_0175235 3300048914 Bacteria 1594
1094 Ga0496112_0011296 3300048915 Bacteria 8147
1095 Ga0496112_0148171 3300048915 Bacteria 2315
1096 Ga0496113_0184490 3300048916 Bacteria 1654
1097 Ga0496113_0436649 3300048916 Bacteria 1052
1098 Ga0496114_0004709 3300048917 Bacteria 10616
1099 Ga0496114_0118552 3300048917 Bacteria 2274
1100 Ga0496114_0120807 3300048917 Bacteria 2253
1101 Ga0496114_0249630 3300048917 Bacteria 1561
1102 Ga0496115_0007508 3300048918 Bacteria 8026
1103 Ga0496118_0065767 3300048921 Bacteria 2651
1104 Ga0496121_0017965 3300048924 Bacteria 7170
1105 Ga0496122_0130111 3300048925 Bacteria 1602
1106 Ga0496122_0164935 3300048925 Bacteria 1345
1107 Ga0496124_0001253 3300048927 Bacteria 38792
1108 Ga0496124_0024540 3300048927 Bacteria 5478
1109 Ga0496124_0165397 3300048927 Bacteria 1720
1110 Ga0496125_0033740 3300048928 Bacteria 4523
1111 Ga0496125_0042673 3300048928 Bacteria 3860
1112 Ga0496125_0086553 3300048928 Bacteria 2369
1113 Ga0496125_0179123 3300048928 Bacteria 1415
1114 Ga0496126_0034601 3300048929 Bacteria 4744
1115 Ga0501292_003863 3300049515 Bacteria 2023
1116 Ga0501297_000622 3300049520 Bacteria 3197
1117 Ga0501298_021543 3300049521 Bacteria 1208
1118 Ga0501303_005764 3300049526 Bacteria 1065
1119 Ga0501032_0222241 3300049569 Bacteria 1229
1120 Ga0501034_0038599 3300049571 Bacteria 4836
1121 Ga0501036_0154458 3300049572 Bacteria 1936
1122 Ga0501043_0005029 3300049579 Bacteria 10700
1123 Ga0501046_0006030 3300049580 Bacteria 10778
1124 Ga0501046_0470263 3300049580 Bacteria 903
1125 Ga0501047_0000069 3300049581 Bacteria 129231
1126 Ga0501047_0538719 3300049581 Bacteria 992
1127 Ga0501048_0051092 3300049582 Bacteria 2943
1128 Ga0501048_0192413 3300049582 Bacteria 1446
1129 Ga0501072_0488323 3300049588 Bacteria 974
1130 Ga0501076_0558951 3300049592 Bacteria 944
1131 Ga0501076_0739502 3300049592 Bacteria 812
1132 Ga0501198_000014 3300049649 Bacteria 106940
1133 Ga0501206_003976 3300049653 Bacteria 1879
1134 Ga0501207_027951 3300049654 Bacteria 936
1135 Ga0501208_050179 3300049655 Bacteria 794
1136 Ga0501211_000534 3300049658 Bacteria 3728
1137 Ga0501222_000008 3300049662 Bacteria 120904
1138 Ga0501222_019566 3300049662 Bacteria 904
1139 Ga0501227_012640 3300049665 Bacteria 1851
1140 Ga0501233_004919 3300049668 Bacteria 2469
1141 Ga0501235_057419 3300049669 Bacteria 909
1142 Ga0501252_012540 3300049682 Bacteria 1027
1143 Ga0501253_000616 3300049683 Bacteria 3160
1144 Ga0501253_073368 3300049683 Bacteria 760
1145 Ga0501257_005139 3300049686 Bacteria 2880
1146 Ga0501257_038050 3300049686 Bacteria 1175
1147 Ga0501259_055906 3300049688 Bacteria 813
1148 Ga0501221_001653 3300049704 Bacteria 3699
1149 Ga0501079_0882934 3300049741 Bacteria 704
1150 Ga0501232_000918 3300049757 Bacteria 2176
1151 Ga0501262_004308 3300049759 Bacteria 1651
1152 Ga0501265_003041 3300049762 Bacteria 1907
1153 Ga0501265_027412 3300049762 Bacteria 803
1154 Ga0501272_012285 3300049769 Bacteria 972
1155 Ga0501273_018490 3300049770 Bacteria 928
1156 Ga0501035_0102307 3300049822 Bacteria 2513
1157 Ga0501035_0426257 3300049822 Bacteria 1101
1158 Ga0501045_0066678 3300049824 Bacteria 2642
1159 Ga0501226_007204 3300049853 Bacteria 1250
1160 nmdc:mga03683_125525_c1 3300050489 Bacteria 1144
1161 nmdc:mga03683_20583_c1 3300050489 Bacteria 2533
1162 nmdc:mga03683_2130_c1 3300050489 Bacteria 6101
1163 nmdc:mga03683_221524_c1 3300050489 Bacteria 873
1164 nmdc:mga03683_3440_c1 3300050489 Bacteria 5110
1165 nmdc:mga03683_48243_c1 3300050489 Bacteria 1769
1166 nmdc:mga03n38_158500_c1 3300050490 Bacteria 1144
1167 nmdc:mga03n38_53897_c1 3300050490 Bacteria 1806
1168 nmdc:mga03n38_9279_c1 3300050490 Bacteria 3570
1169 nmdc:mga00v17_15606_c1 3300050491 Bacteria 4265
1170 nmdc:mga00v17_55125_c1 3300050491 Bacteria 2427
1171 nmdc:mga0yw44_117492_c1 3300050492 Bacteria 1710
1172 nmdc:mga0k408_11201_c1 3300050493 Bacteria 4876
1173 nmdc:mga0k408_139607_c1 3300050493 Bacteria 1441
1174 nmdc:mga0k408_162371_c1 3300050493 Bacteria 1331
1175 nmdc:mga0k408_18066_c1 3300050493 Bacteria 3932
1176 nmdc:mga0k408_1823_c1 3300050493 Bacteria 11436
1177 nmdc:mga0k408_2121_c1 3300050493 Bacteria 10627
1178 nmdc:mga0k408_247862_c1 3300050493 Bacteria 1064
1179 nmdc:mga0k408_2568_c1 3300050493 Bacteria 9636
1180 nmdc:mga0k408_3529_c1 3300050493 Bacteria 8261
1181 nmdc:mga0k408_3796_c1 3300050493 Bacteria 8005
1182 nmdc:mga0k408_395218_c1 3300050493 Bacteria 823
1183 nmdc:mga0k408_431352_c1 3300050493 Bacteria 783
1184 nmdc:mga0k408_478719_c1 3300050493 Bacteria 738
1185 nmdc:mga0k408_5099_c1 3300050493 Bacteria 6957
1186 nmdc:mga0k408_65024_c1 3300050493 Bacteria 2123
1187 nmdc:mga0k408_69910_c1 3300050493 Bacteria 2049
1188 nmdc:mga0k408_81526_c1 3300050493 Bacteria 1895
1189 nmdc:mga0k408_97350_c1 3300050493 Bacteria 1733
1190 nmdc:mga06z11_21621_c1 3300050494 Bacteria 2992
1191 nmdc:mga06z11_23705_c1 3300050494 Bacteria 2887
1192 nmdc:mga06z11_33392_c1 3300050494 Bacteria 2517
1193 nmdc:mga04h51_122173_c1 3300050495 Bacteria 971
1194 nmdc:mga04h51_16186_c1 3300050495 Bacteria 2162
1195 nmdc:mga07m45_109980_c1 3300050496 Bacteria 1587
1196 nmdc:mga07m45_13565_c1 3300050496 Bacteria 4328
1197 nmdc:mga07m45_1396_c1 3300050496 Bacteria 11033
1198 nmdc:mga07m45_149384_c1 3300050496 Bacteria 1355
1199 nmdc:mga07m45_16974_c1 3300050496 Bacteria 3903
1200 nmdc:mga07m45_169790_c1 3300050496 Bacteria 1268
1201 nmdc:mga07m45_17516_c1 3300050496 Bacteria 1557
1202 nmdc:mga07m45_4379_c1 3300050496 Bacteria 6912
1203 nmdc:mga07m45_703_c1 3300050496 Bacteria 10085
1204 nmdc:mga07m45_8060_c1 3300050496 Bacteria 5401
1205 nmdc:mga07m45_8068_c1 3300050496 Bacteria 5399
1206 nmdc:mga05p37_604576_c1 3300050507 Bacteria 1237
1207 nmdc:mga09592_14154_c1 3300050508 Bacteria 6507
1208 nmdc:mga0n895_1021423_c1 3300050512 Bacteria 807
1209 nmdc:mga08x19_441838_c1 3300050514 Bacteria 915
1210 nmdc:mga0sz30_24868_c1 3300050516 Bacteria 2447
1211 nmdc:mga0sz30_44355_c1 3300050516 Bacteria 1873
1212 Ga0495601_0156675 3300053077 Bacteria 1487
1213 Ga0495601_0252829 3300053077 Bacteria 1151
1214 Ga0495612_0179828 3300053078 Bacteria 928
1215 Ga0500635_0000686 3300053080 Bacteria 8572
1216 Ga0500635_0006628 3300053080 Bacteria 3100
1217 Ga0495595_0151240 3300053084 Bacteria 1142
1218 Ga0495619_0020424 3300053085 Bacteria 4218
1219 Ga0500578_0000006 3300053086 Bacteria 234598
1220 Ga0500643_078193 3300053087 Bacteria 911
1221 Ga0500644_0022077 3300053088 Bacteria 1915
1222 Ga0500644_0099687 3300053088 Bacteria 1102
1223 Ga0500644_0110844 3300053088 Bacteria 1057
1224 Ga0500583_0194321 3300053092 Bacteria 1009
1225 Ga0500651_0004274 3300053093 Bacteria 7979
1226 Ga0500651_0030735 3300053093 Bacteria 3381
1227 Ga0500651_0066076 3300053093 Bacteria 2253
1228 Ga0500650_0139028 3300053098 Bacteria 1126
1229 Ga0500562_014154 3300053108 Bacteria 2042
1230 Ga0500562_017531 3300053108 Bacteria 1847
1231 Ga0500569_030765 3300053109 Bacteria 1505
1232 Ga0500593_001497 3300053117 Bacteria 8383
1233 Ga0500593_057174 3300053117 Bacteria 1721
1234 Ga0500593_171330 3300053117 Bacteria 817
1235 Ga0500594_0004520 3300053118 Bacteria 3067
1236 Ga0500607_183554 3300053121 Bacteria 924
1237 Ga0500623_080702 3300053127 Bacteria 1548
1238 Ga0500628_033577 3300053129 Bacteria 1129
1239 Ga0500642_0002917 3300053130 Bacteria 5088
1240 Ga0500652_000046 3300053131 Bacteria 58476
1241 Ga0500652_024874 3300053131 Bacteria 2290
1242 Ga0500655_004813 3300053133 Bacteria 2429
1243 Ga0500658_0001688 3300053134 Bacteria 8752
1244 Ga0500559_0000717 3300053136 Bacteria 21775
1245 Ga0500561_0011034 3300053137 Bacteria 1888
1246 Ga0500568_0009618 3300053139 Bacteria 4580
1247 Ga0500568_0013406 3300053139 Bacteria 3738
1248 Ga0500577_0004010 3300053142 Bacteria 3856
1249 Ga0500588_0014459 3300053146 Bacteria 2001
1250 Ga0500590_004936 3300053148 Bacteria 6373
1251 Ga0500604_0004410 3300053151 Bacteria 3737
1252 Ga0500622_0000415 3300053156 Bacteria 40612
1253 Ga0500622_0004562 3300053156 Bacteria 8637
1254 Ga0500622_0009199 3300053156 Bacteria 5483
1255 Ga0500622_0156237 3300053156 Bacteria 1073
1256 Ga0500622_0172818 3300053156 Bacteria 1004
1257 Ga0500636_0011589 3300053177 Bacteria 5162
1258 Ga0500587_000461 3300053739 Bacteria 4841
1259 Ga0500587_005832 3300053739 Bacteria 1647
1260 Ga0590071_013876 3300059421 Bacteria 1888
1261 Ga0590075_001938 3300059424 Bacteria 5006
1262 Ga0501082_0289178 3300060353 Bacteria 1427
1263 Ga0466962_0004095 3300061719 Bacteria 6983
1264 Ga0466962_0017132 3300061719 Bacteria 3490

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2919704043 2919706921 205
2 3300048915 Ga0496112_0148171 Ga0496112_0148171_1065_1685 206
3 iso_pu_bacteria 2643221660 2644340939 206
4 3300035121 Ga0373960_0071648 Ga0373960_0071648_105_728 207
5 3300035398 Ga0316574_0225148 Ga0316574_0225148_486_1178 207
6 3300042876 Ga0451577_0005835 Ga0451577_0005835_3916_4545 207
7 3300044673 Ga0453683_0366974 Ga0453683_0366974_281_910 207
8 3300046535 Ga0495586_0062991 Ga0495586_0062991_1352_1999 207
9 3300049582 Ga0501048_0192413 Ga0501048_0192413_255_881 207
10 iso_pu_bacteria 2643221544 2643743892 207
11 iso_pu_bacteria 2643221585 2643933060 207
12 iso_pu_bacteria 2643221639 2644217202 207
13 iso_pu_bacteria 2643221646 2644259028 207
14 iso_pu_bacteria 2643221654 2644302785 207
15 iso_pu_bacteria 2643221656 2644314309 207
16 iso_pu_bacteria 2738541337 2739055769 207
17 3300013296 Ga0157374_10000271 Ga0157374_100002712 208
18 3300031250 Ga0265331_10032791 Ga0265331_100327912 208
19 3300034817 Ga0373948_0036937 Ga0373948_0036937_21_653 208
20 3300035691 Ga0373931_0108561 Ga0373931_0108561_346_978 208
21 3300044712 Ga0453684_0000142 Ga0453684_0000142_48462_49097 208
22 3300045051 Ga0451576_0072377 Ga0451576_0072377_184_816 208
23 iso_pu_bacteria 2585428057 2587730781 208
24 iso_pu_bacteria 2585428058 2587737201 208
25 iso_pu_bacteria 2585428062 2587756151 208
26 iso_pu_bacteria 2588253510 2588295770 208
27 iso_pu_bacteria 2643221592 2643966934 208
28 iso_pu_bacteria 2643221644 2644248177 208
29 iso_pu_bacteria 2643221648 2644273628 208
30 iso_pu_bacteria 2831864461 2831866096 208
31 iso_pu_bacteria 2886848708 2886852830 208
32 3300005333 Ga0070677_10014841 Ga0070677_100148413 209
33 3300005353 Ga0070669_100015642 Ga0070669_1000156426 209
34 3300005353 Ga0070669_100455382 Ga0070669_1004553822 209
35 3300005354 Ga0070675_100036889 Ga0070675_1000368893 209
36 3300005355 Ga0070671_100002511 Ga0070671_10000251118 209
37 3300005356 Ga0070674_100429687 Ga0070674_1004296872 209
38 3300005364 Ga0070673_100090098 Ga0070673_1000900982 209
39 3300005456 Ga0070678_100112182 Ga0070678_1001121823 209
40 3300005456 Ga0070678_100475515 Ga0070678_1004755152 209
41 3300005543 Ga0070672_100043657 Ga0070672_1000436572 209
42 3300005618 Ga0068864_100178778 Ga0068864_1001787782 209
43 3300005618 Ga0068864_100717192 Ga0068864_1007171922 209
44 3300005843 Ga0068860_100248051 Ga0068860_1002480513 209
45 3300006353 Ga0075370_10055486 Ga0075370_100554861 209
46 3300009177 Ga0105248_10004768 Ga0105248_100047689 209
47 3300012512 Ga0157327_1019006 Ga0157327_10190061 209
48 3300014326 Ga0157380_10223993 Ga0157380_102239932 209
49 3300025923 Ga0207681_10125073 Ga0207681_101250732 209
50 3300025923 Ga0207681_10615744 Ga0207681_106157442 209
51 3300025931 Ga0207644_10049492 Ga0207644_100494923 209
52 3300025937 Ga0207669_10542214 Ga0207669_105422142 209
53 3300025940 Ga0207691_10057939 Ga0207691_100579392 209
54 3300025941 Ga0207711_10142124 Ga0207711_101421242 209
55 3300025960 Ga0207651_10060252 Ga0207651_100602522 209
56 3300025972 Ga0207668_10055113 Ga0207668_100551132 209
57 3300026088 Ga0207641_10109722 Ga0207641_101097223 209
58 3300026095 Ga0207676_10088207 Ga0207676_100882072 209
59 3300026095 Ga0207676_10247857 Ga0207676_102478572 209
60 3300027471 Ga0209995_1021109 Ga0209995_10211091 209
61 3300027526 Ga0209968_1000140 Ga0209968_10001406 209
62 3300027526 Ga0209968_1046312 Ga0209968_10463121 209
63 3300027614 Ga0209970_1000593 Ga0209970_10005935 209
64 3300027665 Ga0209983_1034722 Ga0209983_10347222 209
65 3300027695 Ga0209966_1000388 Ga0209966_100038811 209
66 3300028381 Ga0268264_10229682 Ga0268264_102296822 209
67 3300028794 Ga0307515_10003451 Ga0307515_1000345111 209
68 3300028794 Ga0307515_10049534 Ga0307515_100495342 209
69 3300030522 Ga0307512_10192219 Ga0307512_101922192 209
70 3300031239 Ga0265328_10013329 Ga0265328_100133294 209
71 3300031239 Ga0265328_10013826 Ga0265328_100138262 209
72 3300031251 Ga0265327_10000210 Ga0265327_1000021073 209
73 3300031344 Ga0265316_10000005 Ga0265316_10000005136 209
74 3300031456 Ga0307513_10043401 Ga0307513_100434018 209
75 3300031456 Ga0307513_10130643 Ga0307513_101306432 209
76 3300031507 Ga0307509_10151843 Ga0307509_101518431 209
77 3300031548 Ga0307408_100379381 Ga0307408_1003793812 209
78 3300031649 Ga0307514_10000711 Ga0307514_1000071144 209
79 3300031691 Ga0316579_10046081 Ga0316579_100460812 209
80 3300031730 Ga0307516_10004205 Ga0307516_100042056 209
81 3300031731 Ga0307405_10033534 Ga0307405_100335342 209
82 3300031733 Ga0316577_10003732 Ga0316577_100037327 209
83 3300031733 Ga0316577_10387931 Ga0316577_103879311 209
84 3300031901 Ga0307406_10614595 Ga0307406_106145951 209
85 3300031911 Ga0307412_10041419 Ga0307412_100414192 209
86 3300031995 Ga0307409_100449872 Ga0307409_1004498722 209
87 3300032005 Ga0307411_10189892 Ga0307411_101898923 209
88 3300033180 Ga0307510_10071009 Ga0307510_100710095 209
89 3300036712 Ga0316584_0343258 Ga0316584_0343258_104_766 209
90 3300037471 Ga0395905_0003411 Ga0395905_0003411_12099_12728 209
91 3300038443 Ga0395901_0765087 Ga0395901_0765087_34_663 209
92 3300041459 Ga0451800_1277183 Ga0451800_1277183_29_658 209
93 3300042004 Ga0439445_0002228 Ga0439445_0002228_572_1201 209
94 3300042115 Ga0450911_000798 Ga0450911_000798_4807_5436 209
95 3300042876 Ga0451577_0000303 Ga0451577_0000303_65411_66040 209
96 3300042876 Ga0451577_0013164 Ga0451577_0013164_254_925 209
97 3300042876 Ga0451577_0032453 Ga0451577_0032453_3889_4518 209
98 3300044673 Ga0453683_0015947 Ga0453683_0015947_2170_2799 209
99 3300044712 Ga0453684_0000055 Ga0453684_0000055_358175_358846 209
100 3300044712 Ga0453684_0000947 Ga0453684_0000947_29801_30430 209
101 3300044712 Ga0453684_0056165 Ga0453684_0056165_41_670 209
102 3300045051 Ga0451576_0000880 Ga0451576_0000880_28103_28732 209
103 3300045051 Ga0451576_0003317 Ga0451576_0003317_15551_16180 209
104 3300046530 Ga0495654_0002282 Ga0495654_0002282_3468_4097 209
105 3300046539 Ga0495621_0003869 Ga0495621_0003869_3505_4137 209
106 3300046542 Ga0495597_0122298 Ga0495597_0122298_395_1024 209
107 3300048904 Ga0496101_0491013 Ga0496101_0491013_131_760 209
108 3300048907 Ga0496104_0196556 Ga0496104_0196556_532_1161 209
109 3300048908 Ga0496105_0066776 Ga0496105_0066776_1873_2502 209
110 3300048912 Ga0496109_0031899 Ga0496109_0031899_1890_2519 209
111 3300048912 Ga0496109_0392819 Ga0496109_0392819_43_672 209
112 3300048913 Ga0496110_0037484 Ga0496110_0037484_535_1164 209
113 3300048913 Ga0496110_0105616 Ga0496110_0105616_170_799 209
114 3300048914 Ga0496111_0175235 Ga0496111_0175235_48_677 209
115 3300048915 Ga0496112_0011296 Ga0496112_0011296_3306_3935 209
116 3300048916 Ga0496113_0184490 Ga0496113_0184490_925_1554 209
117 3300048917 Ga0496114_0249630 Ga0496114_0249630_338_967 209
118 3300048927 Ga0496124_0024540 Ga0496124_0024540_236_865 209
119 3300048928 Ga0496125_0033740 Ga0496125_0033740_442_1071 209
120 3300048928 Ga0496125_0042673 Ga0496125_0042673_3207_3836 209
121 3300048929 Ga0496126_0034601 Ga0496126_0034601_2118_2747 209
122 3300049571 Ga0501034_0038599 Ga0501034_0038599_3997_4626 209
123 3300049581 Ga0501047_0538719 Ga0501047_0538719_247_876 209
124 3300053087 Ga0500643_078193 Ga0500643_078193_77_706 209
125 3300053108 Ga0500562_014154 Ga0500562_014154_1230_1859 209
126 3300053109 Ga0500569_030765 Ga0500569_030765_673_1302 209
127 3300053117 Ga0500593_057174 Ga0500593_057174_660_1289 209
128 3300053137 Ga0500561_0011034 Ga0500561_0011034_1240_1869 209
129 3300059421 Ga0590071_013876 Ga0590071_013876_1197_1826 209
130 3300059424 Ga0590075_001938 Ga0590075_001938_1551_2183 209
131 3300003759 Ga0055525_1000038 Ga0055525_100003831 210
132 3300021361 Ga0213872_10000044 Ga0213872_100000445 210
133 3300025230 Ga0209563_100005 Ga0209563_1000051241 210
134 3300031239 Ga0265328_10010054 Ga0265328_100100545 210
135 3300031250 Ga0265331_10002534 Ga0265331_100025342 210
136 3300031251 Ga0265327_10000028 Ga0265327_10000028182 210
137 3300031649 Ga0307514_10001565 Ga0307514_1000156515 210
138 3300039447 Ga0436361_0886712 Ga0436361_0886712_5020_5664 210
139 3300042876 Ga0451577_0004580 Ga0451577_0004580_11647_12285 210
140 3300042876 Ga0451577_0019759 Ga0451577_0019759_5189_5827 210
141 3300044712 Ga0453684_0047779 Ga0453684_0047779_173_811 210
142 3300044712 Ga0453684_0308604 Ga0453684_0308604_1053_1727 210
143 3300045051 Ga0451576_0007754 Ga0451576_0007754_6344_6982 210
144 3300048925 Ga0496122_0130111 Ga0496122_0130111_428_1072 210
145 3300002705 JGI25156J39149_1002048 JGI25156J39149_10020483 211
146 3300002705 JGI25156J39149_1002716 JGI25156J39149_10027164 211
147 3300002705 JGI25156J39149_1007600 JGI25156J39149_10076004 211
148 3300002705 JGI25156J39149_1017236 JGI25156J39149_10172361 211
149 3300002738 JGI25154J39366_1000783 JGI25154J39366_100078310 211
150 3300002741 JGI25157J39369_1000551 JGI25157J39369_100055118 211
151 3300002772 JGI25164J39214_1005629 JGI25164J39214_10056292 211
152 3300003305 Ga0006770J48903_1062170 Ga0006770J48903_10621701 211
153 3300003316 rootH1_10009161 rootH1_100091615 211
154 3300003320 rootH2_10083264 rootH2_100832642 211
155 3300003320 rootH2_10087210 rootH2_100872103 211
156 3300003323 rootH1_10032898 rootH1_100328985 211
157 3300003752 Ga0055539_1000766 Ga0055539_10007666 211
158 3300003752 Ga0055539_1002353 Ga0055539_10023532 211
159 3300003756 Ga0055533_1000053 Ga0055533_100005321 211
160 3300003759 Ga0055525_1001506 Ga0055525_10015063 211
161 3300003761 Ga0055535_1001169 Ga0055535_10011695 211
162 3300003761 Ga0055535_1018710 Ga0055535_10187102 211
163 3300003763 Ga0055529_1000431 Ga0055529_100043121 211
164 3300003792 Ga0055540_1032332 Ga0055540_10323321 211
165 3300003794 Ga0055531_10000043 Ga0055531_1000004366 211
166 3300005293 Ga0065715_10184216 Ga0065715_101842162 211
167 3300005327 Ga0070658_10040482 Ga0070658_100404822 211
168 3300005327 Ga0070658_10076570 Ga0070658_100765702 211
169 3300005327 Ga0070658_10091163 Ga0070658_100911633 211
170 3300005327 Ga0070658_10750308 Ga0070658_107503081 211
171 3300005328 Ga0070676_10001571 Ga0070676_100015715 211
172 3300005328 Ga0070676_10009968 Ga0070676_100099685 211
173 3300005328 Ga0070676_10077944 Ga0070676_100779442 211
174 3300005328 Ga0070676_10242371 Ga0070676_102423711 211
175 3300005329 Ga0070683_100042121 Ga0070683_1000421213 211
176 3300005329 Ga0070683_100063563 Ga0070683_1000635632 211
177 3300005330 Ga0070690_100067742 Ga0070690_1000677422 211
178 3300005330 Ga0070690_100068766 Ga0070690_1000687663 211
179 3300005330 Ga0070690_100369620 Ga0070690_1003696202 211
180 3300005331 Ga0070670_100002895 Ga0070670_1000028954 211
181 3300005331 Ga0070670_100052223 Ga0070670_1000522232 211
182 3300005331 Ga0070670_100068319 Ga0070670_1000683192 211
183 3300005331 Ga0070670_100072274 Ga0070670_1000722744 211
184 3300005331 Ga0070670_100409113 Ga0070670_1004091131 211
185 3300005334 Ga0068869_100010255 Ga0068869_1000102554 211
186 3300005334 Ga0068869_100036073 Ga0068869_1000360732 211
187 3300005334 Ga0068869_100043229 Ga0068869_1000432292 211
188 3300005334 Ga0068869_100220220 Ga0068869_1002202202 211
189 3300005335 Ga0070666_10005627 Ga0070666_100056272 211
190 3300005335 Ga0070666_10037731 Ga0070666_100377311 211
191 3300005335 Ga0070666_10068676 Ga0070666_100686763 211
192 3300005336 Ga0070680_100014127 Ga0070680_1000141275 211
193 3300005338 Ga0068868_100005991 Ga0068868_1000059912 211
194 3300005338 Ga0068868_100075106 Ga0068868_1000751061 211
195 3300005338 Ga0068868_100357881 Ga0068868_1003578812 211
196 3300005338 Ga0068868_100385495 Ga0068868_1003854951 211
197 3300005339 Ga0070660_100058136 Ga0070660_1000581364 211
198 3300005339 Ga0070660_100058999 Ga0070660_1000589992 211
199 3300005339 Ga0070660_100222427 Ga0070660_1002224272 211
200 3300005343 Ga0070687_100136435 Ga0070687_1001364352 211
201 3300005343 Ga0070687_100137107 Ga0070687_1001371072 211
202 3300005344 Ga0070661_100023474 Ga0070661_1000234743 211
203 3300005344 Ga0070661_100192346 Ga0070661_1001923462 211
204 3300005344 Ga0070661_100285421 Ga0070661_1002854212 211
205 3300005345 Ga0070692_10322102 Ga0070692_103221022 211
206 3300005347 Ga0070668_100005605 Ga0070668_1000056054 211
207 3300005347 Ga0070668_100142831 Ga0070668_1001428312 211
208 3300005347 Ga0070668_100271141 Ga0070668_1002711411 211
209 3300005353 Ga0070669_100020771 Ga0070669_1000207715 211
210 3300005353 Ga0070669_100026966 Ga0070669_1000269663 211
211 3300005353 Ga0070669_100126035 Ga0070669_1001260352 211
212 3300005353 Ga0070669_100242374 Ga0070669_1002423742 211
213 3300005354 Ga0070675_100021338 Ga0070675_1000213383 211
214 3300005354 Ga0070675_100025785 Ga0070675_1000257852 211
215 3300005354 Ga0070675_100029887 Ga0070675_1000298873 211
216 3300005354 Ga0070675_100035559 Ga0070675_1000355592 211
217 3300005354 Ga0070675_100074550 Ga0070675_1000745504 211
218 3300005354 Ga0070675_100101334 Ga0070675_1001013343 211
219 3300005354 Ga0070675_100121594 Ga0070675_1001215942 211
220 3300005354 Ga0070675_100564713 Ga0070675_1005647132 211
221 3300005355 Ga0070671_100014186 Ga0070671_1000141865 211
222 3300005355 Ga0070671_100017039 Ga0070671_1000170396 211
223 3300005355 Ga0070671_100050234 Ga0070671_1000502342 211
224 3300005355 Ga0070671_100053915 Ga0070671_1000539154 211
225 3300005355 Ga0070671_100056719 Ga0070671_1000567193 211
226 3300005355 Ga0070671_100134964 Ga0070671_1001349642 211
227 3300005355 Ga0070671_100170914 Ga0070671_1001709141 211
228 3300005356 Ga0070674_100017041 Ga0070674_1000170412 211
229 3300005356 Ga0070674_100036447 Ga0070674_1000364473 211
230 3300005364 Ga0070673_100001525 Ga0070673_10000152517 211
231 3300005364 Ga0070673_100005338 Ga0070673_1000053383 211
232 3300005364 Ga0070673_100012028 Ga0070673_1000120284 211
233 3300005364 Ga0070673_100097413 Ga0070673_1000974131 211
234 3300005364 Ga0070673_100246407 Ga0070673_1002464072 211
235 3300005364 Ga0070673_100773647 Ga0070673_1007736471 211
236 3300005365 Ga0070688_100090969 Ga0070688_1000909691 211
237 3300005365 Ga0070688_100172768 Ga0070688_1001727682 211
238 3300005366 Ga0070659_100018804 Ga0070659_1000188046 211
239 3300005366 Ga0070659_100132044 Ga0070659_1001320442 211
240 3300005366 Ga0070659_100199327 Ga0070659_1001993273 211
241 3300005367 Ga0070667_100000702 Ga0070667_10000070228 211
242 3300005367 Ga0070667_100014692 Ga0070667_1000146925 211
243 3300005367 Ga0070667_100051164 Ga0070667_1000511643 211
244 3300005367 Ga0070667_100095534 Ga0070667_1000955342 211
245 3300005441 Ga0070700_100298003 Ga0070700_1002980031 211
246 3300005455 Ga0070663_100003281 Ga0070663_1000032814 211
247 3300005456 Ga0070678_100031660 Ga0070678_1000316602 211
248 3300005456 Ga0070678_100088709 Ga0070678_1000887092 211
249 3300005456 Ga0070678_100132721 Ga0070678_1001327211 211
250 3300005456 Ga0070678_100153184 Ga0070678_1001531842 211
251 3300005456 Ga0070678_100304969 Ga0070678_1003049692 211
252 3300005457 Ga0070662_100001681 Ga0070662_1000016813 211
253 3300005457 Ga0070662_100018885 Ga0070662_1000188854 211
254 3300005457 Ga0070662_100083930 Ga0070662_1000839302 211
255 3300005457 Ga0070662_100102524 Ga0070662_1001025242 211
256 3300005457 Ga0070662_100106906 Ga0070662_1001069062 211
257 3300005459 Ga0068867_100000329 Ga0068867_1000003292 211
258 3300005459 Ga0068867_100011396 Ga0068867_1000113962 211
259 3300005459 Ga0068867_100016329 Ga0068867_1000163296 211
260 3300005459 Ga0068867_100024678 Ga0068867_1000246784 211
261 3300005459 Ga0068867_100026671 Ga0068867_1000266713 211
262 3300005459 Ga0068867_100209582 Ga0068867_1002095821 211
263 3300005459 Ga0068867_100243934 Ga0068867_1002439342 211
264 3300005466 Ga0070685_10015464 Ga0070685_100154644 211
265 3300005466 Ga0070685_10491459 Ga0070685_104914591 211
266 3300005467 Ga0070706_100003982 Ga0070706_10000398212 211
267 3300005467 Ga0070706_100100656 Ga0070706_1001006561 211
268 3300005468 Ga0070707_100509147 Ga0070707_1005091471 211
269 3300005530 Ga0070679_100002110 Ga0070679_1000021103 211
270 3300005535 Ga0070684_100252062 Ga0070684_1002520622 211
271 3300005539 Ga0068853_100080642 Ga0068853_1000806421 211
272 3300005539 Ga0068853_100086802 Ga0068853_1000868022 211
273 3300005539 Ga0068853_100187973 Ga0068853_1001879733 211
274 3300005543 Ga0070672_100002315 Ga0070672_1000023154 211
275 3300005543 Ga0070672_100002548 Ga0070672_10000254810 211
276 3300005543 Ga0070672_100002827 Ga0070672_1000028277 211
277 3300005543 Ga0070672_100054949 Ga0070672_1000549493 211
278 3300005543 Ga0070672_100065143 Ga0070672_1000651432 211
279 3300005543 Ga0070672_100188217 Ga0070672_1001882171 211
280 3300005543 Ga0070672_100245180 Ga0070672_1002451802 211
281 3300005543 Ga0070672_100277747 Ga0070672_1002777472 211
282 3300005544 Ga0070686_100031869 Ga0070686_1000318695 211
283 3300005548 Ga0070665_100002955 Ga0070665_10000295512 211
284 3300005548 Ga0070665_101182355 Ga0070665_1011823551 211
285 3300005563 Ga0068855_100074071 Ga0068855_1000740713 211
286 3300005563 Ga0068855_100238851 Ga0068855_1002388513 211
287 3300005564 Ga0070664_100139645 Ga0070664_1001396452 211
288 3300005564 Ga0070664_100261584 Ga0070664_1002615842 211
289 3300005564 Ga0070664_100294446 Ga0070664_1002944462 211
290 3300005577 Ga0068857_100036400 Ga0068857_1000364002 211
291 3300005577 Ga0068857_100253539 Ga0068857_1002535392 211
292 3300005577 Ga0068857_100363086 Ga0068857_1003630862 211
293 3300005578 Ga0068854_100006268 Ga0068854_1000062684 211
294 3300005578 Ga0068854_100012676 Ga0068854_1000126765 211
295 3300005578 Ga0068854_100023755 Ga0068854_1000237556 211
296 3300005578 Ga0068854_100168900 Ga0068854_1001689002 211
297 3300005578 Ga0068854_100416033 Ga0068854_1004160332 211
298 3300005614 Ga0068856_100027796 Ga0068856_1000277962 211
299 3300005614 Ga0068856_100051194 Ga0068856_1000511943 211
300 3300005614 Ga0068856_100102898 Ga0068856_1001028982 211
301 3300005614 Ga0068856_100130455 Ga0068856_1001304552 211
302 3300005614 Ga0068856_100169431 Ga0068856_1001694312 211
303 3300005614 Ga0068856_100735324 Ga0068856_1007353242 211
304 3300005615 Ga0070702_100036625 Ga0070702_1000366253 211
305 3300005616 Ga0068852_100020253 Ga0068852_1000202532 211
306 3300005616 Ga0068852_100123887 Ga0068852_1001238872 211
307 3300005616 Ga0068852_100180734 Ga0068852_1001807342 211
308 3300005616 Ga0068852_100226765 Ga0068852_1002267652 211
309 3300005616 Ga0068852_100229098 Ga0068852_1002290982 211
310 3300005616 Ga0068852_100302447 Ga0068852_1003024473 211
311 3300005616 Ga0068852_100466896 Ga0068852_1004668961 211
312 3300005616 Ga0068852_100595266 Ga0068852_1005952662 211
313 3300005616 Ga0068852_100692491 Ga0068852_1006924912 211
314 3300005616 Ga0068852_100827867 Ga0068852_1008278671 211
315 3300005617 Ga0068859_100005588 Ga0068859_10000558812 211
316 3300005617 Ga0068859_100058362 Ga0068859_1000583623 211
317 3300005617 Ga0068859_100069270 Ga0068859_1000692702 211
318 3300005617 Ga0068859_100964241 Ga0068859_1009642412 211
319 3300005618 Ga0068864_100002234 Ga0068864_1000022345 211
320 3300005618 Ga0068864_100009938 Ga0068864_1000099381 211
321 3300005618 Ga0068864_100115868 Ga0068864_1001158683 211
322 3300005618 Ga0068864_100268253 Ga0068864_1002682531 211
323 3300005718 Ga0068866_10008518 Ga0068866_100085182 211
324 3300005719 Ga0068861_100001661 Ga0068861_10000166111 211
325 3300005719 Ga0068861_100004858 Ga0068861_1000048582 211
326 3300005834 Ga0068851_10183215 Ga0068851_101832152 211
327 3300005840 Ga0068870_10028578 Ga0068870_100285783 211
328 3300005840 Ga0068870_10093157 Ga0068870_100931571 211
329 3300005841 Ga0068863_100004155 Ga0068863_1000041552 211
330 3300005841 Ga0068863_100042613 Ga0068863_1000426133 211
331 3300005841 Ga0068863_100081641 Ga0068863_1000816412 211
332 3300005841 Ga0068863_100278683 Ga0068863_1002786832 211
333 3300005841 Ga0068863_100301059 Ga0068863_1003010592 211
334 3300005841 Ga0068863_100582212 Ga0068863_1005822122 211
335 3300005842 Ga0068858_100002678 Ga0068858_1000026782 211
336 3300005842 Ga0068858_100053372 Ga0068858_1000533725 211
337 3300005842 Ga0068858_100134145 Ga0068858_1001341452 211
338 3300005842 Ga0068858_100640357 Ga0068858_1006403571 211
339 3300005843 Ga0068860_100000943 Ga0068860_10000094327 211
340 3300005843 Ga0068860_100012396 Ga0068860_1000123965 211
341 3300005843 Ga0068860_100112503 Ga0068860_1001125032 211
342 3300005843 Ga0068860_100265208 Ga0068860_1002652082 211
343 3300005843 Ga0068860_100273411 Ga0068860_1002734112 211
344 3300005843 Ga0068860_100604751 Ga0068860_1006047512 211
345 3300005844 Ga0068862_100018064 Ga0068862_1000180643 211
346 3300006038 Ga0075365_10071939 Ga0075365_100719392 211
347 3300006042 Ga0075368_10001858 Ga0075368_100018582 211
348 3300006042 Ga0075368_10010880 Ga0075368_100108802 211
349 3300006048 Ga0075363_100019201 Ga0075363_1000192012 211
350 3300006048 Ga0075363_100023671 Ga0075363_1000236713 211
351 3300006051 Ga0075364_10004616 Ga0075364_100046168 211
352 3300006051 Ga0075364_10022968 Ga0075364_100229682 211
353 3300006177 Ga0075362_10000760 Ga0075362_100007607 211
354 3300006177 Ga0075362_10148162 Ga0075362_101481622 211
355 3300006177 Ga0075362_10249295 Ga0075362_102492951 211
356 3300006178 Ga0075367_10003300 Ga0075367_100033006 211
357 3300006178 Ga0075367_10009174 Ga0075367_100091742 211
358 3300006178 Ga0075367_10037724 Ga0075367_100377242 211
359 3300006178 Ga0075367_10045779 Ga0075367_100457792 211
360 3300006178 Ga0075367_10149702 Ga0075367_101497021 211
361 3300006186 Ga0075369_10017423 Ga0075369_100174232 211
362 3300006186 Ga0075369_10024769 Ga0075369_100247692 211
363 3300006186 Ga0075369_10075485 Ga0075369_100754851 211
364 3300006195 Ga0075366_10004079 Ga0075366_100040792 211
365 3300006195 Ga0075366_10009539 Ga0075366_100095394 211
366 3300006195 Ga0075366_10012478 Ga0075366_100124782 211
367 3300006195 Ga0075366_10013722 Ga0075366_100137224 211
368 3300006195 Ga0075366_10014473 Ga0075366_100144735 211
369 3300006195 Ga0075366_10051734 Ga0075366_100517342 211
370 3300006195 Ga0075366_10073749 Ga0075366_100737492 211
371 3300006195 Ga0075366_10093330 Ga0075366_100933302 211
372 3300006195 Ga0075366_10107373 Ga0075366_101073732 211
373 3300006195 Ga0075366_10233340 Ga0075366_102333402 211
374 3300006195 Ga0075366_10308834 Ga0075366_103088342 211
375 3300006237 Ga0097621_100018003 Ga0097621_1000180036 211
376 3300006237 Ga0097621_100053400 Ga0097621_1000534002 211
377 3300006237 Ga0097621_100194564 Ga0097621_1001945642 211
378 3300006237 Ga0097621_100379711 Ga0097621_1003797112 211
379 3300006237 Ga0097621_100401297 Ga0097621_1004012971 211
380 3300006353 Ga0075370_10002264 Ga0075370_100022642 211
381 3300006353 Ga0075370_10005659 Ga0075370_100056594 211
382 3300006353 Ga0075370_10009378 Ga0075370_100093782 211
383 3300006353 Ga0075370_10023788 Ga0075370_100237883 211
384 3300006353 Ga0075370_10028431 Ga0075370_100284312 211
385 3300006353 Ga0075370_10031310 Ga0075370_100313102 211
386 3300006353 Ga0075370_10106881 Ga0075370_101068812 211
387 3300006358 Ga0068871_100006199 Ga0068871_1000061995 211
388 3300006358 Ga0068871_100158783 Ga0068871_1001587833 211
389 3300006358 Ga0068871_100776908 Ga0068871_1007769082 211
390 3300006880 Ga0075429_100008966 Ga0075429_1000089669 211
391 3300006881 Ga0068865_100004931 Ga0068865_10000493110 211
392 3300006881 Ga0068865_100083825 Ga0068865_1000838253 211
393 3300006881 Ga0068865_100294420 Ga0068865_1002944202 211
394 3300006881 Ga0068865_100440782 Ga0068865_1004407822 211
395 3300006931 Ga0097620_100005588 Ga0097620_1000055882 211
396 3300006931 Ga0097620_100058362 Ga0097620_1000583621 211
397 3300006931 Ga0097620_100069266 Ga0097620_1000692662 211
398 3300006931 Ga0097620_100964190 Ga0097620_1009641901 211
399 3300009093 Ga0105240_10008979 Ga0105240_100089798 211
400 3300009093 Ga0105240_10057797 Ga0105240_100577972 211
401 3300009093 Ga0105240_10073187 Ga0105240_100731875 211
402 3300009098 Ga0105245_10161208 Ga0105245_101612082 211
403 3300009098 Ga0105245_10173555 Ga0105245_101735552 211
404 3300009147 Ga0114129_10378952 Ga0114129_103789522 211
405 3300009147 Ga0114129_10553197 Ga0114129_105531972 211
406 3300009148 Ga0105243_10012059 Ga0105243_100120594 211
407 3300009148 Ga0105243_10017616 Ga0105243_100176162 211
408 3300009148 Ga0105243_10098123 Ga0105243_100981232 211
409 3300009148 Ga0105243_10251151 Ga0105243_102511512 211
410 3300009148 Ga0105243_10619323 Ga0105243_106193231 211
411 3300009174 Ga0105241_10024407 Ga0105241_100244073 211
412 3300009176 Ga0105242_10263050 Ga0105242_102630501 211
413 3300009177 Ga0105248_10019801 Ga0105248_1001980110 211
414 3300009177 Ga0105248_10105860 Ga0105248_101058602 211
415 3300009177 Ga0105248_10209128 Ga0105248_102091282 211
416 3300009177 Ga0105248_10320278 Ga0105248_103202783 211
417 3300009177 Ga0105248_10342136 Ga0105248_103421362 211
418 3300009177 Ga0105248_10465645 Ga0105248_104656453 211
419 3300009177 Ga0105248_10741216 Ga0105248_107412162 211
420 3300009545 Ga0105237_10001800 Ga0105237_100018003 211
421 3300009545 Ga0105237_10052281 Ga0105237_100522813 211
422 3300009545 Ga0105237_10573843 Ga0105237_105738432 211
423 3300009551 Ga0105238_10001620 Ga0105238_1000162011 211
424 3300009551 Ga0105238_10027838 Ga0105238_100278382 211
425 3300009551 Ga0105238_10143142 Ga0105238_101431422 211
426 3300009553 Ga0105249_10006344 Ga0105249_100063444 211
427 3300009553 Ga0105249_10314165 Ga0105249_103141652 211
428 3300009553 Ga0105249_10446991 Ga0105249_104469912 211
429 3300010375 Ga0105239_10001185 Ga0105239_1000118529 211
430 3300010375 Ga0105239_10030763 Ga0105239_100307634 211
431 3300010375 Ga0105239_10138092 Ga0105239_101380922 211
432 3300010375 Ga0105239_10219559 Ga0105239_102195592 211
433 3300011119 Ga0105246_10174447 Ga0105246_101744473 211
434 3300011119 Ga0105246_10467817 Ga0105246_104678171 211
435 3300011119 Ga0105246_10692620 Ga0105246_106926201 211
436 3300012495 Ga0157323_1010599 Ga0157323_10105991 211
437 3300013102 Ga0157371_10041368 Ga0157371_100413682 211
438 3300013102 Ga0157371_10200573 Ga0157371_102005731 211
439 3300013104 Ga0157370_10577339 Ga0157370_105773392 211
440 3300013104 Ga0157370_10772829 Ga0157370_107728291 211
441 3300013296 Ga0157374_10018242 Ga0157374_100182424 211
442 3300013296 Ga0157374_10047499 Ga0157374_100474994 211
443 3300013296 Ga0157374_10161847 Ga0157374_101618472 211
444 3300013296 Ga0157374_10319887 Ga0157374_103198872 211
445 3300013296 Ga0157374_10373898 Ga0157374_103738982 211
446 3300013296 Ga0157374_10479019 Ga0157374_104790192 211
447 3300013297 Ga0157378_10294779 Ga0157378_102947792 211
448 3300013297 Ga0157378_10940126 Ga0157378_109401261 211
449 3300013297 Ga0157378_11185133 Ga0157378_111851331 211
450 3300013306 Ga0163162_10005745 Ga0163162_1000574511 211
451 3300013306 Ga0163162_10159345 Ga0163162_101593454 211
452 3300013307 Ga0157372_10014771 Ga0157372_100147718 211
453 3300013307 Ga0157372_10038743 Ga0157372_100387432 211
454 3300013308 Ga0157375_10043212 Ga0157375_100432123 211
455 3300013308 Ga0157375_10089804 Ga0157375_100898043 211
456 3300013308 Ga0157375_10166099 Ga0157375_101660994 211
457 3300013308 Ga0157375_10464303 Ga0157375_104643032 211
458 3300013308 Ga0157375_10763574 Ga0157375_107635742 211
459 3300013308 Ga0157375_10892202 Ga0157375_108922022 211
460 3300014325 Ga0163163_10376138 Ga0163163_103761381 211
461 3300014325 Ga0163163_10553095 Ga0163163_105530952 211
462 3300014326 Ga0157380_10024608 Ga0157380_100246082 211
463 3300014326 Ga0157380_10352006 Ga0157380_103520062 211
464 3300014745 Ga0157377_10000170 Ga0157377_100001708 211
465 3300014745 Ga0157377_10002946 Ga0157377_100029466 211
466 3300014745 Ga0157377_10218351 Ga0157377_102183512 211
467 3300014968 Ga0157379_10039596 Ga0157379_100395962 211
468 3300014968 Ga0157379_10077702 Ga0157379_100777022 211
469 3300014968 Ga0157379_10283447 Ga0157379_102834472 211
470 3300014968 Ga0157379_10330250 Ga0157379_103302502 211
471 3300014968 Ga0157379_10367708 Ga0157379_103677082 211
472 3300014969 Ga0157376_10021326 Ga0157376_100213262 211
473 3300014969 Ga0157376_10422279 Ga0157376_104222792 211
474 3300014969 Ga0157376_10816629 Ga0157376_108166291 211
475 3300014969 Ga0157376_10851588 Ga0157376_108515881 211
476 3300015262 Ga0182007_10092630 Ga0182007_100926302 211
477 3300017792 Ga0163161_10016697 Ga0163161_100166975 211
478 3300017792 Ga0163161_10053309 Ga0163161_100533093 211
479 3300017792 Ga0163161_10128971 Ga0163161_101289712 211
480 3300021361 Ga0213872_10000073 Ga0213872_1000007347 211
481 3300021361 Ga0213872_10000154 Ga0213872_1000015449 211
482 3300021361 Ga0213872_10022528 Ga0213872_100225281 211
483 3300021361 Ga0213872_10046320 Ga0213872_100463202 211
484 3300021361 Ga0213872_10091385 Ga0213872_100913852 211
485 3300025226 Ga0209674_100039 Ga0209674_100039171 211
486 3300025230 Ga0209563_100080 Ga0209563_100080171 211
487 3300025231 Ga0207427_101590 Ga0207427_1015907 211
488 3300025242 Ga0209258_100072 Ga0209258_1000727 211
489 3300025242 Ga0209258_102156 Ga0209258_1021563 211
490 3300025246 Ga0209646_1000301 Ga0209646_100030136 211
491 3300025250 Ga0209026_1000011 Ga0209026_1000011180 211
492 3300025253 Ga0209677_100130 Ga0209677_10013010 211
493 3300025253 Ga0209677_103493 Ga0209677_1034934 211
494 3300025253 Ga0209677_103696 Ga0209677_1036962 211
495 3300025256 Ga0209759_1000214 Ga0209759_100021449 211
496 3300025256 Ga0209759_1001031 Ga0209759_10010314 211
497 3300025256 Ga0209759_1001266 Ga0209759_10012665 211
498 3300025256 Ga0209759_1007152 Ga0209759_10071523 211
499 3300025256 Ga0209759_1011143 Ga0209759_10111433 211
500 3300025256 Ga0209759_1042771 Ga0209759_10427711 211
501 3300025272 Ga0209455_1000053 Ga0209455_100005387 211
502 3300025298 Ga0209050_1001300 Ga0209050_10013005 211
503 3300025303 Ga0209051_1002155 Ga0209051_100215512 211
504 3300025303 Ga0209051_1004799 Ga0209051_10047992 211
505 3300025303 Ga0209051_1007290 Ga0209051_10072906 211
506 3300025304 Ga0209257_1000182 Ga0209257_100018257 211
507 3300025304 Ga0209257_1011718 Ga0209257_10117182 211
508 3300025304 Ga0209257_1058206 Ga0209257_10582061 211
509 3300025315 Ga0207697_10283218 Ga0207697_102832181 211
510 3300025893 Ga0207682_10005109 Ga0207682_100051096 211
511 3300025893 Ga0207682_10043472 Ga0207682_100434722 211
512 3300025893 Ga0207682_10044919 Ga0207682_100449193 211
513 3300025893 Ga0207682_10059945 Ga0207682_100599452 211
514 3300025901 Ga0207688_10218862 Ga0207688_102188621 211
515 3300025903 Ga0207680_10003380 Ga0207680_100033802 211
516 3300025903 Ga0207680_10010348 Ga0207680_100103483 211
517 3300025903 Ga0207680_10571476 Ga0207680_105714761 211
518 3300025907 Ga0207645_10001208 Ga0207645_100012085 211
519 3300025907 Ga0207645_10013147 Ga0207645_100131476 211
520 3300025907 Ga0207645_10018896 Ga0207645_100188962 211
521 3300025907 Ga0207645_10176396 Ga0207645_101763962 211
522 3300025908 Ga0207643_10044744 Ga0207643_100447442 211
523 3300025909 Ga0207705_10189880 Ga0207705_101898802 211
524 3300025909 Ga0207705_10230832 Ga0207705_102308322 211
525 3300025909 Ga0207705_10312019 Ga0207705_103120192 211
526 3300025910 Ga0207684_10004653 Ga0207684_100046536 211
527 3300025910 Ga0207684_10062899 Ga0207684_100628992 211
528 3300025911 Ga0207654_10109211 Ga0207654_101092113 211
529 3300025912 Ga0207707_10037822 Ga0207707_100378222 211
530 3300025912 Ga0207707_10866141 Ga0207707_108661411 211
531 3300025913 Ga0207695_10010519 Ga0207695_100105197 211
532 3300025913 Ga0207695_10018695 Ga0207695_100186952 211
533 3300025913 Ga0207695_10211675 Ga0207695_102116752 211
534 3300025914 Ga0207671_10001232 Ga0207671_1000123214 211
535 3300025916 Ga0207663_10221519 Ga0207663_102215192 211
536 3300025917 Ga0207660_10013605 Ga0207660_100136053 211
537 3300025918 Ga0207662_10061693 Ga0207662_100616932 211
538 3300025918 Ga0207662_10495788 Ga0207662_104957881 211
539 3300025919 Ga0207657_10045869 Ga0207657_100458695 211
540 3300025919 Ga0207657_10484026 Ga0207657_104840262 211
541 3300025920 Ga0207649_10017005 Ga0207649_100170052 211
542 3300025920 Ga0207649_10183236 Ga0207649_101832362 211
543 3300025920 Ga0207649_10342420 Ga0207649_103424202 211
544 3300025921 Ga0207652_10046936 Ga0207652_100469363 211
545 3300025922 Ga0207646_10163129 Ga0207646_101631292 211
546 3300025923 Ga0207681_10000823 Ga0207681_1000082320 211
547 3300025923 Ga0207681_10056092 Ga0207681_100560922 211
548 3300025923 Ga0207681_10061088 Ga0207681_100610883 211
549 3300025924 Ga0207694_10004625 Ga0207694_100046254 211
550 3300025925 Ga0207650_10002985 Ga0207650_100029853 211
551 3300025925 Ga0207650_10014909 Ga0207650_100149094 211
552 3300025925 Ga0207650_10072923 Ga0207650_100729233 211
553 3300025925 Ga0207650_10120999 Ga0207650_101209992 211
554 3300025926 Ga0207659_10004461 Ga0207659_100044615 211
555 3300025926 Ga0207659_10040286 Ga0207659_100402862 211
556 3300025926 Ga0207659_10055387 Ga0207659_100553873 211
557 3300025926 Ga0207659_10056078 Ga0207659_100560784 211
558 3300025926 Ga0207659_10098047 Ga0207659_100980472 211
559 3300025926 Ga0207659_10110233 Ga0207659_101102332 211
560 3300025926 Ga0207659_10246622 Ga0207659_102466221 211
561 3300025926 Ga0207659_10304617 Ga0207659_103046172 211
562 3300025926 Ga0207659_10633182 Ga0207659_106331822 211
563 3300025927 Ga0207687_10155820 Ga0207687_101558201 211
564 3300025927 Ga0207687_10256539 Ga0207687_102565392 211
565 3300025927 Ga0207687_11068789 Ga0207687_110687891 211
566 3300025931 Ga0207644_10016116 Ga0207644_100161165 211
567 3300025931 Ga0207644_10034103 Ga0207644_100341032 211
568 3300025931 Ga0207644_10072900 Ga0207644_100729003 211
569 3300025931 Ga0207644_11052198 Ga0207644_110521981 211
570 3300025932 Ga0207690_10091128 Ga0207690_100911282 211
571 3300025932 Ga0207690_10099654 Ga0207690_100996542 211
572 3300025932 Ga0207690_10203392 Ga0207690_102033921 211
573 3300025932 Ga0207690_10211436 Ga0207690_102114362 211
574 3300025932 Ga0207690_10381988 Ga0207690_103819881 211
575 3300025933 Ga0207706_10002434 Ga0207706_100024348 211
576 3300025933 Ga0207706_10013338 Ga0207706_100133382 211
577 3300025933 Ga0207706_10013363 Ga0207706_100133632 211
578 3300025933 Ga0207706_10033600 Ga0207706_100336004 211
579 3300025933 Ga0207706_10082407 Ga0207706_100824072 211
580 3300025934 Ga0207686_10064164 Ga0207686_100641642 211
581 3300025935 Ga0207709_10003397 Ga0207709_100033972 211
582 3300025935 Ga0207709_10034651 Ga0207709_100346511 211
583 3300025935 Ga0207709_10057501 Ga0207709_100575012 211
584 3300025935 Ga0207709_10088731 Ga0207709_100887313 211
585 3300025937 Ga0207669_10003010 Ga0207669_100030102 211
586 3300025937 Ga0207669_10086353 Ga0207669_100863532 211
587 3300025937 Ga0207669_10093113 Ga0207669_100931131 211
588 3300025937 Ga0207669_10101108 Ga0207669_101011082 211
589 3300025938 Ga0207704_10066913 Ga0207704_100669132 211
590 3300025938 Ga0207704_10161990 Ga0207704_101619902 211
591 3300025938 Ga0207704_10667310 Ga0207704_106673101 211
592 3300025939 Ga0207665_10079213 Ga0207665_100792134 211
593 3300025940 Ga0207691_10001739 Ga0207691_100017399 211
594 3300025940 Ga0207691_10004984 Ga0207691_1000498413 211
595 3300025940 Ga0207691_10005163 Ga0207691_1000516311 211
596 3300025940 Ga0207691_10022620 Ga0207691_100226202 211
597 3300025940 Ga0207691_10149342 Ga0207691_101493423 211
598 3300025940 Ga0207691_10253259 Ga0207691_102532591 211
599 3300025940 Ga0207691_10264282 Ga0207691_102642822 211
600 3300025941 Ga0207711_10020237 Ga0207711_100202372 211
601 3300025941 Ga0207711_10045517 Ga0207711_100455175 211
602 3300025941 Ga0207711_10125706 Ga0207711_101257062 211
603 3300025941 Ga0207711_10407468 Ga0207711_104074682 211
604 3300025942 Ga0207689_10000521 Ga0207689_1000052123 211
605 3300025942 Ga0207689_10020049 Ga0207689_100200493 211
606 3300025942 Ga0207689_10063726 Ga0207689_100637262 211
607 3300025944 Ga0207661_10009108 Ga0207661_100091083 211
608 3300025944 Ga0207661_10034856 Ga0207661_100348563 211
609 3300025944 Ga0207661_10275496 Ga0207661_102754962 211
610 3300025945 Ga0207679_10064714 Ga0207679_100647142 211
611 3300025945 Ga0207679_10194803 Ga0207679_101948032 211
612 3300025945 Ga0207679_10741197 Ga0207679_107411972 211
613 3300025949 Ga0207667_10283879 Ga0207667_102838792 211
614 3300025949 Ga0207667_10911987 Ga0207667_109119872 211
615 3300025960 Ga0207651_10035586 Ga0207651_100355864 211
616 3300025960 Ga0207651_10040355 Ga0207651_100403554 211
617 3300025960 Ga0207651_10061743 Ga0207651_100617431 211
618 3300025960 Ga0207651_10085639 Ga0207651_100856392 211
619 3300025960 Ga0207651_10094284 Ga0207651_100942841 211
620 3300025960 Ga0207651_10104319 Ga0207651_101043193 211
621 3300025961 Ga0207712_10005486 Ga0207712_100054864 211
622 3300025961 Ga0207712_10653834 Ga0207712_106538342 211
623 3300025972 Ga0207668_10001265 Ga0207668_100012653 211
624 3300025972 Ga0207668_10172966 Ga0207668_101729662 211
625 3300025972 Ga0207668_10388023 Ga0207668_103880232 211
626 3300025972 Ga0207668_10412953 Ga0207668_104129532 211
627 3300025981 Ga0207640_10011366 Ga0207640_100113662 211
628 3300025981 Ga0207640_10073229 Ga0207640_100732292 211
629 3300025981 Ga0207640_10276764 Ga0207640_102767642 211
630 3300025986 Ga0207658_10001833 Ga0207658_100018338 211
631 3300025986 Ga0207658_10002477 Ga0207658_1000247710 211
632 3300025986 Ga0207658_10010320 Ga0207658_100103205 211
633 3300025986 Ga0207658_10011682 Ga0207658_100116825 211
634 3300025986 Ga0207658_10300910 Ga0207658_103009102 211
635 3300025986 Ga0207658_10372914 Ga0207658_103729142 211
636 3300025986 Ga0207658_10467989 Ga0207658_104679892 211
637 3300025986 Ga0207658_10628131 Ga0207658_106281311 211
638 3300026023 Ga0207677_10055505 Ga0207677_100555052 211
639 3300026023 Ga0207677_10113812 Ga0207677_101138122 211
640 3300026023 Ga0207677_10569978 Ga0207677_105699782 211
641 3300026023 Ga0207677_10768681 Ga0207677_107686812 211
642 3300026035 Ga0207703_10004479 Ga0207703_1000447910 211
643 3300026035 Ga0207703_10005888 Ga0207703_100058882 211
644 3300026035 Ga0207703_10265235 Ga0207703_102652353 211
645 3300026041 Ga0207639_10070563 Ga0207639_100705632 211
646 3300026041 Ga0207639_10117923 Ga0207639_101179233 211
647 3300026041 Ga0207639_10171528 Ga0207639_101715282 211
648 3300026067 Ga0207678_10002363 Ga0207678_100023637 211
649 3300026067 Ga0207678_10033453 Ga0207678_100334532 211
650 3300026067 Ga0207678_10783571 Ga0207678_107835711 211
651 3300026075 Ga0207708_10257200 Ga0207708_102572002 211
652 3300026078 Ga0207702_10002302 Ga0207702_1000230210 211
653 3300026078 Ga0207702_10010277 Ga0207702_100102773 211
654 3300026078 Ga0207702_10138217 Ga0207702_101382172 211
655 3300026078 Ga0207702_10161962 Ga0207702_101619622 211
656 3300026088 Ga0207641_10009403 Ga0207641_1000940310 211
657 3300026088 Ga0207641_10092184 Ga0207641_100921842 211
658 3300026088 Ga0207641_10138439 Ga0207641_101384392 211
659 3300026088 Ga0207641_10262979 Ga0207641_102629793 211
660 3300026088 Ga0207641_10280693 Ga0207641_102806932 211
661 3300026088 Ga0207641_10807170 Ga0207641_108071702 211
662 3300026088 Ga0207641_10821009 Ga0207641_108210091 211
663 3300026089 Ga0207648_10000748 Ga0207648_100007486 211
664 3300026089 Ga0207648_10002159 Ga0207648_1000215910 211
665 3300026089 Ga0207648_10011657 Ga0207648_100116576 211
666 3300026089 Ga0207648_10016586 Ga0207648_100165862 211
667 3300026089 Ga0207648_10019952 Ga0207648_100199522 211
668 3300026095 Ga0207676_10005849 Ga0207676_100058491 211
669 3300026095 Ga0207676_10028252 Ga0207676_100282524 211
670 3300026095 Ga0207676_10034901 Ga0207676_100349012 211
671 3300026095 Ga0207676_10138574 Ga0207676_101385742 211
672 3300026095 Ga0207676_10579331 Ga0207676_105793312 211
673 3300026116 Ga0207674_10045241 Ga0207674_100452415 211
674 3300026116 Ga0207674_10048860 Ga0207674_100488604 211
675 3300026116 Ga0207674_10120277 Ga0207674_101202772 211
676 3300026116 Ga0207674_10238182 Ga0207674_102381822 211
677 3300026116 Ga0207674_10389598 Ga0207674_103895982 211
678 3300026118 Ga0207675_100000428 Ga0207675_10000042818 211
679 3300026118 Ga0207675_100003876 Ga0207675_1000038769 211
680 3300026118 Ga0207675_100038266 Ga0207675_1000382664 211
681 3300026121 Ga0207683_10043392 Ga0207683_100433921 211
682 3300026121 Ga0207683_10050350 Ga0207683_100503502 211
683 3300026121 Ga0207683_10556024 Ga0207683_105560241 211
684 3300026142 Ga0207698_10016580 Ga0207698_100165807 211
685 3300026142 Ga0207698_10047782 Ga0207698_100477822 211
686 3300026142 Ga0207698_10071717 Ga0207698_100717174 211
687 3300026142 Ga0207698_10071922 Ga0207698_100719223 211
688 3300026142 Ga0207698_10434669 Ga0207698_104346692 211
689 3300026142 Ga0207698_10590525 Ga0207698_105905252 211
690 3300026142 Ga0207698_10767313 Ga0207698_107673131 211
691 3300026142 Ga0207698_11141321 Ga0207698_111413212 211
692 3300026142 Ga0207698_11479949 Ga0207698_114799491 211
693 3300027866 Ga0209813_10075187 Ga0209813_100751872 211
694 3300028379 Ga0268266_10005969 Ga0268266_100059697 211
695 3300028380 Ga0268265_10203267 Ga0268265_102032672 211
696 3300028381 Ga0268264_10001228 Ga0268264_1000122813 211
697 3300028381 Ga0268264_10179915 Ga0268264_101799151 211
698 3300028381 Ga0268264_10215157 Ga0268264_102151572 211
699 3300028381 Ga0268264_10301245 Ga0268264_103012452 211
700 3300028666 Ga0265336_10000014 Ga0265336_10000014184 211
701 3300028786 Ga0307517_10001591 Ga0307517_1000159112 211
702 3300028786 Ga0307517_10236485 Ga0307517_102364852 211
703 3300028794 Ga0307515_10000103 Ga0307515_1000010392 211
704 3300028794 Ga0307515_10000184 Ga0307515_10000184120 211
705 3300028794 Ga0307515_10001431 Ga0307515_1000143149 211
706 3300028794 Ga0307515_10020933 Ga0307515_100209339 211
707 3300028794 Ga0307515_10023725 Ga0307515_100237255 211
708 3300028794 Ga0307515_10025369 Ga0307515_100253695 211
709 3300028794 Ga0307515_10035551 Ga0307515_100355512 211
710 3300028794 Ga0307515_10098333 Ga0307515_100983332 211
711 3300028794 Ga0307515_10200202 Ga0307515_102002022 211
712 3300028794 Ga0307515_10330553 Ga0307515_103305531 211
713 3300029957 Ga0265324_10006660 Ga0265324_100066606 211
714 3300029957 Ga0265324_10076828 Ga0265324_100768282 211
715 3300030521 Ga0307511_10018336 Ga0307511_100183365 211
716 3300030522 Ga0307512_10051321 Ga0307512_100513212 211
717 3300030522 Ga0307512_10262906 Ga0307512_102629061 211
718 3300031456 Ga0307513_10003898 Ga0307513_1000389819 211
719 3300031456 Ga0307513_10057848 Ga0307513_100578483 211
720 3300031456 Ga0307513_10068414 Ga0307513_100684142 211
721 3300031456 Ga0307513_10213771 Ga0307513_102137712 211
722 3300031507 Ga0307509_10002193 Ga0307509_100021932 211
723 3300031507 Ga0307509_10004459 Ga0307509_1000445919 211
724 3300031507 Ga0307509_10020954 Ga0307509_100209545 211
725 3300031507 Ga0307509_10058153 Ga0307509_100581535 211
726 3300031507 Ga0307509_10063616 Ga0307509_100636164 211
727 3300031507 Ga0307509_10111788 Ga0307509_101117882 211
728 3300031507 Ga0307509_10148470 Ga0307509_101484701 211
729 3300031507 Ga0307509_10434212 Ga0307509_104342122 211
730 3300031507 Ga0307509_10523836 Ga0307509_105238362 211
731 3300031548 Ga0307408_100000023 Ga0307408_1000000236 211
732 3300031548 Ga0307408_100096944 Ga0307408_1000969442 211
733 3300031548 Ga0307408_100333780 Ga0307408_1003337802 211
734 3300031548 Ga0307408_100441135 Ga0307408_1004411351 211
735 3300031548 Ga0307408_100480910 Ga0307408_1004809102 211
736 3300031616 Ga0307508_10000368 Ga0307508_1000036814 211
737 3300031616 Ga0307508_10136626 Ga0307508_101366262 211
738 3300031616 Ga0307508_10213462 Ga0307508_102134622 211
739 3300031649 Ga0307514_10007399 Ga0307514_1000739910 211
740 3300031649 Ga0307514_10013419 Ga0307514_100134195 211
741 3300031649 Ga0307514_10032642 Ga0307514_100326425 211
742 3300031649 Ga0307514_10294174 Ga0307514_102941741 211
743 3300031730 Ga0307516_10004098 Ga0307516_1000409821 211
744 3300031730 Ga0307516_10005073 Ga0307516_1000507313 211
745 3300031730 Ga0307516_10074546 Ga0307516_100745462 211
746 3300031730 Ga0307516_10160134 Ga0307516_101601342 211
747 3300031730 Ga0307516_10163479 Ga0307516_101634792 211
748 3300031730 Ga0307516_10251108 Ga0307516_102511081 211
749 3300031730 Ga0307516_10433058 Ga0307516_104330581 211
750 3300031731 Ga0307405_10007014 Ga0307405_100070143 211
751 3300031731 Ga0307405_10135837 Ga0307405_101358373 211
752 3300031731 Ga0307405_10844576 Ga0307405_108445761 211
753 3300031731 Ga0307405_10956282 Ga0307405_109562821 211
754 3300031824 Ga0307413_10156850 Ga0307413_101568502 211
755 3300031824 Ga0307413_10747516 Ga0307413_107475162 211
756 3300031852 Ga0307410_10253681 Ga0307410_102536812 211
757 3300031852 Ga0307410_10456452 Ga0307410_104564521 211
758 3300031901 Ga0307406_10276559 Ga0307406_102765591 211
759 3300031901 Ga0307406_10721448 Ga0307406_107214481 211
760 3300031903 Ga0307407_10277777 Ga0307407_102777772 211
761 3300031911 Ga0307412_10013904 Ga0307412_100139043 211
762 3300031911 Ga0307412_10025761 Ga0307412_100257612 211
763 3300031911 Ga0307412_10171142 Ga0307412_101711422 211
764 3300031911 Ga0307412_10307831 Ga0307412_103078311 211
765 3300031911 Ga0307412_10970365 Ga0307412_109703651 211
766 3300031995 Ga0307409_100002795 Ga0307409_1000027958 211
767 3300031995 Ga0307409_100006577 Ga0307409_1000065776 211
768 3300032002 Ga0307416_100008008 Ga0307416_1000080082 211
769 3300032002 Ga0307416_100175437 Ga0307416_1001754372 211
770 3300032002 Ga0307416_100346440 Ga0307416_1003464401 211
771 3300032002 Ga0307416_100972711 Ga0307416_1009727111 211
772 3300032004 Ga0307414_10105838 Ga0307414_101058382 211
773 3300032004 Ga0307414_10131771 Ga0307414_101317712 211
774 3300032005 Ga0307411_10021424 Ga0307411_100214242 211
775 3300032005 Ga0307411_10156766 Ga0307411_101567662 211
776 3300032005 Ga0307411_10563882 Ga0307411_105638822 211
777 3300032126 Ga0307415_100018631 Ga0307415_1000186312 211
778 3300032126 Ga0307415_100306267 Ga0307415_1003062672 211
779 3300033179 Ga0307507_10098806 Ga0307507_100988062 211
780 3300033180 Ga0307510_10000290 Ga0307510_1000029043 211
781 3300033180 Ga0307510_10017949 Ga0307510_100179492 211
782 3300033180 Ga0307510_10047591 Ga0307510_100475915 211
783 3300035085 Ga0373929_0015023 Ga0373929_0015023_498_1145 211
784 3300035086 Ga0373934_0023865 Ga0373934_0023865_660_1298 211
785 3300035089 Ga0373944_0072545 Ga0373944_0072545_453_1088 211
786 3300035091 Ga0373951_0005569 Ga0373951_0005569_923_1570 211
787 3300035111 Ga0373923_0114744 Ga0373923_0114744_60_698 211
788 3300035112 Ga0373932_0040585 Ga0373932_0040585_310_948 211
789 3300035113 Ga0373936_0073989 Ga0373936_0073989_754_1389 211
790 3300035114 Ga0373939_0000052 Ga0373939_0000052_20301_20948 211
791 3300035116 Ga0373945_0017131 Ga0373945_0017131_176_811 211
792 3300035119 Ga0373956_0130505 Ga0373956_0130505_159_794 211
793 3300035121 Ga0373960_0000046 Ga0373960_0000046_2929_3576 211
794 3300035170 Ga0373943_0236197 Ga0373943_0236197_107_745 211
795 3300035171 Ga0373946_0028979 Ga0373946_0028979_363_998 211
796 3300035172 Ga0373955_0090201 Ga0373955_0090201_895_1530 211
797 3300035207 Ga0373942_0112013 Ga0373942_0112013_102_740 211
798 3300035241 Ga0373961_0067761 Ga0373961_0067761_12_647 211
799 3300035242 Ga0373962_0060676 Ga0373962_0060676_20_655 211
800 3300035410 Ga0373924_0007452 Ga0373924_0007452_385_1020 211
801 3300035691 Ga0373931_0000306 Ga0373931_0000306_7847_8494 211
802 3300035691 Ga0373931_0005476 Ga0373931_0005476_1892_2527 211
803 3300035691 Ga0373931_0022624 Ga0373931_0022624_31_669 211
804 3300035691 Ga0373931_0051848 Ga0373931_0051848_858_1493 211
805 3300035725 Ga0373947_0062559 Ga0373947_0062559_635_1270 211
806 3300036401 Ga0373937_0635691 Ga0373937_0635691_351_986 211
807 3300036401 Ga0373937_0760290 Ga0373937_0760290_35_670 211
808 3300037312 Ga0395899_0055205 Ga0395899_0055205_1304_1942 211
809 3300037418 Ga0395900_0000234 Ga0395900_0000234_5964_6599 211
810 3300037466 Ga0395898_0002077 Ga0395898_0002077_5964_6599 211
811 3300037466 Ga0395898_0038952 Ga0395898_0038952_3741_4379 211
812 3300037466 Ga0395898_0458094 Ga0395898_0458094_485_1120 211
813 3300037471 Ga0395905_0000071 Ga0395905_0000071_51955_52602 211
814 3300037471 Ga0395905_0003377 Ga0395905_0003377_13828_14463 211
815 3300037471 Ga0395905_0013883 Ga0395905_0013883_4942_5580 211
816 3300037471 Ga0395905_0023686 Ga0395905_0023686_456_1091 211
817 3300037471 Ga0395905_0098886 Ga0395905_0098886_1495_2130 211
818 3300037471 Ga0395905_0252928 Ga0395905_0252928_461_1096 211
819 3300037471 Ga0395905_0297698 Ga0395905_0297698_827_1462 211
820 3300039447 Ga0436361_0530495 Ga0436361_0530495_50893_51540 211
821 3300039447 Ga0436361_0714096 Ga0436361_0714096_2182_2829 211
822 3300039447 Ga0436361_0736070 Ga0436361_0736070_40700_41347 211
823 3300039447 Ga0436361_1123281 Ga0436361_1123281_894_1529 211
824 3300039447 Ga0436361_1146345 Ga0436361_1146345_634_1281 211
825 3300039450 Ga0436363_0219629 Ga0436363_0219629_1545_2180 211
826 3300041410 Ga0439461_0003089 Ga0439461_0003089_249_896 211
827 3300041498 Ga0451841_0251967 Ga0451841_0251967_641_1276 211
828 3300041501 Ga0451845_0255285 Ga0451845_0255285_23_658 211
829 3300041512 Ga0451853_3187860 Ga0451853_3187860_121_756 211
830 3300041997 Ga0439431_0037467 Ga0439431_0037467_140_775 211
831 3300042000 Ga0439437_000789 Ga0439437_000789_979_1626 211
832 3300042005 Ga0439448_0023434 Ga0439448_0023434_638_1273 211
833 3300042007 Ga0439449_0092752 Ga0439449_0092752_113_751 211
834 3300042012 Ga0439455_0073873 Ga0439455_0073873_76_723 211
835 3300042120 Ga0450917_000257 Ga0450917_000257_280_927 211
836 3300042126 Ga0450888_009728 Ga0450888_009728_438_1085 211
837 3300042127 Ga0450890_000264 Ga0450890_000264_1720_2367 211
838 3300042129 Ga0450891_000152 Ga0450891_000152_647_1294 211
839 3300042130 Ga0450892_003518 Ga0450892_003518_609_1256 211
840 3300042134 Ga0450898_014614 Ga0450898_014614_655_1290 211
841 3300042137 Ga0450902_002830 Ga0450902_002830_487_1134 211
842 3300042138 Ga0450903_012132 Ga0450903_012132_192_839 211
843 3300042156 Ga0439446_0063298 Ga0439446_0063298_182_817 211
844 3300042185 Ga0450909_041080 Ga0450909_041080_28_666 211
845 3300042439 Ga0439464_0008819 Ga0439464_0008819_247_882 211
846 3300042439 Ga0439464_0089683 Ga0439464_0089683_49_684 211
847 3300042439 Ga0439464_0113386 Ga0439464_0113386_131_766 211
848 3300042530 Ga0450916_000178 Ga0450916_000178_1105_1752 211
849 3300042532 Ga0450893_0015032 Ga0450893_0015032_35_670 211
850 3300042876 Ga0451577_0003841 Ga0451577_0003841_12888_13529 211
851 3300042876 Ga0451577_0022062 Ga0451577_0022062_3729_4367 211
852 3300042876 Ga0451577_0411673 Ga0451577_0411673_480_1115 211
853 3300044656 Ga0466969_0000028 Ga0466969_0000028_50280_50915 211
854 3300044656 Ga0466969_0008493 Ga0466969_0008493_3504_4142 211
855 3300044656 Ga0466969_0035623 Ga0466969_0035623_1262_1897 211
856 3300044656 Ga0466969_0038616 Ga0466969_0038616_1744_2379 211
857 3300044658 Ga0466972_0006558 Ga0466972_0006558_4446_5081 211
858 3300044658 Ga0466972_0136163 Ga0466972_0136163_368_1003 211
859 3300044673 Ga0453683_0169899 Ga0453683_0169899_196_831 211
860 3300044673 Ga0453683_0292855 Ga0453683_0292855_138_773 211
861 3300044673 Ga0453683_0361107 Ga0453683_0361107_44_679 211
862 3300044683 Ga0466965_0003252 Ga0466965_0003252_3267_3905 211
863 3300044683 Ga0466965_0030115 Ga0466965_0030115_664_1299 211
864 3300044683 Ga0466965_0340859 Ga0466965_0340859_74_709 211
865 3300044684 Ga0466966_0005301 Ga0466966_0005301_1076_1714 211
866 3300044684 Ga0466966_0051843 Ga0466966_0051843_302_937 211
867 3300044684 Ga0466966_0087476 Ga0466966_0087476_207_842 211
868 3300044693 Ga0466961_0003217 Ga0466961_0003217_2269_2904 211
869 3300044693 Ga0466961_0004039 Ga0466961_0004039_8512_9150 211
870 3300044693 Ga0466961_0019292 Ga0466961_0019292_3674_4309 211
871 3300044693 Ga0466961_0273075 Ga0466961_0273075_213_848 211
872 3300044694 Ga0466963_0000935 Ga0466963_0000935_7540_8175 211
873 3300044694 Ga0466963_0236218 Ga0466963_0236218_409_1047 211
874 3300044706 Ga0466964_0024421 Ga0466964_0024421_516_1151 211
875 3300044712 Ga0453684_0006446 Ga0453684_0006446_2124_2759 211
876 3300044712 Ga0453684_0059806 Ga0453684_0059806_1291_1926 211
877 3300044712 Ga0453684_0110760 Ga0453684_0110760_2546_3187 211
878 3300044712 Ga0453684_0331179 Ga0453684_0331179_839_1477 211
879 3300044719 Ga0466971_0005541 Ga0466971_0005541_647_1285 211
880 3300044719 Ga0466971_0168982 Ga0466971_0168982_90_725 211
881 3300044735 Ga0466968_0019767 Ga0466968_0019767_756_1394 211
882 3300044735 Ga0466968_0061625 Ga0466968_0061625_329_964 211
883 3300044765 Ga0466970_0015254 Ga0466970_0015254_2342_2977 211
884 3300044842 Ga0466957_0007668 Ga0466957_0007668_2412_3047 211
885 3300044842 Ga0466957_0022945 Ga0466957_0022945_2735_3373 211
886 3300044901 Ga0466960_0005647 Ga0466960_0005647_1415_2050 211
887 3300044901 Ga0466960_0076434 Ga0466960_0076434_565_1200 211
888 3300044901 Ga0466960_0084285 Ga0466960_0084285_659_1294 211
889 3300044901 Ga0466960_0256171 Ga0466960_0256171_151_786 211
890 3300045049 Ga0466959_0001550 Ga0466959_0001550_11977_12615 211
891 3300045049 Ga0466959_0037485 Ga0466959_0037485_2912_3547 211
892 3300045049 Ga0466959_0686504 Ga0466959_0686504_27_662 211
893 3300045051 Ga0451576_0021518 Ga0451576_0021518_2647_3282 211
894 3300045051 Ga0451576_0366908 Ga0451576_0366908_567_1202 211
895 3300045051 Ga0451576_0636493 Ga0451576_0636493_472_1107 211
896 3300045836 Ga0466958_0015363 Ga0466958_0015363_3437_4075 211
897 3300045836 Ga0466958_0023688 Ga0466958_0023688_2300_2935 211
898 3300045836 Ga0466958_0382727 Ga0466958_0382727_67_702 211
899 3300045976 Ga0466967_0021184 Ga0466967_0021184_4355_4990 211
900 3300045976 Ga0466967_0076045 Ga0466967_0076045_1643_2281 211
901 3300046454 Ga0495592_0000758 Ga0495592_0000758_16044_16682 211
902 3300046454 Ga0495592_0423289 Ga0495592_0423289_45_680 211
903 3300046457 Ga0495590_0004523 Ga0495590_0004523_3760_4395 211
904 3300046459 Ga0495629_0058817 Ga0495629_0058817_1204_1839 211
905 3300046459 Ga0495629_0170766 Ga0495629_0170766_26_661 211
906 3300046462 Ga0495651_0223717 Ga0495651_0223717_331_966 211
907 3300046471 Ga0495650_0018864 Ga0495650_0018864_2522_3157 211
908 3300046471 Ga0495650_0052598 Ga0495650_0052598_339_974 211
909 3300046472 Ga0495580_0028564 Ga0495580_0028564_3020_3655 211
910 3300046475 Ga0495639_0188546 Ga0495639_0188546_359_994 211
911 3300046476 Ga0495662_0172547 Ga0495662_0172547_22_657 211
912 3300046492 Ga0495585_0009636 Ga0495585_0009636_1459_2094 211
913 3300046506 Ga0495583_0000350 Ga0495583_0000350_22690_23328 211
914 3300046507 Ga0495606_0004217 Ga0495606_0004217_4685_5323 211
915 3300046507 Ga0495606_0319309 Ga0495606_0319309_70_708 211
916 3300046512 Ga0495610_0120867 Ga0495610_0120867_433_1068 211
917 3300046515 Ga0495620_0066992 Ga0495620_0066992_45_683 211
918 3300046516 Ga0495628_0096500 Ga0495628_0096500_23_658 211
919 3300046517 Ga0495630_0178524 Ga0495630_0178524_340_978 211
920 3300046519 Ga0495632_0004044 Ga0495632_0004044_901_1539 211
921 3300046519 Ga0495632_0096251 Ga0495632_0096251_235_873 211
922 3300046524 Ga0495648_0100293 Ga0495648_0100293_272_910 211
923 3300046526 Ga0495666_0094779 Ga0495666_0094779_332_970 211
924 3300046529 Ga0495652_0226567 Ga0495652_0226567_643_1278 211
925 3300046537 Ga0495598_0055036 Ga0495598_0055036_407_1042 211
926 3300046542 Ga0495597_0027211 Ga0495597_0027211_33_671 211
927 3300046542 Ga0495597_0073969 Ga0495597_0073969_611_1249 211
928 3300046542 Ga0495597_0134519 Ga0495597_0134519_152_790 211
929 3300046543 Ga0495645_0161563 Ga0495645_0161563_452_1087 211
930 3300046543 Ga0495645_0297267 Ga0495645_0297267_200_835 211
931 3300046557 Ga0495622_0258499 Ga0495622_0258499_21_659 211
932 3300046558 Ga0495633_0164056 Ga0495633_0164056_104_739 211
933 3300046615 Ga0495656_0324462 Ga0495656_0324462_49_684 211
934 3300046616 Ga0495668_0082116 Ga0495668_0082116_807_1445 211
935 3300046616 Ga0495668_0228685 Ga0495668_0228685_227_865 211
936 3300046642 Ga0495634_0182064 Ga0495634_0182064_627_1262 211
937 3300046660 Ga0495625_0005026 Ga0495625_0005026_743_1381 211
938 3300046660 Ga0495625_0018498 Ga0495625_0018498_2389_3027 211
939 3300046660 Ga0495625_0158084 Ga0495625_0158084_508_1146 211
940 3300046665 Ga0495661_0180834 Ga0495661_0180834_243_881 211
941 3300046680 Ga0495646_0134148 Ga0495646_0134148_51_689 211
942 3300046681 Ga0495647_0036783 Ga0495647_0036783_90_725 211
943 3300046683 Ga0495658_0009721 Ga0495658_0009721_2915_3550 211
944 3300046683 Ga0495658_0079957 Ga0495658_0079957_1243_1878 211
945 3300046683 Ga0495658_0118772 Ga0495658_0118772_882_1517 211
946 3300046683 Ga0495658_0206270 Ga0495658_0206270_248_886 211
947 3300046684 Ga0495669_0005767 Ga0495669_0005767_2084_2722 211
948 3300046690 Ga0495624_0144328 Ga0495624_0144328_158_796 211
949 3300046691 Ga0495670_0243320 Ga0495670_0243320_266_901 211
950 3300046694 Ga0495649_0000845 Ga0495649_0000845_896_1534 211
951 3300046794 Ga0495589_0010997 Ga0495589_0010997_3144_3782 211
952 3300046809 Ga0495600_0228715 Ga0495600_0228715_217_852 211
953 3300046810 Ga0495660_0034083 Ga0495660_0034083_459_1097 211
954 3300046810 Ga0495660_0055072 Ga0495660_0055072_1443_2078 211
955 3300047319 Ga0495674_0141275 Ga0495674_0141275_833_1468 211
956 3300047321 Ga0495676_0201211 Ga0495676_0201211_327_965 211
957 3300047443 Ga0495687_000914 Ga0495687_000914_15153_15791 211
958 3300047443 Ga0495687_022484 Ga0495687_022484_374_1012 211
959 3300047469 Ga0495673_0097251 Ga0495673_0097251_547_1185 211
960 3300047471 Ga0495684_0281050 Ga0495684_0281050_345_980 211
961 3300047471 Ga0495684_0441577 Ga0495684_0441577_186_821 211
962 3300047472 Ga0495686_0002064 Ga0495686_0002064_1719_2357 211
963 3300047472 Ga0495686_0036043 Ga0495686_0036043_2510_3145 211
964 3300048089 Ga0495614_0076511 Ga0495614_0076511_518_1153 211
965 3300048903 Ga0496100_0105749 Ga0496100_0105749_842_1477 211
966 3300048904 Ga0496101_0193368 Ga0496101_0193368_240_878 211
967 3300048905 Ga0496102_0087881 Ga0496102_0087881_1299_1934 211
968 3300048907 Ga0496104_0199179 Ga0496104_0199179_1269_1904 211
969 3300048907 Ga0496104_0206468 Ga0496104_0206468_871_1506 211
970 3300048907 Ga0496104_0521547 Ga0496104_0521547_187_822 211
971 3300048908 Ga0496105_0040297 Ga0496105_0040297_1177_1812 211
972 3300048908 Ga0496105_0664932 Ga0496105_0664932_70_705 211
973 3300048909 Ga0496106_0002082 Ga0496106_0002082_10567_11202 211
974 3300048909 Ga0496106_0011064 Ga0496106_0011064_5955_6593 211
975 3300048909 Ga0496106_0364633 Ga0496106_0364633_478_1113 211
976 3300048910 Ga0496107_0058705 Ga0496107_0058705_1059_1694 211
977 3300048911 Ga0496108_0308711 Ga0496108_0308711_678_1313 211
978 3300048912 Ga0496109_0172715 Ga0496109_0172715_773_1408 211
979 3300048912 Ga0496109_0191070 Ga0496109_0191070_919_1554 211
980 3300048913 Ga0496110_0984120 Ga0496110_0984120_10_645 211
981 3300048916 Ga0496113_0436649 Ga0496113_0436649_312_950 211
982 3300048917 Ga0496114_0118552 Ga0496114_0118552_1007_1642 211
983 3300048917 Ga0496114_0120807 Ga0496114_0120807_1558_2193 211
984 3300048918 Ga0496115_0007508 Ga0496115_0007508_1372_2007 211
985 3300048921 Ga0496118_0065767 Ga0496118_0065767_1937_2572 211
986 3300048924 Ga0496121_0017965 Ga0496121_0017965_2509_3144 211
987 3300048925 Ga0496122_0164935 Ga0496122_0164935_76_711 211
988 3300048927 Ga0496124_0001253 Ga0496124_0001253_15970_16605 211
989 3300048927 Ga0496124_0165397 Ga0496124_0165397_725_1477 211
990 3300048928 Ga0496125_0086553 Ga0496125_0086553_269_904 211
991 3300048928 Ga0496125_0179123 Ga0496125_0179123_192_830 211
992 3300049515 Ga0501292_003863 Ga0501292_003863_374_1009 211
993 3300049520 Ga0501297_000622 Ga0501297_000622_2335_2982 211
994 3300049521 Ga0501298_021543 Ga0501298_021543_476_1123 211
995 3300049526 Ga0501303_005764 Ga0501303_005764_259_894 211
996 3300049569 Ga0501032_0222241 Ga0501032_0222241_14_649 211
997 3300049572 Ga0501036_0154458 Ga0501036_0154458_461_1102 211
998 3300049579 Ga0501043_0005029 Ga0501043_0005029_405_1040 211
999 3300049580 Ga0501046_0006030 Ga0501046_0006030_9837_10472 211
1000 3300049580 Ga0501046_0470263 Ga0501046_0470263_89_730 211
1001 3300049581 Ga0501047_0000069 Ga0501047_0000069_92428_93063 211
1002 3300049582 Ga0501048_0051092 Ga0501048_0051092_309_944 211
1003 3300049588 Ga0501072_0488323 Ga0501072_0488323_69_710 211
1004 3300049649 Ga0501198_000014 Ga0501198_000014_99139_99774 211
1005 3300049653 Ga0501206_003976 Ga0501206_003976_266_913 211
1006 3300049654 Ga0501207_027951 Ga0501207_027951_278_925 211
1007 3300049655 Ga0501208_050179 Ga0501208_050179_127_774 211
1008 3300049658 Ga0501211_000534 Ga0501211_000534_1639_2286 211
1009 3300049662 Ga0501222_000008 Ga0501222_000008_4710_5345 211
1010 3300049662 Ga0501222_019566 Ga0501222_019566_214_861 211
1011 3300049665 Ga0501227_012640 Ga0501227_012640_781_1428 211
1012 3300049668 Ga0501233_004919 Ga0501233_004919_289_936 211
1013 3300049669 Ga0501235_057419 Ga0501235_057419_198_845 211
1014 3300049682 Ga0501252_012540 Ga0501252_012540_140_787 211
1015 3300049683 Ga0501253_000616 Ga0501253_000616_673_1308 211
1016 3300049683 Ga0501253_073368 Ga0501253_073368_11_646 211
1017 3300049686 Ga0501257_005139 Ga0501257_005139_1233_1868 211
1018 3300049686 Ga0501257_038050 Ga0501257_038050_494_1129 211
1019 3300049688 Ga0501259_055906 Ga0501259_055906_54_701 211
1020 3300049704 Ga0501221_001653 Ga0501221_001653_2729_3376 211
1021 3300049757 Ga0501232_000918 Ga0501232_000918_95_742 211
1022 3300049759 Ga0501262_004308 Ga0501262_004308_690_1325 211
1023 3300049762 Ga0501265_003041 Ga0501265_003041_960_1595 211
1024 3300049762 Ga0501265_027412 Ga0501265_027412_58_693 211
1025 3300049769 Ga0501272_012285 Ga0501272_012285_314_961 211
1026 3300049770 Ga0501273_018490 Ga0501273_018490_248_886 211
1027 3300049822 Ga0501035_0102307 Ga0501035_0102307_554_1189 211
1028 3300049822 Ga0501035_0426257 Ga0501035_0426257_264_899 211
1029 3300049824 Ga0501045_0066678 Ga0501045_0066678_1766_2401 211
1030 3300049853 Ga0501226_007204 Ga0501226_007204_196_843 211
1031 3300050489 nmdc:mga03683_125525_c1 nmdc:mga03683_125525_c1_49_684 211
1032 3300050489 nmdc:mga03683_2130_c1 nmdc:mga03683_2130_c1_4778_5416 211
1033 3300050489 nmdc:mga03683_221524_c1 nmdc:mga03683_221524_c1_103_741 211
1034 3300050489 nmdc:mga03683_3440_c1 nmdc:mga03683_3440_c1_3217_3855 211
1035 3300050489 nmdc:mga03683_48243_c1 nmdc:mga03683_48243_c1_770_1408 211
1036 3300050490 nmdc:mga03n38_158500_c1 nmdc:mga03n38_158500_c1_315_953 211
1037 3300050490 nmdc:mga03n38_53897_c1 nmdc:mga03n38_53897_c1_562_1200 211
1038 3300050491 nmdc:mga00v17_15606_c1 nmdc:mga00v17_15606_c1_144_782 211
1039 3300050491 nmdc:mga00v17_55125_c1 nmdc:mga00v17_55125_c1_1032_1670 211
1040 3300050492 nmdc:mga0yw44_117492_c1 nmdc:mga0yw44_117492_c1_549_1187 211
1041 3300050493 nmdc:mga0k408_11201_c1 nmdc:mga0k408_11201_c1_2218_2856 211
1042 3300050493 nmdc:mga0k408_139607_c1 nmdc:mga0k408_139607_c1_340_987 211
1043 3300050493 nmdc:mga0k408_162371_c1 nmdc:mga0k408_162371_c1_622_1260 211
1044 3300050493 nmdc:mga0k408_18066_c1 nmdc:mga0k408_18066_c1_741_1379 211
1045 3300050493 nmdc:mga0k408_1823_c1 nmdc:mga0k408_1823_c1_8854_9492 211
1046 3300050493 nmdc:mga0k408_2121_c1 nmdc:mga0k408_2121_c1_4617_5255 211
1047 3300050493 nmdc:mga0k408_2568_c1 nmdc:mga0k408_2568_c1_7075_7713 211
1048 3300050493 nmdc:mga0k408_3529_c1 nmdc:mga0k408_3529_c1_5374_6012 211
1049 3300050493 nmdc:mga0k408_3796_c1 nmdc:mga0k408_3796_c1_687_1325 211
1050 3300050493 nmdc:mga0k408_395218_c1 nmdc:mga0k408_395218_c1_85_723 211
1051 3300050493 nmdc:mga0k408_431352_c1 nmdc:mga0k408_431352_c1_49_687 211
1052 3300050493 nmdc:mga0k408_478719_c1 nmdc:mga0k408_478719_c1_48_683 211
1053 3300050493 nmdc:mga0k408_5099_c1 nmdc:mga0k408_5099_c1_5459_6094 211
1054 3300050493 nmdc:mga0k408_65024_c1 nmdc:mga0k408_65024_c1_914_1552 211
1055 3300050493 nmdc:mga0k408_97350_c1 nmdc:mga0k408_97350_c1_763_1398 211
1056 3300050494 nmdc:mga06z11_23705_c1 nmdc:mga06z11_23705_c1_1552_2190 211
1057 3300050494 nmdc:mga06z11_33392_c1 nmdc:mga06z11_33392_c1_1203_1841 211
1058 3300050495 nmdc:mga04h51_122173_c1 nmdc:mga04h51_122173_c1_136_774 211
1059 3300050495 nmdc:mga04h51_16186_c1 nmdc:mga04h51_16186_c1_205_843 211
1060 3300050496 nmdc:mga07m45_109980_c1 nmdc:mga07m45_109980_c1_751_1389 211
1061 3300050496 nmdc:mga07m45_13565_c1 nmdc:mga07m45_13565_c1_782_1420 211
1062 3300050496 nmdc:mga07m45_1396_c1 nmdc:mga07m45_1396_c1_2154_2792 211
1063 3300050496 nmdc:mga07m45_149384_c1 nmdc:mga07m45_149384_c1_394_1032 211
1064 3300050496 nmdc:mga07m45_16974_c1 nmdc:mga07m45_16974_c1_1842_2480 211
1065 3300050496 nmdc:mga07m45_169790_c1 nmdc:mga07m45_169790_c1_400_1038 211
1066 3300050496 nmdc:mga07m45_703_c1 nmdc:mga07m45_703_c1_3519_4160 211
1067 3300050496 nmdc:mga07m45_8060_c1 nmdc:mga07m45_8060_c1_964_1602 211
1068 3300050496 nmdc:mga07m45_8068_c1 nmdc:mga07m45_8068_c1_2234_2872 211
1069 3300050507 nmdc:mga05p37_604576_c1 nmdc:mga05p37_604576_c1_374_1009 211
1070 3300050508 nmdc:mga09592_14154_c1 nmdc:mga09592_14154_c1_5081_5716 211
1071 3300050512 nmdc:mga0n895_1021423_c1 nmdc:mga0n895_1021423_c1_119_754 211
1072 3300050514 nmdc:mga08x19_441838_c1 nmdc:mga08x19_441838_c1_175_810 211
1073 3300050516 nmdc:mga0sz30_24868_c1 nmdc:mga0sz30_24868_c1_1300_1938 211
1074 3300050516 nmdc:mga0sz30_44355_c1 nmdc:mga0sz30_44355_c1_782_1420 211
1075 3300053077 Ga0495601_0156675 Ga0495601_0156675_425_1060 211
1076 3300053077 Ga0495601_0252829 Ga0495601_0252829_279_914 211
1077 3300053078 Ga0495612_0179828 Ga0495612_0179828_213_848 211
1078 3300053080 Ga0500635_0000686 Ga0500635_0000686_5843_6478 211
1079 3300053080 Ga0500635_0006628 Ga0500635_0006628_1560_2198 211
1080 3300053084 Ga0495595_0151240 Ga0495595_0151240_204_839 211
1081 3300053085 Ga0495619_0020424 Ga0495619_0020424_1573_2208 211
1082 3300053088 Ga0500644_0022077 Ga0500644_0022077_575_1213 211
1083 3300053092 Ga0500583_0194321 Ga0500583_0194321_345_983 211
1084 3300053093 Ga0500651_0030735 Ga0500651_0030735_691_1329 211
1085 3300053118 Ga0500594_0004520 Ga0500594_0004520_1224_1862 211
1086 3300053121 Ga0500607_183554 Ga0500607_183554_28_666 211
1087 3300053131 Ga0500652_024874 Ga0500652_024874_716_1381 211
1088 3300053134 Ga0500658_0001688 Ga0500658_0001688_2690_3328 211
1089 3300053136 Ga0500559_0000717 Ga0500559_0000717_8849_9487 211
1090 3300053139 Ga0500568_0009618 Ga0500568_0009618_373_1011 211
1091 3300053148 Ga0500590_004936 Ga0500590_004936_3314_3949 211
1092 3300053156 Ga0500622_0004562 Ga0500622_0004562_7237_7875 211
1093 3300053177 Ga0500636_0011589 Ga0500636_0011589_1785_2423 211
1094 3300053739 Ga0500587_005832 Ga0500587_005832_312_950 211
1095 3300060353 Ga0501082_0289178 Ga0501082_0289178_627_1268 211
1096 3300061719 Ga0466962_0004095 Ga0466962_0004095_1992_2630 211
1097 3300061719 Ga0466962_0017132 Ga0466962_0017132_954_1589 211
1098 3300001979 JGI24740J21852_10019248 JGI24740J21852_100192483 212
1099 3300002773 JGI25152J39213_1000320 JGI25152J39213_100032036 212
1100 3300002774 JGI25150J39212_1022531 JGI25150J39212_10225311 212
1101 3300003215 JGI25153J46596_10010193 JGI25153J46596_100101935 212
1102 3300003320 rootH2_10018416 rootH2_100184161 212
1103 3300003771 Ga0055526_1002642 Ga0055526_10026427 212
1104 3300003771 Ga0055526_1002801 Ga0055526_100280111 212
1105 3300003775 Ga0055524_1000233 Ga0055524_100023310 212
1106 3300003775 Ga0055524_1001969 Ga0055524_100196911 212
1107 3300003775 Ga0055524_1013683 Ga0055524_10136832 212
1108 3300003791 Ga0055530_10006306 Ga0055530_100063065 212
1109 3300003792 Ga0055540_1000080 Ga0055540_1000080102 212
1110 3300003794 Ga0055531_10005579 Ga0055531_100055795 212
1111 3300004625 Ga0055543_1004230 Ga0055543_10042304 212
1112 3300004625 Ga0055543_1024592 Ga0055543_10245922 212
1113 3300005262 Ga0065165_1000390 Ga0065165_100039052 212
1114 3300005262 Ga0065165_1001585 Ga0065165_100158522 212
1115 3300005262 Ga0065165_1003937 Ga0065165_10039371 212
1116 3300005295 Ga0065707_10186254 Ga0065707_101862541 212
1117 3300005334 Ga0068869_100280110 Ga0068869_1002801101 212
1118 3300005339 Ga0070660_100443902 Ga0070660_1004439022 212
1119 3300005353 Ga0070669_100252329 Ga0070669_1002523292 212
1120 3300005366 Ga0070659_100006770 Ga0070659_1000067704 212
1121 3300005367 Ga0070667_100075701 Ga0070667_1000757013 212
1122 3300005441 Ga0070700_100066458 Ga0070700_1000664583 212
1123 3300005459 Ga0068867_100001329 Ga0068867_10000132911 212
1124 3300005563 Ga0068855_100580319 Ga0068855_1005803192 212
1125 3300005564 Ga0070664_100063519 Ga0070664_1000635192 212
1126 3300005617 Ga0068859_100071420 Ga0068859_1000714205 212
1127 3300005718 Ga0068866_10148757 Ga0068866_101487572 212
1128 3300005719 Ga0068861_100006277 Ga0068861_1000062777 212
1129 3300005842 Ga0068858_100126830 Ga0068858_1001268303 212
1130 3300005843 Ga0068860_100005402 Ga0068860_1000054027 212
1131 3300005844 Ga0068862_100008011 Ga0068862_1000080115 212
1132 3300005844 Ga0068862_100038900 Ga0068862_1000389005 212
1133 3300006048 Ga0075363_100005031 Ga0075363_1000050315 212
1134 3300006048 Ga0075363_100311951 Ga0075363_1003119512 212
1135 3300006177 Ga0075362_10065172 Ga0075362_100651722 212
1136 3300006178 Ga0075367_10033742 Ga0075367_100337421 212
1137 3300006186 Ga0075369_10024429 Ga0075369_100244291 212
1138 3300006195 Ga0075366_10005321 Ga0075366_100053212 212
1139 3300006195 Ga0075366_10045754 Ga0075366_100457541 212
1140 3300006195 Ga0075366_10085889 Ga0075366_100858892 212
1141 3300006195 Ga0075366_10290481 Ga0075366_102904812 212
1142 3300006353 Ga0075370_10000898 Ga0075370_100008985 212
1143 3300006353 Ga0075370_10007605 Ga0075370_100076055 212
1144 3300006881 Ga0068865_100010176 Ga0068865_1000101766 212
1145 3300006931 Ga0097620_100071419 Ga0097620_1000714195 212
1146 3300006944 Ga0099823_1000163 Ga0099823_10001638 212
1147 3300006946 Ga0079104_1001201 Ga0079104_10012019 212
1148 3300009094 Ga0111539_10877273 Ga0111539_108772732 212
1149 3300009148 Ga0105243_10345824 Ga0105243_103458242 212
1150 3300012497 Ga0157319_1000003 Ga0157319_1000003323 212
1151 3300013297 Ga0157378_10024112 Ga0157378_100241126 212
1152 3300013306 Ga0163162_10003029 Ga0163162_100030297 212
1153 3300014326 Ga0157380_10034917 Ga0157380_100349173 212
1154 3300017792 Ga0163161_10291543 Ga0163161_102915431 212
1155 3300021361 Ga0213872_10000070 Ga0213872_1000007014 212
1156 3300021361 Ga0213872_10114075 Ga0213872_101140752 212
1157 3300025245 Ga0207425_1004382 Ga0207425_10043825 212
1158 3300025258 Ga0209129_1000027 Ga0209129_1000027385 212
1159 3300025258 Ga0209129_1027025 Ga0209129_10270252 212
1160 3300025273 Ga0209673_1009613 Ga0209673_10096135 212
1161 3300025273 Ga0209673_1014163 Ga0209673_10141634 212
1162 3300025273 Ga0209673_1018104 Ga0209673_10181042 212
1163 3300025273 Ga0209673_1018827 Ga0209673_10188272 212
1164 3300025295 Ga0209564_1000014 Ga0209564_1000014397 212
1165 3300025295 Ga0209564_1000051 Ga0209564_1000051128 212
1166 3300025297 Ga0209758_1000307 Ga0209758_100030753 212
1167 3300025297 Ga0209758_1000524 Ga0209758_100052450 212
1168 3300025298 Ga0209050_1002883 Ga0209050_10028833 212
1169 3300025298 Ga0209050_1003609 Ga0209050_10036099 212
1170 3300025298 Ga0209050_1009714 Ga0209050_10097145 212
1171 3300025298 Ga0209050_1025737 Ga0209050_10257372 212
1172 3300025299 Ga0209256_1000203 Ga0209256_1000203101 212
1173 3300025299 Ga0209256_1000675 Ga0209256_10006759 212
1174 3300025299 Ga0209256_1004060 Ga0209256_100406010 212
1175 3300025303 Ga0209051_1000035 Ga0209051_1000035101 212
1176 3300025303 Ga0209051_1000981 Ga0209051_100098129 212
1177 3300025303 Ga0209051_1048679 Ga0209051_10486791 212
1178 3300025304 Ga0209257_1000346 Ga0209257_100034660 212
1179 3300025304 Ga0209257_1002753 Ga0209257_10027535 212
1180 3300025304 Ga0209257_1003470 Ga0209257_100347012 212
1181 3300025304 Ga0209257_1086438 Ga0209257_10864381 212
1182 3300025893 Ga0207682_10171003 Ga0207682_101710032 212
1183 3300025907 Ga0207645_10084162 Ga0207645_100841623 212
1184 3300025919 Ga0207657_10389533 Ga0207657_103895331 212
1185 3300025920 Ga0207649_10004761 Ga0207649_100047613 212
1186 3300025932 Ga0207690_10005585 Ga0207690_100055854 212
1187 3300025935 Ga0207709_10405028 Ga0207709_104050282 212
1188 3300025942 Ga0207689_10499944 Ga0207689_104999442 212
1189 3300025945 Ga0207679_10000254 Ga0207679_1000025432 212
1190 3300025945 Ga0207679_10034063 Ga0207679_100340633 212
1191 3300025961 Ga0207712_10103114 Ga0207712_101031142 212
1192 3300025986 Ga0207658_10041908 Ga0207658_100419083 212
1193 3300026035 Ga0207703_10317796 Ga0207703_103177962 212
1194 3300026075 Ga0207708_10075580 Ga0207708_100755804 212
1195 3300026089 Ga0207648_10000439 Ga0207648_100004397 212
1196 3300026095 Ga0207676_10228543 Ga0207676_102285432 212
1197 3300026118 Ga0207675_100001184 Ga0207675_1000011847 212
1198 3300027111 Ga0209281_1000076 Ga0209281_100007688 212
1199 3300027296 Ga0209389_1015795 Ga0209389_10157955 212
1200 3300027312 Ga0209371_1009954 Ga0209371_10099542 212
1201 3300027876 Ga0209974_10070507 Ga0209974_100705072 212
1202 3300028380 Ga0268265_10031835 Ga0268265_100318352 212
1203 3300028380 Ga0268265_10196163 Ga0268265_101961631 212
1204 3300028381 Ga0268264_10093598 Ga0268264_100935983 212
1205 3300028786 Ga0307517_10085334 Ga0307517_100853341 212
1206 3300030500 Ga0268256_1010113 Ga0268256_10101132 212
1207 3300031456 Ga0307513_10020866 Ga0307513_100208666 212
1208 3300031456 Ga0307513_10202548 Ga0307513_102025482 212
1209 3300031507 Ga0307509_10248866 Ga0307509_102488662 212
1210 3300031548 Ga0307408_100071579 Ga0307408_1000715792 212
1211 3300031616 Ga0307508_10001683 Ga0307508_100016835 212
1212 3300031649 Ga0307514_10078141 Ga0307514_100781412 212
1213 3300031730 Ga0307516_10003935 Ga0307516_1000393516 212
1214 3300032002 Ga0307416_101051971 Ga0307416_1010519711 212
1215 3300033179 Ga0307507_10040160 Ga0307507_100401606 212
1216 3300035083 Ga0373926_0076098 Ga0373926_0076098_472_1134 212
1217 3300035725 Ga0373947_0073103 Ga0373947_0073103_409_1071 212
1218 3300037068 Ga0373925_0014193 Ga0373925_0014193_4988_5650 212
1219 3300039447 Ga0436361_0443798 Ga0436361_0443798_1309_1956 212
1220 3300039447 Ga0436361_0735085 Ga0436361_0735085_605_1252 212
1221 3300041456 Ga0451795_1122439 Ga0451795_1122439_152_793 212
1222 3300041459 Ga0451800_0728199 Ga0451800_0728199_127_768 212
1223 3300041463 Ga0451804_0008258 Ga0451804_0008258_580_1221 212
1224 3300041463 Ga0451804_0650180 Ga0451804_0650180_1207_1848 212
1225 3300041511 Ga0451855_1813671 Ga0451855_1813671_27_668 212
1226 3300042011 Ga0439454_000320 Ga0439454_000320_243_890 212
1227 3300042122 Ga0450920_006579 Ga0450920_006579_580_1218 212
1228 3300042156 Ga0439446_0048361 Ga0439446_0048361_144_782 212
1229 3300042438 Ga0439459_0008070 Ga0439459_0008070_624_1271 212
1230 3300042531 Ga0450918_001808 Ga0450918_001808_2951_3589 212
1231 3300042876 Ga0451577_0002225 Ga0451577_0002225_13303_13968 212
1232 3300044712 Ga0453684_0072820 Ga0453684_0072820_3207_3860 212
1233 3300046460 Ga0495638_0078801 Ga0495638_0078801_1333_1974 212
1234 3300046472 Ga0495580_0403708 Ga0495580_0403708_117_779 212
1235 3300046512 Ga0495610_0132414 Ga0495610_0132414_324_965 212
1236 3300046512 Ga0495610_0219234 Ga0495610_0219234_39_680 212
1237 3300046519 Ga0495632_0025809 Ga0495632_0025809_2261_2902 212
1238 3300046519 Ga0495632_0058581 Ga0495632_0058581_786_1427 212
1239 3300046522 Ga0495643_0125248 Ga0495643_0125248_253_894 212
1240 3300046660 Ga0495625_0002284 Ga0495625_0002284_427_1068 212
1241 3300046681 Ga0495647_0055813 Ga0495647_0055813_744_1406 212
1242 3300046683 Ga0495658_0024713 Ga0495658_0024713_375_1037 212
1243 3300046691 Ga0495670_0016246 Ga0495670_0016246_1122_1769 212
1244 3300046692 Ga0495671_0318594 Ga0495671_0318594_17_658 212
1245 3300047472 Ga0495686_0293870 Ga0495686_0293870_16_657 212
1246 3300048905 Ga0496102_0018809 Ga0496102_0018809_4010_4648 212
1247 3300048905 Ga0496102_0029296 Ga0496102_0029296_4143_4784 212
1248 3300048917 Ga0496114_0004709 Ga0496114_0004709_1093_1731 212
1249 3300049592 Ga0501076_0558951 Ga0501076_0558951_203_859 212
1250 3300049592 Ga0501076_0739502 Ga0501076_0739502_72_728 212
1251 3300049741 Ga0501079_0882934 Ga0501079_0882934_27_665 212
1252 3300050489 nmdc:mga03683_20583_c1 nmdc:mga03683_20583_c1_918_1574 212
1253 3300050490 nmdc:mga03n38_9279_c1 nmdc:mga03n38_9279_c1_256_897 212
1254 3300050493 nmdc:mga0k408_247862_c1 nmdc:mga0k408_247862_c1_400_1041 212
1255 3300050493 nmdc:mga0k408_69910_c1 nmdc:mga0k408_69910_c1_762_1409 212
1256 3300050493 nmdc:mga0k408_81526_c1 nmdc:mga0k408_81526_c1_234_875 212
1257 3300050494 nmdc:mga06z11_21621_c1 nmdc:mga06z11_21621_c1_1824_2465 212
1258 3300050496 nmdc:mga07m45_17516_c1 nmdc:mga07m45_17516_c1_885_1532 212
1259 3300050496 nmdc:mga07m45_4379_c1 nmdc:mga07m45_4379_c1_3284_3925 212
1260 3300053086 Ga0500578_0000006 Ga0500578_0000006_46094_46735 212
1261 3300053088 Ga0500644_0099687 Ga0500644_0099687_241_882 212
1262 3300053088 Ga0500644_0110844 Ga0500644_0110844_370_1011 212
1263 3300053093 Ga0500651_0004274 Ga0500651_0004274_4997_5638 212
1264 3300053093 Ga0500651_0066076 Ga0500651_0066076_907_1548 212
1265 3300053098 Ga0500650_0139028 Ga0500650_0139028_333_974 212
1266 3300053108 Ga0500562_017531 Ga0500562_017531_207_848 212
1267 3300053117 Ga0500593_001497 Ga0500593_001497_3170_3811 212
1268 3300053117 Ga0500593_171330 Ga0500593_171330_19_660 212
1269 3300053127 Ga0500623_080702 Ga0500623_080702_655_1296 212
1270 3300053129 Ga0500628_033577 Ga0500628_033577_285_926 212
1271 3300053130 Ga0500642_0002917 Ga0500642_0002917_4336_4977 212
1272 3300053131 Ga0500652_000046 Ga0500652_000046_3362_4003 212
1273 3300053133 Ga0500655_004813 Ga0500655_004813_895_1536 212
1274 3300053139 Ga0500568_0013406 Ga0500568_0013406_297_938 212
1275 3300053142 Ga0500577_0004010 Ga0500577_0004010_3028_3669 212
1276 3300053146 Ga0500588_0014459 Ga0500588_0014459_1337_1978 212
1277 3300053151 Ga0500604_0004410 Ga0500604_0004410_2009_2650 212
1278 3300053156 Ga0500622_0000415 Ga0500622_0000415_12788_13429 212
1279 3300053156 Ga0500622_0009199 Ga0500622_0009199_2074_2721 212
1280 3300053156 Ga0500622_0156237 Ga0500622_0156237_108_749 212
1281 3300053156 Ga0500622_0172818 Ga0500622_0172818_205_846 212
1282 3300053739 Ga0500587_000461 Ga0500587_000461_557_1198 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

44

156

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

187

243

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9726 146 209
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9687 146 209
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9611 147 209
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9553 146 211
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9526 146 209
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9797 149 207 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9492 146 211 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.949 145 211 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.948 149 206 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.948 149 206 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2H6EJE6-F1-model_v4 Response regulator UvrY 0.9396 1 211 GO:0000160
GO:0003677
GO:0006355
AF-A0A2H6EJE6-F1-model_v4 Response regulator UvrY 0.9353 1 211 GO:0000160
GO:0003677
GO:0006355
AF-A0A662BIV3-F1-model_v4 DNA-binding response regulator 0.9266 1 143 GO:0000160
GO:0003677
AF-A0A2S7TR62-F1-model_v4 DNA-binding response regulator 0.9126 2 208 GO:0000160
GO:0003677
GO:0006355
AF-A0A4Q3WAF0-F1-model_v4 Response regulator transcription factor 0.9111 1 136 GO:0000160

Feature Viewer

pLDDT pTM Quality
90.18 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map