F492434

General Info

Members Datasets Scaffolds Average Seq Length
1273 407 2546 72

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10009653|Ga0075433_100096532
Length 86
Sequence MIGNARLWLRKAAWMAKTFKVGDHVTWNSEAGHVSGRIIKVHRKNVTYKGYVHHASKDDPQYEIESDKTDHVALHKGTALTFFGRR

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
239 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
243 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
244 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
276 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
277 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
278 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
279 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
406 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
407 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.55
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0.08
Rhizoplane 3.3
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 4.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10009653 3300006852 Bacteria 7723
2 JGI24736J21556_1010399 3300001904 Bacteria 1520
3 JGI24751J29686_10022912 3300002459 Bacteria 1294
4 JGI24751J29686_10091083 3300002459 Bacteria 634
5 JGI25404J52841_10075167 3300003659 Bacteria 706
6 JGI25405J52794_10003404 3300003911 Bacteria 2787
7 Ga0065712_10464376 3300005290 Bacteria 675
8 Ga0065715_10353108 3300005293 Bacteria 947
9 Ga0065715_10357929 3300005293 Unclassified 927
10 Ga0065715_10556392 3300005293 Bacteria 737
11 Ga0065707_10986447 3300005295 Bacteria 543
12 Ga0070658_10459312 3300005327 Bacteria 1098
13 Ga0070658_11115134 3300005327 Bacteria 686
14 Ga0070658_11123465 3300005327 Unclassified 683
15 Ga0070658_11128245 3300005327 Bacteria 682
16 Ga0070658_11544151 3300005327 Bacteria 575
17 Ga0070683_100092690 3300005329 Bacteria 2837
18 Ga0070683_100347283 3300005329 Bacteria 1413
19 Ga0070683_100868406 3300005329 Bacteria 865
20 Ga0070683_101315157 3300005329 Bacteria 695
21 Ga0070683_101816448 3300005329 Bacteria 586
22 Ga0070683_102194834 3300005329 Bacteria 530
23 Ga0070690_100466661 3300005330 Bacteria 939
24 Ga0070690_100740754 3300005330 Unclassified 758
25 Ga0070690_101702276 3300005330 Bacteria 513
26 Ga0070670_100021590 3300005331 Bacteria 5536
27 Ga0070670_100057498 3300005331 Bacteria 3339
28 Ga0070670_100108603 3300005331 Bacteria 2391
29 Ga0068869_100082156 3300005334 Bacteria 2407
30 Ga0068869_100727545 3300005334 Bacteria 848
31 Ga0068869_101350497 3300005334 Bacteria 630
32 Ga0070666_10157308 3300005335 Bacteria 1587
33 Ga0070666_10184056 3300005335 Bacteria 1466
34 Ga0070680_100007788 3300005336 Bacteria 8164
35 Ga0070680_100017237 3300005336 Bacteria 5692
36 Ga0070680_100021506 3300005336 Bacteria 5128
37 Ga0070680_100086310 3300005336 Bacteria 2594
38 Ga0070680_100095169 3300005336 Bacteria 2468
39 Ga0070680_100160387 3300005336 Bacteria 1890
40 Ga0070680_100165107 3300005336 Bacteria 1861
41 Ga0070680_100221803 3300005336 Bacteria 1596
42 Ga0070680_100686146 3300005336 Bacteria 881
43 Ga0070680_101211565 3300005336 Bacteria 653
44 Ga0070680_101753626 3300005336 Bacteria 538
45 Ga0070682_100049088 3300005337 Bacteria 2630
46 Ga0070682_101083609 3300005337 Bacteria 670
47 Ga0068868_100235823 3300005338 Bacteria 1536
48 Ga0068868_100945784 3300005338 Bacteria 785
49 Ga0068868_101301774 3300005338 Bacteria 675
50 Ga0070660_100006079 3300005339 Bacteria 8346
51 Ga0070660_100013160 3300005339 Bacteria 5929
52 Ga0070660_100016941 3300005339 Bacteria 5304
53 Ga0070660_100241166 3300005339 Bacteria 1472
54 Ga0070660_100308775 3300005339 Bacteria 1298
55 Ga0070660_100328517 3300005339 Bacteria 1257
56 Ga0070660_100568512 3300005339 Bacteria 946
57 Ga0070689_100690264 3300005340 Bacteria 891
58 Ga0070689_101781307 3300005340 Bacteria 561
59 Ga0070691_10274135 3300005341 Bacteria 913
60 Ga0070691_10286414 3300005341 Bacteria 895
61 Ga0070691_10647234 3300005341 Bacteria 629
62 Ga0070691_11034823 3300005341 Bacteria 514
63 Ga0070687_100262044 3300005343 Bacteria 1079
64 Ga0070687_100351430 3300005343 Bacteria 952
65 Ga0070687_100585137 3300005343 Bacteria 764
66 Ga0070661_100099140 3300005344 Bacteria 2164
67 Ga0070661_100107304 3300005344 Bacteria 2082
68 Ga0070661_100111436 3300005344 Bacteria 2043
69 Ga0070661_100215245 3300005344 Bacteria 1472
70 Ga0070661_100888772 3300005344 Bacteria 735
71 Ga0070692_10023789 3300005345 Bacteria 3005
72 Ga0070692_10337969 3300005345 Bacteria 932
73 Ga0070692_10349134 3300005345 Bacteria 919
74 Ga0070668_100057415 3300005347 Bacteria 3008
75 Ga0070668_100698028 3300005347 Bacteria 895
76 Ga0070669_100108729 3300005353 Bacteria 2101
77 Ga0070669_100114185 3300005353 Bacteria 2053
78 Ga0070675_100081028 3300005354 Bacteria 2706
79 Ga0070675_100211751 3300005354 Bacteria 1685
80 Ga0070675_102045356 3300005354 Bacteria 528
81 Ga0070671_100057735 3300005355 Bacteria 3230
82 Ga0070671_100178393 3300005355 Bacteria 1798
83 Ga0070671_100277121 3300005355 Bacteria 1426
84 Ga0070671_100980162 3300005355 Bacteria 740
85 Ga0070674_100040305 3300005356 Bacteria 3159
86 Ga0070674_100414224 3300005356 Bacteria 1104
87 Ga0070674_101420875 3300005356 Bacteria 622
88 Ga0070673_100002604 3300005364 Bacteria 11025
89 Ga0070673_100420210 3300005364 Bacteria 1199
90 Ga0070673_100951917 3300005364 Bacteria 798
91 Ga0070688_100556550 3300005365 Bacteria 872
92 Ga0070688_101008584 3300005365 Bacteria 662
93 Ga0070688_101088649 3300005365 Unclassified 638
94 Ga0070688_101513161 3300005365 Unclassified 546
95 Ga0070659_100013428 3300005366 Bacteria 6096
96 Ga0070659_100016126 3300005366 Bacteria 5607
97 Ga0070659_100221069 3300005366 Bacteria 1563
98 Ga0070659_100226798 3300005366 Bacteria 1543
99 Ga0070659_100399378 3300005366 Bacteria 1160
100 Ga0070659_100435327 3300005366 Bacteria 1110
101 Ga0070659_100940122 3300005366 Bacteria 757
102 Ga0070659_101289272 3300005366 Bacteria 647
103 Ga0070667_100017025 3300005367 Bacteria 6018
104 Ga0070667_100173720 3300005367 Bacteria 1903
105 Ga0070709_10002706 3300005434 Bacteria 9579
106 Ga0070709_10070875 3300005434 Bacteria 2248
107 Ga0070709_10624989 3300005434 Bacteria 832
108 Ga0070714_100000055 3300005435 Bacteria 103321
109 Ga0070714_100064472 3300005435 Bacteria 3153
110 Ga0070714_100072202 3300005435 Bacteria 2987
111 Ga0070714_100076063 3300005435 Bacteria 2914
112 Ga0070714_100109505 3300005435 Bacteria 2444
113 Ga0070714_100157271 3300005435 Bacteria 2053
114 Ga0070714_100704370 3300005435 Bacteria 974
115 Ga0070713_100007608 3300005436 Bacteria 7621
116 Ga0070713_100146066 3300005436 Bacteria 2099
117 Ga0070713_100381165 3300005436 Bacteria 1314
118 Ga0070713_100670091 3300005436 Bacteria 989
119 Ga0070713_100956810 3300005436 Bacteria 825
120 Ga0070710_10050049 3300005437 Bacteria 2340
121 Ga0070710_10057532 3300005437 Bacteria 2204
122 Ga0070710_10310557 3300005437 Bacteria 1032
123 Ga0070710_11004556 3300005437 Bacteria 608
124 Ga0070701_10950049 3300005438 Unclassified 596
125 Ga0070711_100035313 3300005439 Bacteria 3341
126 Ga0070711_100045146 3300005439 Bacteria 2995
127 Ga0070711_100199353 3300005439 Bacteria 1544
128 Ga0070711_100340307 3300005439 Bacteria 1203
129 Ga0070711_100647138 3300005439 Bacteria 886
130 Ga0070711_100839337 3300005439 Bacteria 781
131 Ga0070711_100962533 3300005439 Bacteria 731
132 Ga0070705_100004474 3300005440 Bacteria 6809
133 Ga0070705_100136828 3300005440 Bacteria 1606
134 Ga0070705_100717249 3300005440 Bacteria 787
135 Ga0070700_101261280 3300005441 Bacteria 619
136 Ga0070700_101886347 3300005441 Unclassified 516
137 Ga0070694_100016893 3300005444 Bacteria 4602
138 Ga0070694_100027097 3300005444 Bacteria 3720
139 Ga0070708_100071097 3300005445 Bacteria 3132
140 Ga0070708_100550641 3300005445 Bacteria 1088
141 Ga0070708_100706585 3300005445 Bacteria 949
142 Ga0070663_100023687 3300005455 Bacteria 4119
143 Ga0070663_100176432 3300005455 Bacteria 1655
144 Ga0070663_100206613 3300005455 Bacteria 1535
145 Ga0070663_100421439 3300005455 Bacteria 1095
146 Ga0070663_100547085 3300005455 Bacteria 967
147 Ga0070663_100614367 3300005455 Bacteria 916
148 Ga0070678_100620883 3300005456 Unclassified 967
149 Ga0070662_100034803 3300005457 Bacteria 3554
150 Ga0070662_100091409 3300005457 Bacteria 2286
151 Ga0070662_100243223 3300005457 Bacteria 1444
152 Ga0070662_100333125 3300005457 Bacteria 1240
153 Ga0070662_100709948 3300005457 Bacteria 851
154 Ga0070681_10030227 3300005458 Bacteria 5434
155 Ga0070681_10035952 3300005458 Bacteria 4975
156 Ga0070681_10048380 3300005458 Bacteria 4249
157 Ga0070681_10088574 3300005458 Bacteria 3047
158 Ga0070681_10139282 3300005458 Bacteria 2356
159 Ga0070681_10183308 3300005458 Bacteria 2015
160 Ga0070681_10283209 3300005458 Bacteria 1568
161 Ga0070681_10355701 3300005458 Bacteria 1375
162 Ga0070681_10407434 3300005458 Bacteria 1271
163 Ga0070681_10430981 3300005458 Unclassified 1231
164 Ga0070681_10520370 3300005458 Bacteria 1103
165 Ga0070681_10626891 3300005458 Bacteria 990
166 Ga0070681_10675704 3300005458 Bacteria 948
167 Ga0070681_11179564 3300005458 Bacteria 687
168 Ga0070681_11756186 3300005458 Bacteria 547
169 Ga0068867_101850841 3300005459 Unclassified 568
170 Ga0070685_10102016 3300005466 Bacteria 1754
171 Ga0070706_100027290 3300005467 Bacteria 5254
172 Ga0070706_100056600 3300005467 Bacteria 3618
173 Ga0070706_100119867 3300005467 Bacteria 2452
174 Ga0070706_100142114 3300005467 Bacteria 2240
175 Ga0070707_100044500 3300005468 Bacteria 4250
176 Ga0070707_100193938 3300005468 Bacteria 1981
177 Ga0070707_100322567 3300005468 Bacteria 1501
178 Ga0070707_102083455 3300005468 Bacteria 535
179 Ga0070698_100497030 3300005471 Bacteria 1157
180 Ga0070699_100026019 3300005518 Bacteria 5046
181 Ga0070699_100040931 3300005518 Bacteria 4011
182 Ga0070699_100241960 3300005518 Bacteria 1611
183 Ga0070679_100003838 3300005530 Bacteria 13800
184 Ga0070679_100004437 3300005530 Bacteria 12966
185 Ga0070679_100015754 3300005530 Bacteria 7272
186 Ga0070679_100026974 3300005530 Bacteria 5649
187 Ga0070679_100030866 3300005530 Bacteria 5295
188 Ga0070679_100134721 3300005530 Bacteria 2451
189 Ga0070679_100222616 3300005530 Bacteria 1848
190 Ga0070679_100344474 3300005530 Bacteria 1438
191 Ga0070679_100952197 3300005530 Bacteria 802
192 Ga0070679_101154389 3300005530 Unclassified 719
193 Ga0070679_101294529 3300005530 Bacteria 674
194 Ga0070679_102034957 3300005530 Bacteria 523
195 Ga0070684_100117847 3300005535 Bacteria 2386
196 Ga0070684_100548172 3300005535 Bacteria 1073
197 Ga0070684_100599673 3300005535 Bacteria 1024
198 Ga0070684_100665180 3300005535 Bacteria 970
199 Ga0070684_100900263 3300005535 Bacteria 829
200 Ga0070684_101202866 3300005535 Bacteria 713
201 Ga0070697_100044111 3300005536 Bacteria 3612
202 Ga0070697_100091716 3300005536 Bacteria 2512
203 Ga0070697_100422545 3300005536 Bacteria 1158
204 Ga0070697_100807568 3300005536 Unclassified 830
205 Ga0068853_100073272 3300005539 Bacteria 2985
206 Ga0068853_100077017 3300005539 Bacteria 2913
207 Ga0068853_100557652 3300005539 Bacteria 1086
208 Ga0068853_100597928 3300005539 Bacteria 1047
209 Ga0068853_100679599 3300005539 Bacteria 981
210 Ga0068853_101381479 3300005539 Bacteria 681
211 Ga0070672_100099521 3300005543 Bacteria 2357
212 Ga0070672_100342015 3300005543 Bacteria 1274
213 Ga0070672_102059668 3300005543 Unclassified 514
214 Ga0070686_100244076 3300005544 Bacteria 1309
215 Ga0070686_100333978 3300005544 Bacteria 1134
216 Ga0070686_101346445 3300005544 Unclassified 597
217 Ga0070695_100003737 3300005545 Bacteria 8879
218 Ga0070695_100029121 3300005545 Bacteria 3430
219 Ga0070696_100002826 3300005546 Bacteria 11541
220 Ga0070696_100075822 3300005546 Bacteria 2373
221 Ga0070696_100935871 3300005546 Bacteria 721
222 Ga0070696_100944517 3300005546 Bacteria 717
223 Ga0070696_101071683 3300005546 Bacteria 676
224 Ga0070693_100104063 3300005547 Bacteria 1734
225 Ga0070693_100307788 3300005547 Unclassified 1070
226 Ga0070693_100367161 3300005547 Bacteria 989
227 Ga0070693_100683552 3300005547 Bacteria 750
228 Ga0070693_100693023 3300005547 Bacteria 745
229 Ga0070704_100050628 3300005549 Bacteria 2920
230 Ga0070704_100146045 3300005549 Bacteria 1853
231 Ga0068855_100014193 3300005563 Bacteria 9597
232 Ga0068855_100021688 3300005563 Bacteria 7704
233 Ga0068855_100073614 3300005563 Bacteria 3968
234 Ga0068855_100125365 3300005563 Bacteria 2937
235 Ga0068855_100366116 3300005563 Bacteria 1585
236 Ga0068855_100659380 3300005563 Bacteria 1123
237 Ga0068855_100820106 3300005563 Bacteria 988
238 Ga0068855_101881407 3300005563 Unclassified 606
239 Ga0070664_100297089 3300005564 Bacteria 1459
240 Ga0070664_100552241 3300005564 Bacteria 1065
241 Ga0070664_101135302 3300005564 Bacteria 736
242 Ga0068857_100020573 3300005577 Bacteria 5806
243 Ga0068857_100066470 3300005577 Bacteria 3208
244 Ga0068857_100128028 3300005577 Bacteria 2288
245 Ga0068857_100365470 3300005577 Bacteria 1338
246 Ga0068857_100567711 3300005577 Bacteria 1070
247 Ga0068857_100817999 3300005577 Bacteria 890
248 Ga0068857_101440208 3300005577 Bacteria 671
249 Ga0068854_100185417 3300005578 Bacteria 1627
250 Ga0068854_100218581 3300005578 Bacteria 1506
251 Ga0068854_100325067 3300005578 Bacteria 1251
252 Ga0068856_100004819 3300005614 Bacteria 13371
253 Ga0068856_100405739 3300005614 Bacteria 1382
254 Ga0068856_100507190 3300005614 Bacteria 1227
255 Ga0068856_101556103 3300005614 Bacteria 675
256 Ga0070702_100364054 3300005615 Bacteria 1023
257 Ga0070702_100414402 3300005615 Bacteria 967
258 Ga0068852_100001465 3300005616 Bacteria 15951
259 Ga0068852_100002601 3300005616 Bacteria 12470
260 Ga0068852_100041867 3300005616 Plasmid 3875
261 Ga0068852_100765272 3300005616 Bacteria 978
262 Ga0068852_100898678 3300005616 Bacteria 902
263 Ga0068852_101063436 3300005616 Bacteria 829
264 Ga0068859_100332102 3300005617 Bacteria 1614
265 Ga0068859_100658465 3300005617 Bacteria 1139
266 Ga0068866_10493939 3300005718 Bacteria 808
267 Ga0068861_101679605 3300005719 Bacteria 627
268 Ga0068851_10037756 3300005834 Bacteria 2422
269 Ga0068851_10046486 3300005834 Bacteria 2196
270 Ga0068851_10477462 3300005834 Bacteria 745
271 Ga0068863_100033851 3300005841 Bacteria 4868
272 Ga0068863_100900526 3300005841 Bacteria 885
273 Ga0068858_100100816 3300005842 Bacteria 2693
274 Ga0068858_100949550 3300005842 Bacteria 842
275 Ga0068858_101373810 3300005842 Bacteria 696
276 Ga0068858_101447428 3300005842 Bacteria 677
277 Ga0068860_100402186 3300005843 Bacteria 1355
278 Ga0068860_100432478 3300005843 Bacteria 1306
279 Ga0068860_101290070 3300005843 Bacteria 751
280 Ga0068862_100499905 3300005844 Bacteria 1154
281 Ga0068862_100885658 3300005844 Bacteria 877
282 Ga0068862_101910736 3300005844 Bacteria 604
283 Ga0081455_10000400 3300005937 Bacteria 57211
284 Ga0081455_10010708 3300005937 Bacteria 9276
285 Ga0081455_10210330 3300005937 Bacteria 1450
286 Ga0081538_10036699 3300005981 Bacteria 3193
287 Ga0081540_1021221 3300005983 Bacteria 3877
288 Ga0081540_1314338 3300005983 Bacteria 537
289 Ga0070717_10013682 3300006028 Bacteria 6225
290 Ga0070717_10545575 3300006028 Bacteria 1050
291 Ga0075365_10019070 3300006038 Bacteria 4226
292 Ga0075365_10273864 3300006038 Bacteria 1187
293 Ga0075365_10655356 3300006038 Bacteria 742
294 Ga0075365_10790916 3300006038 Bacteria 669
295 Ga0075364_10173511 3300006051 Bacteria 1458
296 Ga0075364_10318356 3300006051 Bacteria 1059
297 Ga0070715_10637179 3300006163 Bacteria 629
298 Ga0070716_100092767 3300006173 Bacteria 1831
299 Ga0070712_100003231 3300006175 Bacteria 10044
300 Ga0070712_100027438 3300006175 Bacteria 3803
301 Ga0070712_100039572 3300006175 Bacteria 3227
302 Ga0070712_100044679 3300006175 Bacteria 3055
303 Ga0070712_100287634 3300006175 Bacteria 1326
304 Ga0070712_100446898 3300006175 Bacteria 1076
305 Ga0070712_100914002 3300006175 Bacteria 757
306 Ga0070712_101015930 3300006175 Unclassified 718
307 Ga0070712_101758592 3300006175 Bacteria 543
308 Ga0075366_10318857 3300006195 Bacteria 952
309 Ga0097621_100123541 3300006237 Bacteria 2197
310 Ga0097621_100697859 3300006237 Bacteria 934
311 Ga0068871_100168384 3300006358 Bacteria 1877
312 Ga0068871_100379365 3300006358 Bacteria 1256
313 Ga0068871_100404279 3300006358 Bacteria 1216
314 Ga0068871_100903894 3300006358 Bacteria 818
315 Ga0075428_100009401 3300006844 Bacteria 10845
316 Ga0075428_100075008 3300006844 Bacteria 3695
317 Ga0075428_100104567 3300006844 Bacteria 3088
318 Ga0075428_100113736 3300006844 Bacteria 2949
319 Ga0075430_100006139 3300006846 Bacteria 10121
320 Ga0075430_100017105 3300006846 Bacteria 6176
321 Ga0075430_100018554 3300006846 Bacteria 5920
322 Ga0075431_100000862 3300006847 Bacteria 26616
323 Ga0075431_100012233 3300006847 Bacteria 8663
324 Ga0075431_100012723 3300006847 Bacteria 8495
325 Ga0075431_100101973 3300006847 Bacteria 2962
326 Ga0075431_100141100 3300006847 Bacteria 2483
327 Ga0075431_100166586 3300006847 Bacteria 2265
328 Ga0075433_10005832 3300006852 Bacteria 9700
329 Ga0075433_10006236 3300006852 Bacteria 9407
330 Ga0075433_10010043 3300006852 Bacteria 7587
331 Ga0075433_11438180 3300006852 Bacteria 596
332 Ga0075434_100000294 3300006871 Bacteria 35398
333 Ga0075434_100138784 3300006871 Bacteria 2450
334 Ga0075434_100150296 3300006871 Bacteria 2349
335 Ga0075434_100379660 3300006871 Bacteria 1434
336 Ga0075434_100441604 3300006871 Bacteria 1322
337 Ga0075429_100001684 3300006880 Bacteria 18285
338 Ga0075429_100047444 3300006880 Bacteria 3737
339 Ga0075429_100194036 3300006880 Bacteria 1779
340 Ga0075429_100279130 3300006880 Bacteria 1463
341 Ga0075429_100605427 3300006880 Bacteria 960
342 Ga0068865_100049183 3300006881 Bacteria 2905
343 Ga0075436_100399309 3300006914 Bacteria 996
344 Ga0097620_100332129 3300006931 Bacteria 1614
345 Ga0097620_100658418 3300006931 Bacteria 1139
346 Ga0075435_100074572 3300007076 Bacteria 2776
347 Ga0075435_100077975 3300007076 Bacteria 2716
348 Ga0075435_100107116 3300007076 Unclassified 2321
349 Ga0075435_100435474 3300007076 Bacteria 1130
350 Ga0075435_100715952 3300007076 Bacteria 870
351 Ga0099794_10034449 3300007265 Bacteria 2386
352 Ga0099795_10002187 3300007788 Bacteria 4522
353 Ga0105250_10462996 3300009092 Bacteria 571
354 Ga0105240_10003744 3300009093 Bacteria 23493
355 Ga0105240_10039363 3300009093 Bacteria 6055
356 Ga0105240_10045298 3300009093 Bacteria 5581
357 Ga0105240_10103768 3300009093 Bacteria 3453
358 Ga0105240_10106542 3300009093 Bacteria 3400
359 Ga0105240_10225119 3300009093 Bacteria 2183
360 Ga0105240_10382331 3300009093 Bacteria 1590
361 Ga0105240_10667692 3300009093 Unclassified 1137
362 Ga0105240_11962089 3300009093 Bacteria 609
363 Ga0105240_12079986 3300009093 Bacteria 589
364 Ga0111539_10025907 3300009094 Bacteria 7179
365 Ga0111539_10040405 3300009094 Bacteria 5616
366 Ga0111539_10061817 3300009094 Bacteria 4436
367 Ga0111539_10085064 3300009094 Bacteria 3718
368 Ga0111539_10788600 3300009094 Bacteria 1106
369 Ga0111539_10817283 3300009094 Bacteria 1084
370 Ga0111539_11054696 3300009094 Bacteria 945
371 Ga0111539_11460831 3300009094 Bacteria 793
372 Ga0111539_12579476 3300009094 Bacteria 589
373 Ga0111539_12795679 3300009094 Bacteria 565
374 Ga0105245_10416091 3300009098 Bacteria 1346
375 Ga0105245_10644215 3300009098 Bacteria 1089
376 Ga0105245_11480210 3300009098 Bacteria 730
377 Ga0105245_11788836 3300009098 Bacteria 667
378 Ga0105245_11888230 3300009098 Unclassified 650
379 Ga0105245_11951735 3300009098 Bacteria 640
380 Ga0105247_10030581 3300009101 Bacteria 3264
381 Ga0114129_10018340 3300009147 Bacteria 9969
382 Ga0114129_10029275 3300009147 Bacteria 7800
383 Ga0114129_10040520 3300009147 Bacteria 6566
384 Ga0114129_10097307 3300009147 Bacteria 4074
385 Ga0114129_10209713 3300009147 Bacteria 2634
386 Ga0114129_10965477 3300009147 Bacteria 1075
387 Ga0105243_10020165 3300009148 Bacteria 5054
388 Ga0105243_10417821 3300009148 Bacteria 1250
389 Ga0105241_10036112 3300009174 Bacteria 3719
390 Ga0105241_10091278 3300009174 Bacteria 2403
391 Ga0105241_10950171 3300009174 Bacteria 801
392 Ga0105241_11347500 3300009174 Bacteria 681
393 Ga0105241_11463498 3300009174 Bacteria 656
394 Ga0105241_11624908 3300009174 Bacteria 626
395 Ga0105241_11825248 3300009174 Bacteria 594
396 Ga0105242_10463044 3300009176 Bacteria 1198
397 Ga0105248_10165305 3300009177 Bacteria 2495
398 Ga0105248_10595930 3300009177 Bacteria 1247
399 Ga0105248_10880141 3300009177 Bacteria 1011
400 Ga0105237_10117767 3300009545 Bacteria 2650
401 Ga0105237_10178436 3300009545 Bacteria 2124
402 Ga0105237_10544614 3300009545 Bacteria 1167
403 Ga0105237_10732541 3300009545 Bacteria 995
404 Ga0105237_12512785 3300009545 Bacteria 525
405 Ga0105237_12564667 3300009545 Bacteria 520
406 Ga0105238_10034472 3300009551 Bacteria 5150
407 Ga0105238_10037348 3300009551 Bacteria 4938
408 Ga0105238_10200847 3300009551 Bacteria 1969
409 Ga0105238_10226313 3300009551 Bacteria 1847
410 Ga0105238_10244552 3300009551 Bacteria 1772
411 Ga0105238_10342233 3300009551 Bacteria 1484
412 Ga0105238_10728685 3300009551 Bacteria 1004
413 Ga0105238_11260056 3300009551 Bacteria 765
414 Ga0105238_11263501 3300009551 Bacteria 764
415 Ga0105249_10199315 3300009553 Bacteria 1958
416 Ga0105249_11835192 3300009553 Bacteria 679
417 Ga0099796_10006712 3300010159 Bacteria 2964
418 Ga0105239_10040843 3300010375 Bacteria 5083
419 Ga0105239_10510357 3300010375 Bacteria 1367
420 Ga0105239_10917514 3300010375 Bacteria 1005
421 Ga0105239_10930060 3300010375 Bacteria 998
422 Ga0105239_11073761 3300010375 Bacteria 926
423 Ga0105239_11606260 3300010375 Bacteria 752
424 Ga0105239_12391699 3300010375 Bacteria 615
425 Ga0105239_13600017 3300010375 Bacteria 503
426 Ga0105246_10143257 3300011119 Bacteria 1800
427 Ga0105246_11051896 3300011119 Bacteria 740
428 Ga0157347_1077452 3300012502 Bacteria 501
429 Ga0157373_10097486 3300013100 Bacteria 2070
430 Ga0157373_10110565 3300013100 Bacteria 1932
431 Ga0157373_10138234 3300013100 Bacteria 1713
432 Ga0157373_10180954 3300013100 Bacteria 1484
433 Ga0157373_10269977 3300013100 Bacteria 1204
434 Ga0157373_10434681 3300013100 Bacteria 943
435 Ga0157371_10045740 3300013102 Bacteria 3114
436 Ga0157371_10139004 3300013102 Bacteria 1730
437 Ga0157371_10537727 3300013102 Bacteria 865
438 Ga0157371_11293636 3300013102 Unclassified 564
439 Ga0157370_10005540 3300013104 Bacteria 14154
440 Ga0157370_10006789 3300013104 Bacteria 12553
441 Ga0157370_10006941 3300013104 Bacteria 12376
442 Ga0157370_10011149 3300013104 Bacteria 9421
443 Ga0157370_10042823 3300013104 Bacteria 4360
444 Ga0157370_10187391 3300013104 Bacteria 1921
445 Ga0157370_10236477 3300013104 Bacteria 1691
446 Ga0157370_10309975 3300013104 Bacteria 1456
447 Ga0157370_10324968 3300013104 Bacteria 1419
448 Ga0157370_10356471 3300013104 Bacteria 1348
449 Ga0157370_10417250 3300013104 Bacteria 1235
450 Ga0157370_10521497 3300013104 Bacteria 1090
451 Ga0157370_10738422 3300013104 Bacteria 897
452 Ga0157370_10949826 3300013104 Bacteria 779
453 Ga0157370_11082555 3300013104 Bacteria 724
454 Ga0157370_11554492 3300013104 Bacteria 595
455 Ga0157370_11843575 3300013104 Bacteria 543
456 Ga0157369_10000100 3300013105 Bacteria 118782
457 Ga0157369_10015218 3300013105 Bacteria 8683
458 Ga0157369_10040279 3300013105 Bacteria 5101
459 Ga0157369_10075541 3300013105 Bacteria 3613
460 Ga0157369_10075816 3300013105 Bacteria 3605
461 Ga0157369_10281453 3300013105 Bacteria 1732
462 Ga0157369_10316686 3300013105 Bacteria 1622
463 Ga0157369_10387493 3300013105 Bacteria 1450
464 Ga0157369_10537559 3300013105 Unclassified 1208
465 Ga0157369_11112519 3300013105 Bacteria 807
466 Ga0157369_11411378 3300013105 Unclassified 709
467 Ga0157369_11566331 3300013105 Bacteria 670
468 Ga0157369_12283836 3300013105 Bacteria 548
469 Ga0157374_10489409 3300013296 Bacteria 1234
470 Ga0157374_11059147 3300013296 Bacteria 831
471 Ga0157378_10099221 3300013297 Bacteria 2657
472 Ga0157378_10846972 3300013297 Bacteria 942
473 Ga0157378_11291824 3300013297 Bacteria 771
474 Ga0157378_11736673 3300013297 Bacteria 671
475 Ga0157378_12176393 3300013297 Bacteria 606
476 Ga0157378_12839007 3300013297 Bacteria 537
477 Ga0163162_10106794 3300013306 Bacteria 2895
478 Ga0163162_11677639 3300013306 Bacteria 726
479 Ga0157372_10004135 3300013307 Bacteria 15539
480 Ga0157372_10047515 3300013307 Bacteria 4770
481 Ga0157372_10056055 3300013307 Bacteria 4403
482 Ga0157372_10058854 3300013307 Bacteria 4296
483 Ga0157372_10101985 3300013307 Bacteria 3277
484 Ga0157372_10115538 3300013307 Bacteria 3077
485 Ga0157372_10172629 3300013307 Bacteria 2501
486 Ga0157372_10201508 3300013307 Bacteria 2305
487 Ga0157372_10258089 3300013307 Bacteria 2024
488 Ga0157372_10416508 3300013307 Bacteria 1566
489 Ga0157372_10513412 3300013307 Bacteria 1397
490 Ga0157372_10621983 3300013307 Bacteria 1258
491 Ga0157372_10740059 3300013307 Bacteria 1143
492 Ga0157372_11236305 3300013307 Bacteria 863
493 Ga0157372_11914316 3300013307 Bacteria 682
494 Ga0157372_12287872 3300013307 Bacteria 621
495 Ga0157375_10022125 3300013308 Bacteria 5848
496 Ga0157375_10226901 3300013308 Bacteria 2026
497 Ga0157375_10444811 3300013308 Bacteria 1461
498 Ga0157375_10531439 3300013308 Bacteria 1339
499 Ga0157375_10997247 3300013308 Bacteria 977
500 Ga0157375_11544541 3300013308 Bacteria 784
501 Ga0157375_11946835 3300013308 Bacteria 698
502 Ga0163163_10046231 3300014325 Bacteria 4276
503 Ga0163163_10082492 3300014325 Bacteria 3219
504 Ga0163163_11219728 3300014325 Bacteria 815
505 Ga0157380_10082926 3300014326 Bacteria 2625
506 Ga0157380_11081046 3300014326 Bacteria 840
507 Ga0157380_11360148 3300014326 Unclassified 759
508 Ga0157380_12801263 3300014326 Bacteria 554
509 Ga0182008_10084382 3300014497 Bacteria 1564
510 Ga0182008_10943916 3300014497 Bacteria 510
511 Ga0157377_10422631 3300014745 Bacteria 913
512 Ga0157377_10684875 3300014745 Bacteria 742
513 Ga0157377_10718047 3300014745 Bacteria 728
514 Ga0157379_10140814 3300014968 Bacteria 2174
515 Ga0157379_10284227 3300014968 Bacteria 1506
516 Ga0157379_11005469 3300014968 Bacteria 795
517 Ga0157379_11043634 3300014968 Bacteria 781
518 Ga0157376_10006713 3300014969 Bacteria 8147
519 Ga0157376_10108294 3300014969 Bacteria 2441
520 Ga0157376_10112615 3300014969 Bacteria 2397
521 Ga0157376_10587435 3300014969 Bacteria 1107
522 Ga0157376_12005835 3300014969 Unclassified 616
523 Ga0157376_12616677 3300014969 Bacteria 544
524 Ga0182006_1110343 3300015261 Bacteria 966
525 Ga0182005_1089902 3300015265 Bacteria 853
526 Ga0163161_11473184 3300017792 Bacteria 597
527 Ga0163161_11769814 3300017792 Unclassified 549
528 Ga0163161_11995864 3300017792 Bacteria 516
529 Ga0206356_10281404 3300020070 Bacteria 511
530 Ga0206356_11396580 3300020070 Bacteria 533
531 Ga0206353_10973506 3300020082 Bacteria 508
532 Ga0213876_10644739 3300021384 Bacteria 564
533 Ga0209455_1000257 3300025272 Bacteria 62293
534 Ga0207697_10306930 3300025315 Unclassified 704
535 Ga0207697_10403553 3300025315 Bacteria 607
536 Ga0207653_10003730 3300025885 Bacteria 4792
537 Ga0207682_10009072 3300025893 Bacteria 3928
538 Ga0207692_10119267 3300025898 Bacteria 1475
539 Ga0207692_10244148 3300025898 Bacteria 1073
540 Ga0207692_10558458 3300025898 Bacteria 732
541 Ga0207692_11063549 3300025898 Bacteria 535
542 Ga0207642_10091002 3300025899 Bacteria 1507
543 Ga0207710_10081233 3300025900 Bacteria 1504
544 Ga0207710_10126456 3300025900 Bacteria 1225
545 Ga0207688_10011482 3300025901 Bacteria 4821
546 Ga0207688_10246421 3300025901 Bacteria 1081
547 Ga0207688_10552841 3300025901 Bacteria 723
548 Ga0207688_10611145 3300025901 Bacteria 687
549 Ga0207680_10282461 3300025903 Bacteria 1153
550 Ga0207647_10000992 3300025904 Bacteria 22010
551 Ga0207647_10255238 3300025904 Bacteria 1005
552 Ga0207685_10149083 3300025905 Bacteria 1057
553 Ga0207699_10036765 3300025906 Bacteria 2794
554 Ga0207699_10077565 3300025906 Bacteria 2050
555 Ga0207699_10142552 3300025906 Bacteria 1576
556 Ga0207699_10250582 3300025906 Bacteria 1220
557 Ga0207645_10128069 3300025907 Bacteria 1651
558 Ga0207643_10144673 3300025908 Bacteria 1422
559 Ga0207705_10011410 3300025909 Bacteria 6433
560 Ga0207705_10292108 3300025909 Bacteria 1249
561 Ga0207705_10547334 3300025909 Bacteria 900
562 Ga0207705_10723707 3300025909 Unclassified 773
563 Ga0207705_10799936 3300025909 Unclassified 732
564 Ga0207705_11317996 3300025909 Bacteria 551
565 Ga0207705_11320863 3300025909 Bacteria 550
566 Ga0207705_11448483 3300025909 Bacteria 521
567 Ga0207684_10029127 3300025910 Bacteria 4704
568 Ga0207684_10177879 3300025910 Bacteria 1834
569 Ga0207684_10546105 3300025910 Bacteria 991
570 Ga0207684_11442746 3300025910 Bacteria 562
571 Ga0207654_10017315 3300025911 Bacteria 3764
572 Ga0207654_10308185 3300025911 Bacteria 1079
573 Ga0207707_10023133 3300025912 Bacteria 5438
574 Ga0207707_10023579 3300025912 Bacteria 5382
575 Ga0207707_10042317 3300025912 Unclassified 3976
576 Ga0207707_10052620 3300025912 Bacteria 3544
577 Ga0207707_10066128 3300025912 Unclassified 3148
578 Ga0207707_10079711 3300025912 Bacteria 2859
579 Ga0207707_10093496 3300025912 Bacteria 2627
580 Ga0207707_10295903 3300025912 Bacteria 1400
581 Ga0207707_10379069 3300025912 Bacteria 1216
582 Ga0207707_10467022 3300025912 Bacteria 1079
583 Ga0207707_10475301 3300025912 Bacteria 1068
584 Ga0207707_11508843 3300025912 Bacteria 532
585 Ga0207695_10072051 3300025913 Bacteria 3527
586 Ga0207695_10091596 3300025913 Bacteria 3054
587 Ga0207695_10153455 3300025913 Unclassified 2240
588 Ga0207695_10188595 3300025913 Bacteria 1980
589 Ga0207695_10235268 3300025913 Bacteria 1734
590 Ga0207695_10271523 3300025913 Bacteria 1591
591 Ga0207695_10433455 3300025913 Bacteria 1198
592 Ga0207695_10534640 3300025913 Unclassified 1054
593 Ga0207695_11140875 3300025913 Bacteria 659
594 Ga0207695_11361969 3300025913 Bacteria 590
595 Ga0207671_10483685 3300025914 Bacteria 987
596 Ga0207671_10521604 3300025914 Bacteria 947
597 Ga0207671_10541103 3300025914 Unclassified 928
598 Ga0207671_10698586 3300025914 Bacteria 807
599 Ga0207693_10001902 3300025915 Bacteria 18272
600 Ga0207693_10048877 3300025915 Bacteria 3321
601 Ga0207693_10103786 3300025915 Bacteria 2230
602 Ga0207693_10639482 3300025915 Bacteria 827
603 Ga0207693_11112828 3300025915 Unclassified 599
604 Ga0207663_10068053 3300025916 Bacteria 2286
605 Ga0207663_11097277 3300025916 Bacteria 640
606 Ga0207663_11595342 3300025916 Bacteria 525
607 Ga0207660_10006552 3300025917 Bacteria 7554
608 Ga0207660_10031976 3300025917 Bacteria 3628
609 Ga0207660_10060031 3300025917 Bacteria 2732
610 Ga0207660_10109057 3300025917 Bacteria 2080
611 Ga0207660_10178827 3300025917 Bacteria 1646
612 Ga0207660_10184353 3300025917 Bacteria 1623
613 Ga0207660_10190360 3300025917 Bacteria 1597
614 Ga0207660_10229018 3300025917 Bacteria 1461
615 Ga0207660_10682222 3300025917 Bacteria 838
616 Ga0207660_11029361 3300025917 Bacteria 671
617 Ga0207662_10112417 3300025918 Bacteria 1700
618 Ga0207662_10260627 3300025918 Bacteria 1141
619 Ga0207662_10389397 3300025918 Bacteria 943
620 Ga0207657_10005816 3300025919 Bacteria 12848
621 Ga0207657_10015097 3300025919 Bacteria 7501
622 Ga0207657_10029749 3300025919 Bacteria 4967
623 Ga0207657_10077825 3300025919 Bacteria 2794
624 Ga0207657_10169324 3300025919 Bacteria 1770
625 Ga0207657_10299046 3300025919 Bacteria 1275
626 Ga0207657_10525460 3300025919 Bacteria 926
627 Ga0207657_10532424 3300025919 Unclassified 919
628 Ga0207657_10919030 3300025919 Bacteria 674
629 Ga0207657_11017204 3300025919 Bacteria 635
630 Ga0207649_10091327 3300025920 Bacteria 1994
631 Ga0207649_10539780 3300025920 Bacteria 891
632 Ga0207649_10802844 3300025920 Bacteria 735
633 Ga0207649_10829672 3300025920 Bacteria 723
634 Ga0207652_10009623 3300025921 Bacteria 7774
635 Ga0207652_10012379 3300025921 Bacteria 6893
636 Ga0207652_10020397 3300025921 Bacteria 5457
637 Ga0207652_10026651 3300025921 Bacteria 4817
638 Ga0207652_10047609 3300025921 Bacteria 3663
639 Ga0207652_10066745 3300025921 Bacteria 3118
640 Ga0207652_10097357 3300025921 Bacteria 2593
641 Ga0207652_10124106 3300025921 Bacteria 2299
642 Ga0207652_10142941 3300025921 Bacteria 2140
643 Ga0207652_10168036 3300025921 Bacteria 1968
644 Ga0207652_10241017 3300025921 Bacteria 1630
645 Ga0207652_10344280 3300025921 Bacteria 1346
646 Ga0207652_10875669 3300025921 Bacteria 794
647 Ga0207652_11070758 3300025921 Bacteria 706
648 Ga0207652_11129378 3300025921 Bacteria 684
649 Ga0207652_11254880 3300025921 Unclassified 643
650 Ga0207646_10052667 3300025922 Bacteria 3642
651 Ga0207646_10131151 3300025922 Bacteria 2256
652 Ga0207646_10150494 3300025922 Bacteria 2098
653 Ga0207646_11892017 3300025922 Bacteria 509
654 Ga0207681_10053889 3300025923 Bacteria 2732
655 Ga0207681_10742152 3300025923 Bacteria 818
656 Ga0207694_10004208 3300025924 Bacteria 11273
657 Ga0207694_10025794 3300025924 Bacteria 4468
658 Ga0207694_10087286 3300025924 Bacteria 2457
659 Ga0207694_10339894 3300025924 Bacteria 1241
660 Ga0207694_11338222 3300025924 Bacteria 606
661 Ga0207650_10021414 3300025925 Bacteria 4569
662 Ga0207650_10072898 3300025925 Bacteria 2585
663 Ga0207650_10503236 3300025925 Bacteria 1012
664 Ga0207659_10167547 3300025926 Bacteria 1730
665 Ga0207659_10274284 3300025926 Bacteria 1377
666 Ga0207659_10454726 3300025926 Bacteria 1079
667 Ga0207659_10760305 3300025926 Bacteria 832
668 Ga0207687_10546189 3300025927 Bacteria 972
669 Ga0207687_11414905 3300025927 Bacteria 598
670 Ga0207700_10005496 3300025928 Bacteria 7600
671 Ga0207700_10202648 3300025928 Bacteria 1673
672 Ga0207700_10298323 3300025928 Bacteria 1391
673 Ga0207700_10934470 3300025928 Bacteria 776
674 Ga0207700_11514427 3300025928 Bacteria 595
675 Ga0207700_11979997 3300025928 Bacteria 509
676 Ga0207664_10000030 3300025929 Bacteria 179903
677 Ga0207664_10007824 3300025929 Bacteria 7424
678 Ga0207664_10167051 3300025929 Bacteria 1880
679 Ga0207664_10227032 3300025929 Bacteria 1622
680 Ga0207664_10484680 3300025929 Bacteria 1106
681 Ga0207664_10738876 3300025929 Bacteria 885
682 Ga0207664_11349730 3300025929 Bacteria 633
683 Ga0207664_11487388 3300025929 Bacteria 599
684 Ga0207644_10003183 3300025931 Bacteria 10568
685 Ga0207644_10255941 3300025931 Bacteria 1398
686 Ga0207644_10322318 3300025931 Bacteria 1250
687 Ga0207644_11164672 3300025931 Bacteria 648
688 Ga0207690_10035971 3300025932 Bacteria 3203
689 Ga0207690_10107864 3300025932 Bacteria 2000
690 Ga0207690_10119564 3300025932 Bacteria 1911
691 Ga0207690_10208728 3300025932 Bacteria 1488
692 Ga0207690_10241971 3300025932 Bacteria 1390
693 Ga0207690_10254391 3300025932 Bacteria 1358
694 Ga0207690_10268830 3300025932 Bacteria 1324
695 Ga0207690_10273263 3300025932 Bacteria 1314
696 Ga0207690_10293305 3300025932 Bacteria 1270
697 Ga0207690_10643022 3300025932 Bacteria 869
698 Ga0207690_10657214 3300025932 Bacteria 859
699 Ga0207690_10689462 3300025932 Bacteria 839
700 Ga0207690_11388375 3300025932 Bacteria 587
701 Ga0207690_11537432 3300025932 Bacteria 556
702 Ga0207690_11542532 3300025932 Bacteria 555
703 Ga0207706_10026923 3300025933 Bacteria 5146
704 Ga0207706_10068937 3300025933 Bacteria 3111
705 Ga0207706_10083041 3300025933 Bacteria 2816
706 Ga0207706_10905574 3300025933 Bacteria 745
707 Ga0207686_10152334 3300025934 Bacteria 1611
708 Ga0207686_10325709 3300025934 Bacteria 1150
709 Ga0207686_11809101 3300025934 Bacteria 506
710 Ga0207670_10293880 3300025936 Bacteria 1270
711 Ga0207670_11522090 3300025936 Bacteria 569
712 Ga0207669_10143527 3300025937 Bacteria 1661
713 Ga0207669_10240660 3300025937 Bacteria 1341
714 Ga0207669_10537950 3300025937 Bacteria 941
715 Ga0207669_11890976 3300025937 Bacteria 510
716 Ga0207704_10306327 3300025938 Bacteria 1219
717 Ga0207704_11484436 3300025938 Bacteria 582
718 Ga0207665_10047049 3300025939 Bacteria 2891
719 Ga0207665_10050100 3300025939 Bacteria 2808
720 Ga0207665_10130474 3300025939 Bacteria 1784
721 Ga0207665_10187232 3300025939 Bacteria 1502
722 Ga0207665_10603989 3300025939 Bacteria 857
723 Ga0207691_10062517 3300025940 Bacteria 3378
724 Ga0207691_10080554 3300025940 Bacteria 2928
725 Ga0207691_11412695 3300025940 Unclassified 571
726 Ga0207711_10373854 3300025941 Bacteria 1322
727 Ga0207711_10899678 3300025941 Bacteria 823
728 Ga0207711_11374900 3300025941 Bacteria 648
729 Ga0207711_11551588 3300025941 Unclassified 605
730 Ga0207689_10030579 3300025942 Bacteria 4488
731 Ga0207661_10056352 3300025944 Bacteria 3155
732 Ga0207661_10221414 3300025944 Bacteria 1673
733 Ga0207661_10483568 3300025944 Bacteria 1130
734 Ga0207661_11018997 3300025944 Bacteria 762
735 Ga0207661_11051276 3300025944 Bacteria 750
736 Ga0207679_10057128 3300025945 Bacteria 2885
737 Ga0207679_10189344 3300025945 Bacteria 1709
738 Ga0207679_10742178 3300025945 Bacteria 893
739 Ga0207679_11434300 3300025945 Bacteria 633
740 Ga0207667_10003345 3300025949 Bacteria 19793
741 Ga0207667_10100714 3300025949 Bacteria 2980
742 Ga0207667_10112064 3300025949 Bacteria 2813
743 Ga0207667_10187907 3300025949 Bacteria 2120
744 Ga0207667_10193677 3300025949 Bacteria 2086
745 Ga0207667_10762906 3300025949 Bacteria 966
746 Ga0207667_11001275 3300025949 Bacteria 823
747 Ga0207667_11286575 3300025949 Bacteria 708
748 Ga0207667_12217324 3300025949 Bacteria 506
749 Ga0207651_10001351 3300025960 Bacteria 11094
750 Ga0207651_10878132 3300025960 Bacteria 798
751 Ga0207712_10949939 3300025961 Bacteria 761
752 Ga0207668_10981608 3300025972 Bacteria 754
753 Ga0207668_11761764 3300025972 Unclassified 559
754 Ga0207640_10025280 3300025981 Bacteria 3592
755 Ga0207640_10357621 3300025981 Bacteria 1175
756 Ga0207658_10460043 3300025986 Bacteria 1128
757 Ga0207658_11617990 3300025986 Bacteria 592
758 Ga0207677_10378465 3300026023 Bacteria 1194
759 Ga0207677_10390689 3300026023 Bacteria 1177
760 Ga0207703_10079625 3300026035 Bacteria 2727
761 Ga0207703_11382055 3300026035 Bacteria 677
762 Ga0207703_11893173 3300026035 Bacteria 573
763 Ga0207703_12146222 3300026035 Bacteria 535
764 Ga0207639_10031435 3300026041 Bacteria 3902
765 Ga0207639_10052339 3300026041 Bacteria 3111
766 Ga0207639_10120362 3300026041 Bacteria 2156
767 Ga0207639_10303681 3300026041 Bacteria 1412
768 Ga0207639_10546419 3300026041 Bacteria 1063
769 Ga0207639_10600137 3300026041 Bacteria 1015
770 Ga0207639_10715020 3300026041 Bacteria 930
771 Ga0207639_11910059 3300026041 Bacteria 555
772 Ga0207678_10021804 3300026067 Bacteria 5618
773 Ga0207678_10393714 3300026067 Bacteria 1199
774 Ga0207678_10454721 3300026067 Bacteria 1113
775 Ga0207678_10888018 3300026067 Bacteria 788
776 Ga0207678_10888483 3300026067 Bacteria 788
777 Ga0207708_10315516 3300026075 Bacteria 1274
778 Ga0207702_10016551 3300026078 Bacteria 6102
779 Ga0207702_10127278 3300026078 Bacteria 2288
780 Ga0207702_10156547 3300026078 Bacteria 2077
781 Ga0207702_10171702 3300026078 Bacteria 1989
782 Ga0207702_10238330 3300026078 Bacteria 1703
783 Ga0207702_12282580 3300026078 Bacteria 529
784 Ga0207641_10130750 3300026088 Unclassified 2254
785 Ga0207641_10309809 3300026088 Bacteria 1494
786 Ga0207641_10912855 3300026088 Bacteria 872
787 Ga0207674_10004423 3300026116 Bacteria 16915
788 Ga0207674_10019466 3300026116 Bacteria 7351
789 Ga0207674_10032151 3300026116 Bacteria 5505
790 Ga0207674_10040070 3300026116 Bacteria 4855
791 Ga0207674_10042003 3300026116 Bacteria 4726
792 Ga0207674_10077047 3300026116 Bacteria 3341
793 Ga0207674_11533762 3300026116 Bacteria 635
794 Ga0207675_100403525 3300026118 Bacteria 1347
795 Ga0207675_101645566 3300026118 Bacteria 662
796 Ga0207675_101680309 3300026118 Bacteria 655
797 Ga0207683_10256870 3300026121 Bacteria 1595
798 Ga0207683_11028698 3300026121 Bacteria 765
799 Ga0207698_10131060 3300026142 Bacteria 2142
800 Ga0207698_10159480 3300026142 Bacteria 1971
801 Ga0207698_10202011 3300026142 Bacteria 1780
802 Ga0207698_11362754 3300026142 Bacteria 724
803 Ga0207698_12514609 3300026142 Unclassified 525
804 Ga0209973_1059164 3300027252 Bacteria 587
805 Ga0209967_1014889 3300027364 Bacteria 1111
806 Ga0209967_1017071 3300027364 Bacteria 1046
807 Ga0209984_1017528 3300027424 Bacteria 963
808 Ga0209995_1083117 3300027471 Bacteria 550
809 Ga0209968_1025041 3300027526 Bacteria 981
810 Ga0209968_1035566 3300027526 Bacteria 841
811 Ga0209999_1063587 3300027543 Bacteria 704
812 Ga0209983_1010994 3300027665 Bacteria 1850
813 Ga0209983_1063245 3300027665 Bacteria 819
814 Ga0209588_1019393 3300027671 Bacteria 2122
815 Ga0209971_1021045 3300027682 Bacteria 1551
816 Ga0209998_10021487 3300027717 Bacteria 1386
817 Ga0209974_10003087 3300027876 Bacteria 6025
818 Ga0209974_10004171 3300027876 Bacteria 5169
819 Ga0207428_10028214 3300027907 Bacteria 4665
820 Ga0207428_10028443 3300027907 Bacteria 4644
821 Ga0207428_10155947 3300027907 Bacteria 1736
822 Ga0207428_10883668 3300027907 Bacteria 632
823 Ga0268266_11231033 3300028379 Bacteria 724
824 Ga0268266_12117065 3300028379 Bacteria 535
825 Ga0268265_10600466 3300028380 Bacteria 1052
826 Ga0268265_11494913 3300028380 Bacteria 679
827 Ga0268264_10332422 3300028381 Bacteria 1440
828 Ga0268264_10642658 3300028381 Bacteria 1049
829 Ga0268264_11006660 3300028381 Bacteria 840
830 Ga0265336_10168796 3300028666 Bacteria 651
831 Ga0265338_10062558 3300028800 Bacteria 3251
832 Ga0265338_10560508 3300028800 Unclassified 799
833 Ga0265762_1193888 3300030760 Bacteria 507
834 Ga0265771_1025827 3300031010 Bacteria 537
835 Ga0265760_10068464 3300031090 Bacteria 1086
836 Ga0265330_10191872 3300031235 Bacteria 864
837 Ga0265332_10028145 3300031238 Bacteria 2461
838 Ga0265332_10181913 3300031238 Bacteria 875
839 Ga0265325_10000018 3300031241 Bacteria 128451
840 Ga0265325_10051729 3300031241 Bacteria 2111
841 Ga0265325_10073755 3300031241 Bacteria 1708
842 Ga0265325_10082312 3300031241 Bacteria 1598
843 Ga0265325_10307535 3300031241 Bacteria 706
844 Ga0265329_10061576 3300031242 Bacteria 1188
845 Ga0265340_10059954 3300031247 Bacteria 1824
846 Ga0265340_10083538 3300031247 Bacteria 1501
847 Ga0265340_10234848 3300031247 Bacteria 819
848 Ga0265339_10046283 3300031249 Bacteria 2392
849 Ga0265339_10054697 3300031249 Bacteria 2167
850 Ga0265331_10039509 3300031250 Bacteria 2301
851 Ga0265331_10094632 3300031250 Bacteria 1379
852 Ga0265316_10256342 3300031344 Bacteria 1283
853 Ga0265316_10326765 3300031344 Bacteria 1113
854 Ga0265314_10155280 3300031711 Bacteria 1398
855 Ga0265342_10002569 3300031712 Bacteria 15570
856 Ga0265342_10109148 3300031712 Bacteria 1567
857 Ga0307413_10110919 3300031824 Bacteria 1836
858 Ga0307413_10164634 3300031824 Bacteria 1562
859 Ga0307413_10372802 3300031824 Bacteria 1109
860 Ga0307409_100234178 3300031995 Bacteria 1667
861 Ga0307416_100414678 3300032002 Bacteria 1389
862 Ga0307411_11579180 3300032005 Bacteria 605
863 Ga0373948_0083919 3300034817 Bacteria 731
864 Ga0373948_0116801 3300034817 Bacteria 641
865 Ga0373958_0111854 3300034819 Bacteria 651
866 Ga0373938_0056734 3300034957 Bacteria 907
867 Ga0373934_0247605 3300035086 Bacteria 737
868 Ga0373944_0029810 3300035089 Bacteria 1633
869 Ga0373951_0023890 3300035091 Bacteria 1414
870 Ga0373952_0035064 3300035092 Bacteria 1134
871 Ga0373952_0040673 3300035092 Bacteria 1073
872 Ga0373923_0006121 3300035111 Bacteria 4135
873 Ga0373936_0008122 3300035113 Bacteria 3947
874 Ga0373936_0102278 3300035113 Bacteria 1210
875 Ga0373939_0013810 3300035114 Bacteria 2084
876 Ga0373945_0435170 3300035116 Bacteria 578
877 Ga0373954_0002485 3300035118 Bacteria 7734
878 Ga0373956_0018734 3300035119 Bacteria 2933
879 Ga0373956_0522812 3300035119 Unclassified 566
880 Ga0373957_0018727 3300035120 Bacteria 2428
881 Ga0373943_0049403 3300035170 Bacteria 2064
882 Ga0373946_0005193 3300035171 Bacteria 4694
883 Ga0373946_0101562 3300035171 Bacteria 1290
884 Ga0373946_0699747 3300035171 Bacteria 530
885 Ga0373955_0094307 3300035172 Bacteria 1710
886 Ga0373955_0425539 3300035172 Bacteria 808
887 Ga0373955_0771871 3300035172 Bacteria 590
888 Ga0373961_0115978 3300035241 Unclassified 882
889 Ga0373962_0071022 3300035242 Bacteria 1040
890 Ga0373924_0173900 3300035410 Bacteria 947
891 Ga0373924_0497867 3300035410 Bacteria 547
892 Ga0373931_0000751 3300035691 Bacteria 13545
893 Ga0373931_0310923 3300035691 Bacteria 976
894 Ga0373931_0330224 3300035691 Bacteria 950
895 Ga0373935_0068403 3300035692 Bacteria 2285
896 Ga0373935_0077597 3300035692 Bacteria 2153
897 Ga0373935_1000459 3300035692 Bacteria 621
898 Ga0373935_1050103 3300035692 Unclassified 606
899 Ga0373927_0245857 3300035695 Bacteria 1176
900 Ga0373927_0707307 3300035695 Bacteria 666
901 Ga0373933_0006528 3300035724 Bacteria 6352
902 Ga0373933_0218338 3300035724 Bacteria 1223
903 Ga0373933_0934217 3300035724 Bacteria 571
904 Ga0373947_0720096 3300035725 Bacteria 681
905 Ga0373937_0043822 3300036401 Bacteria 4086
906 Ga0373937_0241257 3300036401 Bacteria 1703
907 Ga0373937_0802948 3300036401 Unclassified 889
908 Ga0372808_020777 3300036459 Bacteria 944
909 Ga0373925_0187402 3300037068 Bacteria 1640
910 Ga0373925_0388550 3300037068 Bacteria 1137
911 Ga0395899_0046536 3300037312 Bacteria 3231
912 Ga0395900_0091471 3300037418 Bacteria 3126
913 Ga0395900_0817599 3300037418 Bacteria 859
914 Ga0395900_1528243 3300037418 Bacteria 579
915 Ga0395898_0661428 3300037466 Bacteria 987
916 Ga0395898_1717405 3300037466 Bacteria 550
917 Ga0395905_0026681 3300037471 Bacteria 5447
918 Ga0395905_0295002 3300037471 Bacteria 1508
919 Ga0395905_1122114 3300037471 Bacteria 690
920 Ga0436364_0624032 3300037853 Bacteria 1775
921 Ga0436364_1390098 3300037853 Bacteria 922
922 Ga0395901_0176131 3300038443 Bacteria 2243
923 Ga0395901_0277351 3300038443 Bacteria 1743
924 Ga0395901_1073760 3300038443 Bacteria 777
925 Ga0436360_0463612 3300039438 Bacteria 1267
926 Ga0436361_0485833 3300039447 Bacteria 1193
927 Ga0436361_0822131 3300039447 Bacteria 856
928 Ga0436363_0313163 3300039450 Bacteria 1187
929 Ga0436363_0620969 3300039450 Bacteria 1208
930 Ga0436363_1402868 3300039450 Bacteria 645
931 Ga0439465_0049831 3300041413 Bacteria 1369
932 Ga0451793_0098171 3300041452 Bacteria 857
933 Ga0439448_0265537 3300042005 Bacteria 607
934 Ga0450888_016055 3300042126 Bacteria 919
935 Ga0450896_033686 3300042133 Bacteria 782
936 Ga0453683_0657999 3300044673 Bacteria 685
937 Ga0466966_0013026 3300044684 Bacteria 5505
938 Ga0466966_0344082 3300044684 Bacteria 896
939 Ga0453684_0448907 3300044712 Bacteria 1436
940 Ga0466968_0001844 3300044735 Bacteria 7652
941 Ga0466960_0008771 3300044901 Bacteria 4151
942 Ga0466967_0373208 3300045976 Bacteria 1384
943 Ga0495592_0006884 3300046454 Bacteria 8491
944 Ga0495592_0516587 3300046454 Bacteria 739
945 Ga0495592_0841704 3300046454 Bacteria 543
946 Ga0495603_0084539 3300046455 Bacteria 1858
947 Ga0495603_0780536 3300046455 Bacteria 545
948 Ga0495603_0877020 3300046455 Bacteria 510
949 Ga0495629_0035630 3300046459 Bacteria 3517
950 Ga0495629_0083898 3300046459 Bacteria 2223
951 Ga0495629_0338851 3300046459 Bacteria 1027
952 Ga0495641_0117237 3300046461 Bacteria 1187
953 Ga0495641_0135203 3300046461 Bacteria 1101
954 Ga0495651_0033380 3300046462 Bacteria 4014
955 Ga0495651_0271734 3300046462 Bacteria 1149
956 Ga0495651_0838439 3300046462 Bacteria 565
957 Ga0495653_0010069 3300046463 Bacteria 7734
958 Ga0495653_0602714 3300046463 Bacteria 675
959 Ga0495580_0085285 3300046472 Bacteria 2200
960 Ga0495639_0003773 3300046475 Bacteria 6512
961 Ga0495662_0052459 3300046476 Bacteria 1969
962 Ga0495662_0317738 3300046476 Bacteria 766
963 Ga0495664_0071430 3300046477 Bacteria 2073
964 Ga0495664_0416580 3300046477 Bacteria 806
965 Ga0495664_0488792 3300046477 Unclassified 736
966 Ga0495584_0189003 3300046491 Bacteria 1046
967 Ga0495594_0245413 3300046499 Bacteria 1020
968 Ga0495608_0009049 3300046511 Bacteria 6966
969 Ga0495608_0115314 3300046511 Bacteria 1725
970 Ga0495618_0100705 3300046514 Bacteria 1849
971 Ga0495618_0287336 3300046514 Bacteria 1024
972 Ga0495618_0840314 3300046514 Bacteria 533
973 Ga0495628_0001092 3300046516 Bacteria 24748
974 Ga0495628_0334924 3300046516 Bacteria 1115
975 Ga0495630_0138167 3300046517 Bacteria 1852
976 Ga0495637_0290292 3300046520 Bacteria 582
977 Ga0495666_0011044 3300046526 Bacteria 4506
978 Ga0495652_0010234 3300046529 Bacteria 8503
979 Ga0495652_0132515 3300046529 Bacteria 1971
980 Ga0495652_0990060 3300046529 Bacteria 550
981 Ga0495665_0178471 3300046531 Bacteria 1104
982 Ga0495640_0013426 3300046533 Bacteria 6223
983 Ga0495640_0115579 3300046533 Bacteria 1748
984 Ga0495586_0347398 3300046535 Unclassified 852
985 Ga0495587_0051315 3300046536 Bacteria 2439
986 Ga0495587_0064202 3300046536 Bacteria 2145
987 Ga0495587_0079811 3300046536 Bacteria 1897
988 Ga0495645_0012597 3300046543 Bacteria 5962
989 Ga0495645_0138398 3300046543 Bacteria 1701
990 Ga0495667_0026820 3300046559 Bacteria 3881
991 Ga0495667_0350512 3300046559 Bacteria 932
992 Ga0495656_0317549 3300046615 Bacteria 802
993 Ga0495634_0069055 3300046642 Bacteria 2332
994 Ga0495634_0077677 3300046642 Bacteria 2176
995 Ga0495625_0084892 3300046660 Bacteria 2199
996 Ga0495635_0007428 3300046663 Bacteria 7647
997 Ga0495635_0219553 3300046663 Bacteria 1286
998 Ga0495635_0763186 3300046663 Bacteria 625
999 Ga0495588_0015824 3300046674 Bacteria 3637
1000 Ga0495588_0638190 3300046674 Bacteria 557
1001 Ga0495657_0011578 3300046675 Bacteria 6590
1002 Ga0495657_0099175 3300046675 Bacteria 1858
1003 Ga0495599_0019064 3300046678 Bacteria 4277
1004 Ga0495599_0227665 3300046678 Bacteria 1139
1005 Ga0495623_0032357 3300046679 Bacteria 3361
1006 Ga0495623_0313803 3300046679 Bacteria 863
1007 Ga0495646_0114119 3300046680 Bacteria 1535
1008 Ga0495647_0001911 3300046681 Bacteria 6488
1009 Ga0495658_0142350 3300046683 Bacteria 1467
1010 Ga0495658_0170177 3300046683 Bacteria 1348
1011 Ga0495613_0990965 3300046689 Bacteria 540
1012 Ga0495624_0341991 3300046690 Bacteria 900
1013 Ga0495624_0363624 3300046690 Bacteria 870
1014 Ga0495624_0822130 3300046690 Bacteria 549
1015 Ga0495600_0026626 3300046809 Bacteria 3733
1016 Ga0495600_0366669 3300046809 Bacteria 900
1017 Ga0495581_0063366 3300047315 Bacteria 2136
1018 Ga0495581_0331776 3300047315 Bacteria 888
1019 Ga0495604_0005882 3300047317 Bacteria 9725
1020 Ga0495604_0526610 3300047317 Bacteria 764
1021 Ga0495604_0693348 3300047317 Bacteria 647
1022 Ga0495674_0277337 3300047319 Bacteria 1374
1023 Ga0495674_0377484 3300047319 Bacteria 1147
1024 Ga0495672_0104619 3300047320 Bacteria 1529
1025 Ga0495676_0224924 3300047321 Bacteria 1291
1026 Ga0495680_0029514 3300047322 Bacteria 4490
1027 Ga0495680_0273474 3300047322 Bacteria 1192
1028 Ga0495680_0373613 3300047322 Bacteria 989
1029 Ga0495675_0005368 3300047444 Bacteria 7809
1030 Ga0495684_0000897 3300047471 Bacteria 24092
1031 Ga0495684_0130885 3300047471 Bacteria 1885
1032 Ga0495684_0514457 3300047471 Bacteria 821
1033 Ga0495593_0015926 3300047673 Bacteria 4247
1034 Ga0495593_0501758 3300047673 Bacteria 608
1035 Ga0495602_0013144 3300048088 Bacteria 8469
1036 Ga0495602_0284651 3300048088 Bacteria 1216
1037 Ga0495614_0159812 3300048089 Bacteria 1008
1038 Ga0496100_0128902 3300048903 Bacteria 1779
1039 Ga0496101_0028524 3300048904 Bacteria 3897
1040 Ga0496101_0123714 3300048904 Bacteria 1958
1041 Ga0496101_0153928 3300048904 Bacteria 1760
1042 Ga0496102_0059497 3300048905 Bacteria 3494
1043 Ga0496102_0063235 3300048905 Bacteria 3388
1044 Ga0496102_0733362 3300048905 Bacteria 911
1045 Ga0496102_1198867 3300048905 Bacteria 679
1046 Ga0496102_1262535 3300048905 Unclassified 658
1047 Ga0496102_1480628 3300048905 Bacteria 598
1048 Ga0496103_0114813 3300048906 Bacteria 1712
1049 Ga0496103_0332630 3300048906 Bacteria 977
1050 Ga0496104_0000517 3300048907 Bacteria 33033
1051 Ga0496104_0000965 3300048907 Bacteria 24730
1052 Ga0496104_0531237 3300048907 Unclassified 1087
1053 Ga0496104_1587806 3300048907 Bacteria 557
1054 Ga0496105_0012155 3300048908 Bacteria 6817
1055 Ga0496105_0013222 3300048908 Bacteria 6550
1056 Ga0496105_0379196 3300048908 Bacteria 1125
1057 Ga0496106_0074910 3300048909 Bacteria 2592
1058 Ga0496106_0481850 3300048909 Bacteria 997
1059 Ga0496107_0100061 3300048910 Bacteria 2125
1060 Ga0496107_0978622 3300048910 Bacteria 614
1061 Ga0496108_0002968 3300048911 Bacteria 13629
1062 Ga0496108_0206505 3300048911 Bacteria 1705
1063 Ga0496108_0464877 3300048911 Bacteria 1105
1064 Ga0496108_1214213 3300048911 Bacteria 637
1065 Ga0496109_0388307 3300048912 Bacteria 1319
1066 Ga0496109_0532497 3300048912 Bacteria 1108
1067 Ga0496109_1058368 3300048912 Bacteria 748
1068 Ga0496111_0103139 3300048914 Bacteria 2097
1069 Ga0496111_0562640 3300048914 Bacteria 836
1070 Ga0496112_0001698 3300048915 Bacteria 17181
1071 Ga0496113_0027340 3300048916 Bacteria 4089
1072 Ga0496113_0144087 3300048916 Bacteria 1876
1073 Ga0496114_0327781 3300048917 Bacteria 1353
1074 Ga0496114_0354663 3300048917 Unclassified 1298
1075 Ga0496114_1699247 3300048917 Bacteria 519
1076 Ga0496115_0053883 3300048918 Bacteria 3229
1077 Ga0496115_0087681 3300048918 Bacteria 2539
1078 Ga0496115_0379064 3300048918 Bacteria 1150
1079 Ga0496121_0000406 3300048924 Bacteria 85761
1080 Ga0501031_1075653 3300049568 Bacteria 513
1081 Ga0501032_0022998 3300049569 Bacteria 4315
1082 Ga0501032_0104771 3300049569 Bacteria 1874
1083 Ga0501032_0127851 3300049569 Bacteria 1678
1084 Ga0501033_0017207 3300049570 Bacteria 5464
1085 Ga0501033_0040243 3300049570 Bacteria 3490
1086 Ga0501033_0471029 3300049570 Bacteria 871
1087 Ga0501034_0000811 3300049571 Bacteria 46485
1088 Ga0501034_0002708 3300049571 Bacteria 20876
1089 Ga0501034_0392479 3300049571 Bacteria 1312
1090 Ga0501034_0685384 3300049571 Bacteria 924
1091 Ga0501034_0718030 3300049571 Bacteria 897
1092 Ga0501036_0849960 3300049572 Bacteria 750
1093 Ga0501036_1444996 3300049572 Bacteria 557
1094 Ga0501037_0011076 3300049573 Bacteria 6636
1095 Ga0501037_0174145 3300049573 Bacteria 1529
1096 Ga0501037_0286940 3300049573 Bacteria 1146
1097 Ga0501037_0460858 3300049573 Bacteria 866
1098 Ga0501037_0673747 3300049573 Bacteria 690
1099 Ga0501038_0201607 3300049574 Bacteria 1596
1100 Ga0501038_0209177 3300049574 Bacteria 1562
1101 Ga0501038_0449852 3300049574 Bacteria 990
1102 Ga0501038_0620273 3300049574 Bacteria 817
1103 Ga0501039_0013754 3300049575 Bacteria 6191
1104 Ga0501039_0666673 3300049575 Bacteria 814
1105 Ga0501040_0017760 3300049576 Bacteria 4721
1106 Ga0501041_0007447 3300049577 Bacteria 6426
1107 Ga0501042_0090403 3300049578 Bacteria 2197
1108 Ga0501043_0009146 3300049579 Bacteria 7793
1109 Ga0501043_0043147 3300049579 Bacteria 3545
1110 Ga0501043_0072005 3300049579 Bacteria 2715
1111 Ga0501043_0126122 3300049579 Bacteria 2007
1112 Ga0501043_0341106 3300049579 Bacteria 1140
1113 Ga0501043_0602729 3300049579 Bacteria 811
1114 Ga0501046_0001280 3300049580 Bacteria 24354
1115 Ga0501046_0089305 3300049580 Bacteria 2372
1116 Ga0501046_0264214 3300049580 Bacteria 1264
1117 Ga0501047_0003677 3300049581 Bacteria 14458
1118 Ga0501047_0004660 3300049581 Bacteria 12902
1119 Ga0501047_0007304 3300049581 Bacteria 10389
1120 Ga0501047_0008785 3300049581 Bacteria 9533
1121 Ga0501047_0049228 3300049581 Bacteria 4069
1122 Ga0501047_0050919 3300049581 Bacteria 3999
1123 Ga0501047_0190422 3300049581 Bacteria 1915
1124 Ga0501047_0467471 3300049581 Bacteria 1090
1125 Ga0501047_0498731 3300049581 Bacteria 1044
1126 Ga0501047_0524449 3300049581 Bacteria 1010
1127 Ga0501047_0539469 3300049581 Bacteria 991
1128 Ga0501047_0941346 3300049581 Bacteria 677
1129 Ga0501048_0012260 3300049582 Bacteria 6379
1130 Ga0501048_0079363 3300049582 Bacteria 2316
1131 Ga0501067_0245229 3300049583 Bacteria 997
1132 Ga0501067_0522915 3300049583 Bacteria 664
1133 Ga0501068_0084729 3300049584 Bacteria 1950
1134 Ga0501068_0305453 3300049584 Bacteria 1019
1135 Ga0501068_0366099 3300049584 Bacteria 927
1136 Ga0501069_0010891 3300049585 Bacteria 4818
1137 Ga0501069_0051373 3300049585 Bacteria 2294
1138 Ga0501069_0079453 3300049585 Bacteria 1846
1139 Ga0501069_0089277 3300049585 Bacteria 1742
1140 Ga0501069_0145821 3300049585 Bacteria 1359
1141 Ga0501069_0696745 3300049585 Bacteria 613
1142 Ga0501069_1010288 3300049585 Bacteria 508
1143 Ga0501070_0002023 3300049586 Bacteria 17821
1144 Ga0501070_0003957 3300049586 Bacteria 12753
1145 Ga0501070_0006320 3300049586 Bacteria 10084
1146 Ga0501070_0010051 3300049586 Bacteria 8004
1147 Ga0501070_0025040 3300049586 Bacteria 5004
1148 Ga0501070_0134979 3300049586 Bacteria 2038
1149 Ga0501070_0207624 3300049586 Bacteria 1608
1150 Ga0501070_0218978 3300049586 Bacteria 1561
1151 Ga0501070_0256043 3300049586 Bacteria 1431
1152 Ga0501070_0283525 3300049586 Bacteria 1351
1153 Ga0501070_0357910 3300049586 Bacteria 1184
1154 Ga0501071_0002236 3300049587 Bacteria 11644
1155 Ga0501071_1417460 3300049587 Bacteria 536
1156 Ga0501072_0909224 3300049588 Bacteria 687
1157 Ga0501072_1011049 3300049588 Bacteria 648
1158 Ga0501072_1151641 3300049588 Bacteria 603
1159 Ga0501072_1245395 3300049588 Bacteria 577
1160 Ga0501072_1453379 3300049588 Bacteria 530
1161 Ga0501073_0000067 3300049589 Bacteria 64981
1162 Ga0501073_0005956 3300049589 Bacteria 9097
1163 Ga0501073_0314135 3300049589 Bacteria 1081
1164 Ga0501074_0007848 3300049590 Bacteria 7729
1165 Ga0501074_0014527 3300049590 Bacteria 5729
1166 Ga0501074_0470037 3300049590 Bacteria 891
1167 Ga0501075_0002319 3300049591 Bacteria 12628
1168 Ga0501076_0001659 3300049592 Bacteria 15037
1169 Ga0501076_0455606 3300049592 Bacteria 1053
1170 Ga0501077_0500948 3300049593 Bacteria 779
1171 Ga0501079_0006250 3300049741 Bacteria 8938
1172 Ga0501079_0022548 3300049741 Bacteria 4829
1173 Ga0501079_0056991 3300049741 Bacteria 3015
1174 Ga0501080_0018578 3300049742 Bacteria 6433
1175 Ga0501080_0033234 3300049742 Bacteria 4814
1176 Ga0501080_0035530 3300049742 Bacteria 4651
1177 Ga0501080_0045146 3300049742 Bacteria 4102
1178 Ga0501080_0103481 3300049742 Bacteria 2640
1179 Ga0501080_0333056 3300049742 Bacteria 1372
1180 Ga0501080_0505484 3300049742 Bacteria 1080
1181 Ga0501081_0012506 3300049743 Bacteria 5581
1182 Ga0501083_0003320 3300049744 Bacteria 11243
1183 Ga0501083_0006483 3300049744 Bacteria 8302
1184 Ga0501083_0007925 3300049744 Bacteria 7522
1185 Ga0501083_0127460 3300049744 Bacteria 1668
1186 Ga0501083_0356156 3300049744 Bacteria 951
1187 Ga0501035_0001425 3300049822 Bacteria 24491
1188 Ga0501035_0030292 3300049822 Bacteria 4933
1189 Ga0501035_0193638 3300049822 Bacteria 1747
1190 Ga0501035_0331523 3300049822 Bacteria 1277
1191 Ga0501035_0523372 3300049822 Bacteria 974
1192 Ga0501035_0621176 3300049822 Bacteria 879
1193 Ga0501044_0002896 3300049823 Bacteria 19540
1194 Ga0501044_0018084 3300049823 Bacteria 7560
1195 Ga0501044_0134857 3300049823 Bacteria 2461
1196 Ga0501044_0155935 3300049823 Bacteria 2263
1197 Ga0501044_0374270 3300049823 Bacteria 1340
1198 Ga0501044_0424326 3300049823 Bacteria 1240
1199 Ga0501044_0467790 3300049823 Bacteria 1165
1200 Ga0501045_0004036 3300049824 Bacteria 10118
1201 Ga0501045_1309829 3300049824 Unclassified 527
1202 nmdc:mga00v17_644779_c1 3300050491 Bacteria 681
1203 nmdc:mga0yw44_205412_c1 3300050492 Bacteria 1302
1204 nmdc:mga0yw44_34881_c1 3300050492 Bacteria 2952
1205 nmdc:mga0yw44_608775_c1 3300050492 Bacteria 742
1206 nmdc:mga0k408_328324_c1 3300050493 Bacteria 913
1207 nmdc:mga05p37_1113_c2 3300050507 Bacteria 2797
1208 nmdc:mga05p37_192767_c1 3300050507 Bacteria 2473
1209 nmdc:mga05p37_66227_c1 3300050507 Bacteria 4443
1210 nmdc:mga05p37_69354_c1 3300050507 Bacteria 4337
1211 nmdc:mga09592_180156_c1 3300050508 Bacteria 1828
1212 nmdc:mga09592_34100_c1 3300050508 Bacteria 4255
1213 nmdc:mga09592_589261_c1 3300050508 Bacteria 953
1214 nmdc:mga09592_851013_c1 3300050508 Bacteria 769
1215 nmdc:mga0qj67_13468_c1 3300050509 Bacteria 6167
1216 nmdc:mga0qj67_314411_c1 3300050509 Bacteria 1268
1217 nmdc:mga0qj67_8298_c1 3300050509 Bacteria 7701
1218 nmdc:mga0qj67_929449_c1 3300050509 Bacteria 684
1219 nmdc:mga06r32_1317297_c1 3300050510 Bacteria 666
1220 nmdc:mga06r32_1453509_c1 3300050510 Bacteria 626
1221 nmdc:mga06r32_14926_c1 3300050510 Bacteria 7051
1222 nmdc:mga06r32_159866_c1 3300050510 Bacteria 2235
1223 nmdc:mga06r32_3762_c1 3300050510 Bacteria 13572
1224 nmdc:mga06r32_7217_c1 3300050510 Bacteria 10015
1225 nmdc:mga08y16_1001110_c1 3300050511 Bacteria 816
1226 nmdc:mga08y16_1050707_c1 3300050511 Bacteria 792
1227 nmdc:mga08y16_19475_c1 3300050511 Bacteria 7154
1228 nmdc:mga08y16_24296_c1 3300050511 Bacteria 6397
1229 nmdc:mga08y16_31778_c1 3300050511 Bacteria 5551
1230 nmdc:mga08y16_43940_c1 3300050511 Bacteria 4682
1231 nmdc:mga08y16_932433_c1 3300050511 Bacteria 852
1232 nmdc:mga0n895_12497_c1 3300050512 Bacteria 7619
1233 nmdc:mga0n895_128139_c1 3300050512 Bacteria 2562
1234 nmdc:mga0n895_59875_c1 3300050512 Bacteria 3757
1235 nmdc:mga0n895_710365_c1 3300050512 Bacteria 1001
1236 nmdc:mga0rr50_1558849_c1 3300050513 Bacteria 558
1237 nmdc:mga0rr50_1638439_c1 3300050513 Bacteria 543
1238 nmdc:mga0rr50_303519_c1 3300050513 Bacteria 1336
1239 nmdc:mga0rr50_689239_c1 3300050513 Bacteria 872
1240 nmdc:mga08x19_367641_c1 3300050514 Bacteria 1006
1241 nmdc:mga0a205_12447_c1 3300050515 Bacteria 7870
1242 nmdc:mga0a205_1384423_c1 3300050515 Bacteria 551
1243 nmdc:mga0a205_2443_c3 3300050515 Bacteria 11861
1244 Ga0495601_0006638 3300053077 Bacteria 6770
1245 Ga0495601_0021202 3300053077 Bacteria 3978
1246 Ga0495601_0036626 3300053077 Bacteria 3065
1247 Ga0495601_0062326 3300053077 Bacteria 2368
1248 Ga0495601_0156219 3300053077 Bacteria 1489
1249 Ga0495612_0087722 3300053078 Bacteria 1313
1250 Ga0495612_0284613 3300053078 Bacteria 739
1251 Ga0495595_0015226 3300053084 Bacteria 3277
1252 Ga0495595_0234877 3300053084 Bacteria 916
1253 Ga0495595_0280001 3300053084 Bacteria 837
1254 Ga0495619_0000858 3300053085 Bacteria 19930
1255 Ga0495619_0016773 3300053085 Bacteria 4637
1256 Ga0495619_1009055 3300053085 Bacteria 556
1257 Ga0500595_072423 3300053119 Bacteria 1020
1258 Ga0500568_0025084 3300053139 Bacteria 2519
1259 Ga0501084_0116575 3300054114 Bacteria 2245
1260 Ga0501084_0241634 3300054114 Bacteria 1524
1261 Ga0501084_0502315 3300054114 Bacteria 1025
1262 Ga0501084_0838911 3300054114 Bacteria 774
1263 Ga0501082_0005302 3300060353 Bacteria 11206
1264 Ga0501082_0010559 3300060353 Bacteria 7948
1265 Ga0501082_0105893 3300060353 Bacteria 2433
1266 Ga0501082_0209500 3300060353 Bacteria 1696
1267 Ga0501082_0951226 3300060353 Bacteria 751
1268 Ga0530510_0032579 3300061734 Bacteria 3750
1269 Ga0530510_0354827 3300061734 Bacteria 1102
1270 Ga0530510_0370660 3300061734 Bacteria 1077
1271 Ga0530510_1141496 3300061734 Bacteria 597
1272 2841942464 2841941048 Bacteria 8688029
1273 8002870736 8002869464 Bacteria 3588529
1274 Ga0075433_10009653
1275 JGI24736J21556_1010399
1276 JGI24751J29686_10022912
1277 JGI24751J29686_10091083
1278 JGI25404J52841_10075167
1279 JGI25405J52794_10003404
1280 Ga0065712_10464376
1281 Ga0065715_10353108
1282 Ga0065715_10357929
1283 Ga0065715_10556392
1284 Ga0065707_10986447
1285 Ga0070658_10459312
1286 Ga0070658_11115134
1287 Ga0070658_11123465
1288 Ga0070658_11128245
1289 Ga0070658_11544151
1290 Ga0070683_100092690
1291 Ga0070683_100347283
1292 Ga0070683_100868406
1293 Ga0070683_101315157
1294 Ga0070683_101816448
1295 Ga0070683_102194834
1296 Ga0070690_100466661
1297 Ga0070690_100740754
1298 Ga0070690_101702276
1299 Ga0070670_100021590
1300 Ga0070670_100057498
1301 Ga0070670_100108603
1302 Ga0068869_100082156
1303 Ga0068869_100727545
1304 Ga0068869_101350497
1305 Ga0070666_10157308
1306 Ga0070666_10184056
1307 Ga0070680_100007788
1308 Ga0070680_100017237
1309 Ga0070680_100021506
1310 Ga0070680_100086310
1311 Ga0070680_100095169
1312 Ga0070680_100160387
1313 Ga0070680_100165107
1314 Ga0070680_100221803
1315 Ga0070680_100686146
1316 Ga0070680_101211565
1317 Ga0070680_101753626
1318 Ga0070682_100049088
1319 Ga0070682_101083609
1320 Ga0068868_100235823
1321 Ga0068868_100945784
1322 Ga0068868_101301774
1323 Ga0070660_100006079
1324 Ga0070660_100013160
1325 Ga0070660_100016941
1326 Ga0070660_100241166
1327 Ga0070660_100308775
1328 Ga0070660_100328517
1329 Ga0070660_100568512
1330 Ga0070689_100690264
1331 Ga0070689_101781307
1332 Ga0070691_10274135
1333 Ga0070691_10286414
1334 Ga0070691_10647234
1335 Ga0070691_11034823
1336 Ga0070687_100262044
1337 Ga0070687_100351430
1338 Ga0070687_100585137
1339 Ga0070661_100099140
1340 Ga0070661_100107304
1341 Ga0070661_100111436
1342 Ga0070661_100215245
1343 Ga0070661_100888772
1344 Ga0070692_10023789
1345 Ga0070692_10337969
1346 Ga0070692_10349134
1347 Ga0070668_100057415
1348 Ga0070668_100698028
1349 Ga0070669_100108729
1350 Ga0070669_100114185
1351 Ga0070675_100081028
1352 Ga0070675_100211751
1353 Ga0070675_102045356
1354 Ga0070671_100057735
1355 Ga0070671_100178393
1356 Ga0070671_100277121
1357 Ga0070671_100980162
1358 Ga0070674_100040305
1359 Ga0070674_100414224
1360 Ga0070674_101420875
1361 Ga0070673_100002604
1362 Ga0070673_100420210
1363 Ga0070673_100951917
1364 Ga0070688_100556550
1365 Ga0070688_101008584
1366 Ga0070688_101088649
1367 Ga0070688_101513161
1368 Ga0070659_100013428
1369 Ga0070659_100016126
1370 Ga0070659_100221069
1371 Ga0070659_100226798
1372 Ga0070659_100399378
1373 Ga0070659_100435327
1374 Ga0070659_100940122
1375 Ga0070659_101289272
1376 Ga0070667_100017025
1377 Ga0070667_100173720
1378 Ga0070709_10002706
1379 Ga0070709_10070875
1380 Ga0070709_10624989
1381 Ga0070714_100000055
1382 Ga0070714_100064472
1383 Ga0070714_100072202
1384 Ga0070714_100076063
1385 Ga0070714_100109505
1386 Ga0070714_100157271
1387 Ga0070714_100704370
1388 Ga0070713_100007608
1389 Ga0070713_100146066
1390 Ga0070713_100381165
1391 Ga0070713_100670091
1392 Ga0070713_100956810
1393 Ga0070710_10050049
1394 Ga0070710_10057532
1395 Ga0070710_10310557
1396 Ga0070710_11004556
1397 Ga0070701_10950049
1398 Ga0070711_100035313
1399 Ga0070711_100045146
1400 Ga0070711_100199353
1401 Ga0070711_100340307
1402 Ga0070711_100647138
1403 Ga0070711_100839337
1404 Ga0070711_100962533
1405 Ga0070705_100004474
1406 Ga0070705_100136828
1407 Ga0070705_100717249
1408 Ga0070700_101261280
1409 Ga0070700_101886347
1410 Ga0070694_100016893
1411 Ga0070694_100027097
1412 Ga0070708_100071097
1413 Ga0070708_100550641
1414 Ga0070708_100706585
1415 Ga0070663_100023687
1416 Ga0070663_100176432
1417 Ga0070663_100206613
1418 Ga0070663_100421439
1419 Ga0070663_100547085
1420 Ga0070663_100614367
1421 Ga0070678_100620883
1422 Ga0070662_100034803
1423 Ga0070662_100091409
1424 Ga0070662_100243223
1425 Ga0070662_100333125
1426 Ga0070662_100709948
1427 Ga0070681_10030227
1428 Ga0070681_10035952
1429 Ga0070681_10048380
1430 Ga0070681_10088574
1431 Ga0070681_10139282
1432 Ga0070681_10183308
1433 Ga0070681_10283209
1434 Ga0070681_10355701
1435 Ga0070681_10407434
1436 Ga0070681_10430981
1437 Ga0070681_10520370
1438 Ga0070681_10626891
1439 Ga0070681_10675704
1440 Ga0070681_11179564
1441 Ga0070681_11756186
1442 Ga0068867_101850841
1443 Ga0070685_10102016
1444 Ga0070706_100027290
1445 Ga0070706_100056600
1446 Ga0070706_100119867
1447 Ga0070706_100142114
1448 Ga0070707_100044500
1449 Ga0070707_100193938
1450 Ga0070707_100322567
1451 Ga0070707_102083455
1452 Ga0070698_100497030
1453 Ga0070699_100026019
1454 Ga0070699_100040931
1455 Ga0070699_100241960
1456 Ga0070679_100003838
1457 Ga0070679_100004437
1458 Ga0070679_100015754
1459 Ga0070679_100026974
1460 Ga0070679_100030866
1461 Ga0070679_100134721
1462 Ga0070679_100222616
1463 Ga0070679_100344474
1464 Ga0070679_100952197
1465 Ga0070679_101154389
1466 Ga0070679_101294529
1467 Ga0070679_102034957
1468 Ga0070684_100117847
1469 Ga0070684_100548172
1470 Ga0070684_100599673
1471 Ga0070684_100665180
1472 Ga0070684_100900263
1473 Ga0070684_101202866
1474 Ga0070697_100044111
1475 Ga0070697_100091716
1476 Ga0070697_100422545
1477 Ga0070697_100807568
1478 Ga0068853_100073272
1479 Ga0068853_100077017
1480 Ga0068853_100557652
1481 Ga0068853_100597928
1482 Ga0068853_100679599
1483 Ga0068853_101381479
1484 Ga0070672_100099521
1485 Ga0070672_100342015
1486 Ga0070672_102059668
1487 Ga0070686_100244076
1488 Ga0070686_100333978
1489 Ga0070686_101346445
1490 Ga0070695_100003737
1491 Ga0070695_100029121
1492 Ga0070696_100002826
1493 Ga0070696_100075822
1494 Ga0070696_100935871
1495 Ga0070696_100944517
1496 Ga0070696_101071683
1497 Ga0070693_100104063
1498 Ga0070693_100307788
1499 Ga0070693_100367161
1500 Ga0070693_100683552
1501 Ga0070693_100693023
1502 Ga0070704_100050628
1503 Ga0070704_100146045
1504 Ga0068855_100014193
1505 Ga0068855_100021688
1506 Ga0068855_100073614
1507 Ga0068855_100125365
1508 Ga0068855_100366116
1509 Ga0068855_100659380
1510 Ga0068855_100820106
1511 Ga0068855_101881407
1512 Ga0070664_100297089
1513 Ga0070664_100552241
1514 Ga0070664_101135302
1515 Ga0068857_100020573
1516 Ga0068857_100066470
1517 Ga0068857_100128028
1518 Ga0068857_100365470
1519 Ga0068857_100567711
1520 Ga0068857_100817999
1521 Ga0068857_101440208
1522 Ga0068854_100185417
1523 Ga0068854_100218581
1524 Ga0068854_100325067
1525 Ga0068856_100004819
1526 Ga0068856_100405739
1527 Ga0068856_100507190
1528 Ga0068856_101556103
1529 Ga0070702_100364054
1530 Ga0070702_100414402
1531 Ga0068852_100001465
1532 Ga0068852_100002601
1533 Ga0068852_100041867
1534 Ga0068852_100765272
1535 Ga0068852_100898678
1536 Ga0068852_101063436
1537 Ga0068859_100332102
1538 Ga0068859_100658465
1539 Ga0068866_10493939
1540 Ga0068861_101679605
1541 Ga0068851_10037756
1542 Ga0068851_10046486
1543 Ga0068851_10477462
1544 Ga0068863_100033851
1545 Ga0068863_100900526
1546 Ga0068858_100100816
1547 Ga0068858_100949550
1548 Ga0068858_101373810
1549 Ga0068858_101447428
1550 Ga0068860_100402186
1551 Ga0068860_100432478
1552 Ga0068860_101290070
1553 Ga0068862_100499905
1554 Ga0068862_100885658
1555 Ga0068862_101910736
1556 Ga0081455_10000400
1557 Ga0081455_10010708
1558 Ga0081455_10210330
1559 Ga0081538_10036699
1560 Ga0081540_1021221
1561 Ga0081540_1314338
1562 Ga0070717_10013682
1563 Ga0070717_10545575
1564 Ga0075365_10019070
1565 Ga0075365_10273864
1566 Ga0075365_10655356
1567 Ga0075365_10790916
1568 Ga0075364_10173511
1569 Ga0075364_10318356
1570 Ga0070715_10637179
1571 Ga0070716_100092767
1572 Ga0070712_100003231
1573 Ga0070712_100027438
1574 Ga0070712_100039572
1575 Ga0070712_100044679
1576 Ga0070712_100287634
1577 Ga0070712_100446898
1578 Ga0070712_100914002
1579 Ga0070712_101015930
1580 Ga0070712_101758592
1581 Ga0075366_10318857
1582 Ga0097621_100123541
1583 Ga0097621_100697859
1584 Ga0068871_100168384
1585 Ga0068871_100379365
1586 Ga0068871_100404279
1587 Ga0068871_100903894
1588 Ga0075428_100009401
1589 Ga0075428_100075008
1590 Ga0075428_100104567
1591 Ga0075428_100113736
1592 Ga0075430_100006139
1593 Ga0075430_100017105
1594 Ga0075430_100018554
1595 Ga0075431_100000862
1596 Ga0075431_100012233
1597 Ga0075431_100012723
1598 Ga0075431_100101973
1599 Ga0075431_100141100
1600 Ga0075431_100166586
1601 Ga0075433_10005832
1602 Ga0075433_10006236
1603 Ga0075433_10010043
1604 Ga0075433_11438180
1605 Ga0075434_100000294
1606 Ga0075434_100138784
1607 Ga0075434_100150296
1608 Ga0075434_100379660
1609 Ga0075434_100441604
1610 Ga0075429_100001684
1611 Ga0075429_100047444
1612 Ga0075429_100194036
1613 Ga0075429_100279130
1614 Ga0075429_100605427
1615 Ga0068865_100049183
1616 Ga0075436_100399309
1617 Ga0097620_100332129
1618 Ga0097620_100658418
1619 Ga0075435_100074572
1620 Ga0075435_100077975
1621 Ga0075435_100107116
1622 Ga0075435_100435474
1623 Ga0075435_100715952
1624 Ga0099794_10034449
1625 Ga0099795_10002187
1626 Ga0105250_10462996
1627 Ga0105240_10003744
1628 Ga0105240_10039363
1629 Ga0105240_10045298
1630 Ga0105240_10103768
1631 Ga0105240_10106542
1632 Ga0105240_10225119
1633 Ga0105240_10382331
1634 Ga0105240_10667692
1635 Ga0105240_11962089
1636 Ga0105240_12079986
1637 Ga0111539_10025907
1638 Ga0111539_10040405
1639 Ga0111539_10061817
1640 Ga0111539_10085064
1641 Ga0111539_10788600
1642 Ga0111539_10817283
1643 Ga0111539_11054696
1644 Ga0111539_11460831
1645 Ga0111539_12579476
1646 Ga0111539_12795679
1647 Ga0105245_10416091
1648 Ga0105245_10644215
1649 Ga0105245_11480210
1650 Ga0105245_11788836
1651 Ga0105245_11888230
1652 Ga0105245_11951735
1653 Ga0105247_10030581
1654 Ga0114129_10018340
1655 Ga0114129_10029275
1656 Ga0114129_10040520
1657 Ga0114129_10097307
1658 Ga0114129_10209713
1659 Ga0114129_10965477
1660 Ga0105243_10020165
1661 Ga0105243_10417821
1662 Ga0105241_10036112
1663 Ga0105241_10091278
1664 Ga0105241_10950171
1665 Ga0105241_11347500
1666 Ga0105241_11463498
1667 Ga0105241_11624908
1668 Ga0105241_11825248
1669 Ga0105242_10463044
1670 Ga0105248_10165305
1671 Ga0105248_10595930
1672 Ga0105248_10880141
1673 Ga0105237_10117767
1674 Ga0105237_10178436
1675 Ga0105237_10544614
1676 Ga0105237_10732541
1677 Ga0105237_12512785
1678 Ga0105237_12564667
1679 Ga0105238_10034472
1680 Ga0105238_10037348
1681 Ga0105238_10200847
1682 Ga0105238_10226313
1683 Ga0105238_10244552
1684 Ga0105238_10342233
1685 Ga0105238_10728685
1686 Ga0105238_11260056
1687 Ga0105238_11263501
1688 Ga0105249_10199315
1689 Ga0105249_11835192
1690 Ga0099796_10006712
1691 Ga0105239_10040843
1692 Ga0105239_10510357
1693 Ga0105239_10917514
1694 Ga0105239_10930060
1695 Ga0105239_11073761
1696 Ga0105239_11606260
1697 Ga0105239_12391699
1698 Ga0105239_13600017
1699 Ga0105246_10143257
1700 Ga0105246_11051896
1701 Ga0157347_1077452
1702 Ga0157373_10097486
1703 Ga0157373_10110565
1704 Ga0157373_10138234
1705 Ga0157373_10180954
1706 Ga0157373_10269977
1707 Ga0157373_10434681
1708 Ga0157371_10045740
1709 Ga0157371_10139004
1710 Ga0157371_10537727
1711 Ga0157371_11293636
1712 Ga0157370_10005540
1713 Ga0157370_10006789
1714 Ga0157370_10006941
1715 Ga0157370_10011149
1716 Ga0157370_10042823
1717 Ga0157370_10187391
1718 Ga0157370_10236477
1719 Ga0157370_10309975
1720 Ga0157370_10324968
1721 Ga0157370_10356471
1722 Ga0157370_10417250
1723 Ga0157370_10521497
1724 Ga0157370_10738422
1725 Ga0157370_10949826
1726 Ga0157370_11082555
1727 Ga0157370_11554492
1728 Ga0157370_11843575
1729 Ga0157369_10000100
1730 Ga0157369_10015218
1731 Ga0157369_10040279
1732 Ga0157369_10075541
1733 Ga0157369_10075816
1734 Ga0157369_10281453
1735 Ga0157369_10316686
1736 Ga0157369_10387493
1737 Ga0157369_10537559
1738 Ga0157369_11112519
1739 Ga0157369_11411378
1740 Ga0157369_11566331
1741 Ga0157369_12283836
1742 Ga0157374_10489409
1743 Ga0157374_11059147
1744 Ga0157378_10099221
1745 Ga0157378_10846972
1746 Ga0157378_11291824
1747 Ga0157378_11736673
1748 Ga0157378_12176393
1749 Ga0157378_12839007
1750 Ga0163162_10106794
1751 Ga0163162_11677639
1752 Ga0157372_10004135
1753 Ga0157372_10047515
1754 Ga0157372_10056055
1755 Ga0157372_10058854
1756 Ga0157372_10101985
1757 Ga0157372_10115538
1758 Ga0157372_10172629
1759 Ga0157372_10201508
1760 Ga0157372_10258089
1761 Ga0157372_10416508
1762 Ga0157372_10513412
1763 Ga0157372_10621983
1764 Ga0157372_10740059
1765 Ga0157372_11236305
1766 Ga0157372_11914316
1767 Ga0157372_12287872
1768 Ga0157375_10022125
1769 Ga0157375_10226901
1770 Ga0157375_10444811
1771 Ga0157375_10531439
1772 Ga0157375_10997247
1773 Ga0157375_11544541
1774 Ga0157375_11946835
1775 Ga0163163_10046231
1776 Ga0163163_10082492
1777 Ga0163163_11219728
1778 Ga0157380_10082926
1779 Ga0157380_11081046
1780 Ga0157380_11360148
1781 Ga0157380_12801263
1782 Ga0182008_10084382
1783 Ga0182008_10943916
1784 Ga0157377_10422631
1785 Ga0157377_10684875
1786 Ga0157377_10718047
1787 Ga0157379_10140814
1788 Ga0157379_10284227
1789 Ga0157379_11005469
1790 Ga0157379_11043634
1791 Ga0157376_10006713
1792 Ga0157376_10108294
1793 Ga0157376_10112615
1794 Ga0157376_10587435
1795 Ga0157376_12005835
1796 Ga0157376_12616677
1797 Ga0182006_1110343
1798 Ga0182005_1089902
1799 Ga0163161_11473184
1800 Ga0163161_11769814
1801 Ga0163161_11995864
1802 Ga0206356_10281404
1803 Ga0206356_11396580
1804 Ga0206353_10973506
1805 Ga0213876_10644739
1806 Ga0209455_1000257
1807 Ga0207697_10306930
1808 Ga0207697_10403553
1809 Ga0207653_10003730
1810 Ga0207682_10009072
1811 Ga0207692_10119267
1812 Ga0207692_10244148
1813 Ga0207692_10558458
1814 Ga0207692_11063549
1815 Ga0207642_10091002
1816 Ga0207710_10081233
1817 Ga0207710_10126456
1818 Ga0207688_10011482
1819 Ga0207688_10246421
1820 Ga0207688_10552841
1821 Ga0207688_10611145
1822 Ga0207680_10282461
1823 Ga0207647_10000992
1824 Ga0207647_10255238
1825 Ga0207685_10149083
1826 Ga0207699_10036765
1827 Ga0207699_10077565
1828 Ga0207699_10142552
1829 Ga0207699_10250582
1830 Ga0207645_10128069
1831 Ga0207643_10144673
1832 Ga0207705_10011410
1833 Ga0207705_10292108
1834 Ga0207705_10547334
1835 Ga0207705_10723707
1836 Ga0207705_10799936
1837 Ga0207705_11317996
1838 Ga0207705_11320863
1839 Ga0207705_11448483
1840 Ga0207684_10029127
1841 Ga0207684_10177879
1842 Ga0207684_10546105
1843 Ga0207684_11442746
1844 Ga0207654_10017315
1845 Ga0207654_10308185
1846 Ga0207707_10023133
1847 Ga0207707_10023579
1848 Ga0207707_10042317
1849 Ga0207707_10052620
1850 Ga0207707_10066128
1851 Ga0207707_10079711
1852 Ga0207707_10093496
1853 Ga0207707_10295903
1854 Ga0207707_10379069
1855 Ga0207707_10467022
1856 Ga0207707_10475301
1857 Ga0207707_11508843
1858 Ga0207695_10072051
1859 Ga0207695_10091596
1860 Ga0207695_10153455
1861 Ga0207695_10188595
1862 Ga0207695_10235268
1863 Ga0207695_10271523
1864 Ga0207695_10433455
1865 Ga0207695_10534640
1866 Ga0207695_11140875
1867 Ga0207695_11361969
1868 Ga0207671_10483685
1869 Ga0207671_10521604
1870 Ga0207671_10541103
1871 Ga0207671_10698586
1872 Ga0207693_10001902
1873 Ga0207693_10048877
1874 Ga0207693_10103786
1875 Ga0207693_10639482
1876 Ga0207693_11112828
1877 Ga0207663_10068053
1878 Ga0207663_11097277
1879 Ga0207663_11595342
1880 Ga0207660_10006552
1881 Ga0207660_10031976
1882 Ga0207660_10060031
1883 Ga0207660_10109057
1884 Ga0207660_10178827
1885 Ga0207660_10184353
1886 Ga0207660_10190360
1887 Ga0207660_10229018
1888 Ga0207660_10682222
1889 Ga0207660_11029361
1890 Ga0207662_10112417
1891 Ga0207662_10260627
1892 Ga0207662_10389397
1893 Ga0207657_10005816
1894 Ga0207657_10015097
1895 Ga0207657_10029749
1896 Ga0207657_10077825
1897 Ga0207657_10169324
1898 Ga0207657_10299046
1899 Ga0207657_10525460
1900 Ga0207657_10532424
1901 Ga0207657_10919030
1902 Ga0207657_11017204
1903 Ga0207649_10091327
1904 Ga0207649_10539780
1905 Ga0207649_10802844
1906 Ga0207649_10829672
1907 Ga0207652_10009623
1908 Ga0207652_10012379
1909 Ga0207652_10020397
1910 Ga0207652_10026651
1911 Ga0207652_10047609
1912 Ga0207652_10066745
1913 Ga0207652_10097357
1914 Ga0207652_10124106
1915 Ga0207652_10142941
1916 Ga0207652_10168036
1917 Ga0207652_10241017
1918 Ga0207652_10344280
1919 Ga0207652_10875669
1920 Ga0207652_11070758
1921 Ga0207652_11129378
1922 Ga0207652_11254880
1923 Ga0207646_10052667
1924 Ga0207646_10131151
1925 Ga0207646_10150494
1926 Ga0207646_11892017
1927 Ga0207681_10053889
1928 Ga0207681_10742152
1929 Ga0207694_10004208
1930 Ga0207694_10025794
1931 Ga0207694_10087286
1932 Ga0207694_10339894
1933 Ga0207694_11338222
1934 Ga0207650_10021414
1935 Ga0207650_10072898
1936 Ga0207650_10503236
1937 Ga0207659_10167547
1938 Ga0207659_10274284
1939 Ga0207659_10454726
1940 Ga0207659_10760305
1941 Ga0207687_10546189
1942 Ga0207687_11414905
1943 Ga0207700_10005496
1944 Ga0207700_10202648
1945 Ga0207700_10298323
1946 Ga0207700_10934470
1947 Ga0207700_11514427
1948 Ga0207700_11979997
1949 Ga0207664_10000030
1950 Ga0207664_10007824
1951 Ga0207664_10167051
1952 Ga0207664_10227032
1953 Ga0207664_10484680
1954 Ga0207664_10738876
1955 Ga0207664_11349730
1956 Ga0207664_11487388
1957 Ga0207644_10003183
1958 Ga0207644_10255941
1959 Ga0207644_10322318
1960 Ga0207644_11164672
1961 Ga0207690_10035971
1962 Ga0207690_10107864
1963 Ga0207690_10119564
1964 Ga0207690_10208728
1965 Ga0207690_10241971
1966 Ga0207690_10254391
1967 Ga0207690_10268830
1968 Ga0207690_10273263
1969 Ga0207690_10293305
1970 Ga0207690_10643022
1971 Ga0207690_10657214
1972 Ga0207690_10689462
1973 Ga0207690_11388375
1974 Ga0207690_11537432
1975 Ga0207690_11542532
1976 Ga0207706_10026923
1977 Ga0207706_10068937
1978 Ga0207706_10083041
1979 Ga0207706_10905574
1980 Ga0207686_10152334
1981 Ga0207686_10325709
1982 Ga0207686_11809101
1983 Ga0207670_10293880
1984 Ga0207670_11522090
1985 Ga0207669_10143527
1986 Ga0207669_10240660
1987 Ga0207669_10537950
1988 Ga0207669_11890976
1989 Ga0207704_10306327
1990 Ga0207704_11484436
1991 Ga0207665_10047049
1992 Ga0207665_10050100
1993 Ga0207665_10130474
1994 Ga0207665_10187232
1995 Ga0207665_10603989
1996 Ga0207691_10062517
1997 Ga0207691_10080554
1998 Ga0207691_11412695
1999 Ga0207711_10373854
2000 Ga0207711_10899678
2001 Ga0207711_11374900
2002 Ga0207711_11551588
2003 Ga0207689_10030579
2004 Ga0207661_10056352
2005 Ga0207661_10221414
2006 Ga0207661_10483568
2007 Ga0207661_11018997
2008 Ga0207661_11051276
2009 Ga0207679_10057128
2010 Ga0207679_10189344
2011 Ga0207679_10742178
2012 Ga0207679_11434300
2013 Ga0207667_10003345
2014 Ga0207667_10100714
2015 Ga0207667_10112064
2016 Ga0207667_10187907
2017 Ga0207667_10193677
2018 Ga0207667_10762906
2019 Ga0207667_11001275
2020 Ga0207667_11286575
2021 Ga0207667_12217324
2022 Ga0207651_10001351
2023 Ga0207651_10878132
2024 Ga0207712_10949939
2025 Ga0207668_10981608
2026 Ga0207668_11761764
2027 Ga0207640_10025280
2028 Ga0207640_10357621
2029 Ga0207658_10460043
2030 Ga0207658_11617990
2031 Ga0207677_10378465
2032 Ga0207677_10390689
2033 Ga0207703_10079625
2034 Ga0207703_11382055
2035 Ga0207703_11893173
2036 Ga0207703_12146222
2037 Ga0207639_10031435
2038 Ga0207639_10052339
2039 Ga0207639_10120362
2040 Ga0207639_10303681
2041 Ga0207639_10546419
2042 Ga0207639_10600137
2043 Ga0207639_10715020
2044 Ga0207639_11910059
2045 Ga0207678_10021804
2046 Ga0207678_10393714
2047 Ga0207678_10454721
2048 Ga0207678_10888018
2049 Ga0207678_10888483
2050 Ga0207708_10315516
2051 Ga0207702_10016551
2052 Ga0207702_10127278
2053 Ga0207702_10156547
2054 Ga0207702_10171702
2055 Ga0207702_10238330
2056 Ga0207702_12282580
2057 Ga0207641_10130750
2058 Ga0207641_10309809
2059 Ga0207641_10912855
2060 Ga0207674_10004423
2061 Ga0207674_10019466
2062 Ga0207674_10032151
2063 Ga0207674_10040070
2064 Ga0207674_10042003
2065 Ga0207674_10077047
2066 Ga0207674_11533762
2067 Ga0207675_100403525
2068 Ga0207675_101645566
2069 Ga0207675_101680309
2070 Ga0207683_10256870
2071 Ga0207683_11028698
2072 Ga0207698_10131060
2073 Ga0207698_10159480
2074 Ga0207698_10202011
2075 Ga0207698_11362754
2076 Ga0207698_12514609
2077 Ga0209973_1059164
2078 Ga0209967_1014889
2079 Ga0209967_1017071
2080 Ga0209984_1017528
2081 Ga0209995_1083117
2082 Ga0209968_1025041
2083 Ga0209968_1035566
2084 Ga0209999_1063587
2085 Ga0209983_1010994
2086 Ga0209983_1063245
2087 Ga0209588_1019393
2088 Ga0209971_1021045
2089 Ga0209998_10021487
2090 Ga0209974_10003087
2091 Ga0209974_10004171
2092 Ga0207428_10028214
2093 Ga0207428_10028443
2094 Ga0207428_10155947
2095 Ga0207428_10883668
2096 Ga0268266_11231033
2097 Ga0268266_12117065
2098 Ga0268265_10600466
2099 Ga0268265_11494913
2100 Ga0268264_10332422
2101 Ga0268264_10642658
2102 Ga0268264_11006660
2103 Ga0265336_10168796
2104 Ga0265338_10062558
2105 Ga0265338_10560508
2106 Ga0265762_1193888
2107 Ga0265771_1025827
2108 Ga0265760_10068464
2109 Ga0265330_10191872
2110 Ga0265332_10028145
2111 Ga0265332_10181913
2112 Ga0265325_10000018
2113 Ga0265325_10051729
2114 Ga0265325_10073755
2115 Ga0265325_10082312
2116 Ga0265325_10307535
2117 Ga0265329_10061576
2118 Ga0265340_10059954
2119 Ga0265340_10083538
2120 Ga0265340_10234848
2121 Ga0265339_10046283
2122 Ga0265339_10054697
2123 Ga0265331_10039509
2124 Ga0265331_10094632
2125 Ga0265316_10256342
2126 Ga0265316_10326765
2127 Ga0265314_10155280
2128 Ga0265342_10002569
2129 Ga0265342_10109148
2130 Ga0307413_10110919
2131 Ga0307413_10164634
2132 Ga0307413_10372802
2133 Ga0307409_100234178
2134 Ga0307416_100414678
2135 Ga0307411_11579180
2136 Ga0373948_0083919
2137 Ga0373948_0116801
2138 Ga0373958_0111854
2139 Ga0373938_0056734
2140 Ga0373934_0247605
2141 Ga0373944_0029810
2142 Ga0373951_0023890
2143 Ga0373952_0035064
2144 Ga0373952_0040673
2145 Ga0373923_0006121
2146 Ga0373936_0008122
2147 Ga0373936_0102278
2148 Ga0373939_0013810
2149 Ga0373945_0435170
2150 Ga0373954_0002485
2151 Ga0373956_0018734
2152 Ga0373956_0522812
2153 Ga0373957_0018727
2154 Ga0373943_0049403
2155 Ga0373946_0005193
2156 Ga0373946_0101562
2157 Ga0373946_0699747
2158 Ga0373955_0094307
2159 Ga0373955_0425539
2160 Ga0373955_0771871
2161 Ga0373961_0115978
2162 Ga0373962_0071022
2163 Ga0373924_0173900
2164 Ga0373924_0497867
2165 Ga0373931_0000751
2166 Ga0373931_0310923
2167 Ga0373931_0330224
2168 Ga0373935_0068403
2169 Ga0373935_0077597
2170 Ga0373935_1000459
2171 Ga0373935_1050103
2172 Ga0373927_0245857
2173 Ga0373927_0707307
2174 Ga0373933_0006528
2175 Ga0373933_0218338
2176 Ga0373933_0934217
2177 Ga0373947_0720096
2178 Ga0373937_0043822
2179 Ga0373937_0241257
2180 Ga0373937_0802948
2181 Ga0372808_020777
2182 Ga0373925_0187402
2183 Ga0373925_0388550
2184 Ga0395899_0046536
2185 Ga0395900_0091471
2186 Ga0395900_0817599
2187 Ga0395900_1528243
2188 Ga0395898_0661428
2189 Ga0395898_1717405
2190 Ga0395905_0026681
2191 Ga0395905_0295002
2192 Ga0395905_1122114
2193 Ga0436364_0624032
2194 Ga0436364_1390098
2195 Ga0395901_0176131
2196 Ga0395901_0277351
2197 Ga0395901_1073760
2198 Ga0436360_0463612
2199 Ga0436361_0485833
2200 Ga0436361_0822131
2201 Ga0436363_0313163
2202 Ga0436363_0620969
2203 Ga0436363_1402868
2204 Ga0439465_0049831
2205 Ga0451793_0098171
2206 Ga0439448_0265537
2207 Ga0450888_016055
2208 Ga0450896_033686
2209 Ga0453683_0657999
2210 Ga0466966_0013026
2211 Ga0466966_0344082
2212 Ga0453684_0448907
2213 Ga0466968_0001844
2214 Ga0466960_0008771
2215 Ga0466967_0373208
2216 Ga0495592_0006884
2217 Ga0495592_0516587
2218 Ga0495592_0841704
2219 Ga0495603_0084539
2220 Ga0495603_0780536
2221 Ga0495603_0877020
2222 Ga0495629_0035630
2223 Ga0495629_0083898
2224 Ga0495629_0338851
2225 Ga0495641_0117237
2226 Ga0495641_0135203
2227 Ga0495651_0033380
2228 Ga0495651_0271734
2229 Ga0495651_0838439
2230 Ga0495653_0010069
2231 Ga0495653_0602714
2232 Ga0495580_0085285
2233 Ga0495639_0003773
2234 Ga0495662_0052459
2235 Ga0495662_0317738
2236 Ga0495664_0071430
2237 Ga0495664_0416580
2238 Ga0495664_0488792
2239 Ga0495584_0189003
2240 Ga0495594_0245413
2241 Ga0495608_0009049
2242 Ga0495608_0115314
2243 Ga0495618_0100705
2244 Ga0495618_0287336
2245 Ga0495618_0840314
2246 Ga0495628_0001092
2247 Ga0495628_0334924
2248 Ga0495630_0138167
2249 Ga0495637_0290292
2250 Ga0495666_0011044
2251 Ga0495652_0010234
2252 Ga0495652_0132515
2253 Ga0495652_0990060
2254 Ga0495665_0178471
2255 Ga0495640_0013426
2256 Ga0495640_0115579
2257 Ga0495586_0347398
2258 Ga0495587_0051315
2259 Ga0495587_0064202
2260 Ga0495587_0079811
2261 Ga0495645_0012597
2262 Ga0495645_0138398
2263 Ga0495667_0026820
2264 Ga0495667_0350512
2265 Ga0495656_0317549
2266 Ga0495634_0069055
2267 Ga0495634_0077677
2268 Ga0495625_0084892
2269 Ga0495635_0007428
2270 Ga0495635_0219553
2271 Ga0495635_0763186
2272 Ga0495588_0015824
2273 Ga0495588_0638190
2274 Ga0495657_0011578
2275 Ga0495657_0099175
2276 Ga0495599_0019064
2277 Ga0495599_0227665
2278 Ga0495623_0032357
2279 Ga0495623_0313803
2280 Ga0495646_0114119
2281 Ga0495647_0001911
2282 Ga0495658_0142350
2283 Ga0495658_0170177
2284 Ga0495613_0990965
2285 Ga0495624_0341991
2286 Ga0495624_0363624
2287 Ga0495624_0822130
2288 Ga0495600_0026626
2289 Ga0495600_0366669
2290 Ga0495581_0063366
2291 Ga0495581_0331776
2292 Ga0495604_0005882
2293 Ga0495604_0526610
2294 Ga0495604_0693348
2295 Ga0495674_0277337
2296 Ga0495674_0377484
2297 Ga0495672_0104619
2298 Ga0495676_0224924
2299 Ga0495680_0029514
2300 Ga0495680_0273474
2301 Ga0495680_0373613
2302 Ga0495675_0005368
2303 Ga0495684_0000897
2304 Ga0495684_0130885
2305 Ga0495684_0514457
2306 Ga0495593_0015926
2307 Ga0495593_0501758
2308 Ga0495602_0013144
2309 Ga0495602_0284651
2310 Ga0495614_0159812
2311 Ga0496100_0128902
2312 Ga0496101_0028524
2313 Ga0496101_0123714
2314 Ga0496101_0153928
2315 Ga0496102_0059497
2316 Ga0496102_0063235
2317 Ga0496102_0733362
2318 Ga0496102_1198867
2319 Ga0496102_1262535
2320 Ga0496102_1480628
2321 Ga0496103_0114813
2322 Ga0496103_0332630
2323 Ga0496104_0000517
2324 Ga0496104_0000965
2325 Ga0496104_0531237
2326 Ga0496104_1587806
2327 Ga0496105_0012155
2328 Ga0496105_0013222
2329 Ga0496105_0379196
2330 Ga0496106_0074910
2331 Ga0496106_0481850
2332 Ga0496107_0100061
2333 Ga0496107_0978622
2334 Ga0496108_0002968
2335 Ga0496108_0206505
2336 Ga0496108_0464877
2337 Ga0496108_1214213
2338 Ga0496109_0388307
2339 Ga0496109_0532497
2340 Ga0496109_1058368
2341 Ga0496111_0103139
2342 Ga0496111_0562640
2343 Ga0496112_0001698
2344 Ga0496113_0027340
2345 Ga0496113_0144087
2346 Ga0496114_0327781
2347 Ga0496114_0354663
2348 Ga0496114_1699247
2349 Ga0496115_0053883
2350 Ga0496115_0087681
2351 Ga0496115_0379064
2352 Ga0496121_0000406
2353 Ga0501031_1075653
2354 Ga0501032_0022998
2355 Ga0501032_0104771
2356 Ga0501032_0127851
2357 Ga0501033_0017207
2358 Ga0501033_0040243
2359 Ga0501033_0471029
2360 Ga0501034_0000811
2361 Ga0501034_0002708
2362 Ga0501034_0392479
2363 Ga0501034_0685384
2364 Ga0501034_0718030
2365 Ga0501036_0849960
2366 Ga0501036_1444996
2367 Ga0501037_0011076
2368 Ga0501037_0174145
2369 Ga0501037_0286940
2370 Ga0501037_0460858
2371 Ga0501037_0673747
2372 Ga0501038_0201607
2373 Ga0501038_0209177
2374 Ga0501038_0449852
2375 Ga0501038_0620273
2376 Ga0501039_0013754
2377 Ga0501039_0666673
2378 Ga0501040_0017760
2379 Ga0501041_0007447
2380 Ga0501042_0090403
2381 Ga0501043_0009146
2382 Ga0501043_0043147
2383 Ga0501043_0072005
2384 Ga0501043_0126122
2385 Ga0501043_0341106
2386 Ga0501043_0602729
2387 Ga0501046_0001280
2388 Ga0501046_0089305
2389 Ga0501046_0264214
2390 Ga0501047_0003677
2391 Ga0501047_0004660
2392 Ga0501047_0007304
2393 Ga0501047_0008785
2394 Ga0501047_0049228
2395 Ga0501047_0050919
2396 Ga0501047_0190422
2397 Ga0501047_0467471
2398 Ga0501047_0498731
2399 Ga0501047_0524449
2400 Ga0501047_0539469
2401 Ga0501047_0941346
2402 Ga0501048_0012260
2403 Ga0501048_0079363
2404 Ga0501067_0245229
2405 Ga0501067_0522915
2406 Ga0501068_0084729
2407 Ga0501068_0305453
2408 Ga0501068_0366099
2409 Ga0501069_0010891
2410 Ga0501069_0051373
2411 Ga0501069_0079453
2412 Ga0501069_0089277
2413 Ga0501069_0145821
2414 Ga0501069_0696745
2415 Ga0501069_1010288
2416 Ga0501070_0002023
2417 Ga0501070_0003957
2418 Ga0501070_0006320
2419 Ga0501070_0010051
2420 Ga0501070_0025040
2421 Ga0501070_0134979
2422 Ga0501070_0207624
2423 Ga0501070_0218978
2424 Ga0501070_0256043
2425 Ga0501070_0283525
2426 Ga0501070_0357910
2427 Ga0501071_0002236
2428 Ga0501071_1417460
2429 Ga0501072_0909224
2430 Ga0501072_1011049
2431 Ga0501072_1151641
2432 Ga0501072_1245395
2433 Ga0501072_1453379
2434 Ga0501073_0000067
2435 Ga0501073_0005956
2436 Ga0501073_0314135
2437 Ga0501074_0007848
2438 Ga0501074_0014527
2439 Ga0501074_0470037
2440 Ga0501075_0002319
2441 Ga0501076_0001659
2442 Ga0501076_0455606
2443 Ga0501077_0500948
2444 Ga0501079_0006250
2445 Ga0501079_0022548
2446 Ga0501079_0056991
2447 Ga0501080_0018578
2448 Ga0501080_0033234
2449 Ga0501080_0035530
2450 Ga0501080_0045146
2451 Ga0501080_0103481
2452 Ga0501080_0333056
2453 Ga0501080_0505484
2454 Ga0501081_0012506
2455 Ga0501083_0003320
2456 Ga0501083_0006483
2457 Ga0501083_0007925
2458 Ga0501083_0127460
2459 Ga0501083_0356156
2460 Ga0501035_0001425
2461 Ga0501035_0030292
2462 Ga0501035_0193638
2463 Ga0501035_0331523
2464 Ga0501035_0523372
2465 Ga0501035_0621176
2466 Ga0501044_0002896
2467 Ga0501044_0018084
2468 Ga0501044_0134857
2469 Ga0501044_0155935
2470 Ga0501044_0374270
2471 Ga0501044_0424326
2472 Ga0501044_0467790
2473 Ga0501045_0004036
2474 Ga0501045_1309829
2475 nmdc:mga00v17_644779_c1
2476 nmdc:mga0yw44_205412_c1
2477 nmdc:mga0yw44_34881_c1
2478 nmdc:mga0yw44_608775_c1
2479 nmdc:mga0k408_328324_c1
2480 nmdc:mga05p37_1113_c2
2481 nmdc:mga05p37_192767_c1
2482 nmdc:mga05p37_66227_c1
2483 nmdc:mga05p37_69354_c1
2484 nmdc:mga09592_180156_c1
2485 nmdc:mga09592_34100_c1
2486 nmdc:mga09592_589261_c1
2487 nmdc:mga09592_851013_c1
2488 nmdc:mga0qj67_13468_c1
2489 nmdc:mga0qj67_314411_c1
2490 nmdc:mga0qj67_8298_c1
2491 nmdc:mga0qj67_929449_c1
2492 nmdc:mga06r32_1317297_c1
2493 nmdc:mga06r32_1453509_c1
2494 nmdc:mga06r32_14926_c1
2495 nmdc:mga06r32_159866_c1
2496 nmdc:mga06r32_3762_c1
2497 nmdc:mga06r32_7217_c1
2498 nmdc:mga08y16_1001110_c1
2499 nmdc:mga08y16_1050707_c1
2500 nmdc:mga08y16_19475_c1
2501 nmdc:mga08y16_24296_c1
2502 nmdc:mga08y16_31778_c1
2503 nmdc:mga08y16_43940_c1
2504 nmdc:mga08y16_932433_c1
2505 nmdc:mga0n895_12497_c1
2506 nmdc:mga0n895_128139_c1
2507 nmdc:mga0n895_59875_c1
2508 nmdc:mga0n895_710365_c1
2509 nmdc:mga0rr50_1558849_c1
2510 nmdc:mga0rr50_1638439_c1
2511 nmdc:mga0rr50_303519_c1
2512 nmdc:mga0rr50_689239_c1
2513 nmdc:mga08x19_367641_c1
2514 nmdc:mga0a205_12447_c1
2515 nmdc:mga0a205_1384423_c1
2516 nmdc:mga0a205_2443_c3
2517 Ga0495601_0006638
2518 Ga0495601_0021202
2519 Ga0495601_0036626
2520 Ga0495601_0062326
2521 Ga0495601_0156219
2522 Ga0495612_0087722
2523 Ga0495612_0284613
2524 Ga0495595_0015226
2525 Ga0495595_0234877
2526 Ga0495595_0280001
2527 Ga0495619_0000858
2528 Ga0495619_0016773
2529 Ga0495619_1009055
2530 Ga0500595_072423
2531 Ga0500568_0025084
2532 Ga0501084_0116575
2533 Ga0501084_0241634
2534 Ga0501084_0502315
2535 Ga0501084_0838911
2536 Ga0501082_0005302
2537 Ga0501082_0010559
2538 Ga0501082_0105893
2539 Ga0501082_0209500
2540 Ga0501082_0951226
2541 Ga0530510_0032579
2542 Ga0530510_0354827
2543 Ga0530510_0370660
2544 Ga0530510_1141496
2545 2841942464
2546 8002870736

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11160

Hva1_TUDOR

Hypervirulence associated proteins TUDOR domain

22

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kd6-assembly2.cif.gz_D shuguo pwwp domain 0.8321 5 68
2f5k-assembly6.cif.gz_F crystal structure of the chromo domain of human mrg15 0.8215 3 68
6kco-assembly5.cif.gz_J shuguo pwwp in complex with ssdna 0.8192 3 68
6ie7-assembly1.cif.gz_A crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me2 0.8159 3 69
6ie4-assembly1.cif.gz_A crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me1 0.8047 2 69
ID Description Score Start End Superfamily
af_Q9FFA0_84_140_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8797 5 69 2.30.30.140
af_C4JC55_378_443_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8734 6 69 2.30.30.140
af_A0A0N7KQS4_223_284_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8444 6 69 2.30.30.140
af_C6KSV4_613_667_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8335 5 69 2.30.30.30
2do3A01 Mainly Beta;Roll;SH3 type barrels.; 0.833 6 69 2.30.30.30
ID Description Score Start End GO Terms
AF-W0RSF0-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 1.005 5 69
AF-A0A4R1V1S9-F1-model_v4 DUF2945 family protein 1.001 3 70
AF-A0A1V8RPF3-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 0.9953 2 70
AF-A0A0B3BMJ6-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 0.995 1 70
AF-A0A4U5JV76-F1-model_v4 DUF2945 domain-containing protein 0.9939 2 70

Map