F492442

General Info

Members Datasets Scaffolds Average Seq Length
1273 641 1082 429

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0077685|Ga0496105_0077685_1002_2516
Length 496
Sequence MADSYFPRWRVQSRSVEGRVVNTDERLPGPQMLAMGIQHVVAMFGSTVLAPLLMGFDPNLCIFMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAITGYTGHGLNTNIPVALGGIIACGVVYVIIGLIVSAVGTAWIETLMPPVVTGSIVAVIGLNLAPIAVKGVSGSAFDSYMALVTVLCVGAVAVFTRGMLQRLLILVGLLIAYVIYAVVTNGMGMGKPIDFSIVANAAWFGMPHFTAPVFSGQAMALLAPVAVILVAENLGHIKAVSAMTGQNLDGYIGRAFIGDGLATVVSGFAGGTGVTTYAENIGVMAVTRIYSTLVFVIAAVIALVLGFSPKFGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNKVDFSDNRNLIVAAVTLVLGAGDFSLKFGGFALGGIGTATFGAIILYALLRRSARAGCLIQRSASARRAPAFSARRPFSCYLPFPRVSNAVSDRSTSRISLFIVSSLISVARSARIAASFI

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
10 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
11 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
12 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
13 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
14 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
15 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
16 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
17 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
18 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
19 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
20 2519103095 Burkholderia sp. KJ006 Isolate Nodule
21 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
22 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
23 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
24 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
25 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
26 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
27 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
28 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
29 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
30 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
31 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
32 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
33 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
34 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
35 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
36 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
37 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
38 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
39 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
40 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
41 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
42 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
43 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
44 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
45 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
46 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
47 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
48 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
49 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
50 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
51 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
52 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
53 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
54 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
55 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
56 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
57 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
58 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
59 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
60 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
61 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
62 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
63 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
64 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
65 2636415599 Klebsiella variicola DX120E Isolate Unclassified
66 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
67 2643221658 Variovorax sp. Root411 Isolate Unclassified
68 2643221672 Variovorax sp. Root434 Isolate Unclassified
69 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
70 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
71 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
72 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
73 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
74 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
75 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
76 2738541277 Variovorax sp. GV051 Isolate Unclassified
77 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
78 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
79 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
80 2738541307 Variovorax sp. GV008 Isolate Unclassified
81 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
82 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
83 2738543012 Acidovorax sp. CF301 Isolate Unclassified
84 2738543019 Variovorax sp. GV040 Isolate Unclassified
85 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
86 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
87 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
88 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
89 2775507074 Klebsiella sp. D5A Isolate Unclassified
90 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
91 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
92 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
93 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
94 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
95 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
96 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
97 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
98 2816332133 Acidovorax radicis 2721A Isolate Unclassified
99 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
100 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
101 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
102 2818991436 Collimonas arenae 515 Isolate Unclassified
103 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
104 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
105 2818991450 Burkholderia sp. 604 Isolate Unclassified
106 2818991452 Burkholderia cepacia 561 Isolate Unclassified
107 2831864461 Roseateles noduli HZ7 Isolate Nodule
108 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
109 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
110 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
111 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
112 2842677519 Variovorax sp. R-72495 Isolate Unclassified
113 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
114 2842733646 Variovorax sp. R-72446 Isolate Unclassified
115 2842747753 Variovorax sp. R-72060 Isolate Unclassified
116 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
117 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
118 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
119 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
120 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
121 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
122 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
123 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
124 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
125 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
126 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
127 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
128 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
129 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
130 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
131 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
132 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
133 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
134 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
135 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
136 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
137 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
138 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
139 2904564687 Burkholderia sp. 571 Isolate Unclassified
140 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
141 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
142 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
143 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
144 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
145 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
146 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
147 2919150387 Rahnella aceris 1817 Isolate Unclassified
148 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
149 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
150 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
151 2927143783 Rahnella sp. 2050 Isolate Unclassified
152 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
153 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
154 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
155 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
156 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
157 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
158 2928163908 Burkholderia sp. 567 Isolate Unclassified
159 2928170801 Burkholderia sp. 572 Isolate Unclassified
160 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
161 2928536128 Burkholderia sola 565 Isolate Unclassified
162 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
163 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
164 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
165 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
166 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
167 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
168 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
169 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
170 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
171 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
172 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
173 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
174 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
175 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
176 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
177 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
178 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
179 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
180 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
181 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
182 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
183 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
184 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
185 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
186 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
187 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
188 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
189 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
190 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
191 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
192 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
193 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
194 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
195 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
196 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
197 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
198 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
199 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
200 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
201 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
202 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
203 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
204 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
205 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
206 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
207 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
208 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
209 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
210 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
211 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
212 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
213 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
214 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
215 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
216 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
217 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
218 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
219 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
220 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
221 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
222 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
223 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
224 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
225 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
226 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
227 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
228 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
229 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
230 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
231 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
232 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
233 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
234 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
235 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
236 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
237 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
238 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
239 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
240 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
241 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
242 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
243 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
244 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
245 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
246 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
247 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
248 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
249 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
250 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
251 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
252 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
253 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
254 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
255 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
256 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
257 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
258 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
259 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
260 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
261 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
262 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
263 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
264 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
265 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
266 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
267 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
268 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
269 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
270 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
271 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
272 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
273 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
274 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
275 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
276 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
277 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
278 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
279 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
280 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
281 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
282 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
283 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
284 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
285 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
286 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
287 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
288 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
289 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
290 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
291 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
292 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
293 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
294 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
295 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
296 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
297 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
298 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
299 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
300 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
301 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
302 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
303 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
304 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
305 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
306 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
307 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
308 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
309 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
310 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
311 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
312 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
313 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
314 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
315 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
316 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
317 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
318 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
319 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
320 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
321 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
322 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
329 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
330 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
332 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
333 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
334 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
337 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
338 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
339 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
340 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
342 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
343 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
344 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
346 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
347 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
348 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
350 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
351 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
409 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
412 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
413 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
417 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
418 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
419 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
420 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
421 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
422 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
423 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
424 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
425 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
426 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
427 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
428 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
429 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
430 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
431 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
432 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
433 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
434 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
435 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
436 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
437 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
438 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
439 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
440 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
441 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
442 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
443 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
444 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
445 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
446 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
447 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
448 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
449 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
450 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
451 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
452 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
453 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
454 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
455 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
456 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
457 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
458 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
459 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
460 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
461 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
462 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
463 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
464 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
465 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
466 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
467 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
468 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
469 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
470 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
471 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
472 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
473 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
474 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
475 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
476 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
477 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
478 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
479 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
480 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
481 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
482 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
483 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
484 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
485 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
486 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
487 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
488 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
489 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
490 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
491 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
492 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
493 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
494 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
495 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
496 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
497 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
498 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
499 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
500 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
501 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
502 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
503 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
504 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
505 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
506 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
507 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
508 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
509 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
510 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
511 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
512 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
513 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
514 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
515 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
516 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
517 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
518 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
519 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
520 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
521 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
522 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
523 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
524 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
525 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
526 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
527 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
528 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
529 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
530 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
531 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
532 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
533 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
534 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
535 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
536 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
537 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
538 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
539 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
540 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
541 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
542 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
543 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
544 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
545 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
546 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
547 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
548 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
549 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
550 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
551 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
552 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
553 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
554 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
555 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
556 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
557 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
558 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
559 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
560 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
561 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
562 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
563 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
564 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
565 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
566 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
567 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
568 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
569 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
570 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
571 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
572 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
573 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
574 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
575 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
576 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
577 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
578 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
579 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
580 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
581 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
582 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
583 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
584 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
585 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
588 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
589 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
590 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
593 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
594 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
595 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
596 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
597 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
598 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
599 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
600 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
601 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
602 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
603 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
604 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
605 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
606 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
607 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
608 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
609 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
610 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
611 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
612 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
613 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
614 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
615 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
616 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
617 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
618 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
619 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
620 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
621 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
622 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
623 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
624 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
625 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
626 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
627 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
628 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
629 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
630 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
631 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
632 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
633 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
634 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
635 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
636 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
637 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
638 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
639 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
640 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
641 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.76
Metatranscriptomes 0.24
Isolates 15

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 19.01
Nodule 2.2
Rhizoplane 6.68
Rhizosphere 60.33
Stem 0
Stem Tuber 0
Unclassified 11.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003389 3300001979 Bacteria 7015
2 JGI24739J22299_10002488 3300001989 Bacteria 7112
3 JGI24739J22299_10034353 3300001989 Bacteria 1728
4 JGI24737J22298_10014326 3300001990 Bacteria 2574
5 JGI24735J21928_10001283 3300002067 Bacteria 8913
6 JGI24735J21928_10006478 3300002067 Bacteria 3852
7 JGI25155J39150_1000171 3300002704 Bacteria 28440
8 JGI25155J39150_1000201 3300002704 Bacteria 24800
9 JGI25156J39149_1000164 3300002705 Bacteria 48491
10 JGI25156J39149_1000647 3300002705 Bacteria 19031
11 JGI25156J39149_1004311 3300002705 Bacteria 4369
12 JGI25156J39149_1010618 3300002705 Bacteria 2150
13 JGI25162J39368_1000001 3300002737 Bacteria 740113
14 JGI25154J39366_1000114 3300002738 Bacteria 68169
15 JGI25154J39366_1000443 3300002738 Bacteria 22025
16 JGI25158J39367_1001141 3300002739 Bacteria 4819
17 JGI25157J39369_1000438 3300002741 Bacteria 26689
18 JGI25163J39215_1000124 3300002771 Bacteria 31687
19 JGI25163J39215_1003067 3300002771 Bacteria 1449
20 JGI25164J39214_1000062 3300002772 Bacteria 108882
21 JGI25152J39213_1010945 3300002773 Bacteria 2036
22 JGI25159J45721_1005654 3300002987 Bacteria 3888
23 JGI25165J46597_1000001 3300003214 Bacteria 1111887
24 JGI25165J46597_1001807 3300003214 Bacteria 9051
25 JGI25153J46596_10007733 3300003215 Bacteria 5232
26 JGI25153J46596_10027318 3300003215 Bacteria 2001
27 Ga0055538_1000001 3300003751 Bacteria 1111887
28 Ga0055538_1000019 3300003751 Bacteria 282365
29 Ga0055538_1000060 3300003751 Bacteria 108880
30 Ga0055539_1000001 3300003752 Bacteria 1111887
31 Ga0055539_1000024 3300003752 Bacteria 282365
32 Ga0055539_1000092 3300003752 Bacteria 108880
33 Ga0055533_1000003 3300003756 Bacteria 1111887
34 Ga0055533_1000032 3300003756 Bacteria 282365
35 Ga0055533_1000101 3300003756 Bacteria 108880
36 Ga0055533_1000175 3300003756 Bacteria 57439
37 Ga0055533_1000234 3300003756 Bacteria 36168
38 Ga0055533_1004342 3300003756 Bacteria 2573
39 Ga0055532_1000031 3300003758 Bacteria 231440
40 Ga0055532_1000080 3300003758 Bacteria 120879
41 Ga0055525_1000003 3300003759 Bacteria 962094
42 Ga0055525_1000041 3300003759 Bacteria 282365
43 Ga0055525_1000134 3300003759 Bacteria 108880
44 Ga0055527_1000020 3300003760 Bacteria 231441
45 Ga0055535_1000023 3300003761 Bacteria 231441
46 Ga0055535_1000133 3300003761 Bacteria 79386
47 Ga0055535_1000943 3300003761 Bacteria 19288
48 Ga0055535_1002087 3300003761 Bacteria 7960
49 Ga0055542_1000003 3300003762 Bacteria 582721
50 Ga0055542_1000035 3300003762 Bacteria 231441
51 Ga0055529_1000039 3300003763 Bacteria 231439
52 Ga0055529_1000516 3300003763 Bacteria 33894
53 Ga0055529_1000793 3300003763 Bacteria 19346
54 Ga0055526_1005632 3300003771 Bacteria 7132
55 Ga0055526_1006598 3300003771 Bacteria 6255
56 Ga0055537_1000032 3300003773 Bacteria 98934
57 Ga0055537_1001556 3300003773 Bacteria 8758
58 Ga0055524_1000374 3300003775 Bacteria 39008
59 Ga0055536_1007959 3300003781 Bacteria 4643
60 Ga0055536_1014382 3300003781 Bacteria 2783
61 Ga0055534_1000060 3300003784 Bacteria 83797
62 Ga0055534_1004524 3300003784 Bacteria 4001
63 Ga0055528_1000709 3300003790 Bacteria 23641
64 Ga0055528_1005012 3300003790 Bacteria 6253
65 Ga0055530_10012161 3300003791 Bacteria 3023
66 Ga0055540_1000628 3300003792 Bacteria 25001
67 Ga0055540_1004181 3300003792 Bacteria 6651
68 Ga0055540_1018685 3300003792 Bacteria 1893
69 Ga0055531_10000574 3300003794 Bacteria 32094
70 Ga0055531_10001531 3300003794 Bacteria 16944
71 Ga0055531_10002828 3300003794 Bacteria 11360
72 Ga0055531_10027446 3300003794 Bacteria 1997
73 Ga0055531_10029676 3300003794 Bacteria 1857
74 Ga0055541_1000001 3300003841 Bacteria 1111887
75 Ga0055541_1000018 3300003841 Bacteria 282365
76 Ga0055541_1000062 3300003841 Bacteria 108880
77 Ga0058692_1000921 3300003856 Bacteria 11605
78 Ga0055543_1001224 3300004625 Bacteria 10755
79 Ga0065165_1000079 3300005262 Bacteria 162095
80 Ga0065165_1000194 3300005262 Bacteria 106347
81 Ga0065165_1001795 3300005262 Bacteria 21152
82 Ga0065165_1002237 3300005262 Bacteria 17200
83 Ga0065714_10016817 3300005288 Bacteria 1543
84 Ga0065707_10000729 3300005295 Bacteria 20283
85 Ga0070658_10048214 3300005327 Bacteria 3448
86 Ga0070658_10222747 3300005327 Bacteria 1596
87 Ga0070676_10000163 3300005328 Bacteria 26788
88 Ga0070676_10007498 3300005328 Bacteria 5858
89 Ga0070683_100128466 3300005329 Bacteria 2397
90 Ga0070683_100189189 3300005329 Bacteria 1954
91 Ga0070690_100038746 3300005330 Bacteria 3009
92 Ga0070670_100012915 3300005331 Bacteria 7151
93 Ga0070670_100027847 3300005331 Bacteria 4862
94 Ga0070670_100034746 3300005331 Bacteria 4339
95 Ga0068869_100000400 3300005334 Bacteria 23628
96 Ga0068869_100030900 3300005334 Bacteria 3764
97 Ga0070666_10018576 3300005335 Bacteria 4474
98 Ga0070680_100056547 3300005336 Bacteria 3207
99 Ga0068868_100046475 3300005338 Bacteria 3398
100 Ga0070660_100000015 3300005339 Bacteria 105703
101 Ga0070660_100001523 3300005339 Bacteria 15904
102 Ga0070660_100006289 3300005339 Bacteria 8226
103 Ga0070660_100026061 3300005339 Bacteria 4351
104 Ga0070660_100054826 3300005339 Bacteria 3079
105 Ga0070689_100003353 3300005340 Bacteria 10645
106 Ga0070661_100003912 3300005344 Bacteria 10245
107 Ga0070661_100163086 3300005344 Bacteria 1689
108 Ga0070668_100050338 3300005347 Bacteria 3207
109 Ga0070668_100207484 3300005347 Bacteria 1610
110 Ga0070669_100003800 3300005353 Bacteria 10910
111 Ga0070669_100018510 3300005353 Bacteria 4978
112 Ga0070669_100084763 3300005353 Bacteria 2365
113 Ga0070669_100149686 3300005353 Bacteria 1806
114 Ga0070675_100015142 3300005354 Bacteria 6090
115 Ga0070675_100083150 3300005354 Bacteria 2672
116 Ga0070675_100087879 3300005354 Bacteria 2600
117 Ga0070675_100163214 3300005354 Bacteria 1917
118 Ga0070671_100002902 3300005355 Bacteria 13341
119 Ga0070674_100000918 3300005356 Bacteria 15350
120 Ga0070674_100014210 3300005356 Bacteria 4944
121 Ga0070673_100012305 3300005364 Bacteria 5871
122 Ga0070673_100019286 3300005364 Bacteria 4894
123 Ga0070673_100050696 3300005364 Bacteria 3246
124 Ga0070688_100000396 3300005365 Bacteria 22123
125 Ga0070659_100001015 3300005366 Bacteria 20566
126 Ga0070659_100003387 3300005366 Bacteria 11349
127 Ga0070659_100032608 3300005366 Bacteria 4041
128 Ga0070667_100001217 3300005367 Bacteria 23459
129 Ga0070667_100019351 3300005367 Bacteria 5648
130 Ga0070667_100057323 3300005367 Bacteria 3292
131 Ga0070667_100118121 3300005367 Bacteria 2305
132 Ga0070667_100316097 3300005367 Bacteria 1408
133 Ga0070711_100146466 3300005439 Bacteria 1777
134 Ga0070700_100018517 3300005441 Bacteria 4004
135 Ga0070663_100002550 3300005455 Bacteria 10286
136 Ga0070663_100049523 3300005455 Bacteria 2984
137 Ga0070678_100000108 3300005456 Bacteria 32250
138 Ga0070678_100187517 3300005456 Bacteria 1698
139 Ga0070662_100000492 3300005457 Bacteria 23504
140 Ga0070662_100135505 3300005457 Bacteria 1903
141 Ga0070662_100208089 3300005457 Bacteria 1555
142 Ga0070681_10183853 3300005458 Bacteria 2011
143 Ga0068867_100000093 3300005459 Bacteria 57534
144 Ga0068867_100000237 3300005459 Bacteria 36147
145 Ga0068867_100000562 3300005459 Bacteria 24541
146 Ga0070685_10001975 3300005466 Bacteria 10651
147 Ga0070707_100043561 3300005468 Bacteria 4295
148 Ga0070679_100037723 3300005530 Bacteria 4802
149 Ga0070679_100044605 3300005530 Bacteria 4417
150 Ga0070684_100060211 3300005535 Bacteria 3320
151 Ga0070684_100119736 3300005535 Bacteria 2368
152 Ga0070697_100024796 3300005536 Bacteria 4776
153 Ga0068853_100003541 3300005539 Bacteria 11945
154 Ga0068853_100017651 3300005539 Bacteria 5890
155 Ga0068853_100048183 3300005539 Bacteria 3659
156 Ga0068853_100186782 3300005539 Bacteria 1882
157 Ga0070672_100000588 3300005543 Bacteria 21295
158 Ga0070672_100004508 3300005543 Bacteria 9119
159 Ga0070672_100014536 3300005543 Bacteria 5580
160 Ga0070672_100026769 3300005543 Bacteria 4297
161 Ga0070665_100005868 3300005548 Bacteria 12592
162 Ga0070665_100143343 3300005548 Bacteria 2392
163 Ga0068855_100002682 3300005563 Bacteria 21941
164 Ga0068855_100035994 3300005563 Bacteria 5894
165 Ga0068855_100061146 3300005563 Bacteria 4401
166 Ga0068855_100072485 3300005563 Bacteria 4003
167 Ga0068855_100136320 3300005563 Bacteria 2800
168 Ga0068855_100196070 3300005563 Bacteria 2275
169 Ga0070664_100000906 3300005564 Bacteria 23107
170 Ga0070664_100001389 3300005564 Bacteria 19306
171 Ga0070664_100036507 3300005564 Bacteria 4129
172 Ga0068857_100008227 3300005577 Bacteria 9017
173 Ga0068857_100044583 3300005577 Bacteria 3934
174 Ga0068854_100003738 3300005578 Bacteria 9512
175 Ga0068854_100172361 3300005578 Bacteria 1685
176 Ga0068856_100003574 3300005614 Bacteria 15646
177 Ga0068856_100014541 3300005614 Bacteria 7606
178 Ga0068852_100003443 3300005616 Bacteria 11059
179 Ga0068852_100008270 3300005616 Bacteria 7655
180 Ga0068852_100014098 3300005616 Bacteria 6137
181 Ga0068852_100035441 3300005616 Bacteria 4163
182 Ga0068859_100000190 3300005617 Bacteria 59517
183 Ga0068864_100000753 3300005618 Bacteria 27203
184 Ga0068864_100014949 3300005618 Bacteria 6451
185 Ga0068864_100050786 3300005618 Bacteria 3570
186 Ga0068861_100002563 3300005719 Bacteria 11879
187 Ga0068851_10000392 3300005834 Bacteria 19799
188 Ga0068851_10008200 3300005834 Bacteria 4822
189 Ga0068851_10015162 3300005834 Bacteria 3668
190 Ga0068851_10056345 3300005834 Bacteria 2004
191 Ga0068870_10000413 3300005840 Bacteria 16046
192 Ga0068870_10002225 3300005840 Bacteria 8049
193 Ga0068863_100012787 3300005841 Bacteria 8094
194 Ga0068863_100102558 3300005841 Bacteria 2720
195 Ga0068858_100024232 3300005842 Bacteria 5655
196 Ga0068858_100051387 3300005842 Bacteria 3813
197 Ga0068862_100003467 3300005844 Bacteria 13569
198 Ga0068862_100029452 3300005844 Bacteria 4627
199 Ga0068862_100035762 3300005844 Bacteria 4209
200 Ga0075365_10030299 3300006038 Bacteria 3464
201 Ga0075365_10055461 3300006038 Bacteria 2630
202 Ga0075363_100032241 3300006048 Bacteria 2720
203 Ga0075363_100055069 3300006048 Bacteria 2130
204 Ga0075364_10002679 3300006051 Bacteria 9997
205 Ga0075364_10103192 3300006051 Bacteria 1899
206 Ga0075432_10013268 3300006058 Bacteria 2798
207 Ga0075362_10015995 3300006177 Bacteria 3063
208 Ga0075367_10040061 3300006178 Bacteria 2734
209 Ga0075367_10066779 3300006178 Bacteria 2155
210 Ga0075367_10113977 3300006178 Bacteria 1661
211 Ga0075369_10044648 3300006186 Bacteria 1904
212 Ga0075366_10011425 3300006195 Bacteria 5015
213 Ga0075366_10024763 3300006195 Bacteria 3501
214 Ga0075366_10064206 3300006195 Bacteria 2183
215 Ga0097621_100012923 3300006237 Bacteria 6204
216 Ga0075370_10002159 3300006353 Bacteria 9009
217 Ga0075370_10002622 3300006353 Bacteria 8391
218 Ga0075370_10021135 3300006353 Bacteria 3565
219 Ga0075370_10061617 3300006353 Bacteria 2137
220 Ga0068871_100095321 3300006358 Bacteria 2485
221 Ga0068865_100023960 3300006881 Bacteria 4001
222 Ga0097620_100000190 3300006931 Bacteria 59517
223 Ga0099823_1000002 3300006944 Bacteria 212272
224 Ga0079104_1004005 3300006946 Bacteria 6538
225 Ga0099826_10015904 3300006948 Bacteria 5683
226 Ga0075435_100055722 3300007076 Bacteria 3194
227 Ga0105251_10000269 3300009011 Bacteria 52035
228 Ga0105251_10000332 3300009011 Bacteria 47333
229 Ga0105244_10008377 3300009036 Bacteria 6460
230 Ga0105244_10091347 3300009036 Bacteria 1497
231 Ga0105250_10005368 3300009092 Bacteria 5754
232 Ga0105250_10008227 3300009092 Bacteria 4441
233 Ga0105240_10000809 3300009093 Bacteria 56801
234 Ga0105240_10003213 3300009093 Bacteria 25602
235 Ga0105240_10005969 3300009093 Bacteria 18019
236 Ga0105240_10045286 3300009093 Bacteria 5582
237 Ga0111539_10065113 3300009094 Bacteria 4309
238 Ga0105243_10000456 3300009148 Bacteria 42501
239 Ga0105243_10001192 3300009148 Bacteria 23440
240 Ga0105243_10009905 3300009148 Bacteria 7247
241 Ga0105241_10257149 3300009174 Bacteria 1483
242 Ga0105242_10140324 3300009176 Bacteria 2096
243 Ga0105242_10148571 3300009176 Bacteria 2041
244 Ga0105248_10005250 3300009177 Bacteria 14270
245 Ga0105237_10032464 3300009545 Bacteria 5285
246 Ga0105237_10073764 3300009545 Bacteria 3404
247 Ga0105237_10103035 3300009545 Bacteria 2846
248 Ga0105238_10031675 3300009551 Bacteria 5382
249 Ga0105238_10044117 3300009551 Bacteria 4510
250 Ga0105238_10174459 3300009551 Bacteria 2126
251 Ga0105239_10005015 3300010375 Bacteria 15633
252 Ga0105239_10009979 3300010375 Bacteria 10657
253 Ga0105239_10092970 3300010375 Bacteria 3330
254 Ga0105239_10200261 3300010375 Bacteria 2237
255 Ga0105239_10281270 3300010375 Bacteria 1873
256 Ga0157319_1000007 3300012497 Bacteria 318528
257 Ga0157347_1000394 3300012502 Bacteria 2787
258 Ga0157373_10016328 3300013100 Bacteria 5417
259 Ga0157373_10036117 3300013100 Bacteria 3547
260 Ga0157371_10000101 3300013102 Bacteria 129981
261 Ga0157371_10002976 3300013102 Bacteria 15727
262 Ga0157371_10026873 3300013102 Bacteria 4179
263 Ga0157371_10040285 3300013102 Bacteria 3337
264 Ga0157371_10130521 3300013102 Bacteria 1788
265 Ga0157370_10009411 3300013104 Bacteria 10443
266 Ga0157370_10014999 3300013104 Bacteria 7900
267 Ga0157370_10114872 3300013104 Bacteria 2515
268 Ga0157369_10000639 3300013105 Bacteria 45206
269 Ga0157369_10001620 3300013105 Bacteria 27526
270 Ga0157369_10036458 3300013105 Bacteria 5387
271 Ga0157369_10052588 3300013105 Bacteria 4406
272 Ga0157374_10006945 3300013296 Bacteria 9630
273 Ga0157374_10032937 3300013296 Bacteria 4724
274 Ga0157374_10122384 3300013296 Bacteria 2512
275 Ga0157378_10039592 3300013297 Bacteria 4181
276 Ga0157378_10172791 3300013297 Bacteria 2028
277 Ga0163162_10007902 3300013306 Bacteria 10367
278 Ga0163162_10089124 3300013306 Bacteria 3165
279 Ga0157372_10000920 3300013307 Bacteria 32013
280 Ga0157372_10127049 3300013307 Bacteria 2932
281 Ga0157372_10140220 3300013307 Bacteria 2785
282 Ga0157375_10045040 3300013308 Bacteria 4292
283 Ga0157375_10220337 3300013308 Bacteria 2056
284 Ga0163163_10026196 3300014325 Bacteria 5570
285 Ga0157380_10001782 3300014326 Bacteria 14223
286 Ga0182008_10000210 3300014497 Bacteria 46115
287 Ga0182008_10009543 3300014497 Bacteria 5230
288 Ga0182008_10013352 3300014497 Bacteria 4319
289 Ga0182008_10013489 3300014497 Bacteria 4296
290 Ga0157377_10000036 3300014745 Bacteria 116358
291 Ga0157379_10000333 3300014968 Bacteria 37858
292 Ga0157379_10007658 3300014968 Bacteria 9349
293 Ga0157376_10106460 3300014969 Bacteria 2460
294 Ga0157376_10119782 3300014969 Bacteria 2331
295 Ga0157376_10120562 3300014969 Bacteria 2324
296 Ga0182006_1052463 3300015261 Bacteria 1567
297 Ga0182007_10001063 3300015262 Bacteria 14973
298 Ga0182007_10002279 3300015262 Bacteria 9669
299 Ga0182007_10003782 3300015262 Bacteria 7051
300 Ga0182007_10006261 3300015262 Bacteria 5116
301 Ga0182007_10006657 3300015262 Bacteria 4940
302 Ga0182007_10028698 3300015262 Bacteria 1910
303 Ga0182005_1001125 3300015265 Bacteria 11166
304 Ga0183362_10004 3300015683 Bacteria 569303
305 Ga0163161_10000062 3300017792 Bacteria 112177
306 Ga0163161_10004815 3300017792 Bacteria 9404
307 Ga0163161_10124816 3300017792 Bacteria 1937
308 Ga0206356_10615716 3300020070 Bacteria 6319
309 Ga0206354_11086307 3300020081 Bacteria 2190
310 Ga0213872_10000208 3300021361 Bacteria 52289
311 Ga0213872_10004344 3300021361 Bacteria 7554
312 Ga0213871_10000258 3300021441 Bacteria 6483
313 Ga0224712_10000089 3300022467 Bacteria 14209
314 Ga0209435_100018 3300025206 Bacteria 274625
315 Ga0209435_100173 3300025206 Bacteria 19680
316 Ga0209435_105547 3300025206 Bacteria 1412
317 Ga0209760_100001 3300025207 Bacteria 348781
318 Ga0209784_100001 3300025224 Bacteria 3600592
319 Ga0209784_100004 3300025224 Bacteria 1378156
320 Ga0209784_100009 3300025224 Bacteria 688031
321 Ga0209566_100001 3300025225 Bacteria 3600765
322 Ga0209566_100004 3300025225 Bacteria 1531866
323 Ga0209566_100007 3300025225 Bacteria 688031
324 Ga0209674_100002 3300025226 Bacteria 3600592
325 Ga0209674_100006 3300025226 Bacteria 1531866
326 Ga0209674_100017 3300025226 Bacteria 689087
327 Ga0209674_100018 3300025226 Bacteria 688031
328 Ga0209674_100085 3300025226 Bacteria 190617
329 Ga0209674_100143 3300025226 Bacteria 107275
330 Ga0209672_100001 3300025228 Bacteria 2828210
331 Ga0209672_100041 3300025228 Bacteria 278535
332 Ga0209672_100071 3300025228 Bacteria 169941
333 Ga0209672_100306 3300025228 Bacteria 33051
334 Ga0209147_100001 3300025229 Bacteria 2384371
335 Ga0209147_100051 3300025229 Bacteria 274605
336 Ga0209147_100135 3300025229 Bacteria 118099
337 Ga0209147_100173 3300025229 Bacteria 82900
338 Ga0209147_100449 3300025229 Bacteria 25874
339 Ga0209563_100008 3300025230 Bacteria 1554545
340 Ga0209563_100009 3300025230 Bacteria 1378156
341 Ga0209563_100020 3300025230 Bacteria 688031
342 Ga0209563_101449 3300025230 Bacteria 6275
343 Ga0207427_100002 3300025231 Bacteria 1355321
344 Ga0207427_100558 3300025231 Bacteria 18929
345 Ga0207427_101362 3300025231 Bacteria 9008
346 Ga0209437_100004 3300025233 Bacteria 1378156
347 Ga0209437_100007 3300025233 Bacteria 938377
348 Ga0209437_100145 3300025233 Bacteria 163138
349 Ga0209258_100001 3300025242 Bacteria 2384269
350 Ga0209258_100015 3300025242 Bacteria 706310
351 Ga0209258_100120 3300025242 Bacteria 183488
352 Ga0209258_100207 3300025242 Bacteria 119062
353 Ga0209258_100244 3300025242 Bacteria 100255
354 Ga0207425_1000359 3300025245 Bacteria 31533
355 Ga0207425_1000405 3300025245 Bacteria 29038
356 Ga0209646_1000081 3300025246 Bacteria 201708
357 Ga0209646_1000090 3300025246 Bacteria 189912
358 Ga0209026_1000042 3300025250 Bacteria 273111
359 Ga0209026_1005121 3300025250 Bacteria 3622
360 Ga0209677_100004 3300025253 Bacteria 1554545
361 Ga0209677_100005 3300025253 Bacteria 1378156
362 Ga0209677_100010 3300025253 Bacteria 688031
363 Ga0209148_1000003 3300025254 Bacteria 2384288
364 Ga0209148_1000028 3300025254 Bacteria 582773
365 Ga0209148_1000134 3300025254 Bacteria 169941
366 Ga0209148_1000598 3300025254 Bacteria 32567
367 Ga0209759_1000037 3300025256 Bacteria 259200
368 Ga0209759_1000092 3300025256 Bacteria 161238
369 Ga0209759_1000098 3300025256 Bacteria 157516
370 Ga0209759_1000109 3300025256 Bacteria 145042
371 Ga0209759_1000200 3300025256 Bacteria 94590
372 Ga0209759_1003352 3300025256 Bacteria 6426
373 Ga0209129_1000035 3300025258 Bacteria 329303
374 Ga0209129_1000461 3300025258 Bacteria 29937
375 Ga0209129_1003918 3300025258 Bacteria 6181
376 Ga0209129_1007161 3300025258 Bacteria 3394
377 Ga0209233_1000005 3300025261 Bacteria 1531866
378 Ga0209233_1000123 3300025261 Bacteria 228400
379 Ga0209233_1002843 3300025261 Bacteria 6208
380 Ga0209565_1000144 3300025263 Bacteria 99074
381 Ga0209565_1000646 3300025263 Bacteria 22549
382 Ga0209565_1006184 3300025263 Bacteria 3389
383 Ga0209455_1000001 3300025272 Bacteria 2384278
384 Ga0209455_1000309 3300025272 Bacteria 49845
385 Ga0209455_1000562 3300025272 Bacteria 24879
386 Ga0209455_1003499 3300025272 Bacteria 5521
387 Ga0209455_1008550 3300025272 Bacteria 2773
388 Ga0209673_1000102 3300025273 Bacteria 189583
389 Ga0209673_1000136 3300025273 Bacteria 159975
390 Ga0209673_1000461 3300025273 Bacteria 68612
391 Ga0209673_1001670 3300025273 Bacteria 18991
392 Ga0209673_1009190 3300025273 Bacteria 4311
393 Ga0209673_1019427 3300025273 Bacteria 2440
394 Ga0209673_1020344 3300025273 Bacteria 2353
395 Ga0209130_1000485 3300025284 Bacteria 40942
396 Ga0209130_1012138 3300025284 Bacteria 2271
397 Ga0209675_1000071 3300025291 Bacteria 168382
398 Ga0209675_1000369 3300025291 Bacteria 38317
399 Ga0209675_1009637 3300025291 Bacteria 3389
400 Ga0209675_1009770 3300025291 Bacteria 3353
401 Ga0209676_1000241 3300025292 Bacteria 117623
402 Ga0209676_1000575 3300025292 Bacteria 55372
403 Ga0209676_1014021 3300025292 Bacteria 3043
404 Ga0209676_1025228 3300025292 Bacteria 1910
405 Ga0209025_1000305 3300025294 Bacteria 109479
406 Ga0209025_1001135 3300025294 Bacteria 38119
407 Ga0209025_1016824 3300025294 Bacteria 4274
408 Ga0209025_1017879 3300025294 Bacteria 4062
409 Ga0209025_1023795 3300025294 Bacteria 3187
410 Ga0209564_1000024 3300025295 Bacteria 535041
411 Ga0209564_1000030 3300025295 Bacteria 503296
412 Ga0209564_1000110 3300025295 Bacteria 212842
413 Ga0209564_1000123 3300025295 Bacteria 202487
414 Ga0209564_1001952 3300025295 Bacteria 18215
415 Ga0209758_1000039 3300025297 Bacteria 428951
416 Ga0209758_1000066 3300025297 Bacteria 298620
417 Ga0209758_1000213 3300025297 Bacteria 126745
418 Ga0209050_1000015 3300025298 Bacteria 759102
419 Ga0209050_1000178 3300025298 Bacteria 145314
420 Ga0209050_1001757 3300025298 Bacteria 21484
421 Ga0209050_1004829 3300025298 Bacteria 8862
422 Ga0209256_1000074 3300025299 Bacteria 236893
423 Ga0209256_1000082 3300025299 Bacteria 221491
424 Ga0209256_1000197 3300025299 Bacteria 114432
425 Ga0209256_1000959 3300025299 Bacteria 34894
426 Ga0207426_1000007 3300025302 Bacteria 971011
427 Ga0207426_1000112 3300025302 Bacteria 231436
428 Ga0207426_1000121 3300025302 Bacteria 219007
429 Ga0207426_1002428 3300025302 Bacteria 11925
430 Ga0209051_1000081 3300025303 Bacteria 195619
431 Ga0209051_1000120 3300025303 Bacteria 147281
432 Ga0209051_1000650 3300025303 Bacteria 39380
433 Ga0209051_1001437 3300025303 Bacteria 20303
434 Ga0209051_1002183 3300025303 Bacteria 14488
435 Ga0209051_1003682 3300025303 Bacteria 9907
436 Ga0209051_1047255 3300025303 Bacteria 1472
437 Ga0209257_1000015 3300025304 Bacteria 908141
438 Ga0209257_1000026 3300025304 Bacteria 723225
439 Ga0209257_1000945 3300025304 Bacteria 40114
440 Ga0209257_1001188 3300025304 Bacteria 32794
441 Ga0209257_1001975 3300025304 Bacteria 22058
442 Ga0209257_1012549 3300025304 Bacteria 3899
443 Ga0209257_1014786 3300025304 Bacteria 3315
444 Ga0209257_1026757 3300025304 Bacteria 1935
445 Ga0209257_1027178 3300025304 Bacteria 1909
446 Ga0207697_10000185 3300025315 Bacteria 32415
447 Ga0207656_10002444 3300025321 Bacteria 6260
448 Ga0207696_1007065 3300025711 Bacteria 4442
449 Ga0207696_1007438 3300025711 Bacteria 4288
450 Ga0207655_1002128 3300025728 Bacteria 16541
451 Ga0207713_1000435 3300025735 Bacteria 44035
452 Ga0207713_1002336 3300025735 Bacteria 13926
453 Ga0207682_10000116 3300025893 Bacteria 36921
454 Ga0207682_10000942 3300025893 Bacteria 13483
455 Ga0207688_10010272 3300025901 Bacteria 5095
456 Ga0207688_10041569 3300025901 Bacteria 2558
457 Ga0207680_10056006 3300025903 Bacteria 2379
458 Ga0207680_10090204 3300025903 Bacteria 1948
459 Ga0207680_10134527 3300025903 Bacteria 1632
460 Ga0207647_10000212 3300025904 Bacteria 47335
461 Ga0207647_10008322 3300025904 Bacteria 7436
462 Ga0207647_10019744 3300025904 Bacteria 4528
463 Ga0207699_10021069 3300025906 Bacteria 3506
464 Ga0207645_10001013 3300025907 Bacteria 23226
465 Ga0207645_10013008 3300025907 Bacteria 5623
466 Ga0207645_10020042 3300025907 Bacteria 4380
467 Ga0207643_10000211 3300025908 Bacteria 40799
468 Ga0207705_10063475 3300025909 Bacteria 2669
469 Ga0207705_10072556 3300025909 Bacteria 2497
470 Ga0207684_10027295 3300025910 Bacteria 4866
471 Ga0207654_10055546 3300025911 Bacteria 2293
472 Ga0207695_10001496 3300025913 Bacteria 38927
473 Ga0207695_10001802 3300025913 Bacteria 33804
474 Ga0207695_10020120 3300025913 Bacteria 7656
475 Ga0207695_10051275 3300025913 Bacteria 4334
476 Ga0207695_10145160 3300025913 Bacteria 2318
477 Ga0207663_10142744 3300025916 Bacteria 1670
478 Ga0207662_10014945 3300025918 Bacteria 4360
479 Ga0207657_10000039 3300025919 Bacteria 121088
480 Ga0207657_10005034 3300025919 Bacteria 13868
481 Ga0207657_10008355 3300025919 Bacteria 10513
482 Ga0207657_10033676 3300025919 Bacteria 4615
483 Ga0207657_10090805 3300025919 Bacteria 2548
484 Ga0207646_10238907 3300025922 Bacteria 1641
485 Ga0207681_10003074 3300025923 Bacteria 10490
486 Ga0207650_10026404 3300025925 Bacteria 4143
487 Ga0207650_10131372 3300025925 Bacteria 1959
488 Ga0207659_10001317 3300025926 Bacteria 14821
489 Ga0207659_10036350 3300025926 Bacteria 3411
490 Ga0207659_10066810 3300025926 Bacteria 2611
491 Ga0207687_10034554 3300025927 Bacteria 3432
492 Ga0207644_10006544 3300025931 Bacteria 7593
493 Ga0207690_10000010 3300025932 Bacteria 330298
494 Ga0207690_10001553 3300025932 Bacteria 14380
495 Ga0207690_10008500 3300025932 Bacteria 6090
496 Ga0207690_10042257 3300025932 Bacteria 2993
497 Ga0207706_10000144 3300025933 Bacteria 76997
498 Ga0207706_10001214 3300025933 Bacteria 26046
499 Ga0207686_10107798 3300025934 Bacteria 1873
500 Ga0207709_10000229 3300025935 Bacteria 70907
501 Ga0207709_10000887 3300025935 Bacteria 22613
502 Ga0207670_10017823 3300025936 Bacteria 4300
503 Ga0207669_10000388 3300025937 Bacteria 19463
504 Ga0207669_10007790 3300025937 Bacteria 4984
505 Ga0207704_10035262 3300025938 Bacteria 2865
506 Ga0207691_10000050 3300025940 Bacteria 94763
507 Ga0207691_10006610 3300025940 Bacteria 11193
508 Ga0207691_10010974 3300025940 Bacteria 8692
509 Ga0207691_10012846 3300025940 Bacteria 8017
510 Ga0207691_10017585 3300025940 Bacteria 6776
511 Ga0207691_10023771 3300025940 Bacteria 5768
512 Ga0207691_10094878 3300025940 Bacteria 2669
513 Ga0207711_10012296 3300025941 Bacteria 7116
514 Ga0207711_10025431 3300025941 Bacteria 4968
515 Ga0207711_10172848 3300025941 Bacteria 1961
516 Ga0207689_10000526 3300025942 Bacteria 36327
517 Ga0207689_10012008 3300025942 Bacteria 7423
518 Ga0207689_10097386 3300025942 Bacteria 2416
519 Ga0207661_10025828 3300025944 Bacteria 4469
520 Ga0207679_10002642 3300025945 Bacteria 11055
521 Ga0207679_10005146 3300025945 Bacteria 8188
522 Ga0207667_10009299 3300025949 Bacteria 11592
523 Ga0207667_10012398 3300025949 Bacteria 9824
524 Ga0207667_10022753 3300025949 Bacteria 6914
525 Ga0207667_10036065 3300025949 Bacteria 5303
526 Ga0207667_10073898 3300025949 Bacteria 3542
527 Ga0207667_10148751 3300025949 Bacteria 2411
528 Ga0207651_10026910 3300025960 Bacteria 3602
529 Ga0207668_10020977 3300025972 Bacteria 4160
530 Ga0207640_10099597 3300025981 Bacteria 2034
531 Ga0207658_10005274 3300025986 Bacteria 8892
532 Ga0207658_10013364 3300025986 Bacteria 5607
533 Ga0207677_10001620 3300026023 Bacteria 11948
534 Ga0207677_10071000 3300026023 Bacteria 2456
535 Ga0207677_10117828 3300026023 Bacteria 1991
536 Ga0207703_10022333 3300026035 Bacteria 4961
537 Ga0207703_10163994 3300026035 Bacteria 1948
538 Ga0207639_10005360 3300026041 Bacteria 8667
539 Ga0207639_10034307 3300026041 Bacteria 3750
540 Ga0207639_10118818 3300026041 Bacteria 2168
541 Ga0207639_10222289 3300026041 Bacteria 1632
542 Ga0207678_10000032 3300026067 Bacteria 109814
543 Ga0207678_10002728 3300026067 Bacteria 15989
544 Ga0207678_10008128 3300026067 Bacteria 9248
545 Ga0207678_10008541 3300026067 Bacteria 9025
546 Ga0207678_10015305 3300026067 Bacteria 6746
547 Ga0207678_10087348 3300026067 Bacteria 2665
548 Ga0207678_10093087 3300026067 Bacteria 2575
549 Ga0207708_10000359 3300026075 Bacteria 35755
550 Ga0207708_10031227 3300026075 Bacteria 4042
551 Ga0207702_10006416 3300026078 Bacteria 10148
552 Ga0207702_10008743 3300026078 Bacteria 8539
553 Ga0207702_10065416 3300026078 Bacteria 3114
554 Ga0207702_10258684 3300026078 Bacteria 1638
555 Ga0207641_10005662 3300026088 Bacteria 10636
556 Ga0207641_10014446 3300026088 Bacteria 6468
557 Ga0207641_10038467 3300026088 Bacteria 3999
558 Ga0207641_10208961 3300026088 Bacteria 1804
559 Ga0207648_10000039 3300026089 Bacteria 118860
560 Ga0207648_10001149 3300026089 Bacteria 29657
561 Ga0207648_10002175 3300026089 Bacteria 21287
562 Ga0207648_10028913 3300026089 Bacteria 4913
563 Ga0207676_10002748 3300026095 Bacteria 12524
564 Ga0207676_10009311 3300026095 Bacteria 6989
565 Ga0207676_10011291 3300026095 Bacteria 6383
566 Ga0207676_10023437 3300026095 Bacteria 4554
567 Ga0207676_10049556 3300026095 Bacteria 3268
568 Ga0207676_10113320 3300026095 Bacteria 2273
569 Ga0207674_10005066 3300026116 Bacteria 15725
570 Ga0207674_10006776 3300026116 Bacteria 13441
571 Ga0207674_10053089 3300026116 Bacteria 4131
572 Ga0207674_10136684 3300026116 Bacteria 2412
573 Ga0207674_10266636 3300026116 Bacteria 1660
574 Ga0207675_100000411 3300026118 Bacteria 41131
575 Ga0207675_100003832 3300026118 Bacteria 14632
576 Ga0207675_100016918 3300026118 Bacteria 6814
577 Ga0207683_10000278 3300026121 Bacteria 45668
578 Ga0207683_10002009 3300026121 Bacteria 17994
579 Ga0207683_10030023 3300026121 Bacteria 4708
580 Ga0207683_10039167 3300026121 Bacteria 4134
581 Ga0207683_10062440 3300026121 Bacteria 3281
582 Ga0207698_10008665 3300026142 Bacteria 6445
583 Ga0207698_10069753 3300026142 Bacteria 2781
584 Ga0209389_1000483 3300027296 Bacteria 23894
585 Ga0209371_1000530 3300027312 Bacteria 36280
586 Ga0209371_1002008 3300027312 Bacteria 12240
587 Ga0209371_1007567 3300027312 Bacteria 3759
588 Ga0209371_1017410 3300027312 Bacteria 1862
589 Ga0209983_1016114 3300027665 Bacteria 1542
590 Ga0209282_1002844 3300027666 Bacteria 10142
591 Ga0209974_10007952 3300027876 Bacteria 3637
592 Ga0268266_10005235 3300028379 Bacteria 12192
593 Ga0268265_10005070 3300028380 Bacteria 9039
594 Ga0268265_10039116 3300028380 Bacteria 3493
595 Ga0268265_10259162 3300028380 Bacteria 1545
596 Ga0268264_10005575 3300028381 Bacteria 10663
597 Ga0307517_10067759 3300028786 Bacteria 3262
598 Ga0307517_10118038 3300028786 Bacteria 1977
599 Ga0307515_10091760 3300028794 Bacteria 3790
600 Ga0265338_10000344 3300028800 Bacteria 84742
601 Ga0268256_1000523 3300030500 Bacteria 32210
602 Ga0268256_1001757 3300030500 Bacteria 12240
603 Ga0268256_1019415 3300030500 Bacteria 1862
604 Ga0307512_10022646 3300030522 Bacteria 5638
605 Ga0316181_1018696 3300030744 Bacteria 4419
606 Ga0316181_1294799 3300030744 Bacteria 4491
607 Ga0265330_10000368 3300031235 Bacteria 31833
608 Ga0265330_10020209 3300031235 Bacteria 3043
609 Ga0265332_10000394 3300031238 Bacteria 31776
610 Ga0265325_10006433 3300031241 Bacteria 7124
611 Ga0307513_10117103 3300031456 Bacteria 2642
612 Ga0307408_100019005 3300031548 Bacteria 4622
613 Ga0307408_100040437 3300031548 Bacteria 3302
614 Ga0265314_10000292 3300031711 Bacteria 71982
615 Ga0265314_10003357 3300031711 Bacteria 15558
616 Ga0265342_10010328 3300031712 Bacteria 6490
617 Ga0307405_10153654 3300031731 Bacteria 1621
618 Ga0307413_10011173 3300031824 Bacteria 4399
619 Ga0307413_10018032 3300031824 Bacteria 3692
620 Ga0307413_10058614 3300031824 Bacteria 2361
621 Ga0307410_10018673 3300031852 Bacteria 4195
622 Ga0307406_10007204 3300031901 Bacteria 6161
623 Ga0307406_10009997 3300031901 Bacteria 5337
624 Ga0307406_10041304 3300031901 Bacteria 2873
625 Ga0307407_10006349 3300031903 Bacteria 5237
626 Ga0307412_10000014 3300031911 Bacteria 353795
627 Ga0307412_10014155 3300031911 Bacteria 4697
628 Ga0307412_10059699 3300031911 Bacteria 2557
629 Ga0307412_10082802 3300031911 Bacteria 2222
630 Ga0307412_10185474 3300031911 Bacteria 1568
631 Ga0307409_100014210 3300031995 Bacteria 5164
632 Ga0307409_100037770 3300031995 Bacteria 3563
633 Ga0307416_100020374 3300032002 Bacteria 4730
634 Ga0307416_100036199 3300032002 Bacteria 3782
635 Ga0307416_100040664 3300032002 Bacteria 3614
636 Ga0307416_100051043 3300032002 Bacteria 3301
637 Ga0307416_100196924 3300032002 Bacteria 1907
638 Ga0307414_10073766 3300032004 Bacteria 2470
639 Ga0307414_10101099 3300032004 Bacteria 2170
640 Ga0307411_10015285 3300032005 Bacteria 4305
641 Ga0307411_10038218 3300032005 Bacteria 3025
642 Ga0307411_10059529 3300032005 Bacteria 2532
643 Ga0307411_10099580 3300032005 Bacteria 2052
644 Ga0307415_100076110 3300032126 Bacteria 2378
645 Ga0373954_0041529 3300035118 Bacteria 2145
646 Ga0373933_0064274 3300035724 Bacteria 2220
647 Ga0373937_0025709 3300036401 Bacteria 5317
648 Ga0373937_0083275 3300036401 Bacteria 2959
649 Ga0395899_0000031 3300037312 Bacteria 322356
650 Ga0395899_0006630 3300037312 Bacteria 8974
651 Ga0395899_0023970 3300037312 Bacteria 4617
652 Ga0395899_0028529 3300037312 Bacteria 4202
653 Ga0395899_0035771 3300037312 Bacteria 3727
654 Ga0395899_0058273 3300037312 Bacteria 2849
655 Ga0395899_0069307 3300037312 Bacteria 2583
656 Ga0395899_0110361 3300037312 Bacteria 1978
657 Ga0395900_0000110 3300037418 Bacteria 145544
658 Ga0395900_0000147 3300037418 Bacteria 118678
659 Ga0395900_0011385 3300037418 Bacteria 9103
660 Ga0395900_0022070 3300037418 Bacteria 6511
661 Ga0395900_0031095 3300037418 Bacteria 5484
662 Ga0395900_0031877 3300037418 Bacteria 5418
663 Ga0395900_0054246 3300037418 Bacteria 4127
664 Ga0395900_0280256 3300037418 Bacteria 1659
665 Ga0395898_0000040 3300037466 Bacteria 317329
666 Ga0395898_0000747 3300037466 Bacteria 56704
667 Ga0395898_0003990 3300037466 Bacteria 16244
668 Ga0395898_0019144 3300037466 Bacteria 6970
669 Ga0395898_0047197 3300037466 Bacteria 4227
670 Ga0395898_0053503 3300037466 Bacteria 3943
671 Ga0395898_0095546 3300037466 Bacteria 2855
672 Ga0395898_0290326 3300037466 Bacteria 1560
673 Ga0395905_0000014 3300037471 Bacteria 394209
674 Ga0395905_0000078 3300037471 Bacteria 161593
675 Ga0395905_0000722 3300037471 Bacteria 43605
676 Ga0395905_0010490 3300037471 Bacteria 9011
677 Ga0395905_0023865 3300037471 Bacteria 5774
678 Ga0395905_0050278 3300037471 Bacteria 3906
679 Ga0395905_0061736 3300037471 Bacteria 3505
680 Ga0395905_0115229 3300037471 Bacteria 2525
681 Ga0395905_0169270 3300037471 Bacteria 2052
682 Ga0436364_0472897 3300037853 Bacteria 6677
683 Ga0395901_0000017 3300038443 Bacteria 345003
684 Ga0395901_0000113 3300038443 Bacteria 110398
685 Ga0395901_0002021 3300038443 Bacteria 20876
686 Ga0395901_0003649 3300038443 Bacteria 15519
687 Ga0395901_0034790 3300038443 Bacteria 5204
688 Ga0395901_0050427 3300038443 Bacteria 4324
689 Ga0395901_0054473 3300038443 Bacteria 4157
690 Ga0395901_0228488 3300038443 Bacteria 1943
691 Ga0436360_0136613 3300039438 Bacteria 12424
692 Ga0436360_0799340 3300039438 Bacteria 1537
693 Ga0436361_0074986 3300039447 Bacteria 19532
694 Ga0436361_0348185 3300039447 Bacteria 8422
695 Ga0436361_0481941 3300039447 Bacteria 2696
696 Ga0436361_0726260 3300039447 Bacteria 7171
697 Ga0439436_0003956 3300041404 Bacteria 4540
698 Ga0439447_016466 3300041407 Bacteria 2028
699 Ga0439465_0001214 3300041413 Bacteria 8301
700 Ga0451800_0993913 3300041459 Bacteria 1988
701 Ga0451807_1174122 3300041486 Bacteria 1806
702 Ga0439433_0002868 3300041999 Bacteria 3683
703 Ga0439433_0004138 3300041999 Bacteria 3117
704 Ga0439445_0000443 3300042004 Bacteria 8398
705 Ga0439448_0001178 3300042005 Bacteria 6650
706 Ga0439432_008465 3300042006 Bacteria 3610
707 Ga0439449_0001696 3300042007 Bacteria 8669
708 Ga0439449_0027862 3300042007 Bacteria 2107
709 Ga0439452_002044 3300042010 Bacteria 7681
710 Ga0439452_002992 3300042010 Bacteria 6005
711 Ga0439462_0008004 3300042015 Bacteria 2659
712 Ga0450898_000996 3300042134 Bacteria 3586
713 Ga0450900_001276 3300042136 Bacteria 2415
714 Ga0450906_001466 3300042145 Bacteria 5142
715 Ga0450907_006264 3300042146 Bacteria 1990
716 Ga0439434_0012826 3300042435 Bacteria 2484
717 Ga0439459_0000340 3300042438 Bacteria 5731
718 Ga0451577_0200425 3300042876 Bacteria 1802
719 Ga0451577_0227390 3300042876 Bacteria 1687
720 Ga0466969_0000026 3300044656 Bacteria 95232
721 Ga0466969_0006571 3300044656 Bacteria 6180
722 Ga0466969_0008893 3300044656 Bacteria 5325
723 Ga0466969_0017170 3300044656 Bacteria 3781
724 Ga0453683_0002824 3300044673 Bacteria 13192
725 Ga0466965_0006647 3300044683 Bacteria 5268
726 Ga0466965_0008120 3300044683 Bacteria 4848
727 Ga0466966_0000024 3300044684 Bacteria 110205
728 Ga0466966_0000134 3300044684 Bacteria 47765
729 Ga0466966_0001199 3300044684 Bacteria 16629
730 Ga0466966_0036570 3300044684 Bacteria 3170
731 Ga0466961_0000972 3300044693 Bacteria 17753
732 Ga0466961_0006484 3300044693 Bacteria 7434
733 Ga0466961_0022120 3300044693 Bacteria 4091
734 Ga0466961_0046806 3300044693 Bacteria 2765
735 Ga0466963_0001032 3300044694 Bacteria 14467
736 Ga0466963_0003369 3300044694 Bacteria 9123
737 Ga0466963_0024078 3300044694 Bacteria 3873
738 Ga0453684_0028819 3300044712 Bacteria 7905
739 Ga0466971_0004992 3300044719 Bacteria 5741
740 Ga0466968_0020885 3300044735 Bacteria 2647
741 Ga0466970_0004043 3300044765 Bacteria 7201
742 Ga0466970_0008884 3300044765 Bacteria 5067
743 Ga0466957_0075593 3300044842 Bacteria 2090
744 Ga0466960_0015381 3300044901 Bacteria 3297
745 Ga0466959_0000590 3300045049 Bacteria 21130
746 Ga0466959_0004774 3300045049 Bacteria 9139
747 Ga0466959_0014570 3300045049 Bacteria 5719
748 Ga0466959_0030967 3300045049 Bacteria 3960
749 Ga0466959_0073433 3300045049 Bacteria 2474
750 Ga0466959_0077176 3300045049 Bacteria 2404
751 Ga0451576_0015581 3300045051 Bacteria 8415
752 Ga0451576_0590498 3300045051 Bacteria 1167
753 Ga0466958_0002455 3300045836 Bacteria 9308
754 Ga0466958_0006725 3300045836 Bacteria 6277
755 Ga0466958_0028519 3300045836 Bacteria 3310
756 Ga0466958_0041424 3300045836 Bacteria 2770
757 Ga0466967_0140468 3300045976 Bacteria 2249
758 Ga0495592_0002058 3300046454 Bacteria 14162
759 Ga0495592_0009213 3300046454 Bacteria 7427
760 Ga0495592_0024141 3300046454 Bacteria 4623
761 Ga0495603_0005997 3300046455 Bacteria 7266
762 Ga0495590_0002519 3300046457 Bacteria 7577
763 Ga0495590_0009115 3300046457 Bacteria 3769
764 Ga0495591_001389 3300046458 Bacteria 15148
765 Ga0495629_0003743 3300046459 Bacteria 11455
766 Ga0495629_0007244 3300046459 Bacteria 8169
767 Ga0495629_0007389 3300046459 Bacteria 8100
768 Ga0495629_0044098 3300046459 Bacteria 3131
769 Ga0495641_0003742 3300046461 Bacteria 11190
770 Ga0495651_0003813 3300046462 Bacteria 11527
771 Ga0495651_0099994 3300046462 Bacteria 2161
772 Ga0495653_0001766 3300046463 Bacteria 17042
773 Ga0495653_0012356 3300046463 Bacteria 6968
774 Ga0495653_0016850 3300046463 Bacteria 5947
775 Ga0495653_0033068 3300046463 Bacteria 4099
776 Ga0495653_0081309 3300046463 Bacteria 2394
777 Ga0495650_0003098 3300046471 Bacteria 12470
778 Ga0495650_0020005 3300046471 Bacteria 3275
779 Ga0495650_0026241 3300046471 Bacteria 2713
780 Ga0495650_0027243 3300046471 Bacteria 2644
781 Ga0495580_0000583 3300046472 Bacteria 30806
782 Ga0495580_0000814 3300046472 Bacteria 27040
783 Ga0495580_0004961 3300046472 Bacteria 11120
784 Ga0495580_0006375 3300046472 Bacteria 9626
785 Ga0495580_0007438 3300046472 Bacteria 8804
786 Ga0495580_0009550 3300046472 Bacteria 7621
787 Ga0495580_0014610 3300046472 Bacteria 5951
788 Ga0495580_0020412 3300046472 Bacteria 4902
789 Ga0495580_0055272 3300046472 Bacteria 2798
790 Ga0495582_0005650 3300046473 Bacteria 6962
791 Ga0495582_0008349 3300046473 Bacteria 5714
792 Ga0495582_0023631 3300046473 Bacteria 3362
793 Ga0495605_0002834 3300046474 Bacteria 10539
794 Ga0495605_0014392 3300046474 Bacteria 4336
795 Ga0495662_0016881 3300046476 Bacteria 3533
796 Ga0495664_0004320 3300046477 Bacteria 7764
797 Ga0495664_0062818 3300046477 Bacteria 2212
798 Ga0495596_0001891 3300046500 Bacteria 11608
799 Ga0495607_0000011 3300046501 Bacteria 201960
800 Ga0495583_0003116 3300046506 Bacteria 13113
801 Ga0495583_0027654 3300046506 Bacteria 2796
802 Ga0495606_0009134 3300046507 Bacteria 8442
803 Ga0495606_0023492 3300046507 Bacteria 4465
804 Ga0495606_0052164 3300046507 Bacteria 2661
805 Ga0495608_0008208 3300046511 Bacteria 7332
806 Ga0495608_0008720 3300046511 Bacteria 7094
807 Ga0495608_0010462 3300046511 Bacteria 6474
808 Ga0495608_0052344 3300046511 Bacteria 2703
809 Ga0495608_0180848 3300046511 Bacteria 1334
810 Ga0495610_0004048 3300046512 Bacteria 11021
811 Ga0495616_0042128 3300046513 Bacteria 2326
812 Ga0495618_0005176 3300046514 Bacteria 7970
813 Ga0495618_0007086 3300046514 Bacteria 6779
814 Ga0495618_0047988 3300046514 Bacteria 2695
815 Ga0495620_0003580 3300046515 Bacteria 8876
816 Ga0495620_0051538 3300046515 Bacteria 1751
817 Ga0495628_0001153 3300046516 Bacteria 24121
818 Ga0495628_0005603 3300046516 Bacteria 10994
819 Ga0495628_0008323 3300046516 Bacteria 8908
820 Ga0495628_0009315 3300046516 Bacteria 8389
821 Ga0495628_0120880 3300046516 Bacteria 2009
822 Ga0495630_0019177 3300046517 Bacteria 5026
823 Ga0495630_0081841 3300046517 Bacteria 2436
824 Ga0495631_0000634 3300046518 Bacteria 22982
825 Ga0495632_0015384 3300046519 Bacteria 4294
826 Ga0495644_0029347 3300046523 Bacteria 2079
827 Ga0495648_0008628 3300046524 Bacteria 7993
828 Ga0495666_0007411 3300046526 Bacteria 5499
829 Ga0495666_0012569 3300046526 Bacteria 4221
830 Ga0495666_0015894 3300046526 Bacteria 3748
831 Ga0495666_0020278 3300046526 Bacteria 3295
832 Ga0495666_0079029 3300046526 Bacteria 1558
833 Ga0495642_0019980 3300046528 Bacteria 2627
834 Ga0495642_0026395 3300046528 Bacteria 2307
835 Ga0495652_0005229 3300046529 Bacteria 12259
836 Ga0495652_0039062 3300046529 Bacteria 4105
837 Ga0495652_0061496 3300046529 Bacteria 3170
838 Ga0495652_0168863 3300046529 Bacteria 1690
839 Ga0495665_0005506 3300046531 Bacteria 6821
840 Ga0495665_0021980 3300046531 Bacteria 3430
841 Ga0495665_0025968 3300046531 Bacteria 3145
842 Ga0495665_0094044 3300046531 Bacteria 1575
843 Ga0495640_0004868 3300046533 Bacteria 10683
844 Ga0495640_0011169 3300046533 Bacteria 6913
845 Ga0495586_0010556 3300046535 Bacteria 4913
846 Ga0495587_0007394 3300046536 Bacteria 7116
847 Ga0495587_0013810 3300046536 Bacteria 5074
848 Ga0495621_0000394 3300046539 Bacteria 10733
849 Ga0495621_0014998 3300046539 Bacteria 2464
850 Ga0495597_0010029 3300046542 Bacteria 4647
851 Ga0495645_0002627 3300046543 Bacteria 12219
852 Ga0495645_0020954 3300046543 Bacteria 4724
853 Ga0495622_0000106 3300046557 Bacteria 72908
854 Ga0495667_0019125 3300046559 Bacteria 4623
855 Ga0495667_0032346 3300046559 Bacteria 3506
856 Ga0495656_0000305 3300046615 Bacteria 17044
857 Ga0495656_0009114 3300046615 Bacteria 3563
858 Ga0495656_0012053 3300046615 Bacteria 3184
859 Ga0495668_0109649 3300046616 Bacteria 1510
860 Ga0495634_0007237 3300046642 Bacteria 8366
861 Ga0495625_0000114 3300046660 Bacteria 123268
862 Ga0495625_0000673 3300046660 Bacteria 48716
863 Ga0495625_0092075 3300046660 Bacteria 2095
864 Ga0495635_0007675 3300046663 Bacteria 7528
865 Ga0495635_0014972 3300046663 Bacteria 5424
866 Ga0495635_0027031 3300046663 Bacteria 3991
867 Ga0495661_0008073 3300046665 Bacteria 7304
868 Ga0495661_0010605 3300046665 Bacteria 6283
869 Ga0495588_0084083 3300046674 Bacteria 1663
870 Ga0495599_0005537 3300046678 Bacteria 7569
871 Ga0495599_0006022 3300046678 Bacteria 7299
872 Ga0495599_0029278 3300046678 Bacteria 3451
873 Ga0495623_0003924 3300046679 Bacteria 9809
874 Ga0495623_0014711 3300046679 Bacteria 5060
875 Ga0495623_0022961 3300046679 Bacteria 4028
876 Ga0495646_0001749 3300046680 Bacteria 13033
877 Ga0495646_0012545 3300046680 Bacteria 5386
878 Ga0495646_0026916 3300046680 Bacteria 3610
879 Ga0495646_0045860 3300046680 Bacteria 2667
880 Ga0495646_0113600 3300046680 Bacteria 1539
881 Ga0495658_0030569 3300046683 Bacteria 2926
882 Ga0495613_0003622 3300046689 Bacteria 11568
883 Ga0495624_0000205 3300046690 Bacteria 45459
884 Ga0495624_0002128 3300046690 Bacteria 15089
885 Ga0495624_0006504 3300046690 Bacteria 8283
886 Ga0495624_0011297 3300046690 Bacteria 6138
887 Ga0495624_0091586 3300046690 Bacteria 1875
888 Ga0495670_0052387 3300046691 Bacteria 2043
889 Ga0495671_0008434 3300046692 Bacteria 5800
890 Ga0495671_0010961 3300046692 Bacteria 5005
891 Ga0495589_0004012 3300046794 Bacteria 7893
892 Ga0495589_0005240 3300046794 Bacteria 6859
893 Ga0495589_0051334 3300046794 Bacteria 2039
894 Ga0495600_0002851 3300046809 Bacteria 10061
895 Ga0495600_0011066 3300046809 Bacteria 5614
896 Ga0495581_0000867 3300047315 Bacteria 16154
897 Ga0495581_0007002 3300047315 Bacteria 6536
898 Ga0495581_0008077 3300047315 Bacteria 6092
899 Ga0495604_0002664 3300047317 Bacteria 14335
900 Ga0495604_0053107 3300047317 Bacteria 3134
901 Ga0495604_0079343 3300047317 Bacteria 2461
902 Ga0495674_0005975 3300047319 Bacteria 11683
903 Ga0495674_0032237 3300047319 Bacteria 4754
904 Ga0495674_0039437 3300047319 Bacteria 4233
905 Ga0495674_0185003 3300047319 Bacteria 1733
906 Ga0495676_0005709 3300047321 Bacteria 11408
907 Ga0495676_0018952 3300047321 Bacteria 6061
908 Ga0495676_0174433 3300047321 Bacteria 1511
909 Ga0495680_0005010 3300047322 Bacteria 12532
910 Ga0495680_0014350 3300047322 Bacteria 6866
911 Ga0495680_0042829 3300047322 Bacteria 3588
912 Ga0495680_0048172 3300047322 Bacteria 3348
913 Ga0495680_0105865 3300047322 Bacteria 2091
914 Ga0495683_0044287 3300047323 Bacteria 2238
915 Ga0495683_0074856 3300047323 Bacteria 1658
916 Ga0495687_000627 3300047443 Bacteria 40736
917 Ga0495687_018933 3300047443 Bacteria 3390
918 Ga0495675_0003010 3300047444 Bacteria 10118
919 Ga0495675_0006606 3300047444 Bacteria 7102
920 Ga0495675_0013374 3300047444 Bacteria 5179
921 Ga0495679_000007 3300047446 Bacteria 401482
922 Ga0495679_000675 3300047446 Bacteria 22377
923 Ga0495679_008189 3300047446 Bacteria 4275
924 Ga0495673_0001793 3300047469 Bacteria 16278
925 Ga0495684_0011715 3300047471 Bacteria 6770
926 Ga0495593_0003670 3300047673 Bacteria 9164
927 Ga0495593_0004593 3300047673 Bacteria 8209
928 Ga0495593_0008511 3300047673 Bacteria 5965
929 Ga0495593_0019753 3300047673 Bacteria 3775
930 Ga0495602_0015811 3300048088 Bacteria 7600
931 Ga0495602_0041139 3300048088 Bacteria 4226
932 Ga0495602_0050891 3300048088 Bacteria 3696
933 Ga0495602_0168096 3300048088 Bacteria 1704
934 Ga0495614_0007800 3300048089 Bacteria 4757
935 Ga0495614_0011841 3300048089 Bacteria 3834
936 Ga0495614_0012595 3300048089 Bacteria 3710
937 Ga0495615_0001570 3300048090 Bacteria 3439
938 Ga0496100_0000134 3300048903 Bacteria 41088
939 Ga0496100_0015242 3300048903 Bacteria 4485
940 Ga0496100_0023647 3300048903 Bacteria 3736
941 Ga0496100_0054869 3300048903 Bacteria 2601
942 Ga0496100_0111206 3300048903 Bacteria 1903
943 Ga0496101_0001260 3300048904 Bacteria 15158
944 Ga0496101_0043502 3300048904 Bacteria 3210
945 Ga0496101_0063640 3300048904 Bacteria 2686
946 Ga0496101_0095335 3300048904 Bacteria 2219
947 Ga0496102_0000293 3300048905 Bacteria 64179
948 Ga0496102_0002167 3300048905 Bacteria 16850
949 Ga0496102_0003915 3300048905 Bacteria 12608
950 Ga0496102_0065377 3300048905 Bacteria 3333
951 Ga0496102_0159663 3300048905 Bacteria 2120
952 Ga0496103_0000711 3300048906 Bacteria 24662
953 Ga0496103_0008996 3300048906 Bacteria 5917
954 Ga0496103_0016725 3300048906 Bacteria 4380
955 Ga0496104_0214291 3300048907 Bacteria 1838
956 Ga0496105_0017799 3300048908 Bacteria 5700
957 Ga0496105_0042035 3300048908 Bacteria 3768
958 Ga0496105_0077685 3300048908 Bacteria 2741
959 Ga0496105_0139075 3300048908 Bacteria 1999
960 Ga0496106_0000021 3300048909 Bacteria 168346
961 Ga0496106_0002914 3300048909 Bacteria 12735
962 Ga0496106_0029898 3300048909 Bacteria 4061
963 Ga0496106_0217482 3300048909 Bacteria 1523
964 Ga0496107_0009116 3300048910 Bacteria 6880
965 Ga0496107_0035662 3300048910 Bacteria 3566
966 Ga0496107_0041083 3300048910 Bacteria 3321
967 Ga0496108_0023404 3300048911 Bacteria 5083
968 Ga0496109_0057377 3300048912 Bacteria 3554
969 Ga0496109_0059615 3300048912 Bacteria 3487
970 Ga0496109_0098045 3300048912 Bacteria 2717
971 Ga0496110_0057264 3300048913 Bacteria 3431
972 Ga0496111_0052025 3300048914 Bacteria 2957
973 Ga0496112_0014356 3300048915 Bacteria 7341
974 Ga0496112_0122727 3300048915 Bacteria 2568
975 Ga0496113_0002688 3300048916 Bacteria 10427
976 Ga0496114_0000551 3300048917 Bacteria 27713
977 Ga0496114_0007591 3300048917 Bacteria 8573
978 Ga0496114_0027841 3300048917 Bacteria 4633
979 Ga0496114_0101811 3300048917 Bacteria 2453
980 Ga0496116_0003614 3300048919 Bacteria 15206
981 Ga0496116_0032642 3300048919 Bacteria 3707
982 Ga0496117_0000147 3300048920 Bacteria 149471
983 Ga0496117_0002249 3300048920 Bacteria 24913
984 Ga0496117_0008916 3300048920 Bacteria 9448
985 Ga0496117_0101731 3300048920 Bacteria 1815
986 Ga0496118_0000464 3300048921 Bacteria 67368
987 Ga0496118_0000499 3300048921 Bacteria 64881
988 Ga0496118_0001891 3300048921 Bacteria 29878
989 Ga0496118_0011851 3300048921 Bacteria 8451
990 Ga0496118_0016464 3300048921 Bacteria 6781
991 Ga0496118_0021529 3300048921 Bacteria 5670
992 Ga0496118_0082490 3300048921 Bacteria 2252
993 Ga0496121_0000357 3300048924 Bacteria 94003
994 Ga0496121_0000761 3300048924 Bacteria 59223
995 Ga0496121_0006632 3300048924 Bacteria 14254
996 Ga0496121_0010719 3300048924 Bacteria 10281
997 Ga0496121_0021040 3300048924 Bacteria 6415
998 Ga0496121_0022024 3300048924 Bacteria 6207
999 Ga0496121_0056130 3300048924 Bacteria 3274
1000 Ga0496121_0070700 3300048924 Bacteria 2810
1001 Ga0496122_0000039 3300048925 Bacteria 295352
1002 Ga0496122_0000801 3300048925 Bacteria 60312
1003 Ga0496122_0038217 3300048925 Bacteria 3850
1004 Ga0496123_0000026 3300048926 Bacteria 318040
1005 Ga0496123_0000528 3300048926 Bacteria 65747
1006 Ga0496123_0008204 3300048926 Bacteria 9631
1007 Ga0496123_0053650 3300048926 Bacteria 2662
1008 Ga0496124_0000038 3300048927 Bacteria 312485
1009 Ga0496124_0008146 3300048927 Bacteria 11003
1010 Ga0496124_0024125 3300048927 Bacteria 5536
1011 Ga0496124_0034010 3300048927 Bacteria 4479
1012 Ga0496124_0056537 3300048927 Bacteria 3308
1013 Ga0496125_0000019 3300048928 Bacteria 474989
1014 Ga0496125_0002162 3300048928 Bacteria 26300
1015 Ga0496125_0002410 3300048928 Bacteria 24343
1016 Ga0496125_0007776 3300048928 Bacteria 11341
1017 Ga0496125_0009597 3300048928 Bacteria 9901
1018 Ga0496125_0039380 3300048928 Bacteria 4071
1019 Ga0496125_0117194 3300048928 Bacteria 1910
1020 Ga0496126_0000038 3300048929 Bacteria 347738
1021 Ga0496126_0000484 3300048929 Bacteria 78854
1022 Ga0496126_0001949 3300048929 Bacteria 29315
1023 Ga0496126_0002807 3300048929 Bacteria 22903
1024 Ga0496126_0221935 3300048929 Bacteria 1587
1025 Ga0495678_025210 3300049459 Bacteria 2557
1026 Ga0495682_0054715 3300049460 Bacteria 1448
1027 Ga0501034_0002930 3300049571 Bacteria 19779
1028 Ga0501034_0014325 3300049571 Bacteria 8172
1029 Ga0501043_0000024 3300049579 Bacteria 154045
1030 Ga0501046_0000107 3300049580 Bacteria 88655
1031 Ga0501047_0000051 3300049581 Bacteria 154281
1032 Ga0501047_0087623 3300049581 Bacteria 2991
1033 Ga0501068_0036078 3300049584 Bacteria 2955
1034 Ga0501035_0024705 3300049822 Bacteria 5509
1035 Ga0501044_0000162 3300049823 Bacteria 82725
1036 Ga0501044_0017813 3300049823 Bacteria 7619
1037 Ga0501045_0002190 3300049824 Bacteria 13251
1038 nmdc:mga03683_18011_c1 3300050489 Bacteria 2680
1039 nmdc:mga03683_8534_c1 3300050489 Bacteria 3606
1040 nmdc:mga03n38_50300_c1 3300050490 Bacteria 1857
1041 nmdc:mga03n38_55033_c1 3300050490 Bacteria 1791
1042 nmdc:mga0yw44_26921_c1 3300050492 Bacteria 3289
1043 nmdc:mga0yw44_873_c1 3300050492 Bacteria 11337
1044 nmdc:mga0k408_10468_c1 3300050493 Bacteria 5016
1045 nmdc:mga0k408_25171_c1 3300050493 Bacteria 3369
1046 nmdc:mga06z11_27506_c1 3300050494 Bacteria 2719
1047 nmdc:mga07m45_143_c1 3300050496 Bacteria 28092
1048 nmdc:mga07m45_1808_c1 3300050496 Bacteria 9854
1049 nmdc:mga07m45_1985_c1 3300050496 Bacteria 9478
1050 nmdc:mga07m45_30036_c1 3300050496 Bacteria 3009
1051 nmdc:mga07m45_9496_c1 3300050496 Bacteria 5049
1052 nmdc:mga09592_918_c1 3300050508 Bacteria 23162
1053 nmdc:mga0rr50_44678_c1 3300050513 Bacteria 3251
1054 nmdc:mga0sz30_71593_c1 3300050516 Bacteria 1493
1055 Ga0495601_0090036 3300053077 Bacteria 1973
1056 Ga0500610_0018896 3300053079 Bacteria 3341
1057 Ga0500578_0000182 3300053086 Bacteria 75873
1058 Ga0500646_0001297 3300053090 Bacteria 6682
1059 Ga0500651_0002119 3300053093 Bacteria 10327
1060 Ga0500651_0005188 3300053093 Bacteria 7413
1061 Ga0500571_000120 3300053110 Bacteria 25884
1062 Ga0500593_001443 3300053117 Bacteria 8546
1063 Ga0500594_0003171 3300053118 Bacteria 3601
1064 Ga0500595_003140 3300053119 Bacteria 7833
1065 Ga0500618_000198 3300053125 Bacteria 48816
1066 Ga0500618_002381 3300053125 Bacteria 7168
1067 Ga0500628_001927 3300053129 Bacteria 3491
1068 Ga0500642_0010981 3300053130 Bacteria 3219
1069 Ga0500652_003380 3300053131 Bacteria 4830
1070 Ga0500658_0004750 3300053134 Bacteria 5061
1071 Ga0500658_0005317 3300053134 Bacteria 4787
1072 Ga0500559_0000746 3300053136 Bacteria 21360
1073 Ga0500568_0004355 3300053139 Bacteria 7578
1074 Ga0500574_000634 3300053141 Bacteria 4563
1075 Ga0500579_099986 3300053143 Bacteria 1517
1076 Ga0500616_0004412 3300053153 Bacteria 10038
1077 Ga0500616_0016885 3300053153 Bacteria 4145
1078 Ga0500619_001244 3300053154 Bacteria 4450
1079 Ga0500622_0000600 3300053156 Bacteria 32731
1080 Ga0466962_0000380 3300061719 Bacteria 19181
1081 Ga0466962_0013792 3300061719 Bacteria 3890
1082 Ga0466962_0026349 3300061719 Bacteria 2791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0590498 Ga0451576_0590498_40_1155 338
2 3300037418 Ga0395900_0031877 Ga0395900_0031877_4195_5400 360
3 3300045836 Ga0466958_0041424 Ga0466958_0041424_1638_2756 363
4 3300042007 Ga0439449_0027862 Ga0439449_0027862_893_2095 370
5 3300005543 Ga0070672_100014536 Ga0070672_1000145363 379
6 3300025940 Ga0207691_10017585 Ga0207691_100175853 379
7 3300038443 Ga0395901_0228488 Ga0395901_0228488_13_1227 383
8 3300042136 Ga0450900_001276 Ga0450900_001276_16_1218 385
9 3300026067 Ga0207678_10087348 Ga0207678_100873483 387
10 3300026142 Ga0207698_10069753 Ga0207698_100697532 387
11 3300037312 Ga0395899_0028529 Ga0395899_0028529_1564_2871 388
12 3300045836 Ga0466958_0006725 Ga0466958_0006725_2280_3587 388
13 3300005834 Ga0068851_10056345 Ga0068851_100563452 389
14 3300037471 Ga0395905_0169270 Ga0395905_0169270_83_1363 390
15 3300025901 Ga0207688_10041569 Ga0207688_100415693 393
16 3300027665 Ga0209983_1016114 Ga0209983_10161141 393
17 3300038443 Ga0395901_0000113 Ga0395901_0000113_18145_19452 394
18 3300026088 Ga0207641_10208961 Ga0207641_102089611 395
19 3300026095 Ga0207676_10049556 Ga0207676_100495562 395
20 3300048926 Ga0496123_0053650 Ga0496123_0053650_1417_2631 396
21 3300005457 Ga0070662_100208089 Ga0070662_1002080892 397
22 3300005564 Ga0070664_100000906 Ga0070664_10000090610 397
23 3300005577 Ga0068857_100044583 Ga0068857_1000445832 397
24 3300005578 Ga0068854_100172361 Ga0068854_1001723612 397
25 3300015262 Ga0182007_10001063 Ga0182007_1000106310 397
26 3300025728 Ga0207655_1002128 Ga0207655_100212820 397
27 3300025945 Ga0207679_10005146 Ga0207679_100051468 397
28 3300026116 Ga0207674_10053089 Ga0207674_100530894 397
29 3300048921 Ga0496118_0016464 Ga0496118_0016464_667_1950 397
30 3300050496 nmdc:mga07m45_30036_c1 nmdc:mga07m45_30036_c1_1018_2301 397
31 3300003763 Ga0055529_1000793 Ga0055529_100079312 398
32 3300025272 Ga0209455_1000309 Ga0209455_100030923 398
33 3300028380 Ga0268265_10259162 Ga0268265_102591621 398
34 3300046511 Ga0495608_0052344 Ga0495608_0052344_246_1541 398
35 3300049823 Ga0501044_0000162 Ga0501044_0000162_31587_32909 398
36 3300005347 Ga0070668_100207484 Ga0070668_1002074841 399
37 3300005354 Ga0070675_100087879 Ga0070675_1000878792 399
38 3300025925 Ga0207650_10131372 Ga0207650_101313722 399
39 3300025926 Ga0207659_10066810 Ga0207659_100668102 399
40 3300026088 Ga0207641_10014446 Ga0207641_100144462 399
41 3300026095 Ga0207676_10009311 Ga0207676_100093111 399
42 3300053090 Ga0500646_0001297 Ga0500646_0001297_4186_5415 399
43 3300003751 Ga0055538_1000019 Ga0055538_100001965 400
44 3300003752 Ga0055539_1000024 Ga0055539_1000024225 400
45 3300003756 Ga0055533_1000032 Ga0055533_100003265 400
46 3300003759 Ga0055525_1000041 Ga0055525_100004165 400
47 3300003841 Ga0055541_1000018 Ga0055541_1000018225 400
48 3300005328 Ga0070676_10000163 Ga0070676_100001634 400
49 3300005335 Ga0070666_10018576 Ga0070666_100185762 400
50 3300005338 Ga0068868_100046475 Ga0068868_1000464752 400
51 3300005347 Ga0070668_100050338 Ga0070668_1000503382 400
52 3300005354 Ga0070675_100015142 Ga0070675_1000151422 400
53 3300005355 Ga0070671_100002902 Ga0070671_1000029029 400
54 3300005356 Ga0070674_100000918 Ga0070674_10000091811 400
55 3300005364 Ga0070673_100012305 Ga0070673_1000123053 400
56 3300005367 Ga0070667_100057323 Ga0070667_1000573231 400
57 3300005455 Ga0070663_100002550 Ga0070663_1000025509 400
58 3300005456 Ga0070678_100000108 Ga0070678_10000010824 400
59 3300005459 Ga0068867_100000562 Ga0068867_1000005623 400
60 3300005539 Ga0068853_100003541 Ga0068853_1000035419 400
61 3300005543 Ga0070672_100000588 Ga0070672_10000058814 400
62 3300005548 Ga0070665_100005868 Ga0070665_1000058682 400
63 3300005616 Ga0068852_100003443 Ga0068852_1000034437 400
64 3300005618 Ga0068864_100014949 Ga0068864_1000149493 400
65 3300005834 Ga0068851_10000392 Ga0068851_1000039216 400
66 3300005841 Ga0068863_100012787 Ga0068863_1000127874 400
67 3300006237 Ga0097621_100012923 Ga0097621_1000129233 400
68 3300006881 Ga0068865_100023960 Ga0068865_1000239602 400
69 3300009036 Ga0105244_10008377 Ga0105244_100083776 400
70 3300009148 Ga0105243_10009905 Ga0105243_100099057 400
71 3300013296 Ga0157374_10122384 Ga0157374_101223842 400
72 3300013306 Ga0163162_10089124 Ga0163162_100891242 400
73 3300014497 Ga0182008_10009543 Ga0182008_100095435 400
74 3300015261 Ga0182006_1052463 Ga0182006_10524632 400
75 3300021361 Ga0213872_10004344 Ga0213872_100043448 400
76 3300025224 Ga0209784_100009 Ga0209784_100009290 400
77 3300025225 Ga0209566_100007 Ga0209566_100007290 400
78 3300025226 Ga0209674_100018 Ga0209674_100018290 400
79 3300025230 Ga0209563_100020 Ga0209563_100020290 400
80 3300025253 Ga0209677_100010 Ga0209677_100010290 400
81 3300025321 Ga0207656_10002444 Ga0207656_100024443 400
82 3300025893 Ga0207682_10000116 Ga0207682_1000011629 400
83 3300025903 Ga0207680_10056006 Ga0207680_100560061 400
84 3300025907 Ga0207645_10001013 Ga0207645_100010136 400
85 3300025909 Ga0207705_10063475 Ga0207705_100634752 400
86 3300025926 Ga0207659_10001317 Ga0207659_1000131712 400
87 3300025931 Ga0207644_10006544 Ga0207644_100065442 400
88 3300025937 Ga0207669_10000388 Ga0207669_1000038812 400
89 3300025938 Ga0207704_10035262 Ga0207704_100352622 400
90 3300025940 Ga0207691_10000050 Ga0207691_1000005023 400
91 3300025942 Ga0207689_10012008 Ga0207689_100120083 400
92 3300025972 Ga0207668_10020977 Ga0207668_100209774 400
93 3300025986 Ga0207658_10005274 Ga0207658_100052746 400
94 3300026023 Ga0207677_10071000 Ga0207677_100710002 400
95 3300026041 Ga0207639_10118818 Ga0207639_101188182 400
96 3300026067 Ga0207678_10008128 Ga0207678_100081289 400
97 3300026088 Ga0207641_10005662 Ga0207641_100056626 400
98 3300026089 Ga0207648_10001149 Ga0207648_1000114928 400
99 3300026095 Ga0207676_10011291 Ga0207676_100112913 400
100 3300026118 Ga0207675_100003832 Ga0207675_1000038327 400
101 3300026121 Ga0207683_10000278 Ga0207683_1000027823 400
102 3300026142 Ga0207698_10008665 Ga0207698_100086652 400
103 3300028379 Ga0268266_10005235 Ga0268266_100052353 400
104 3300028381 Ga0268264_10005575 Ga0268264_100055759 400
105 3300039447 Ga0436361_0726260 Ga0436361_0726260_4358_5653 400
106 3300049584 Ga0501068_0036078 Ga0501068_0036078_715_1986 400
107 3300049823 Ga0501044_0017813 Ga0501044_0017813_5581_6852 400
108 3300005456 Ga0070678_100187517 Ga0070678_1001875172 401
109 3300013308 Ga0157375_10220337 Ga0157375_102203372 401
110 3300015683 Ga0183362_10004 Ga0183362_10004309 401
111 3300046459 Ga0495629_0007244 Ga0495629_0007244_5043_6347 401
112 3300046463 Ga0495653_0016850 Ga0495653_0016850_2336_3640 401
113 3300046471 Ga0495650_0003098 Ga0495650_0003098_1824_3128 401
114 3300046472 Ga0495580_0014610 Ga0495580_0014610_2193_3497 401
115 3300046473 Ga0495582_0023631 Ga0495582_0023631_121_1425 401
116 3300046531 Ga0495665_0094044 Ga0495665_0094044_189_1493 401
117 3300046543 Ga0495645_0002627 Ga0495645_0002627_6563_7867 401
118 3300046559 Ga0495667_0032346 Ga0495667_0032346_1105_2409 401
119 3300046615 Ga0495656_0000305 Ga0495656_0000305_13411_14775 401
120 3300046616 Ga0495668_0109649 Ga0495668_0109649_79_1383 401
121 3300046794 Ga0495589_0051334 Ga0495589_0051334_695_1999 401
122 3300047315 Ga0495581_0008077 Ga0495581_0008077_929_2233 401
123 3300048090 Ga0495615_0001570 Ga0495615_0001570_493_1857 401
124 3300048912 Ga0496109_0059615 Ga0496109_0059615_238_1560 401
125 3300048917 Ga0496114_0000551 Ga0496114_0000551_24749_26053 401
126 3300013105 Ga0157369_10000639 Ga0157369_1000063921 402
127 3300020070 Ga0206356_10615716 Ga0206356_106157162 402
128 3300020081 Ga0206354_11086307 Ga0206354_110863071 402
129 3300022467 Ga0224712_10000089 Ga0224712_1000008910 402
130 3300026067 Ga0207678_10093087 Ga0207678_100930871 402
131 3300044712 Ga0453684_0028819 Ga0453684_0028819_5804_7081 402
132 3300048904 Ga0496101_0095335 Ga0496101_0095335_804_2087 402
133 3300049822 Ga0501035_0024705 Ga0501035_0024705_4113_5435 402
134 3300037471 Ga0395905_0023865 Ga0395905_0023865_2022_3302 404
135 3300049571 Ga0501034_0002930 Ga0501034_0002930_1926_3197 404
136 3300025906 Ga0207699_10021069 Ga0207699_100210694 405
137 3300025949 Ga0207667_10036065 Ga0207667_100360655 405
138 3300026078 Ga0207702_10258684 Ga0207702_102586842 405
139 3300053153 Ga0500616_0004412 Ga0500616_0004412_7411_8685 406
140 3300006048 Ga0075363_100032241 Ga0075363_1000322413 407
141 3300006178 Ga0075367_10040061 Ga0075367_100400613 407
142 3300006186 Ga0075369_10044648 Ga0075369_100446482 407
143 3300026116 Ga0207674_10136684 Ga0207674_101366842 407
144 3300026116 Ga0207674_10266636 Ga0207674_102666361 407
145 3300044673 Ga0453683_0002824 Ga0453683_0002824_3575_4906 407
146 3300050489 nmdc:mga03683_8534_c1 nmdc:mga03683_8534_c1_416_1759 407
147 3300050490 nmdc:mga03n38_55033_c1 nmdc:mga03n38_55033_c1_431_1774 407
148 3300050494 nmdc:mga06z11_27506_c1 nmdc:mga06z11_27506_c1_512_1855 407
149 3300003794 Ga0055531_10000574 Ga0055531_100005746 408
150 3300005295 Ga0065707_10000729 Ga0065707_100007292 408
151 3300005439 Ga0070711_100146466 Ga0070711_1001464662 408
152 3300006353 Ga0075370_10061617 Ga0075370_100616172 408
153 3300013104 Ga0157370_10009411 Ga0157370_100094113 408
154 3300025303 Ga0209051_1001437 Ga0209051_100143718 408
155 3300025304 Ga0209257_1000015 Ga0209257_1000015109 408
156 3300025916 Ga0207663_10142744 Ga0207663_101427442 408
157 3300037312 Ga0395899_0023970 Ga0395899_0023970_2299_3624 408
158 3300037466 Ga0395898_0019144 Ga0395898_0019144_4430_5755 408
159 3300046457 Ga0495590_0009115 Ga0495590_0009115_1646_2896 408
160 3300050496 nmdc:mga07m45_1985_c1 nmdc:mga07m45_1985_c1_7239_8582 408
161 3300050508 nmdc:mga09592_918_c1 nmdc:mga09592_918_c1_3178_4464 408
162 3300005339 Ga0070660_100026061 Ga0070660_1000260614 409
163 3300025919 Ga0207657_10090805 Ga0207657_100908052 409
164 3300037466 Ga0395898_0000747 Ga0395898_0000747_35360_36640 409
165 3300042015 Ga0439462_0008004 Ga0439462_0008004_1224_2555 409
166 3300025284 Ga0209130_1012138 Ga0209130_10121381 410
167 3300037418 Ga0395900_0000147 Ga0395900_0000147_62013_63293 410
168 3300047322 Ga0495680_0048172 Ga0495680_0048172_1560_2867 410
169 3300002067 JGI24735J21928_10001283 JGI24735J21928_100012834 411
170 3300005339 Ga0070660_100006289 Ga0070660_1000062892 411
171 3300005459 Ga0068867_100000093 Ga0068867_10000009311 411
172 3300009093 Ga0105240_10003213 Ga0105240_1000321319 411
173 3300009545 Ga0105237_10073764 Ga0105237_100737642 411
174 3300010375 Ga0105239_10005015 Ga0105239_100050153 411
175 3300013100 Ga0157373_10036117 Ga0157373_100361171 411
176 3300013105 Ga0157369_10036458 Ga0157369_100364583 411
177 3300013296 Ga0157374_10006945 Ga0157374_100069452 411
178 3300013307 Ga0157372_10127049 Ga0157372_101270492 411
179 3300025256 Ga0209759_1003352 Ga0209759_10033522 411
180 3300025904 Ga0207647_10000212 Ga0207647_1000021235 411
181 3300025911 Ga0207654_10055546 Ga0207654_100555462 411
182 3300025913 Ga0207695_10051275 Ga0207695_100512753 411
183 3300025919 Ga0207657_10008355 Ga0207657_100083554 411
184 3300025935 Ga0207709_10000887 Ga0207709_1000088711 411
185 3300025949 Ga0207667_10022753 Ga0207667_100227532 411
186 3300026089 Ga0207648_10000039 Ga0207648_1000003933 411
187 3300031456 Ga0307513_10117103 Ga0307513_101171031 411
188 3300037466 Ga0395898_0290326 Ga0395898_0290326_181_1488 411
189 3300042005 Ga0439448_0001178 Ga0439448_0001178_2848_4155 411
190 3300047443 Ga0495687_000627 Ga0495687_000627_39368_40669 411
191 3300002739 JGI25158J39367_1001141 JGI25158J39367_10011413 412
192 3300002987 JGI25159J45721_1005654 JGI25159J45721_10056544 412
193 3300003761 Ga0055535_1000133 Ga0055535_10001339 412
194 3300003762 Ga0055542_1000003 Ga0055542_1000003439 412
195 3300003773 Ga0055537_1001556 Ga0055537_10015561 412
196 3300003781 Ga0055536_1014382 Ga0055536_10143823 412
197 3300003784 Ga0055534_1004524 Ga0055534_10045241 412
198 3300003792 Ga0055540_1018685 Ga0055540_10186851 412
199 3300003794 Ga0055531_10029676 Ga0055531_100296761 412
200 3300004625 Ga0055543_1001224 Ga0055543_10012249 412
201 3300005262 Ga0065165_1001795 Ga0065165_10017951 412
202 3300005331 Ga0070670_100027847 Ga0070670_1000278472 412
203 3300005834 Ga0068851_10008200 Ga0068851_100082004 412
204 3300006038 Ga0075365_10030299 Ga0075365_100302993 412
205 3300013102 Ga0157371_10026873 Ga0157371_100268733 412
206 3300013307 Ga0157372_10140220 Ga0157372_101402203 412
207 3300021361 Ga0213872_10000208 Ga0213872_1000020833 412
208 3300025229 Ga0209147_100449 Ga0209147_10044921 412
209 3300025242 Ga0209258_100015 Ga0209258_100015559 412
210 3300025245 Ga0207425_1000405 Ga0207425_10004053 412
211 3300025254 Ga0209148_1000028 Ga0209148_1000028110 412
212 3300025258 Ga0209129_1000461 Ga0209129_10004612 412
213 3300025258 Ga0209129_1007161 Ga0209129_10071613 412
214 3300025263 Ga0209565_1000646 Ga0209565_10006462 412
215 3300025263 Ga0209565_1006184 Ga0209565_10061842 412
216 3300025273 Ga0209673_1000461 Ga0209673_100046118 412
217 3300025273 Ga0209673_1001670 Ga0209673_10016702 412
218 3300025284 Ga0209130_1000485 Ga0209130_10004853 412
219 3300025291 Ga0209675_1000369 Ga0209675_100036935 412
220 3300025291 Ga0209675_1009637 Ga0209675_10096373 412
221 3300025292 Ga0209676_1000575 Ga0209676_10005753 412
222 3300025292 Ga0209676_1025228 Ga0209676_10252282 412
223 3300025294 Ga0209025_1000305 Ga0209025_1000305106 412
224 3300025294 Ga0209025_1017879 Ga0209025_10178792 412
225 3300025295 Ga0209564_1000110 Ga0209564_1000110116 412
226 3300025295 Ga0209564_1000123 Ga0209564_100012386 412
227 3300025297 Ga0209758_1000039 Ga0209758_1000039116 412
228 3300025298 Ga0209050_1000015 Ga0209050_1000015600 412
229 3300025298 Ga0209050_1001757 Ga0209050_10017572 412
230 3300025299 Ga0209256_1000074 Ga0209256_1000074116 412
231 3300025299 Ga0209256_1000082 Ga0209256_1000082104 412
232 3300025302 Ga0207426_1000112 Ga0207426_100011297 412
233 3300025302 Ga0207426_1000121 Ga0207426_1000121115 412
234 3300025303 Ga0209051_1000081 Ga0209051_1000081122 412
235 3300025303 Ga0209051_1003682 Ga0209051_10036823 412
236 3300025303 Ga0209051_1047255 Ga0209051_10472551 412
237 3300025304 Ga0209257_1000026 Ga0209257_100002677 412
238 3300025304 Ga0209257_1001188 Ga0209257_10011883 412
239 3300025304 Ga0209257_1026757 Ga0209257_10267572 412
240 3300025304 Ga0209257_1027178 Ga0209257_10271782 412
241 3300039447 Ga0436361_0074986 Ga0436361_0074986_9725_11011 412
242 3300039447 Ga0436361_0348185 Ga0436361_0348185_1464_2837 412
243 3300039447 Ga0436361_0481941 Ga0436361_0481941_1094_2386 412
244 3300050516 nmdc:mga0sz30_71593_c1 nmdc:mga0sz30_71593_c1_102_1376 412
245 3300002705 JGI25156J39149_1004311 JGI25156J39149_10043112 413
246 3300003756 Ga0055533_1004342 Ga0055533_10043422 413
247 3300003781 Ga0055536_1007959 Ga0055536_10079593 413
248 3300003792 Ga0055540_1000628 Ga0055540_10006283 413
249 3300003794 Ga0055531_10027446 Ga0055531_100274462 413
250 3300005327 Ga0070658_10048214 Ga0070658_100482141 413
251 3300005844 Ga0068862_100035762 Ga0068862_1000357622 413
252 3300006051 Ga0075364_10002679 Ga0075364_100026798 413
253 3300009148 Ga0105243_10000456 Ga0105243_1000045613 413
254 3300009148 Ga0105243_10001192 Ga0105243_1000119214 413
255 3300014745 Ga0157377_10000036 Ga0157377_1000003686 413
256 3300025206 Ga0209435_105547 Ga0209435_1055471 413
257 3300025226 Ga0209674_100143 Ga0209674_10014361 413
258 3300025228 Ga0209672_100306 Ga0209672_10030621 413
259 3300025256 Ga0209759_1000092 Ga0209759_1000092153 413
260 3300025292 Ga0209676_1000241 Ga0209676_100024125 413
261 3300025303 Ga0209051_1000650 Ga0209051_100065031 413
262 3300025304 Ga0209257_1012549 Ga0209257_10125492 413
263 3300025919 Ga0207657_10033676 Ga0207657_100336762 413
264 3300025935 Ga0207709_10000229 Ga0207709_1000022934 413
265 3300028380 Ga0268265_10039116 Ga0268265_100391165 413
266 3300042876 Ga0451577_0227390 Ga0451577_0227390_180_1535 413
267 3300044901 Ga0466960_0015381 Ga0466960_0015381_1100_2407 413
268 3300049579 Ga0501043_0000024 Ga0501043_0000024_96348_97664 413
269 3300049580 Ga0501046_0000107 Ga0501046_0000107_30950_32266 413
270 3300049581 Ga0501047_0000051 Ga0501047_0000051_56372_57688 413
271 3300049824 Ga0501045_0002190 Ga0501045_0002190_6663_7979 413
272 iso_pu_bacteria 2513020051 2513230882 413
273 iso_pu_bacteria 2643221658 2644327324 413
274 iso_pu_bacteria 2643221672 2644401930 413
275 iso_pu_bacteria 2738541277 2738722719 413
276 iso_pu_bacteria 2738541307 2738883638 413
277 iso_pu_bacteria 2738543019 2739283290 413
278 iso_pu_bacteria 2928084124 2928085315 413
279 iso_pu_bacteria 2945909444 2945915315 413
280 iso_pu_bacteria 2945984333 2945989281 413
281 3300014497 Ga0182008_10000210 Ga0182008_1000021040 414
282 3300037312 Ga0395899_0069307 Ga0395899_0069307_239_1570 414
283 3300037418 Ga0395900_0011385 Ga0395900_0011385_1261_2589 414
284 3300038443 Ga0395901_0054473 Ga0395901_0054473_2526_3854 414
285 iso_pu_bacteria 2738543012 2739241527 414
286 iso_pu_bacteria 2816332133 2816476159 414
287 iso_pu_bacteria 2954767861 2954769896 414
288 3300002705 JGI25156J39149_1010618 JGI25156J39149_10106182 415
289 3300002773 JGI25152J39213_1010945 JGI25152J39213_10109452 415
290 3300003215 JGI25153J46596_10007733 JGI25153J46596_100077331 415
291 3300003771 Ga0055526_1006598 Ga0055526_10065986 415
292 3300003792 Ga0055540_1004181 Ga0055540_10041813 415
293 3300005329 Ga0070683_100189189 Ga0070683_1001891892 415
294 3300005563 Ga0068855_100072485 Ga0068855_1000724853 415
295 3300005614 Ga0068856_100014541 Ga0068856_1000145411 415
296 3300005616 Ga0068852_100014098 Ga0068852_1000140984 415
297 3300006358 Ga0068871_100095321 Ga0068871_1000953212 415
298 3300009174 Ga0105241_10257149 Ga0105241_102571492 415
299 3300009545 Ga0105237_10103035 Ga0105237_101030352 415
300 3300010375 Ga0105239_10092970 Ga0105239_100929703 415
301 3300013102 Ga0157371_10040285 Ga0157371_100402853 415
302 3300013105 Ga0157369_10001620 Ga0157369_1000162018 415
303 3300025245 Ga0207425_1000359 Ga0207425_100035928 415
304 3300025256 Ga0209759_1000200 Ga0209759_10002007 415
305 3300025258 Ga0209129_1000035 Ga0209129_1000035250 415
306 3300025273 Ga0209673_1009190 Ga0209673_10091904 415
307 3300025295 Ga0209564_1000024 Ga0209564_1000024444 415
308 3300025297 Ga0209758_1000066 Ga0209758_100006668 415
309 3300025303 Ga0209051_1000120 Ga0209051_100012089 415
310 3300025304 Ga0209257_1014786 Ga0209257_10147863 415
311 3300025944 Ga0207661_10025828 Ga0207661_100258283 415
312 3300025949 Ga0207667_10073898 Ga0207667_100738983 415
313 3300026041 Ga0207639_10222289 Ga0207639_102222892 415
314 3300026078 Ga0207702_10008743 Ga0207702_100087437 415
315 3300026121 Ga0207683_10039167 Ga0207683_100391673 415
316 3300030744 Ga0316181_1018696 Ga0316181_10186963 415
317 3300031901 Ga0307406_10007204 Ga0307406_100072041 415
318 3300031911 Ga0307412_10185474 Ga0307412_101854741 415
319 3300037312 Ga0395899_0058273 Ga0395899_0058273_373_1680 415
320 3300037418 Ga0395900_0031095 Ga0395900_0031095_1624_2895 415
321 3300037466 Ga0395898_0003990 Ga0395898_0003990_9731_11038 415
322 3300037466 Ga0395898_0047197 Ga0395898_0047197_330_1637 415
323 3300037466 Ga0395898_0095546 Ga0395898_0095546_359_1630 415
324 3300038443 Ga0395901_0003649 Ga0395901_0003649_4836_6107 415
325 3300044656 Ga0466969_0008893 Ga0466969_0008893_3388_4695 415
326 3300044693 Ga0466961_0046806 Ga0466961_0046806_290_1597 415
327 3300044842 Ga0466957_0075593 Ga0466957_0075593_695_2002 415
328 3300045049 Ga0466959_0073433 Ga0466959_0073433_131_1438 415
329 3300045976 Ga0466967_0140468 Ga0466967_0140468_735_2006 415
330 3300046471 Ga0495650_0026241 Ga0495650_0026241_610_1917 415
331 3300049571 Ga0501034_0014325 Ga0501034_0014325_24_1295 415
332 3300053143 Ga0500579_099986 Ga0500579_099986_151_1422 415
333 iso_pu_bacteria 2551306416 2553007110 415
334 iso_pu_bacteria 2857542790 2857544825 415
335 iso_pu_bacteria 2923510766 2923513270 415
336 3300006353 Ga0075370_10002622 Ga0075370_100026223 416
337 3300037312 Ga0395899_0035771 Ga0395899_0035771_1424_2698 416
338 3300037418 Ga0395900_0054246 Ga0395900_0054246_2549_3823 416
339 3300038443 Ga0395901_0050427 Ga0395901_0050427_396_1670 416
340 3300039438 Ga0436360_0799340 Ga0436360_0799340_169_1443 416
341 3300044656 Ga0466969_0000026 Ga0466969_0000026_28761_30068 416
342 3300044683 Ga0466965_0006647 Ga0466965_0006647_1919_3226 416
343 3300044684 Ga0466966_0036570 Ga0466966_0036570_842_2149 416
344 3300044693 Ga0466961_0022120 Ga0466961_0022120_2010_3317 416
345 3300044694 Ga0466963_0001032 Ga0466963_0001032_5476_6783 416
346 3300044735 Ga0466968_0020885 Ga0466968_0020885_605_1912 416
347 3300044765 Ga0466970_0004043 Ga0466970_0004043_3353_4660 416
348 3300045049 Ga0466959_0030967 Ga0466959_0030967_1953_3260 416
349 3300045836 Ga0466958_0002455 Ga0466958_0002455_362_1669 416
350 3300050496 nmdc:mga07m45_1808_c1 nmdc:mga07m45_1808_c1_3749_5032 416
351 iso_pu_bacteria 2831864461 2831865457 416
352 iso_pu_bacteria 2842677519 2842681645 416
353 iso_pu_bacteria 2842718218 2842720445 416
354 iso_pu_bacteria 2842733646 2842737249 416
355 iso_pu_bacteria 2842747753 2842750477 416
356 iso_pu_bacteria 2919462493 2919466611 416
357 iso_pu_bacteria 2945945610 2945950670 416
358 iso_pu_bacteria 2974320154 2974321374 416
359 3300001989 JGI24739J22299_10002488 JGI24739J22299_100024881 417
360 3300003215 JGI25153J46596_10027318 JGI25153J46596_100273181 417
361 3300003791 Ga0055530_10012161 Ga0055530_100121612 417
362 3300005262 Ga0065165_1002237 Ga0065165_10022379 417
363 3300005336 Ga0070680_100056547 Ga0070680_1000565472 417
364 3300005353 Ga0070669_100149686 Ga0070669_1001496862 417
365 3300005367 Ga0070667_100316097 Ga0070667_1003160971 417
366 3300005457 Ga0070662_100135505 Ga0070662_1001355052 417
367 3300005539 Ga0068853_100186782 Ga0068853_1001867821 417
368 3300005543 Ga0070672_100004508 Ga0070672_1000045088 417
369 3300005563 Ga0068855_100136320 Ga0068855_1001363203 417
370 3300006038 Ga0075365_10055461 Ga0075365_100554612 417
371 3300009011 Ga0105251_10000269 Ga0105251_100002691 417
372 3300009176 Ga0105242_10140324 Ga0105242_101403242 417
373 3300009177 Ga0105248_10005250 Ga0105248_100052506 417
374 3300009545 Ga0105237_10032464 Ga0105237_100324642 417
375 3300010375 Ga0105239_10281270 Ga0105239_102812702 417
376 3300013104 Ga0157370_10014999 Ga0157370_100149997 417
377 3300013104 Ga0157370_10114872 Ga0157370_101148722 417
378 3300013105 Ga0157369_10052588 Ga0157369_100525882 417
379 3300015262 Ga0182007_10002279 Ga0182007_100022796 417
380 3300017792 Ga0163161_10000062 Ga0163161_1000006297 417
381 3300017792 Ga0163161_10004815 Ga0163161_100048155 417
382 3300025291 Ga0209675_1009770 Ga0209675_10097703 417
383 3300025294 Ga0209025_1023795 Ga0209025_10237952 417
384 3300025297 Ga0209758_1000213 Ga0209758_1000213115 417
385 3300025298 Ga0209050_1000178 Ga0209050_1000178107 417
386 3300025735 Ga0207713_1000435 Ga0207713_100043542 417
387 3300025903 Ga0207680_10090204 Ga0207680_100902042 417
388 3300025940 Ga0207691_10006610 Ga0207691_100066108 417
389 3300025940 Ga0207691_10010974 Ga0207691_100109746 417
390 3300025949 Ga0207667_10148751 Ga0207667_101487513 417
391 3300028786 Ga0307517_10067759 Ga0307517_100677592 417
392 3300028786 Ga0307517_10118038 Ga0307517_101180381 417
393 3300028794 Ga0307515_10091760 Ga0307515_100917603 417
394 3300031911 Ga0307412_10014155 Ga0307412_100141554 417
395 3300036401 Ga0373937_0083275 Ga0373937_0083275_814_2091 417
396 3300037312 Ga0395899_0000031 Ga0395899_0000031_299312_300619 417
397 3300037418 Ga0395900_0000110 Ga0395900_0000110_138837_140144 417
398 3300037466 Ga0395898_0000040 Ga0395898_0000040_294319_295626 417
399 3300041486 Ga0451807_1174122 Ga0451807_1174122_37_1332 417
400 3300042876 Ga0451577_0200425 Ga0451577_0200425_191_1468 417
401 3300044719 Ga0466971_0004992 Ga0466971_0004992_1926_3233 417
402 3300046459 Ga0495629_0044098 Ga0495629_0044098_1629_2912 417
403 3300046518 Ga0495631_0000634 Ga0495631_0000634_2412_3695 417
404 3300048089 Ga0495614_0012595 Ga0495614_0012595_834_2117 417
405 3300048903 Ga0496100_0054869 Ga0496100_0054869_736_2022 417
406 3300048910 Ga0496107_0041083 Ga0496107_0041083_1388_2674 417
407 3300048917 Ga0496114_0007591 Ga0496114_0007591_1092_2378 417
408 3300048919 Ga0496116_0032642 Ga0496116_0032642_184_1467 417
409 3300048921 Ga0496118_0021529 Ga0496118_0021529_311_1618 417
410 3300048927 Ga0496124_0056537 Ga0496124_0056537_1799_3082 417
411 3300050492 nmdc:mga0yw44_873_c1 nmdc:mga0yw44_873_c1_3481_4767 417
412 3300050493 nmdc:mga0k408_10468_c1 nmdc:mga0k408_10468_c1_3711_4994 417
413 3300053086 Ga0500578_0000182 Ga0500578_0000182_69008_70291 417
414 3300053093 Ga0500651_0002119 Ga0500651_0002119_2197_3480 417
415 3300053110 Ga0500571_000120 Ga0500571_000120_9753_11036 417
416 3300053118 Ga0500594_0003171 Ga0500594_0003171_1245_2528 417
417 3300053131 Ga0500652_003380 Ga0500652_003380_1022_2305 417
418 3300053134 Ga0500658_0004750 Ga0500658_0004750_1177_2460 417
419 3300053134 Ga0500658_0005317 Ga0500658_0005317_1243_2526 417
420 3300053139 Ga0500568_0004355 Ga0500568_0004355_2274_3557 417
421 3300053153 Ga0500616_0016885 Ga0500616_0016885_2394_3677 417
422 3300061719 Ga0466962_0026349 Ga0466962_0026349_710_2017 417
423 iso_pu_bacteria 2511231003 2511247871 417
424 iso_pu_bacteria 2511231026 2511383403 417
425 iso_pu_bacteria 2521172590 2521559535 417
426 iso_pu_bacteria 2765235838 2765570770 417
427 iso_pu_bacteria 2808606386 2808983144 417
428 iso_pu_bacteria 2808606415 2809128364 417
429 iso_pu_bacteria 2808606419 2809147985 417
430 iso_pu_bacteria 2818991449 2819616250 417
431 iso_pu_bacteria 2839094727 2839098323 417
432 iso_pu_bacteria 2852618963 2852620601 417
433 iso_pu_bacteria 2857576091 2857581078 417
434 iso_pu_bacteria 2904439833 2904443148 417
435 iso_pu_bacteria 2904530477 2904532857 417
436 iso_pu_bacteria 2904584206 2904585409 417
437 iso_pu_bacteria 2904589729 2904593758 417
438 iso_pu_bacteria 2904601388 2904604096 417
439 iso_pu_bacteria 2919046199 2919047801 417
440 iso_pu_bacteria 2919079590 2919081676 417
441 iso_pu_bacteria 2928130867 2928134148 417
442 iso_pu_bacteria 8033232454 8033234540 417
443 3300005367 Ga0070667_100019351 Ga0070667_1000193512 418
444 3300006178 Ga0075367_10113977 Ga0075367_101139772 418
445 3300006195 Ga0075366_10064206 Ga0075366_100642062 418
446 3300006353 Ga0075370_10021135 Ga0075370_100211351 418
447 3300009176 Ga0105242_10148571 Ga0105242_101485711 418
448 3300012502 Ga0157347_1000394 Ga0157347_10003943 418
449 3300013306 Ga0163162_10007902 Ga0163162_1000790212 418
450 3300021441 Ga0213871_10000258 Ga0213871_100002582 418
451 3300025258 Ga0209129_1003918 Ga0209129_10039182 418
452 3300025294 Ga0209025_1001135 Ga0209025_100113535 418
453 3300025934 Ga0207686_10107798 Ga0207686_101077982 418
454 3300025986 Ga0207658_10013364 Ga0207658_100133644 418
455 3300026067 Ga0207678_10008541 Ga0207678_100085414 418
456 3300028800 Ga0265338_10000344 Ga0265338_100003446 418
457 3300030522 Ga0307512_10022646 Ga0307512_100226465 418
458 3300030744 Ga0316181_1294799 Ga0316181_12947992 418
459 3300031712 Ga0265342_10010328 Ga0265342_100103283 418
460 3300037418 Ga0395900_0280256 Ga0395900_0280256_56_1381 418
461 3300037471 Ga0395905_0061736 Ga0395905_0061736_1212_2492 418
462 3300039438 Ga0436360_0136613 Ga0436360_0136613_2710_3990 418
463 3300041459 Ga0451800_0993913 Ga0451800_0993913_566_1849 418
464 3300044656 Ga0466969_0006571 Ga0466969_0006571_1594_2901 418
465 3300045049 Ga0466959_0000590 Ga0466959_0000590_17271_18551 418
466 3300045049 Ga0466959_0004774 Ga0466959_0004774_5325_6632 418
467 3300046474 Ga0495605_0014392 Ga0495605_0014392_2685_3989 418
468 3300046507 Ga0495606_0023492 Ga0495606_0023492_1530_2834 418
469 3300046519 Ga0495632_0015384 Ga0495632_0015384_2881_4164 418
470 3300046691 Ga0495670_0052387 Ga0495670_0052387_279_1583 418
471 3300046692 Ga0495671_0008434 Ga0495671_0008434_3061_4347 418
472 3300046794 Ga0495589_0005240 Ga0495589_0005240_616_1920 418
473 3300048905 Ga0496102_0159663 Ga0496102_0159663_418_1722 418
474 3300048910 Ga0496107_0035662 Ga0496107_0035662_1932_3236 418
475 3300048924 Ga0496121_0000761 Ga0496121_0000761_17520_18809 418
476 3300048927 Ga0496124_0034010 Ga0496124_0034010_2694_3977 418
477 3300048928 Ga0496125_0002410 Ga0496125_0002410_20067_21347 418
478 3300048928 Ga0496125_0007776 Ga0496125_0007776_3663_4952 418
479 3300048928 Ga0496125_0117194 Ga0496125_0117194_161_1444 418
480 3300048929 Ga0496126_0221935 Ga0496126_0221935_38_1321 418
481 3300050496 nmdc:mga07m45_9496_c1 nmdc:mga07m45_9496_c1_1290_2576 418
482 3300053079 Ga0500610_0018896 Ga0500610_0018896_1869_3155 418
483 3300053093 Ga0500651_0005188 Ga0500651_0005188_5051_6334 418
484 3300053117 Ga0500593_001443 Ga0500593_001443_2391_3677 418
485 3300053129 Ga0500628_001927 Ga0500628_001927_580_1863 418
486 3300053130 Ga0500642_0010981 Ga0500642_0010981_506_1789 418
487 3300053156 Ga0500622_0000600 Ga0500622_0000600_30045_31328 418
488 iso_pu_bacteria 2548876994 2550697342 418
489 iso_pu_bacteria 2818991436 2819542671 418
490 iso_pu_bacteria 2818991445 2819594722 418
491 iso_pu_bacteria 2884811622 2884812138 418
492 iso_pu_bacteria 2884836552 2884841208 418
493 iso_pu_bacteria 2884852848 2884856082 418
494 iso_pu_bacteria 2885192300 2885194967 418
495 iso_pu_bacteria 2896154374 2896156992 418
496 iso_pu_bacteria 2928115317 2928116642 418
497 3300005327 Ga0070658_10222747 Ga0070658_102227472 419
498 3300005334 Ga0068869_100000400 Ga0068869_10000040021 419
499 3300005530 Ga0070679_100037723 Ga0070679_1000377234 419
500 3300025940 Ga0207691_10094878 Ga0207691_100948781 419
501 3300031548 Ga0307408_100040437 Ga0307408_1000404374 419
502 3300031852 Ga0307410_10018673 Ga0307410_100186733 419
503 3300032002 Ga0307416_100051043 Ga0307416_1000510432 419
504 3300032004 Ga0307414_10101099 Ga0307414_101010992 419
505 3300044683 Ga0466965_0008120 Ga0466965_0008120_1090_2373 419
506 3300044684 Ga0466966_0000024 Ga0466966_0000024_34114_35421 419
507 3300044693 Ga0466961_0000972 Ga0466961_0000972_11721_13028 419
508 3300044694 Ga0466963_0024078 Ga0466963_0024078_1264_2571 419
509 3300044765 Ga0466970_0008884 Ga0466970_0008884_1593_2900 419
510 3300045049 Ga0466959_0077176 Ga0466959_0077176_765_2072 419
511 3300045836 Ga0466958_0028519 Ga0466958_0028519_1504_2811 419
512 3300046539 Ga0495621_0000394 Ga0495621_0000394_465_1751 419
513 3300048914 Ga0496111_0052025 Ga0496111_0052025_1477_2778 419
514 3300048924 Ga0496121_0070700 Ga0496121_0070700_1092_2411 419
515 3300048927 Ga0496124_0000038 Ga0496124_0000038_3243_4562 419
516 3300061719 Ga0466962_0000380 Ga0466962_0000380_2865_4172 419
517 iso_pu_bacteria 2643221628 2644163461 419
518 iso_pu_bacteria 8057160832 8057162665 419
519 3300001989 JGI24739J22299_10034353 JGI24739J22299_100343531 420
520 3300003771 Ga0055526_1005632 Ga0055526_10056322 420
521 3300003775 Ga0055524_1000374 Ga0055524_100037426 420
522 3300003794 Ga0055531_10001531 Ga0055531_100015313 420
523 3300003794 Ga0055531_10002828 Ga0055531_100028282 420
524 3300005262 Ga0065165_1000079 Ga0065165_10000798 420
525 3300005339 Ga0070660_100054826 Ga0070660_1000548262 420
526 3300005353 Ga0070669_100018510 Ga0070669_1000185104 420
527 3300005458 Ga0070681_10183853 Ga0070681_101838532 420
528 3300005530 Ga0070679_100044605 Ga0070679_1000446052 420
529 3300006048 Ga0075363_100055069 Ga0075363_1000550693 420
530 3300006051 Ga0075364_10103192 Ga0075364_101031921 420
531 3300006944 Ga0099823_1000002 Ga0099823_1000002133 420
532 3300009093 Ga0105240_10005969 Ga0105240_1000596917 420
533 3300009551 Ga0105238_10044117 Ga0105238_100441172 420
534 3300012497 Ga0157319_1000007 Ga0157319_100000769 420
535 3300013297 Ga0157378_10172791 Ga0157378_101727912 420
536 3300014969 Ga0157376_10119782 Ga0157376_101197822 420
537 3300025273 Ga0209673_1019427 Ga0209673_10194271 420
538 3300025295 Ga0209564_1000030 Ga0209564_1000030166 420
539 3300025298 Ga0209050_1004829 Ga0209050_10048293 420
540 3300025299 Ga0209256_1000197 Ga0209256_100019722 420
541 3300025299 Ga0209256_1000959 Ga0209256_10009596 420
542 3300025303 Ga0209051_1002183 Ga0209051_10021834 420
543 3300025304 Ga0209257_1000945 Ga0209257_10009456 420
544 3300025304 Ga0209257_1001975 Ga0209257_10019752 420
545 3300025913 Ga0207695_10145160 Ga0207695_101451602 420
546 3300025923 Ga0207681_10003074 Ga0207681_100030748 420
547 3300025927 Ga0207687_10034554 Ga0207687_100345543 420
548 3300025942 Ga0207689_10097386 Ga0207689_100973862 420
549 3300026023 Ga0207677_10001620 Ga0207677_1000162013 420
550 3300027296 Ga0209389_1000483 Ga0209389_10004835 420
551 3300027312 Ga0209371_1007567 Ga0209371_10075675 420
552 3300031824 Ga0307413_10011173 Ga0307413_100111733 420
553 3300031824 Ga0307413_10058614 Ga0307413_100586142 420
554 3300031901 Ga0307406_10009997 Ga0307406_100099973 420
555 3300031903 Ga0307407_10006349 Ga0307407_100063492 420
556 3300031911 Ga0307412_10082802 Ga0307412_100828022 420
557 3300031995 Ga0307409_100014210 Ga0307409_1000142103 420
558 3300032002 Ga0307416_100020374 Ga0307416_1000203743 420
559 3300032005 Ga0307411_10038218 Ga0307411_100382181 420
560 3300037471 Ga0395905_0010490 Ga0395905_0010490_4157_5443 420
561 3300042438 Ga0439459_0000340 Ga0439459_0000340_2548_3834 420
562 3300046463 Ga0495653_0001766 Ga0495653_0001766_5912_7219 420
563 3300046471 Ga0495650_0020005 Ga0495650_0020005_579_1886 420
564 3300046472 Ga0495580_0000583 Ga0495580_0000583_15623_16930 420
565 3300046472 Ga0495580_0000814 Ga0495580_0000814_17171_18478 420
566 3300046472 Ga0495580_0006375 Ga0495580_0006375_7655_8962 420
567 3300046472 Ga0495580_0007438 Ga0495580_0007438_5398_6705 420
568 3300046474 Ga0495605_0002834 Ga0495605_0002834_5414_6721 420
569 3300046506 Ga0495583_0003116 Ga0495583_0003116_3396_4703 420
570 3300046507 Ga0495606_0052164 Ga0495606_0052164_230_1537 420
571 3300046515 Ga0495620_0003580 Ga0495620_0003580_109_1416 420
572 3300046516 Ga0495628_0008323 Ga0495628_0008323_2806_4113 420
573 3300046516 Ga0495628_0009315 Ga0495628_0009315_1297_2604 420
574 3300046523 Ga0495644_0029347 Ga0495644_0029347_343_1653 420
575 3300046526 Ga0495666_0015894 Ga0495666_0015894_1437_2744 420
576 3300046526 Ga0495666_0020278 Ga0495666_0020278_245_1552 420
577 3300046531 Ga0495665_0025968 Ga0495665_0025968_1174_2481 420
578 3300046660 Ga0495625_0092075 Ga0495625_0092075_27_1334 420
579 3300046678 Ga0495599_0006022 Ga0495599_0006022_5628_6935 420
580 3300046690 Ga0495624_0000205 Ga0495624_0000205_33209_34516 420
581 3300046690 Ga0495624_0002128 Ga0495624_0002128_9639_10946 420
582 3300047322 Ga0495680_0014350 Ga0495680_0014350_5061_6368 420
583 3300047446 Ga0495679_000007 Ga0495679_000007_296584_297891 420
584 3300047673 Ga0495593_0019753 Ga0495593_0019753_2100_3407 420
585 3300048925 Ga0496122_0000039 Ga0496122_0000039_240544_241830 420
586 3300048926 Ga0496123_0000026 Ga0496123_0000026_240640_241926 420
587 3300048927 Ga0496124_0024125 Ga0496124_0024125_2197_3483 420
588 3300049459 Ga0495678_025210 Ga0495678_025210_450_1757 420
589 3300049581 Ga0501047_0087623 Ga0501047_0087623_451_1782 420
590 3300053136 Ga0500559_0000746 Ga0500559_0000746_2721_4007 420
591 iso_pu_bacteria 2881101125 2881104563 420
592 3300002704 JGI25155J39150_1000201 JGI25155J39150_100020123 421
593 3300002705 JGI25156J39149_1000647 JGI25156J39149_10006479 421
594 3300002738 JGI25154J39366_1000443 JGI25154J39366_100044318 421
595 3300005331 Ga0070670_100012915 Ga0070670_1000129156 421
596 3300005468 Ga0070707_100043561 Ga0070707_1000435612 421
597 3300005536 Ga0070697_100024796 Ga0070697_1000247966 421
598 3300005563 Ga0068855_100035994 Ga0068855_1000359943 421
599 3300005616 Ga0068852_100008270 Ga0068852_1000082702 421
600 3300005842 Ga0068858_100024232 Ga0068858_1000242326 421
601 3300006946 Ga0079104_1004005 Ga0079104_10040058 421
602 3300007076 Ga0075435_100055722 Ga0075435_1000557224 421
603 3300009092 Ga0105250_10008227 Ga0105250_100082273 421
604 3300009093 Ga0105240_10045286 Ga0105240_100452864 421
605 3300014497 Ga0182008_10013352 Ga0182008_100133522 421
606 3300015262 Ga0182007_10006657 Ga0182007_100066575 421
607 3300025206 Ga0209435_100173 Ga0209435_10017318 421
608 3300025246 Ga0209646_1000081 Ga0209646_100008148 421
609 3300025250 Ga0209026_1005121 Ga0209026_10051214 421
610 3300025256 Ga0209759_1000098 Ga0209759_100009848 421
611 3300025711 Ga0207696_1007065 Ga0207696_10070653 421
612 3300025904 Ga0207647_10008322 Ga0207647_100083223 421
613 3300025909 Ga0207705_10072556 Ga0207705_100725562 421
614 3300025910 Ga0207684_10027295 Ga0207684_100272957 421
615 3300025913 Ga0207695_10020120 Ga0207695_100201207 421
616 3300025922 Ga0207646_10238907 Ga0207646_102389071 421
617 3300025925 Ga0207650_10026404 Ga0207650_100264046 421
618 3300026067 Ga0207678_10000032 Ga0207678_1000003220 421
619 3300026121 Ga0207683_10030023 Ga0207683_100300235 421
620 3300037471 Ga0395905_0050278 Ga0395905_0050278_1190_2512 421
621 3300045051 Ga0451576_0015581 Ga0451576_0015581_6575_7915 421
622 3300046472 Ga0495580_0055272 Ga0495580_0055272_118_1428 421
623 3300046501 Ga0495607_0000011 Ga0495607_0000011_145409_146698 421
624 3300046615 Ga0495656_0009114 Ga0495656_0009114_799_2163 421
625 3300048903 Ga0496100_0023647 Ga0496100_0023647_991_2355 421
626 3300048905 Ga0496102_0065377 Ga0496102_0065377_487_1851 421
627 3300048908 Ga0496105_0017799 Ga0496105_0017799_4064_5428 421
628 3300048915 Ga0496112_0014356 Ga0496112_0014356_2561_3865 421
629 3300048924 Ga0496121_0000357 Ga0496121_0000357_60828_62135 421
630 3300048924 Ga0496121_0022024 Ga0496121_0022024_1008_2303 421
631 3300048929 Ga0496126_0001949 Ga0496126_0001949_18584_19891 421
632 3300050513 nmdc:mga0rr50_44678_c1 nmdc:mga0rr50_44678_c1_1659_2969 421
633 3300053125 Ga0500618_000198 Ga0500618_000198_3278_4573 421
634 3300053125 Ga0500618_002381 Ga0500618_002381_2681_3976 421
635 iso_pu_bacteria 2856287931 2856293131 421
636 iso_pu_bacteria 2857357740 2857361698 421
637 3300002704 JGI25155J39150_1000171 JGI25155J39150_10001717 422
638 3300002705 JGI25156J39149_1000164 JGI25156J39149_100016440 422
639 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001181 422
640 3300002738 JGI25154J39366_1000114 JGI25154J39366_100011458 422
641 3300002741 JGI25157J39369_1000438 JGI25157J39369_100043818 422
642 3300002771 JGI25163J39215_1003067 JGI25163J39215_10030671 422
643 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001176 422
644 3300003751 Ga0055538_1000001 Ga0055538_1000001856 422
645 3300003752 Ga0055539_1000001 Ga0055539_1000001856 422
646 3300003756 Ga0055533_1000003 Ga0055533_1000003176 422
647 3300003758 Ga0055532_1000080 Ga0055532_100008040 422
648 3300003759 Ga0055525_1000003 Ga0055525_1000003176 422
649 3300003841 Ga0055541_1000001 Ga0055541_1000001176 422
650 3300005328 Ga0070676_10007498 Ga0070676_100074982 422
651 3300005329 Ga0070683_100128466 Ga0070683_1001284661 422
652 3300005330 Ga0070690_100038746 Ga0070690_1000387463 422
653 3300005331 Ga0070670_100034746 Ga0070670_1000347462 422
654 3300005334 Ga0068869_100030900 Ga0068869_1000309003 422
655 3300005339 Ga0070660_100001523 Ga0070660_10000152310 422
656 3300005340 Ga0070689_100003353 Ga0070689_1000033537 422
657 3300005344 Ga0070661_100003912 Ga0070661_1000039127 422
658 3300005353 Ga0070669_100003800 Ga0070669_1000038006 422
659 3300005353 Ga0070669_100084763 Ga0070669_1000847633 422
660 3300005354 Ga0070675_100083150 Ga0070675_1000831502 422
661 3300005354 Ga0070675_100163214 Ga0070675_1001632142 422
662 3300005356 Ga0070674_100014210 Ga0070674_1000142103 422
663 3300005364 Ga0070673_100019286 Ga0070673_1000192863 422
664 3300005364 Ga0070673_100050696 Ga0070673_1000506962 422
665 3300005365 Ga0070688_100000396 Ga0070688_10000039614 422
666 3300005366 Ga0070659_100003387 Ga0070659_10000338711 422
667 3300005366 Ga0070659_100032608 Ga0070659_1000326084 422
668 3300005367 Ga0070667_100001217 Ga0070667_10000121712 422
669 3300005367 Ga0070667_100118121 Ga0070667_1001181212 422
670 3300005441 Ga0070700_100018517 Ga0070700_1000185172 422
671 3300005455 Ga0070663_100049523 Ga0070663_1000495232 422
672 3300005457 Ga0070662_100000492 Ga0070662_1000004924 422
673 3300005459 Ga0068867_100000237 Ga0068867_1000002376 422
674 3300005466 Ga0070685_10001975 Ga0070685_1000197511 422
675 3300005535 Ga0070684_100060211 Ga0070684_1000602112 422
676 3300005539 Ga0068853_100017651 Ga0068853_1000176514 422
677 3300005539 Ga0068853_100048183 Ga0068853_1000481831 422
678 3300005543 Ga0070672_100026769 Ga0070672_1000267693 422
679 3300005548 Ga0070665_100143343 Ga0070665_1001433432 422
680 3300005563 Ga0068855_100002682 Ga0068855_10000268222 422
681 3300005563 Ga0068855_100196070 Ga0068855_1001960701 422
682 3300005564 Ga0070664_100001389 Ga0070664_10000138920 422
683 3300005564 Ga0070664_100036507 Ga0070664_1000365074 422
684 3300005577 Ga0068857_100008227 Ga0068857_1000082275 422
685 3300005578 Ga0068854_100003738 Ga0068854_1000037389 422
686 3300005614 Ga0068856_100003574 Ga0068856_1000035747 422
687 3300005616 Ga0068852_100035441 Ga0068852_1000354412 422
688 3300005617 Ga0068859_100000190 Ga0068859_10000019046 422
689 3300005618 Ga0068864_100000753 Ga0068864_1000007536 422
690 3300005618 Ga0068864_100050786 Ga0068864_1000507864 422
691 3300005719 Ga0068861_100002563 Ga0068861_1000025635 422
692 3300005834 Ga0068851_10015162 Ga0068851_100151623 422
693 3300005840 Ga0068870_10000413 Ga0068870_100004135 422
694 3300005840 Ga0068870_10002225 Ga0068870_100022252 422
695 3300005841 Ga0068863_100102558 Ga0068863_1001025581 422
696 3300005842 Ga0068858_100051387 Ga0068858_1000513871 422
697 3300005844 Ga0068862_100003467 Ga0068862_1000034675 422
698 3300005844 Ga0068862_100029452 Ga0068862_1000294522 422
699 3300006177 Ga0075362_10015995 Ga0075362_100159952 422
700 3300006195 Ga0075366_10024763 Ga0075366_100247632 422
701 3300006931 Ga0097620_100000190 Ga0097620_1000001907 422
702 3300009093 Ga0105240_10000809 Ga0105240_1000080924 422
703 3300009094 Ga0111539_10065113 Ga0111539_100651131 422
704 3300009551 Ga0105238_10031675 Ga0105238_100316755 422
705 3300010375 Ga0105239_10200261 Ga0105239_102002611 422
706 3300013100 Ga0157373_10016328 Ga0157373_100163287 422
707 3300013102 Ga0157371_10002976 Ga0157371_100029767 422
708 3300013102 Ga0157371_10130521 Ga0157371_101305212 422
709 3300013296 Ga0157374_10032937 Ga0157374_100329375 422
710 3300013297 Ga0157378_10039592 Ga0157378_100395925 422
711 3300013307 Ga0157372_10000920 Ga0157372_1000092022 422
712 3300013308 Ga0157375_10045040 Ga0157375_100450402 422
713 3300014325 Ga0163163_10026196 Ga0163163_100261962 422
714 3300014326 Ga0157380_10001782 Ga0157380_100017827 422
715 3300014968 Ga0157379_10000333 Ga0157379_1000033328 422
716 3300014968 Ga0157379_10007658 Ga0157379_100076583 422
717 3300014969 Ga0157376_10106460 Ga0157376_101064603 422
718 3300014969 Ga0157376_10120562 Ga0157376_101205622 422
719 3300015262 Ga0182007_10003782 Ga0182007_100037825 422
720 3300015262 Ga0182007_10006261 Ga0182007_100062614 422
721 3300015265 Ga0182005_1001125 Ga0182005_10011255 422
722 3300017792 Ga0163161_10124816 Ga0163161_101248162 422
723 3300025206 Ga0209435_100018 Ga0209435_100018177 422
724 3300025224 Ga0209784_100004 Ga0209784_100004176 422
725 3300025225 Ga0209566_100004 Ga0209566_100004333 422
726 3300025226 Ga0209674_100006 Ga0209674_100006333 422
727 3300025229 Ga0209147_100051 Ga0209147_100051177 422
728 3300025230 Ga0209563_100009 Ga0209563_100009176 422
729 3300025231 Ga0207427_100558 Ga0207427_10055814 422
730 3300025233 Ga0209437_100004 Ga0209437_100004176 422
731 3300025233 Ga0209437_100145 Ga0209437_100145106 422
732 3300025242 Ga0209258_100244 Ga0209258_10024448 422
733 3300025246 Ga0209646_1000090 Ga0209646_100009096 422
734 3300025250 Ga0209026_1000042 Ga0209026_100004269 422
735 3300025253 Ga0209677_100005 Ga0209677_100005176 422
736 3300025256 Ga0209759_1000109 Ga0209759_100010986 422
737 3300025261 Ga0209233_1000005 Ga0209233_1000005333 422
738 3300025272 Ga0209455_1003499 Ga0209455_10034992 422
739 3300025273 Ga0209673_1020344 Ga0209673_10203442 422
740 3300025315 Ga0207697_10000185 Ga0207697_1000018519 422
741 3300025893 Ga0207682_10000942 Ga0207682_1000094214 422
742 3300025901 Ga0207688_10010272 Ga0207688_100102723 422
743 3300025903 Ga0207680_10134527 Ga0207680_101345272 422
744 3300025907 Ga0207645_10013008 Ga0207645_100130087 422
745 3300025907 Ga0207645_10020042 Ga0207645_100200425 422
746 3300025908 Ga0207643_10000211 Ga0207643_1000021123 422
747 3300025913 Ga0207695_10001496 Ga0207695_1000149624 422
748 3300025918 Ga0207662_10014945 Ga0207662_100149455 422
749 3300025919 Ga0207657_10005034 Ga0207657_100050344 422
750 3300025926 Ga0207659_10036350 Ga0207659_100363503 422
751 3300025932 Ga0207690_10001553 Ga0207690_100015533 422
752 3300025932 Ga0207690_10008500 Ga0207690_100085003 422
753 3300025932 Ga0207690_10042257 Ga0207690_100422573 422
754 3300025933 Ga0207706_10000144 Ga0207706_1000014461 422
755 3300025933 Ga0207706_10001214 Ga0207706_1000121415 422
756 3300025936 Ga0207670_10017823 Ga0207670_100178233 422
757 3300025937 Ga0207669_10007790 Ga0207669_100077902 422
758 3300025940 Ga0207691_10012846 Ga0207691_100128467 422
759 3300025940 Ga0207691_10023771 Ga0207691_100237713 422
760 3300025941 Ga0207711_10025431 Ga0207711_100254315 422
761 3300025941 Ga0207711_10172848 Ga0207711_101728482 422
762 3300025942 Ga0207689_10000526 Ga0207689_1000052620 422
763 3300025945 Ga0207679_10002642 Ga0207679_100026424 422
764 3300025949 Ga0207667_10009299 Ga0207667_1000929913 422
765 3300025949 Ga0207667_10012398 Ga0207667_100123982 422
766 3300025960 Ga0207651_10026910 Ga0207651_100269102 422
767 3300025981 Ga0207640_10099597 Ga0207640_100995971 422
768 3300026023 Ga0207677_10117828 Ga0207677_101178281 422
769 3300026035 Ga0207703_10022333 Ga0207703_100223335 422
770 3300026035 Ga0207703_10163994 Ga0207703_101639942 422
771 3300026041 Ga0207639_10005360 Ga0207639_100053606 422
772 3300026041 Ga0207639_10034307 Ga0207639_100343073 422
773 3300026067 Ga0207678_10002728 Ga0207678_100027284 422
774 3300026067 Ga0207678_10015305 Ga0207678_100153054 422
775 3300026075 Ga0207708_10000359 Ga0207708_1000035919 422
776 3300026075 Ga0207708_10031227 Ga0207708_100312274 422
777 3300026078 Ga0207702_10006416 Ga0207702_100064163 422
778 3300026078 Ga0207702_10065416 Ga0207702_100654161 422
779 3300026088 Ga0207641_10038467 Ga0207641_100384673 422
780 3300026089 Ga0207648_10002175 Ga0207648_100021756 422
781 3300026089 Ga0207648_10028913 Ga0207648_100289136 422
782 3300026095 Ga0207676_10002748 Ga0207676_100027484 422
783 3300026095 Ga0207676_10023437 Ga0207676_100234375 422
784 3300026095 Ga0207676_10113320 Ga0207676_101133202 422
785 3300026116 Ga0207674_10005066 Ga0207674_1000506615 422
786 3300026116 Ga0207674_10006776 Ga0207674_100067765 422
787 3300026118 Ga0207675_100000411 Ga0207675_10000041117 422
788 3300026118 Ga0207675_100016918 Ga0207675_1000169187 422
789 3300026121 Ga0207683_10002009 Ga0207683_1000200915 422
790 3300026121 Ga0207683_10062440 Ga0207683_100624402 422
791 3300027876 Ga0209974_10007952 Ga0209974_100079523 422
792 3300028380 Ga0268265_10005070 Ga0268265_100050707 422
793 3300031548 Ga0307408_100019005 Ga0307408_1000190054 422
794 3300031731 Ga0307405_10153654 Ga0307405_101536542 422
795 3300031824 Ga0307413_10018032 Ga0307413_100180322 422
796 3300031901 Ga0307406_10041304 Ga0307406_100413043 422
797 3300031911 Ga0307412_10059699 Ga0307412_100596993 422
798 3300031995 Ga0307409_100037770 Ga0307409_1000377705 422
799 3300032002 Ga0307416_100040664 Ga0307416_1000406645 422
800 3300032002 Ga0307416_100196924 Ga0307416_1001969241 422
801 3300032004 Ga0307414_10073766 Ga0307414_100737663 422
802 3300032005 Ga0307411_10015285 Ga0307411_100152855 422
803 3300032005 Ga0307411_10099580 Ga0307411_100995803 422
804 3300032126 Ga0307415_100076110 Ga0307415_1000761102 422
805 3300035118 Ga0373954_0041529 Ga0373954_0041529_128_1447 422
806 3300035724 Ga0373933_0064274 Ga0373933_0064274_424_1743 422
807 3300036401 Ga0373937_0025709 Ga0373937_0025709_743_2062 422
808 3300041404 Ga0439436_0003956 Ga0439436_0003956_2706_4124 422
809 3300041407 Ga0439447_016466 Ga0439447_016466_149_1567 422
810 3300041413 Ga0439465_0001214 Ga0439465_0001214_4990_6408 422
811 3300041999 Ga0439433_0002868 Ga0439433_0002868_1128_2546 422
812 3300041999 Ga0439433_0004138 Ga0439433_0004138_409_1767 422
813 3300042004 Ga0439445_0000443 Ga0439445_0000443_6220_7638 422
814 3300042006 Ga0439432_008465 Ga0439432_008465_803_2221 422
815 3300042007 Ga0439449_0001696 Ga0439449_0001696_4065_5483 422
816 3300042010 Ga0439452_002992 Ga0439452_002992_3036_4454 422
817 3300042134 Ga0450898_000996 Ga0450898_000996_1878_3236 422
818 3300042145 Ga0450906_001466 Ga0450906_001466_271_1629 422
819 3300042435 Ga0439434_0012826 Ga0439434_0012826_988_2346 422
820 3300046462 Ga0495651_0003813 Ga0495651_0003813_5980_7278 422
821 3300046463 Ga0495653_0012356 Ga0495653_0012356_5621_6919 422
822 3300046511 Ga0495608_0008208 Ga0495608_0008208_6024_7322 422
823 3300046511 Ga0495608_0180848 Ga0495608_0180848_16_1314 422
824 3300046516 Ga0495628_0005603 Ga0495628_0005603_6258_7556 422
825 3300046528 Ga0495642_0026395 Ga0495642_0026395_928_2226 422
826 3300046529 Ga0495652_0061496 Ga0495652_0061496_538_1836 422
827 3300046539 Ga0495621_0014998 Ga0495621_0014998_398_1702 422
828 3300046543 Ga0495645_0020954 Ga0495645_0020954_2027_3325 422
829 3300046660 Ga0495625_0000673 Ga0495625_0000673_3744_5042 422
830 3300046678 Ga0495599_0029278 Ga0495599_0029278_159_1457 422
831 3300046679 Ga0495623_0022961 Ga0495623_0022961_2456_3754 422
832 3300046680 Ga0495646_0012545 Ga0495646_0012545_152_1450 422
833 3300046680 Ga0495646_0026916 Ga0495646_0026916_2258_3556 422
834 3300046683 Ga0495658_0030569 Ga0495658_0030569_464_1786 422
835 3300046809 Ga0495600_0002851 Ga0495600_0002851_177_1475 422
836 3300047321 Ga0495676_0174433 Ga0495676_0174433_198_1496 422
837 3300048903 Ga0496100_0111206 Ga0496100_0111206_150_1481 422
838 3300048904 Ga0496101_0043502 Ga0496101_0043502_867_2228 422
839 3300048908 Ga0496105_0042035 Ga0496105_0042035_142_1473 422
840 3300048909 Ga0496106_0002914 Ga0496106_0002914_9728_11089 422
841 3300048909 Ga0496106_0029898 Ga0496106_0029898_1336_2640 422
842 3300048909 Ga0496106_0217482 Ga0496106_0217482_123_1454 422
843 3300048911 Ga0496108_0023404 Ga0496108_0023404_2582_3913 422
844 3300048912 Ga0496109_0057377 Ga0496109_0057377_305_1636 422
845 3300048912 Ga0496109_0098045 Ga0496109_0098045_897_2228 422
846 3300048913 Ga0496110_0057264 Ga0496110_0057264_989_2320 422
847 3300048917 Ga0496114_0027841 Ga0496114_0027841_799_2103 422
848 3300048924 Ga0496121_0056130 Ga0496121_0056130_1435_2772 422
849 3300048925 Ga0496122_0000801 Ga0496122_0000801_4176_5513 422
850 3300048926 Ga0496123_0000528 Ga0496123_0000528_60320_61657 422
851 3300048928 Ga0496125_0002162 Ga0496125_0002162_20804_22102 422
852 3300048928 Ga0496125_0039380 Ga0496125_0039380_2292_3629 422
853 3300050489 nmdc:mga03683_18011_c1 nmdc:mga03683_18011_c1_817_2175 422
854 3300050493 nmdc:mga0k408_25171_c1 nmdc:mga0k408_25171_c1_136_1494 422
855 3300053077 Ga0495601_0090036 Ga0495601_0090036_538_1836 422
856 3300053119 Ga0500595_003140 Ga0500595_003140_4385_5683 422
857 3300053141 Ga0500574_000634 Ga0500574_000634_1646_2944 422
858 3300053154 Ga0500619_001244 Ga0500619_001244_3029_4327 422
859 iso_pu_bacteria 2501025501 2501069658 422
860 iso_pu_bacteria 2501025502 2501080195 422
861 iso_pu_bacteria 2501025504 2501409887 422
862 iso_pu_bacteria 2510917013 2511089825 422
863 iso_pu_bacteria 2510917014 2511095218 422
864 iso_pu_bacteria 2510917015 2511104876 422
865 iso_pu_bacteria 2513237082 2513557774 422
866 iso_pu_bacteria 2513237083 2513559910 422
867 iso_pu_bacteria 2515154189 2516016669 422
868 iso_pu_bacteria 2599185169 2599411133 422
869 iso_pu_bacteria 2600255067 2600810198 422
870 iso_pu_bacteria 2600255254 2601523564 422
871 iso_pu_bacteria 2600255255 2601528723 422
872 iso_pu_bacteria 2600255280 2601615556 422
873 iso_pu_bacteria 2600255281 2601620724 422
874 iso_pu_bacteria 2600255287 2601643383 422
875 iso_pu_bacteria 2600255288 2601649121 422
876 iso_pu_bacteria 2600255289 2601653607 422
877 iso_pu_bacteria 2600255290 2601659027 422
878 iso_pu_bacteria 2600255291 2601663206 422
879 iso_pu_bacteria 2600255298 2601696165 422
880 iso_pu_bacteria 2600255299 2601700839 422
881 iso_pu_bacteria 2600255300 2601707816 422
882 iso_pu_bacteria 2600255301 2601712875 422
883 iso_pu_bacteria 2600255302 2601716866 422
884 iso_pu_bacteria 2600255303 2601721189 422
885 iso_pu_bacteria 2600255304 2601724971 422
886 iso_pu_bacteria 2600255305 2601732254 422
887 iso_pu_bacteria 2600255306 2601737868 422
888 iso_pu_bacteria 2600255307 2601744011 422
889 iso_pu_bacteria 2600255309 2601753397 422
890 iso_pu_bacteria 2600255392 2602022024 422
891 iso_pu_bacteria 2602042052 2603660589 422
892 iso_pu_bacteria 2602042053 2603665861 422
893 iso_pu_bacteria 2602042103 2603839209 422
894 iso_pu_bacteria 2602042104 2603844735 422
895 iso_pu_bacteria 2602042105 2603849366 422
896 iso_pu_bacteria 2602042106 2603854435 422
897 iso_pu_bacteria 2602042110 2603870152 422
898 iso_pu_bacteria 2602042111 2603875107 422
899 iso_pu_bacteria 2603880178 2606047343 422
900 iso_pu_bacteria 2603880184 2606070295 422
901 iso_pu_bacteria 2603880202 2606146154 422
902 iso_pu_bacteria 2603880211 2606177081 422
903 iso_pu_bacteria 2636415599 2637226060 422
904 iso_pu_bacteria 2675903046 2676407752 422
905 iso_pu_bacteria 2775507074 2777020578 422
906 iso_pu_bacteria 2808606384 2808968529 422
907 iso_pu_bacteria 2808606390 2809003360 422
908 iso_pu_bacteria 2808606391 2809010637 422
909 iso_pu_bacteria 2883087390 2883090652 422
910 iso_pu_bacteria 2904513164 2904517543 422
911 iso_pu_bacteria 2928157003 2928161837 422
912 iso_pu_bacteria 2928163908 2928169953 422
913 iso_pu_bacteria 2969079654 2969083072 422
914 iso_pu_bacteria 2981990288 2981992997 422
915 iso_pu_bacteria 2984595703 2984598172 422
916 iso_pu_bacteria 641736154 642418709 422
917 iso_pu_bacteria 8003955200 8003957175 422
918 3300003773 Ga0055537_1000032 Ga0055537_100003223 423
919 3300003784 Ga0055534_1000060 Ga0055534_100006070 423
920 3300003790 Ga0055528_1000709 Ga0055528_100070913 423
921 3300005288 Ga0065714_10016817 Ga0065714_100168171 423
922 3300005563 Ga0068855_100061146 Ga0068855_1000611462 423
923 3300006058 Ga0075432_10013268 Ga0075432_100132682 423
924 3300006178 Ga0075367_10066779 Ga0075367_100667791 423
925 3300006195 Ga0075366_10011425 Ga0075366_100114254 423
926 3300006353 Ga0075370_10002159 Ga0075370_100021591 423
927 3300006948 Ga0099826_10015904 Ga0099826_100159044 423
928 3300015262 Ga0182007_10028698 Ga0182007_100286981 423
929 3300025263 Ga0209565_1000144 Ga0209565_100014487 423
930 3300025273 Ga0209673_1000136 Ga0209673_100013623 423
931 3300025291 Ga0209675_1000071 Ga0209675_100007123 423
932 3300025292 Ga0209676_1014021 Ga0209676_10140213 423
933 3300025294 Ga0209025_1016824 Ga0209025_10168243 423
934 3300027666 Ga0209282_1002844 Ga0209282_10028445 423
935 3300031235 Ga0265330_10020209 Ga0265330_100202091 423
936 3300031711 Ga0265314_10003357 Ga0265314_100033578 423
937 3300032005 Ga0307411_10059529 Ga0307411_100595293 423
938 3300037312 Ga0395899_0006630 Ga0395899_0006630_2274_3602 423
939 3300037418 Ga0395900_0022070 Ga0395900_0022070_879_2207 423
940 3300037466 Ga0395898_0053503 Ga0395898_0053503_1844_3172 423
941 3300037471 Ga0395905_0000078 Ga0395905_0000078_120029_121357 423
942 3300037471 Ga0395905_0000722 Ga0395905_0000722_21938_23266 423
943 3300037471 Ga0395905_0115229 Ga0395905_0115229_31_1359 423
944 3300038443 Ga0395901_0034790 Ga0395901_0034790_1264_2592 423
945 3300044656 Ga0466969_0017170 Ga0466969_0017170_1400_2728 423
946 3300044684 Ga0466966_0001199 Ga0466966_0001199_2589_3917 423
947 3300044693 Ga0466961_0006484 Ga0466961_0006484_2731_4059 423
948 3300045049 Ga0466959_0014570 Ga0466959_0014570_1682_3010 423
949 3300046615 Ga0495656_0012053 Ga0495656_0012053_178_1503 423
950 3300046660 Ga0495625_0000114 Ga0495625_0000114_22401_23702 423
951 3300046674 Ga0495588_0084083 Ga0495588_0084083_180_1481 423
952 3300048904 Ga0496101_0063640 Ga0496101_0063640_514_1815 423
953 3300050490 nmdc:mga03n38_50300_c1 nmdc:mga03n38_50300_c1_120_1421 423
954 3300050492 nmdc:mga0yw44_26921_c1 nmdc:mga0yw44_26921_c1_1971_3272 423
955 3300050496 nmdc:mga07m45_143_c1 nmdc:mga07m45_143_c1_6902_8203 423
956 iso_pu_bacteria 2508501125 2509129266 423
957 iso_pu_bacteria 2510065045 2510253059 423
958 iso_pu_bacteria 2512047030 2512347227 423
959 iso_pu_bacteria 2513237151 2513959346 423
960 iso_pu_bacteria 2513237166 2514048782 423
961 iso_pu_bacteria 2515154122 2515681797 423
962 iso_pu_bacteria 2515154123 2515688096 423
963 iso_pu_bacteria 2519103095 2519460051 423
964 iso_pu_bacteria 2526164713 2527080163 423
965 iso_pu_bacteria 2562617112 2563055253 423
966 iso_pu_bacteria 2582581311 2585290445 423
967 iso_pu_bacteria 2599185239 2599740008 423
968 iso_pu_bacteria 2599185240 2599744330 423
969 iso_pu_bacteria 2599185355 2600206367 423
970 iso_pu_bacteria 2648501693 2650899625 423
971 iso_pu_bacteria 2675903129 2676744793 423
972 iso_pu_bacteria 2684622997 2686355647 423
973 iso_pu_bacteria 2711768613 2713479106 423
974 iso_pu_bacteria 2718217991 2719638850 423
975 iso_pu_bacteria 2721755763 2723879734 423
976 iso_pu_bacteria 2738541296 2738822365 423
977 iso_pu_bacteria 2738541298 2738835818 423
978 iso_pu_bacteria 2738541306 2738876051 423
979 iso_pu_bacteria 2738543002 2739188003 423
980 iso_pu_bacteria 2738543008 2739222649 423
981 iso_pu_bacteria 2744054900 2746086509 423
982 iso_pu_bacteria 2744054901 2746093908 423
983 iso_pu_bacteria 2751185846 2753565440 423
984 iso_pu_bacteria 2791355137 2792834830 423
985 iso_pu_bacteria 2808606414 2809126006 423
986 iso_pu_bacteria 2816332253 2817262325 423
987 iso_pu_bacteria 2816332256 2817280043 423
988 iso_pu_bacteria 2816332286 2817455369 423
989 iso_pu_bacteria 2818991450 2819625181 423
990 iso_pu_bacteria 2818991452 2819636025 423
991 iso_pu_bacteria 2842324504 2842328861 423
992 iso_pu_bacteria 2842348783 2842353720 423
993 iso_pu_bacteria 2842454564 2842459196 423
994 iso_pu_bacteria 2847797336 2847802259 423
995 iso_pu_bacteria 2863421361 2863426308 423
996 iso_pu_bacteria 2870068957 2870069901 423
997 iso_pu_bacteria 2885270888 2885274088 423
998 iso_pu_bacteria 2900634093 2900636563 423
999 iso_pu_bacteria 2902682994 2902688969 423
1000 iso_pu_bacteria 2904474040 2904475235 423
1001 iso_pu_bacteria 2904483920 2904488384 423
1002 iso_pu_bacteria 2904564687 2904567876 423
1003 iso_pu_bacteria 2904571731 2904574722 423
1004 iso_pu_bacteria 2904615490 2904619221 423
1005 iso_pu_bacteria 2919150387 2919151581 423
1006 iso_pu_bacteria 2919527303 2919532000 423
1007 iso_pu_bacteria 2927143783 2927146455 423
1008 iso_pu_bacteria 2928108538 2928109359 423
1009 iso_pu_bacteria 2928135762 2928137187 423
1010 iso_pu_bacteria 2928170801 2928178853 423
1011 iso_pu_bacteria 2928503688 2928509886 423
1012 iso_pu_bacteria 2928536128 2928539186 423
1013 iso_pu_bacteria 2945934425 2945935073 423
1014 iso_pu_bacteria 2984494565 2984494693 423
1015 iso_pu_bacteria 2990261002 2990265311 423
1016 iso_pu_bacteria 2990703756 2990704335 423
1017 iso_pu_bacteria 641736151 642422488 423
1018 iso_pu_bacteria 642555112 642591901 423
1019 iso_pu_bacteria 642555113 642619977 423
1020 iso_pu_bacteria 8018845410 8018850778 423
1021 iso_pu_bacteria 8020807995 8020813786 423
1022 iso_pu_bacteria 8020938398 8020943005 423
1023 iso_pu_bacteria 8020945358 8020951521 423
1024 iso_pu_bacteria 8020953355 8020957499 423
1025 iso_pu_bacteria 8021120328 8021127362 423
1026 iso_pu_bacteria 8039098773 8039098793 423
1027 iso_pu_bacteria 8040167225 8040170297 423
1028 iso_pu_bacteria 8040173305 8040177258 423
1029 iso_pu_bacteria 8055266321 8055268025 423
1030 iso_pu_bacteria 8055301274 8055304221 423
1031 3300031235 Ga0265330_10000368 Ga0265330_1000036810 424
1032 3300031238 Ga0265332_10000394 Ga0265332_1000039415 424
1033 3300031241 Ga0265325_10006433 Ga0265325_100064333 424
1034 3300031711 Ga0265314_10000292 Ga0265314_1000029215 424
1035 3300037853 Ga0436364_0472897 Ga0436364_0472897_331_1665 424
1036 3300001990 JGI24737J22298_10014326 JGI24737J22298_100143261 425
1037 3300002067 JGI24735J21928_10006478 JGI24735J21928_100064783 425
1038 3300009011 Ga0105251_10000332 Ga0105251_1000033243 425
1039 3300009036 Ga0105244_10091347 Ga0105244_100913471 425
1040 3300009551 Ga0105238_10174459 Ga0105238_101744592 425
1041 3300025302 Ga0207426_1002428 Ga0207426_100242815 425
1042 3300025735 Ga0207713_1002336 Ga0207713_10023364 425
1043 3300032002 Ga0307416_100036199 Ga0307416_1000361991 425
1044 3300042146 Ga0450907_006264 Ga0450907_006264_242_1615 425
1045 3300046457 Ga0495590_0002519 Ga0495590_0002519_1254_2555 425
1046 3300046531 Ga0495665_0021980 Ga0495665_0021980_795_2096 425
1047 3300046542 Ga0495597_0010029 Ga0495597_0010029_674_1975 425
1048 3300047319 Ga0495674_0185003 Ga0495674_0185003_375_1676 425
1049 3300047322 Ga0495680_0105865 Ga0495680_0105865_657_1958 425
1050 3300047673 Ga0495593_0008511 Ga0495593_0008511_1260_2561 425
1051 3300048088 Ga0495602_0041139 Ga0495602_0041139_2328_3629 425
1052 3300048903 Ga0496100_0015242 Ga0496100_0015242_2996_4297 425
1053 3300048905 Ga0496102_0002167 Ga0496102_0002167_4488_5789 425
1054 3300048906 Ga0496103_0000711 Ga0496103_0000711_13393_14694 425
1055 3300048907 Ga0496104_0214291 Ga0496104_0214291_191_1492 425
1056 3300048910 Ga0496107_0009116 Ga0496107_0009116_2519_3820 425
1057 3300048916 Ga0496113_0002688 Ga0496113_0002688_188_1489 425
1058 3300048917 Ga0496114_0101811 Ga0496114_0101811_482_1786 425
1059 3300048919 Ga0496116_0003614 Ga0496116_0003614_10657_11958 425
1060 3300048920 Ga0496117_0000147 Ga0496117_0000147_48832_50136 425
1061 3300048920 Ga0496117_0101731 Ga0496117_0101731_273_1574 425
1062 3300048924 Ga0496121_0021040 Ga0496121_0021040_5073_6374 425
1063 3300048925 Ga0496122_0038217 Ga0496122_0038217_1128_2429 425
1064 3300048926 Ga0496123_0008204 Ga0496123_0008204_6277_7578 425
1065 3300048927 Ga0496124_0008146 Ga0496124_0008146_6524_7825 425
1066 3300048928 Ga0496125_0009597 Ga0496125_0009597_5518_6819 425
1067 3300048929 Ga0496126_0000038 Ga0496126_0000038_138726_140030 425
1068 3300005339 Ga0070660_100000015 Ga0070660_10000001599 426
1069 3300005366 Ga0070659_100001015 Ga0070659_10000101520 426
1070 3300005535 Ga0070684_100119736 Ga0070684_1001197361 426
1071 3300010375 Ga0105239_10009979 Ga0105239_100099799 426
1072 3300025919 Ga0207657_10000039 Ga0207657_1000003920 426
1073 3300025932 Ga0207690_10000010 Ga0207690_1000001097 426
1074 3300025941 Ga0207711_10012296 Ga0207711_100122962 426
1075 3300027312 Ga0209371_1017410 Ga0209371_10174101 426
1076 3300030500 Ga0268256_1019415 Ga0268256_10194151 426
1077 3300042010 Ga0439452_002044 Ga0439452_002044_4592_5929 426
1078 3300044684 Ga0466966_0000134 Ga0466966_0000134_5909_7216 426
1079 3300044694 Ga0466963_0003369 Ga0466963_0003369_7206_8513 426
1080 3300046557 Ga0495622_0000106 Ga0495622_0000106_10864_12171 426
1081 3300048909 Ga0496106_0000021 Ga0496106_0000021_130509_131813 426
1082 3300048921 Ga0496118_0082490 Ga0496118_0082490_176_1480 426
1083 3300048924 Ga0496121_0010719 Ga0496121_0010719_4057_5361 426
1084 3300048929 Ga0496126_0002807 Ga0496126_0002807_11517_12821 426
1085 3300061719 Ga0466962_0013792 Ga0466962_0013792_2007_3314 426
1086 3300001979 JGI24740J21852_10003389 JGI24740J21852_100033895 427
1087 3300002771 JGI25163J39215_1000124 JGI25163J39215_100012423 427
1088 3300002772 JGI25164J39214_1000062 JGI25164J39214_100006211 427
1089 3300003214 JGI25165J46597_1001807 JGI25165J46597_10018074 427
1090 3300003751 Ga0055538_1000060 Ga0055538_1000060100 427
1091 3300003752 Ga0055539_1000092 Ga0055539_1000092100 427
1092 3300003756 Ga0055533_1000101 Ga0055533_1000101100 427
1093 3300003756 Ga0055533_1000175 Ga0055533_100017511 427
1094 3300003756 Ga0055533_1000234 Ga0055533_100023412 427
1095 3300003758 Ga0055532_1000031 Ga0055532_1000031214 427
1096 3300003759 Ga0055525_1000134 Ga0055525_1000134100 427
1097 3300003760 Ga0055527_1000020 Ga0055527_1000020214 427
1098 3300003761 Ga0055535_1000023 Ga0055535_10000235 427
1099 3300003761 Ga0055535_1000943 Ga0055535_100094311 427
1100 3300003761 Ga0055535_1002087 Ga0055535_10020872 427
1101 3300003762 Ga0055542_1000035 Ga0055542_1000035214 427
1102 3300003763 Ga0055529_1000039 Ga0055529_10000395 427
1103 3300003763 Ga0055529_1000516 Ga0055529_100051610 427
1104 3300003790 Ga0055528_1005012 Ga0055528_10050123 427
1105 3300003841 Ga0055541_1000062 Ga0055541_1000062100 427
1106 3300003856 Ga0058692_1000921 Ga0058692_10009218 427
1107 3300005262 Ga0065165_1000194 Ga0065165_100019496 427
1108 3300005344 Ga0070661_100163086 Ga0070661_1001630862 427
1109 3300009092 Ga0105250_10005368 Ga0105250_100053685 427
1110 3300013102 Ga0157371_10000101 Ga0157371_1000010186 427
1111 3300014497 Ga0182008_10013489 Ga0182008_100134893 427
1112 3300025207 Ga0209760_100001 Ga0209760_100001160 427
1113 3300025224 Ga0209784_100001 Ga0209784_1000011116 427
1114 3300025225 Ga0209566_100001 Ga0209566_1000011116 427
1115 3300025226 Ga0209674_100002 Ga0209674_1000021116 427
1116 3300025226 Ga0209674_100017 Ga0209674_100017155 427
1117 3300025226 Ga0209674_100085 Ga0209674_10008566 427
1118 3300025228 Ga0209672_100001 Ga0209672_1000012092 427
1119 3300025228 Ga0209672_100041 Ga0209672_100041122 427
1120 3300025228 Ga0209672_100071 Ga0209672_10007142 427
1121 3300025229 Ga0209147_100001 Ga0209147_1000012092 427
1122 3300025229 Ga0209147_100135 Ga0209147_10013576 427
1123 3300025229 Ga0209147_100173 Ga0209147_10017341 427
1124 3300025230 Ga0209563_100008 Ga0209563_1000081117 427
1125 3300025230 Ga0209563_101449 Ga0209563_1014494 427
1126 3300025231 Ga0207427_100002 Ga0207427_100002160 427
1127 3300025231 Ga0207427_101362 Ga0207427_1013622 427
1128 3300025233 Ga0209437_100007 Ga0209437_100007569 427
1129 3300025242 Ga0209258_100001 Ga0209258_1000012092 427
1130 3300025242 Ga0209258_100120 Ga0209258_10012076 427
1131 3300025242 Ga0209258_100207 Ga0209258_10020742 427
1132 3300025253 Ga0209677_100004 Ga0209677_1000041117 427
1133 3300025254 Ga0209148_1000003 Ga0209148_10000032092 427
1134 3300025254 Ga0209148_1000134 Ga0209148_1000134128 427
1135 3300025254 Ga0209148_1000598 Ga0209148_100059810 427
1136 3300025256 Ga0209759_1000037 Ga0209759_100003792 427
1137 3300025261 Ga0209233_1000123 Ga0209233_10001235 427
1138 3300025261 Ga0209233_1002843 Ga0209233_10028433 427
1139 3300025272 Ga0209455_1000001 Ga0209455_10000012092 427
1140 3300025272 Ga0209455_1000562 Ga0209455_100056211 427
1141 3300025272 Ga0209455_1008550 Ga0209455_10085502 427
1142 3300025273 Ga0209673_1000102 Ga0209673_1000102181 427
1143 3300025295 Ga0209564_1001952 Ga0209564_10019526 427
1144 3300025302 Ga0207426_1000007 Ga0207426_1000007426 427
1145 3300025711 Ga0207696_1007438 Ga0207696_10074384 427
1146 3300025904 Ga0207647_10019744 Ga0207647_100197443 427
1147 3300025913 Ga0207695_10001802 Ga0207695_1000180211 427
1148 3300027312 Ga0209371_1000530 Ga0209371_100053020 427
1149 3300027312 Ga0209371_1002008 Ga0209371_10020085 427
1150 3300030500 Ga0268256_1000523 Ga0268256_100052314 427
1151 3300030500 Ga0268256_1001757 Ga0268256_10017574 427
1152 3300031911 Ga0307412_10000014 Ga0307412_10000014297 427
1153 3300037312 Ga0395899_0110361 Ga0395899_0110361_366_1673 427
1154 3300037471 Ga0395905_0000014 Ga0395905_0000014_353683_354990 427
1155 3300038443 Ga0395901_0000017 Ga0395901_0000017_287118_288425 427
1156 3300038443 Ga0395901_0002021 Ga0395901_0002021_9766_11073 427
1157 3300046454 Ga0495592_0002058 Ga0495592_0002058_1584_2891 427
1158 3300046454 Ga0495592_0009213 Ga0495592_0009213_152_1459 427
1159 3300046454 Ga0495592_0024141 Ga0495592_0024141_2658_3965 427
1160 3300046455 Ga0495603_0005997 Ga0495603_0005997_4306_5613 427
1161 3300046458 Ga0495591_001389 Ga0495591_001389_4890_6197 427
1162 3300046459 Ga0495629_0003743 Ga0495629_0003743_1984_3291 427
1163 3300046459 Ga0495629_0007389 Ga0495629_0007389_2896_4203 427
1164 3300046461 Ga0495641_0003742 Ga0495641_0003742_6904_8211 427
1165 3300046462 Ga0495651_0099994 Ga0495651_0099994_283_1590 427
1166 3300046463 Ga0495653_0033068 Ga0495653_0033068_2730_4037 427
1167 3300046463 Ga0495653_0081309 Ga0495653_0081309_894_2201 427
1168 3300046471 Ga0495650_0027243 Ga0495650_0027243_240_1547 427
1169 3300046472 Ga0495580_0004961 Ga0495580_0004961_1851_3158 427
1170 3300046472 Ga0495580_0009550 Ga0495580_0009550_5289_6596 427
1171 3300046472 Ga0495580_0020412 Ga0495580_0020412_353_1660 427
1172 3300046473 Ga0495582_0005650 Ga0495582_0005650_1451_2758 427
1173 3300046473 Ga0495582_0008349 Ga0495582_0008349_1314_2621 427
1174 3300046476 Ga0495662_0016881 Ga0495662_0016881_2013_3320 427
1175 3300046477 Ga0495664_0004320 Ga0495664_0004320_3799_5106 427
1176 3300046477 Ga0495664_0062818 Ga0495664_0062818_571_1878 427
1177 3300046500 Ga0495596_0001891 Ga0495596_0001891_583_1890 427
1178 3300046506 Ga0495583_0027654 Ga0495583_0027654_472_1779 427
1179 3300046507 Ga0495606_0009134 Ga0495606_0009134_1605_2912 427
1180 3300046511 Ga0495608_0008720 Ga0495608_0008720_2964_4271 427
1181 3300046511 Ga0495608_0010462 Ga0495608_0010462_2584_3891 427
1182 3300046512 Ga0495610_0004048 Ga0495610_0004048_6951_8258 427
1183 3300046513 Ga0495616_0042128 Ga0495616_0042128_652_1959 427
1184 3300046514 Ga0495618_0005176 Ga0495618_0005176_1432_2739 427
1185 3300046514 Ga0495618_0007086 Ga0495618_0007086_969_2276 427
1186 3300046514 Ga0495618_0047988 Ga0495618_0047988_380_1687 427
1187 3300046515 Ga0495620_0051538 Ga0495620_0051538_342_1649 427
1188 3300046516 Ga0495628_0001153 Ga0495628_0001153_1186_2493 427
1189 3300046516 Ga0495628_0120880 Ga0495628_0120880_368_1675 427
1190 3300046517 Ga0495630_0019177 Ga0495630_0019177_2749_4056 427
1191 3300046517 Ga0495630_0081841 Ga0495630_0081841_194_1501 427
1192 3300046524 Ga0495648_0008628 Ga0495648_0008628_4361_5668 427
1193 3300046526 Ga0495666_0007411 Ga0495666_0007411_1445_2752 427
1194 3300046526 Ga0495666_0012569 Ga0495666_0012569_1076_2383 427
1195 3300046526 Ga0495666_0079029 Ga0495666_0079029_129_1436 427
1196 3300046528 Ga0495642_0019980 Ga0495642_0019980_769_2076 427
1197 3300046529 Ga0495652_0005229 Ga0495652_0005229_4210_5517 427
1198 3300046529 Ga0495652_0039062 Ga0495652_0039062_948_2255 427
1199 3300046529 Ga0495652_0168863 Ga0495652_0168863_321_1628 427
1200 3300046531 Ga0495665_0005506 Ga0495665_0005506_781_2088 427
1201 3300046533 Ga0495640_0004868 Ga0495640_0004868_9211_10518 427
1202 3300046533 Ga0495640_0011169 Ga0495640_0011169_2793_4100 427
1203 3300046535 Ga0495586_0010556 Ga0495586_0010556_2659_3966 427
1204 3300046536 Ga0495587_0007394 Ga0495587_0007394_1849_3156 427
1205 3300046536 Ga0495587_0013810 Ga0495587_0013810_316_1623 427
1206 3300046559 Ga0495667_0019125 Ga0495667_0019125_2324_3631 427
1207 3300046642 Ga0495634_0007237 Ga0495634_0007237_3895_5202 427
1208 3300046663 Ga0495635_0007675 Ga0495635_0007675_3129_4436 427
1209 3300046663 Ga0495635_0014972 Ga0495635_0014972_260_1567 427
1210 3300046663 Ga0495635_0027031 Ga0495635_0027031_135_1442 427
1211 3300046665 Ga0495661_0008073 Ga0495661_0008073_2963_4270 427
1212 3300046665 Ga0495661_0010605 Ga0495661_0010605_1883_3190 427
1213 3300046678 Ga0495599_0005537 Ga0495599_0005537_3094_4401 427
1214 3300046679 Ga0495623_0003924 Ga0495623_0003924_931_2238 427
1215 3300046679 Ga0495623_0014711 Ga0495623_0014711_3504_4811 427
1216 3300046680 Ga0495646_0001749 Ga0495646_0001749_9884_11191 427
1217 3300046680 Ga0495646_0045860 Ga0495646_0045860_1026_2333 427
1218 3300046680 Ga0495646_0113600 Ga0495646_0113600_166_1473 427
1219 3300046689 Ga0495613_0003622 Ga0495613_0003622_8148_9455 427
1220 3300046690 Ga0495624_0006504 Ga0495624_0006504_3799_5106 427
1221 3300046690 Ga0495624_0011297 Ga0495624_0011297_4249_5556 427
1222 3300046690 Ga0495624_0091586 Ga0495624_0091586_319_1626 427
1223 3300046692 Ga0495671_0010961 Ga0495671_0010961_2619_3926 427
1224 3300046794 Ga0495589_0004012 Ga0495589_0004012_3285_4592 427
1225 3300046809 Ga0495600_0011066 Ga0495600_0011066_2424_3731 427
1226 3300047315 Ga0495581_0000867 Ga0495581_0000867_4360_5667 427
1227 3300047315 Ga0495581_0007002 Ga0495581_0007002_2774_4081 427
1228 3300047317 Ga0495604_0002664 Ga0495604_0002664_8056_9363 427
1229 3300047317 Ga0495604_0053107 Ga0495604_0053107_378_1685 427
1230 3300047317 Ga0495604_0079343 Ga0495604_0079343_583_1890 427
1231 3300047319 Ga0495674_0005975 Ga0495674_0005975_4948_6255 427
1232 3300047319 Ga0495674_0032237 Ga0495674_0032237_820_2127 427
1233 3300047319 Ga0495674_0039437 Ga0495674_0039437_1076_2383 427
1234 3300047321 Ga0495676_0005709 Ga0495676_0005709_3008_4315 427
1235 3300047321 Ga0495676_0018952 Ga0495676_0018952_260_1567 427
1236 3300047322 Ga0495680_0005010 Ga0495680_0005010_3180_4487 427
1237 3300047322 Ga0495680_0042829 Ga0495680_0042829_2091_3398 427
1238 3300047323 Ga0495683_0044287 Ga0495683_0044287_555_1862 427
1239 3300047323 Ga0495683_0074856 Ga0495683_0074856_278_1585 427
1240 3300047443 Ga0495687_018933 Ga0495687_018933_1109_2416 427
1241 3300047444 Ga0495675_0003010 Ga0495675_0003010_7527_8834 427
1242 3300047444 Ga0495675_0006606 Ga0495675_0006606_3113_4420 427
1243 3300047444 Ga0495675_0013374 Ga0495675_0013374_1612_2919 427
1244 3300047446 Ga0495679_000675 Ga0495679_000675_17894_19201 427
1245 3300047446 Ga0495679_008189 Ga0495679_008189_2043_3350 427
1246 3300047469 Ga0495673_0001793 Ga0495673_0001793_9841_11148 427
1247 3300047471 Ga0495684_0011715 Ga0495684_0011715_2487_3794 427
1248 3300047673 Ga0495593_0003670 Ga0495593_0003670_6035_7342 427
1249 3300047673 Ga0495593_0004593 Ga0495593_0004593_5405_6712 427
1250 3300048088 Ga0495602_0015811 Ga0495602_0015811_3780_5087 427
1251 3300048088 Ga0495602_0050891 Ga0495602_0050891_1314_2621 427
1252 3300048088 Ga0495602_0168096 Ga0495602_0168096_335_1642 427
1253 3300048089 Ga0495614_0007800 Ga0495614_0007800_2181_3488 427
1254 3300048089 Ga0495614_0011841 Ga0495614_0011841_1749_3056 427
1255 3300048903 Ga0496100_0000134 Ga0496100_0000134_3460_4767 427
1256 3300048904 Ga0496101_0001260 Ga0496101_0001260_9383_10690 427
1257 3300048905 Ga0496102_0000293 Ga0496102_0000293_58404_59711 427
1258 3300048905 Ga0496102_0003915 Ga0496102_0003915_6471_7778 427
1259 3300048906 Ga0496103_0008996 Ga0496103_0008996_360_1667 427
1260 3300048906 Ga0496103_0016725 Ga0496103_0016725_720_2027 427
1261 3300048908 Ga0496105_0077685 Ga0496105_0077685_1002_2516 427
1262 3300048908 Ga0496105_0139075 Ga0496105_0139075_176_1483 427
1263 3300048915 Ga0496112_0122727 Ga0496112_0122727_962_2269 427
1264 3300048920 Ga0496117_0002249 Ga0496117_0002249_22660_23967 427
1265 3300048920 Ga0496117_0008916 Ga0496117_0008916_5211_6518 427
1266 3300048921 Ga0496118_0000464 Ga0496118_0000464_20716_22065 427
1267 3300048921 Ga0496118_0000499 Ga0496118_0000499_4455_5762 427
1268 3300048921 Ga0496118_0001891 Ga0496118_0001891_23545_24852 427
1269 3300048921 Ga0496118_0011851 Ga0496118_0011851_1307_2614 427
1270 3300048924 Ga0496121_0006632 Ga0496121_0006632_8479_9786 427
1271 3300048928 Ga0496125_0000019 Ga0496125_0000019_22356_23702 427
1272 3300048929 Ga0496126_0000484 Ga0496126_0000484_53538_54845 427
1273 3300049460 Ga0495682_0054715 Ga0495682_0054715_98_1405 427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00860

Xan_ur_permease

Permease family

30

402

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.8674 21 413
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.8356 21 413
3qe7-assembly1.cif.gz_A crystal structure of uracil transporter--uraa 0.7578 19 416
3qe7-assembly1.cif.gz_A crystal structure of uracil transporter--uraa 0.7407 19 416
5i6c-assembly1.cif.gz_A the structure of the eukaryotic purine/h+ symporter, uapa, in complex with xanthine 0.731 19 416
ID Description Score Start End Superfamily
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7062 31 410 1.20.1730.10
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.6419 31 410 1.20.1730.10
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6362 32 413 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.632 30 413 1.20.1740.10
af_Q5A1D7_182_536_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.6231 112 417 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A352LMI7-F1-model_v4 Pyrimidine utilization transport protein G 0.9549 214 416 GO:0015205
GO:0016020
AF-A0A2N2SUH6-F1-model_v4 Pyrimidine utilization transport protein G 0.9422 8 260 GO:0005886
GO:0042907
AF-A0A377M356-F1-model_v4 Pyrimidine utilization transport protein G 0.9417 6 289 GO:0005886
GO:0042907
AF-A0A258CMX6-F1-model_v4 Pyrimidine utilization transport protein G 0.926 172 418 GO:0005886
GO:0042907
AF-A0A352LMI7-F1-model_v4 Pyrimidine utilization transport protein G 0.9198 214 416 GO:0015205
GO:0016020

Feature Viewer

pLDDT pTM Quality
82.05 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map