F492244

General Info

Members Datasets Scaffolds Average Seq Length
1255 407 1225 123

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_11302261|Ga0207652_113022612
Length 140
Sequence MRRAGPTRLPDSNDAEPTVAIQKILIVDDSPTERYYLTDILVRNGFTVTTADNGEEALAKIRAERPELILMDVVMPGANGFQVTRSIARDPELASVPVIICSSKNQETDRIWGLRQGAKDYFVKPVDAAKLLATIATLGA

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738541357 Duganella sp. GV053 Isolate Unclassified
11 2738543003 Duganella sp. GV066 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
17 2818991436 Collimonas arenae 515 Isolate Unclassified
18 2821131069 Duganella sp. 1224 Isolate Unclassified
19 2842711865 Duganella sp. R-73148 Isolate Unclassified
20 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
21 2857553236 Duganella sp. R-74557 Isolate Unclassified
22 2857558681 Duganella sp. R-74565 Isolate Unclassified
23 2857564685 Duganella sp. R-74599 Isolate Unclassified
24 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
25 2904424332 Duganella sp. 1411 Isolate Rhizosphere
26 2919476304 Duganella sp. 3397 Isolate Unclassified
27 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
28 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
43 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
44 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
45 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
161 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
162 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
163 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
296 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
338 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
339 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
355 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
356 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
357 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
358 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
359 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
363 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
364 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
365 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
379 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
380 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
381 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
382 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
383 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
384 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
385 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
386 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
387 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
388 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
389 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
390 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
391 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
392 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
393 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
394 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
395 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
396 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 3.11
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.41
Nodule 0.32
Rhizoplane 4.46
Rhizosphere 82.31
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000032 3300002737 Bacteria 195871
2 JGI25154J39366_1000513 3300002738 Bacteria 19747
3 JGI25164J39214_1007684 3300002772 Bacteria 1090
4 JGI25159J45721_1000973 3300002987 Bacteria 12413
5 Ga0006759J45824_1059780 3300003163 Bacteria 1460
6 JGI25165J46597_1000067 3300003214 Bacteria 196411
7 rootL2_10006439 3300003322 Bacteria 1913
8 rootL2_10040613 3300003322 Bacteria 3667
9 Ga0007417J51691_1044202 3300003544 Bacteria 5029
10 Ga0007410J51695_1030958 3300003574 Bacteria 3281
11 Ga0007409J51694_1026388 3300003575 Bacteria 7628
12 Ga0007409J51694_1038762 3300003575 Bacteria 1280
13 Ga0007416J51690_1029738 3300003577 Bacteria 3741
14 Ga0007411J51799_114674 3300003611 Bacteria 1089
15 Ga0032354_1059071 3300003693 Bacteria 5445
16 Ga0055538_1000033 3300003751 Bacteria 195914
17 Ga0055539_1000045 3300003752 Bacteria 195316
18 Ga0055533_1000054 3300003756 Bacteria 195914
19 Ga0055525_1000009 3300003759 Bacteria 596899
20 Ga0055525_1000065 3300003759 Bacteria 195779
21 Ga0055542_1006607 3300003762 Bacteria 2459
22 Ga0055529_1000127 3300003763 Bacteria 109148
23 Ga0055526_1000111 3300003771 Bacteria 71834
24 Ga0055526_1000179 3300003771 Bacteria 56199
25 Ga0055526_1000556 3300003771 Bacteria 29488
26 Ga0055537_1000056 3300003773 Bacteria 81623
27 Ga0055524_1000029 3300003775 Bacteria 201332
28 Ga0055524_1002563 3300003775 Bacteria 9273
29 Ga0055524_1008643 3300003775 Bacteria 4215
30 Ga0055534_1000178 3300003784 Bacteria 46872
31 Ga0055528_1000297 3300003790 Bacteria 42261
32 Ga0055541_1000031 3300003841 Bacteria 195914
33 Ga0055543_1003240 3300004625 Bacteria 4926
34 Ga0065165_1000447 3300005262 Bacteria 64800
35 Ga0065165_1000986 3300005262 Bacteria 35247
36 Ga0065714_10159014 3300005288 Bacteria 1062
37 Ga0065714_10287985 3300005288 Bacteria 712
38 Ga0070658_10692533 3300005327 Bacteria 884
39 Ga0070658_11439988 3300005327 Bacteria 598
40 Ga0070670_100171357 3300005331 Bacteria 1883
41 Ga0070680_100278490 3300005336 Bacteria 1417
42 Ga0070680_100974658 3300005336 Bacteria 732
43 Ga0070682_100053028 3300005337 Bacteria 2540
44 Ga0070682_100060325 3300005337 Bacteria 2399
45 Ga0070660_100231247 3300005339 Bacteria 1504
46 Ga0070671_101808380 3300005355 Bacteria 543
47 Ga0070659_100047634 3300005366 Bacteria 3363
48 Ga0070659_100904427 3300005366 Bacteria 771
49 Ga0070663_101361576 3300005455 Bacteria 628
50 Ga0070662_100091440 3300005457 Bacteria 2285
51 Ga0070662_100404071 3300005457 Bacteria 1128
52 Ga0068867_101681342 3300005459 Bacteria 595
53 Ga0070679_100547407 3300005530 Bacteria 1101
54 Ga0070684_100280441 3300005535 Bacteria 1527
55 Ga0070672_101076794 3300005543 Bacteria 714
56 Ga0068855_100015626 3300005563 Bacteria 9133
57 Ga0070664_100117201 3300005564 Bacteria 2329
58 Ga0068856_100745090 3300005614 Bacteria 1000
59 Ga0068856_101872247 3300005614 Bacteria 611
60 Ga0068852_100370802 3300005616 Bacteria 1402
61 Ga0068852_101174441 3300005616 Unclassified 788
62 Ga0068866_10794180 3300005718 Bacteria 657
63 Ga0068862_101602608 3300005844 Bacteria 658
64 Ga0070717_10039351 3300006028 Bacteria 3847
65 Ga0075365_10062826 3300006038 Bacteria 2485
66 Ga0075368_10013167 3300006042 Bacteria 3034
67 Ga0075368_10286426 3300006042 Bacteria 709
68 Ga0075363_100001850 3300006048 Bacteria 8328
69 Ga0075363_101048368 3300006048 Bacteria 504
70 Ga0075364_10310718 3300006051 Bacteria 1073
71 Ga0070712_100044051 3300006175 Bacteria 3075
72 Ga0075362_10024716 3300006177 Bacteria 2550
73 Ga0075367_10002897 3300006178 Bacteria 7990
74 Ga0075367_10340463 3300006178 Bacteria 946
75 Ga0075369_10012102 3300006186 Bacteria 3403
76 Ga0075366_10183688 3300006195 Bacteria 1270
77 Ga0075366_10257561 3300006195 Bacteria 1065
78 Ga0097621_100749287 3300006237 Bacteria 902
79 Ga0075370_10027705 3300006353 Bacteria 3146
80 Ga0068871_101368744 3300006358 Bacteria 667
81 Ga0068865_100120533 3300006881 Bacteria 1950
82 Ga0068865_101089655 3300006881 Bacteria 703
83 Ga0079104_1004290 3300006946 Bacteria 6182
84 Ga0099826_10000003 3300006948 Bacteria 1067817
85 Ga0105244_10000592 3300009036 Bacteria 32509
86 Ga0105244_10049230 3300009036 Bacteria 2154
87 Ga0105240_10368684 3300009093 Bacteria 1624
88 Ga0105245_10059404 3300009098 Bacteria 3443
89 Ga0105243_10100026 3300009148 Bacteria 2405
90 Ga0105241_10082522 3300009174 Bacteria 2520
91 Ga0105238_10933962 3300009551 Bacteria 887
92 Ga0105239_10333714 3300010375 Bacteria 1711
93 Ga0157324_1017150 3300012506 Bacteria 697
94 Ga0157371_10360574 3300013102 Bacteria 1059
95 Ga0157371_10439294 3300013102 Bacteria 958
96 Ga0157371_10569972 3300013102 Bacteria 840
97 Ga0157374_10615179 3300013296 Bacteria 1097
98 Ga0163162_10124770 3300013306 Bacteria 2680
99 Ga0163162_13273630 3300013306 Bacteria 519
100 Ga0163163_11642229 3300014325 Bacteria 703
101 Ga0182008_10000621 3300014497 Bacteria 26047
102 Ga0182008_10160915 3300014497 Bacteria 1130
103 Ga0182006_1000046 3300015261 Bacteria 189544
104 Ga0182006_1000060 3300015261 Bacteria 161773
105 Ga0182006_1013996 3300015261 Bacteria 3464
106 Ga0182006_1024013 3300015261 Bacteria 2519
107 Ga0182007_10000044 3300015262 Bacteria 106301
108 Ga0182007_10038009 3300015262 Bacteria 1615
109 Ga0182007_10041014 3300015262 Bacteria 1544
110 Ga0182005_1000003 3300015265 Bacteria 683269
111 Ga0182005_1000032 3300015265 Bacteria 188517
112 Ga0182005_1001085 3300015265 Bacteria 11419
113 Ga0163161_10035625 3300017792 Bacteria 3562
114 Ga0163161_10035735 3300017792 Bacteria 3557
115 Ga0163161_10323043 3300017792 Bacteria 1221
116 Ga0213872_10001431 3300021361 Bacteria 15588
117 Ga0213872_10002203 3300021361 Bacteria 11688
118 Ga0213872_10218566 3300021361 Bacteria 811
119 Ga0213872_10374304 3300021361 Bacteria 581
120 Ga0209760_105228 3300025207 Bacteria 1076
121 Ga0209784_100048 3300025224 Bacteria 198885
122 Ga0209566_100060 3300025225 Bacteria 198885
123 Ga0209674_100082 3300025226 Bacteria 198885
124 Ga0209563_100015 3300025230 Bacteria 879901
125 Ga0209563_100082 3300025230 Bacteria 198750
126 Ga0207427_100350 3300025231 Bacteria 29506
127 Ga0209437_100125 3300025233 Bacteria 198146
128 Ga0209646_1000047 3300025246 Bacteria 323416
129 Ga0209026_1003099 3300025250 Bacteria 5672
130 Ga0209677_100046 3300025253 Bacteria 198287
131 Ga0209677_102235 3300025253 Bacteria 7507
132 Ga0209148_1005704 3300025254 Bacteria 2804
133 Ga0209233_1000138 3300025261 Bacteria 198287
134 Ga0209565_1000006 3300025263 Bacteria 897294
135 Ga0209565_1010682 3300025263 Bacteria 2269
136 Ga0209455_1000051 3300025272 Bacteria 369818
137 Ga0209673_1000004 3300025273 Bacteria 896155
138 Ga0209130_1000437 3300025284 Bacteria 44427
139 Ga0209675_1000006 3300025291 Bacteria 732267
140 Ga0209564_1000006 3300025295 Bacteria 1100927
141 Ga0209564_1000085 3300025295 Bacteria 251509
142 Ga0209564_1000595 3300025295 Bacteria 56670
143 Ga0209256_1000013 3300025299 Bacteria 689442
144 Ga0209256_1000179 3300025299 Bacteria 123865
145 Ga0207655_1015165 3300025728 Bacteria 4301
146 Ga0207655_1201680 3300025728 Bacteria 593
147 Ga0207642_10658476 3300025899 Bacteria 657
148 Ga0207645_10411928 3300025907 Bacteria 910
149 Ga0207705_10015714 3300025909 Bacteria 5435
150 Ga0207705_10085898 3300025909 Bacteria 2299
151 Ga0207654_10008535 3300025911 Bacteria 5187
152 Ga0207693_10706047 3300025915 Bacteria 781
153 Ga0207660_10532051 3300025917 Bacteria 955
154 Ga0207657_10032579 3300025919 Bacteria 4706
155 Ga0207657_10051467 3300025919 Bacteria 3580
156 Ga0207649_10099574 3300025920 Bacteria 1921
157 Ga0207652_11302261 3300025921 Bacteria 629
158 Ga0207694_10571020 3300025924 Bacteria 950
159 Ga0207650_10111729 3300025925 Bacteria 2116
160 Ga0207659_10457263 3300025926 Bacteria 1076
161 Ga0207690_10025340 3300025932 Bacteria 3722
162 Ga0207690_10102307 3300025932 Bacteria 2048
163 Ga0207706_10271623 3300025933 Bacteria 1479
164 Ga0207686_10195403 3300025934 Bacteria 1445
165 Ga0207709_10204473 3300025935 Bacteria 1413
166 Ga0207679_10028128 3300025945 Bacteria 3897
167 Ga0207679_10073620 3300025945 Bacteria 2585
168 Ga0207679_10167898 3300025945 Bacteria 1804
169 Ga0207667_10041977 3300025949 Bacteria 4864
170 Ga0207667_10559284 3300025949 Bacteria 1156
171 Ga0207640_10093311 3300025981 Bacteria 2091
172 Ga0207639_10235180 3300026041 Bacteria 1590
173 Ga0207678_10277906 3300026067 Bacteria 1437
174 Ga0207648_10127573 3300026089 Bacteria 2238
175 Ga0207674_10068251 3300026116 Bacteria 3578
176 Ga0207698_11045460 3300026142 Bacteria 828
177 Ga0209281_1001620 3300027111 Bacteria 12113
178 Ga0209282_1000002 3300027666 Bacteria 1067825
179 Ga0209813_10000697 3300027866 Bacteria 7670
180 Ga0307515_10199114 3300028794 Bacteria 1885
181 Ga0265324_10047655 3300029957 Bacteria 1474
182 Ga0307511_10006722 3300030521 Bacteria 11585
183 Ga0316177_1106398 3300030731 Bacteria 688
184 Ga0316177_1159616 3300030731 Bacteria 1416
185 Ga0316178_1107042 3300030735 Bacteria 855
186 Ga0316178_1137549 3300030735 Bacteria 654
187 Ga0316180_1181545 3300030736 Bacteria 4243
188 Ga0316181_1169984 3300030744 Bacteria 994
189 Ga0316182_1007163 3300030745 Bacteria 2668
190 Ga0316182_1057913 3300030745 Bacteria 740
191 Ga0316182_1106132 3300030745 Bacteria 1126
192 Ga0265332_10110874 3300031238 Bacteria 1156
193 Ga0265327_10031635 3300031251 Bacteria 2970
194 Ga0265316_10031234 3300031344 Bacteria 4358
195 Ga0265316_10304104 3300031344 Bacteria 1161
196 Ga0307513_10300546 3300031456 Bacteria 1372
197 Ga0307408_100000120 3300031548 Bacteria 85916
198 Ga0265314_10023296 3300031711 Bacteria 4723
199 Ga0265314_10151622 3300031711 Bacteria 1420
200 Ga0307518_10026109 3300031838 Bacteria 4215
201 Ga0307406_11107306 3300031901 Bacteria 684
202 Ga0307406_11391361 3300031901 Bacteria 615
203 Ga0307406_11422399 3300031901 Bacteria 608
204 Ga0307416_100009981 3300032002 Bacteria 6248
205 Ga0307416_100834297 3300032002 Bacteria 1019
206 Ga0307416_101745207 3300032002 Bacteria 727
207 Ga0307414_10255082 3300032004 Bacteria 1460
208 Ga0307414_11010506 3300032004 Bacteria 766
209 Ga0307411_10168806 3300032005 Bacteria 1648
210 Ga0307411_10852644 3300032005 Bacteria 806
211 Ga0307411_10972724 3300032005 Bacteria 758
212 Ga0307411_12074309 3300032005 Bacteria 532
213 Ga0307507_10188729 3300033179 Bacteria 1454
214 Ga0307507_10209430 3300033179 Bacteria 1332
215 Ga0373948_0173085 3300034817 Bacteria 550
216 Ga0373928_0094116 3300035084 Bacteria 773
217 Ga0373932_0431836 3300035112 Bacteria 514
218 Ga0373935_1471864 3300035692 Bacteria 510
219 Ga0395899_0000166 3300037312 Bacteria 101803
220 Ga0395899_0001004 3300037312 Bacteria 25887
221 Ga0395899_0004846 3300037312 Bacteria 10479
222 Ga0395899_0587398 3300037312 Bacteria 711
223 Ga0395900_0010881 3300037418 Bacteria 9303
224 Ga0395900_0032095 3300037418 Bacteria 5399
225 Ga0395900_0034117 3300037418 Bacteria 5238
226 Ga0395900_0151105 3300037418 Bacteria 2372
227 Ga0395900_0158171 3300037418 Bacteria 2313
228 Ga0395900_0594508 3300037418 Bacteria 1047
229 Ga0395900_0629851 3300037418 Bacteria 1011
230 Ga0395898_0039718 3300037466 Bacteria 4656
231 Ga0395898_0070994 3300037466 Bacteria 3365
232 Ga0395898_0108068 3300037466 Bacteria 2667
233 Ga0395898_1215609 3300037466 Bacteria 684
234 Ga0395898_1257169 3300037466 Bacteria 670
235 Ga0395898_1956637 3300037466 Bacteria 506
236 Ga0395905_0000256 3300037471 Bacteria 79866
237 Ga0395905_0003267 3300037471 Bacteria 17431
238 Ga0395905_0039759 3300037471 Bacteria 4413
239 Ga0395905_0041247 3300037471 Bacteria 4331
240 Ga0395905_0102715 3300037471 Bacteria 2684
241 Ga0395905_0149327 3300037471 Bacteria 2199
242 Ga0395905_0157363 3300037471 Bacteria 2136
243 Ga0395905_0181758 3300037471 Bacteria 1975
244 Ga0395905_0427291 3300037471 Bacteria 1221
245 Ga0395905_0457460 3300037471 Bacteria 1174
246 Ga0395905_0694765 3300037471 Bacteria 919
247 Ga0395901_0000596 3300038443 Bacteria 42123
248 Ga0395901_0001017 3300038443 Bacteria 30361
249 Ga0395901_0018415 3300038443 Bacteria 7128
250 Ga0395901_0018801 3300038443 Bacteria 7061
251 Ga0395901_0110860 3300038443 Bacteria 2881
252 Ga0395901_0433649 3300038443 Bacteria 1346
253 Ga0395901_0530107 3300038443 Bacteria 1195
254 Ga0395901_0867670 3300038443 Bacteria 886
255 Ga0395901_1381318 3300038443 Bacteria 663
256 Ga0436361_0008388 3300039447 Bacteria 869
257 Ga0436361_0080684 3300039447 Bacteria 1293
258 Ga0436361_0330066 3300039447 Bacteria 1222
259 Ga0436361_0766678 3300039447 Bacteria 642
260 Ga0436361_0811061 3300039447 Bacteria 135576
261 Ga0436361_0878062 3300039447 Bacteria 3667
262 Ga0451841_0939562 3300041498 Bacteria 550
263 Ga0439431_0200760 3300041997 Bacteria 581
264 Ga0439448_0040821 3300042005 Bacteria 1499
265 Ga0439449_0139118 3300042007 Bacteria 903
266 Ga0439455_0045037 3300042012 Bacteria 1139
267 Ga0439455_0122181 3300042012 Bacteria 730
268 Ga0450904_000069 3300042139 Bacteria 23065
269 Ga0450906_041782 3300042145 Bacteria 809
270 Ga0439458_0029697 3300042157 Bacteria 1298
271 Ga0439458_0070312 3300042157 Bacteria 883
272 Ga0439458_0187047 3300042157 Bacteria 563
273 Ga0450893_0042705 3300042532 Bacteria 834
274 Ga0451577_0009412 3300042876 Bacteria 9416
275 Ga0451577_0009848 3300042876 Bacteria 9156
276 Ga0451577_0033893 3300042876 Bacteria 4604
277 Ga0466969_0090918 3300044656 Bacteria 1446
278 Ga0466969_0362602 3300044656 Bacteria 656
279 Ga0466972_0000029 3300044658 Bacteria 165236
280 Ga0466972_0012159 3300044658 Bacteria 4325
281 Ga0453683_0119321 3300044673 Bacteria 1660
282 Ga0466965_0000755 3300044683 Bacteria 12148
283 Ga0466965_0014568 3300044683 Bacteria 3723
284 Ga0466965_0081527 3300044683 Bacteria 1636
285 Ga0466965_0249649 3300044683 Bacteria 951
286 Ga0466966_0052723 3300044684 Bacteria 2582
287 Ga0466966_0058873 3300044684 Bacteria 2427
288 Ga0466966_0209722 3300044684 Bacteria 1177
289 Ga0466966_0345283 3300044684 Bacteria 894
290 Ga0466961_0127140 3300044693 Bacteria 1598
291 Ga0466964_0001533 3300044706 Bacteria 7950
292 Ga0466964_0005240 3300044706 Bacteria 4807
293 Ga0466964_0015479 3300044706 Bacteria 2903
294 Ga0466964_0061461 3300044706 Bacteria 1564
295 Ga0453684_0002983 3300044712 Bacteria 39454
296 Ga0453684_0039091 3300044712 Bacteria 6471
297 Ga0453684_0056340 3300044712 Bacteria 5099
298 Ga0453684_0100408 3300044712 Bacteria 3542
299 Ga0453684_0117152 3300044712 Bacteria 3224
300 Ga0453684_1935268 3300044712 Bacteria 596
301 Ga0453684_1975273 3300044712 Bacteria 588
302 Ga0466971_0083280 3300044719 Bacteria 1460
303 Ga0466971_0270338 3300044719 Bacteria 812
304 Ga0466968_0107668 3300044735 Bacteria 1250
305 Ga0466968_0164483 3300044735 Bacteria 1025
306 Ga0466968_0317123 3300044735 Bacteria 752
307 Ga0466968_0419271 3300044735 Bacteria 658
308 Ga0466968_0569446 3300044735 Bacteria 570
309 Ga0466968_0683227 3300044735 Bacteria 523
310 Ga0466970_0127077 3300044765 Bacteria 1398
311 Ga0466957_0002203 3300044842 Bacteria 10445
312 Ga0466957_0168033 3300044842 Bacteria 1427
313 Ga0466957_0820527 3300044842 Bacteria 661
314 Ga0466960_0077963 3300044901 Bacteria 1663
315 Ga0466960_0574437 3300044901 Bacteria 667
316 Ga0466959_0027687 3300045049 Bacteria 4203
317 Ga0466959_0045456 3300045049 Bacteria 3233
318 Ga0466959_0132453 3300045049 Bacteria 1766
319 Ga0466959_0587628 3300045049 Bacteria 749
320 Ga0466959_0989054 3300045049 Bacteria 560
321 Ga0451576_0000621 3300045051 Bacteria 74139
322 Ga0451576_0557944 3300045051 Bacteria 1203
323 Ga0466958_0034211 3300045836 Bacteria 3030
324 Ga0466958_0672138 3300045836 Bacteria 674
325 Ga0466967_0067081 3300045976 Bacteria 3199
326 Ga0466967_0091988 3300045976 Bacteria 2757
327 Ga0466967_0251181 3300045976 Bacteria 1689
328 Ga0466967_0952414 3300045976 Bacteria 854
329 Ga0495617_000002 3300046452 Bacteria 710121
330 Ga0495617_000056 3300046452 Bacteria 100802
331 Ga0495617_000682 3300046452 Bacteria 16995
332 Ga0495617_013062 3300046452 Bacteria 2829
333 Ga0495617_019432 3300046452 Bacteria 2297
334 Ga0495617_074501 3300046452 Bacteria 1114
335 Ga0495617_123118 3300046452 Bacteria 834
336 Ga0495627_000016 3300046453 Bacteria 318947
337 Ga0495627_000500 3300046453 Bacteria 32825
338 Ga0495627_002924 3300046453 Bacteria 7848
339 Ga0495627_010880 3300046453 Bacteria 3287
340 Ga0495603_0003211 3300046455 Bacteria 9729
341 Ga0495603_0035395 3300046455 Bacteria 2999
342 Ga0495590_0000007 3300046457 Bacteria 331108
343 Ga0495590_0000035 3300046457 Bacteria 129481
344 Ga0495590_0000635 3300046457 Bacteria 16312
345 Ga0495590_0002506 3300046457 Bacteria 7597
346 Ga0495590_0012687 3300046457 Bacteria 3120
347 Ga0495590_0162028 3300046457 Bacteria 813
348 Ga0495591_001122 3300046458 Bacteria 17673
349 Ga0495629_0043536 3300046459 Bacteria 3151
350 Ga0495629_0048948 3300046459 Bacteria 2963
351 Ga0495638_0000172 3300046460 Bacteria 100572
352 Ga0495638_0001511 3300046460 Bacteria 20931
353 Ga0495638_0013415 3300046460 Bacteria 5579
354 Ga0495638_0014106 3300046460 Bacteria 5411
355 Ga0495638_0015707 3300046460 Bacteria 5078
356 Ga0495638_0021145 3300046460 Bacteria 4292
357 Ga0495638_0024993 3300046460 Bacteria 3888
358 Ga0495638_0054488 3300046460 Bacteria 2486
359 Ga0495638_0182910 3300046460 Bacteria 1194
360 Ga0495638_0213565 3300046460 Bacteria 1082
361 Ga0495638_0461762 3300046460 Bacteria 646
362 Ga0495638_0634028 3300046460 Bacteria 521
363 Ga0495651_0000518 3300046462 Bacteria 30011
364 Ga0495651_0047755 3300046462 Bacteria 3307
365 Ga0495653_0000007 3300046463 Bacteria 314281
366 Ga0495653_0831233 3300046463 Bacteria 553
367 Ga0495650_0000056 3300046471 Bacteria 307565
368 Ga0495650_0000105 3300046471 Bacteria 205855
369 Ga0495650_0000551 3300046471 Bacteria 53445
370 Ga0495650_0000969 3300046471 Bacteria 32892
371 Ga0495650_0000987 3300046471 Bacteria 32422
372 Ga0495650_0002049 3300046471 Bacteria 17565
373 Ga0495650_0008835 3300046471 Bacteria 5819
374 Ga0495650_0020424 3300046471 Bacteria 3230
375 Ga0495650_0026101 3300046471 Bacteria 2724
376 Ga0495650_0034292 3300046471 Bacteria 2248
377 Ga0495650_0040617 3300046471 Bacteria 1995
378 Ga0495650_0043627 3300046471 Bacteria 1901
379 Ga0495580_0294000 3300046472 Bacteria 1107
380 Ga0495582_0006590 3300046473 Bacteria 6446
381 Ga0495605_0000015 3300046474 Bacteria 300227
382 Ga0495605_0000085 3300046474 Bacteria 121011
383 Ga0495605_0000108 3300046474 Bacteria 104865
384 Ga0495605_0002293 3300046474 Bacteria 11946
385 Ga0495605_0006435 3300046474 Bacteria 6751
386 Ga0495605_0016364 3300046474 Bacteria 4014
387 Ga0495605_0027714 3300046474 Bacteria 2932
388 Ga0495605_0031339 3300046474 Bacteria 2717
389 Ga0495605_0039435 3300046474 Bacteria 2366
390 Ga0495605_0050389 3300046474 Bacteria 2031
391 Ga0495605_0071108 3300046474 Bacteria 1644
392 Ga0495605_0090102 3300046474 Bacteria 1422
393 Ga0495605_0094903 3300046474 Bacteria 1377
394 Ga0495605_0114319 3300046474 Bacteria 1229
395 Ga0495605_0359683 3300046474 Bacteria 609
396 Ga0495605_0367577 3300046474 Bacteria 601
397 Ga0495605_0433117 3300046474 Bacteria 543
398 Ga0495639_0062346 3300046475 Bacteria 1710
399 Ga0495664_0143309 3300046477 Bacteria 1449
400 Ga0495584_0000022 3300046491 Bacteria 128471
401 Ga0495584_0001018 3300046491 Bacteria 17514
402 Ga0495584_0001378 3300046491 Bacteria 14650
403 Ga0495584_0002257 3300046491 Bacteria 10991
404 Ga0495584_0013733 3300046491 Bacteria 4130
405 Ga0495584_0024354 3300046491 Bacteria 3069
406 Ga0495584_0025290 3300046491 Bacteria 3010
407 Ga0495584_0028581 3300046491 Bacteria 2826
408 Ga0495584_0034985 3300046491 Bacteria 2539
409 Ga0495584_0040894 3300046491 Bacteria 2340
410 Ga0495584_0042872 3300046491 Bacteria 2284
411 Ga0495584_0060194 3300046491 Bacteria 1909
412 Ga0495584_0082672 3300046491 Bacteria 1616
413 Ga0495584_0114091 3300046491 Bacteria 1367
414 Ga0495584_0115860 3300046491 Bacteria 1356
415 Ga0495584_0198283 3300046491 Bacteria 1020
416 Ga0495585_0000004 3300046492 Bacteria 348260
417 Ga0495585_0000332 3300046492 Bacteria 46071
418 Ga0495585_0000525 3300046492 Bacteria 36200
419 Ga0495585_0000788 3300046492 Bacteria 27947
420 Ga0495585_0000921 3300046492 Bacteria 24893
421 Ga0495585_0002433 3300046492 Bacteria 13336
422 Ga0495585_0006621 3300046492 Bacteria 7159
423 Ga0495585_0015644 3300046492 Bacteria 4405
424 Ga0495585_0017551 3300046492 Bacteria 4134
425 Ga0495585_0018403 3300046492 Bacteria 4029
426 Ga0495585_0020042 3300046492 Bacteria 3847
427 Ga0495585_0039006 3300046492 Bacteria 2671
428 Ga0495585_0049893 3300046492 Bacteria 2322
429 Ga0495585_0053657 3300046492 Bacteria 2230
430 Ga0495585_0063602 3300046492 Bacteria 2025
431 Ga0495585_0077260 3300046492 Bacteria 1807
432 Ga0495585_0108152 3300046492 Bacteria 1481
433 Ga0495585_0123437 3300046492 Bacteria 1368
434 Ga0495585_0137331 3300046492 Bacteria 1282
435 Ga0495585_0142471 3300046492 Bacteria 1254
436 Ga0495585_0193394 3300046492 Bacteria 1039
437 Ga0495585_0245269 3300046492 Bacteria 895
438 Ga0495585_0425343 3300046492 Bacteria 637
439 Ga0495585_0554916 3300046492 Bacteria 542
440 Ga0495594_0003312 3300046499 Bacteria 8331
441 Ga0495594_0015227 3300046499 Bacteria 4039
442 Ga0495594_0058384 3300046499 Bacteria 2131
443 Ga0495594_0193612 3300046499 Bacteria 1158
444 Ga0495594_0296826 3300046499 Bacteria 921
445 Ga0495594_0306613 3300046499 Bacteria 904
446 Ga0495596_0001322 3300046500 Bacteria 14272
447 Ga0495596_0002806 3300046500 Bacteria 9129
448 Ga0495596_0002844 3300046500 Bacteria 9041
449 Ga0495596_0005233 3300046500 Bacteria 6164
450 Ga0495596_0007034 3300046500 Bacteria 5110
451 Ga0495596_0009536 3300046500 Bacteria 4266
452 Ga0495596_0012656 3300046500 Bacteria 3604
453 Ga0495596_0024991 3300046500 Bacteria 2416
454 Ga0495596_0026244 3300046500 Bacteria 2348
455 Ga0495596_0027166 3300046500 Bacteria 2303
456 Ga0495596_0034057 3300046500 Bacteria 2024
457 Ga0495596_0059605 3300046500 Bacteria 1487
458 Ga0495607_0000834 3300046501 Bacteria 29098
459 Ga0495607_0002950 3300046501 Bacteria 13369
460 Ga0495607_0004212 3300046501 Bacteria 10675
461 Ga0495607_0006375 3300046501 Bacteria 8307
462 Ga0495607_0013188 3300046501 Bacteria 5426
463 Ga0495607_0019251 3300046501 Bacteria 4338
464 Ga0495607_0026032 3300046501 Bacteria 3632
465 Ga0495607_0031657 3300046501 Bacteria 3236
466 Ga0495607_0040218 3300046501 Bacteria 2785
467 Ga0495607_0057670 3300046501 Bacteria 2224
468 Ga0495607_0065107 3300046501 Bacteria 2056
469 Ga0495607_0082114 3300046501 Bacteria 1769
470 Ga0495607_0086630 3300046501 Bacteria 1707
471 Ga0495607_0094087 3300046501 Bacteria 1617
472 Ga0495607_0164068 3300046501 Bacteria 1126
473 Ga0495607_0204921 3300046501 Bacteria 973
474 Ga0495607_0265911 3300046501 Bacteria 819
475 Ga0495607_0475618 3300046501 Bacteria 557
476 Ga0495583_0000004 3300046506 Bacteria 655287
477 Ga0495583_0000257 3300046506 Bacteria 87964
478 Ga0495583_0000892 3300046506 Bacteria 35776
479 Ga0495583_0000901 3300046506 Bacteria 35351
480 Ga0495583_0001085 3300046506 Bacteria 30173
481 Ga0495583_0001376 3300046506 Bacteria 24969
482 Ga0495583_0002774 3300046506 Bacteria 14445
483 Ga0495583_0002793 3300046506 Bacteria 14371
484 Ga0495583_0006861 3300046506 Bacteria 7334
485 Ga0495583_0014846 3300046506 Bacteria 4267
486 Ga0495583_0016280 3300046506 Bacteria 4006
487 Ga0495583_0033635 3300046506 Bacteria 2464
488 Ga0495583_0046827 3300046506 Bacteria 1992
489 Ga0495583_0052777 3300046506 Bacteria 1847
490 Ga0495583_0139200 3300046506 Bacteria 1011
491 Ga0495583_0218046 3300046506 Bacteria 771
492 Ga0495583_0239944 3300046506 Bacteria 728
493 Ga0495606_0000673 3300046507 Bacteria 53474
494 Ga0495606_0000690 3300046507 Bacteria 52411
495 Ga0495606_0000739 3300046507 Bacteria 50567
496 Ga0495606_0001449 3300046507 Bacteria 31793
497 Ga0495606_0001991 3300046507 Bacteria 25186
498 Ga0495606_0005173 3300046507 Bacteria 12619
499 Ga0495606_0005986 3300046507 Bacteria 11400
500 Ga0495606_0009760 3300046507 Bacteria 8072
501 Ga0495606_0014554 3300046507 Bacteria 6125
502 Ga0495606_0016068 3300046507 Bacteria 5729
503 Ga0495606_0034215 3300046507 Bacteria 3490
504 Ga0495606_0064873 3300046507 Bacteria 2322
505 Ga0495606_0098452 3300046507 Bacteria 1784
506 Ga0495606_0165837 3300046507 Bacteria 1285
507 Ga0495606_0244541 3300046507 Bacteria 998
508 Ga0495606_0299442 3300046507 Bacteria 872
509 Ga0495606_0502114 3300046507 Bacteria 612
510 Ga0495608_0003892 3300046511 Bacteria 10732
511 Ga0495608_0179371 3300046511 Bacteria 1340
512 Ga0495610_0000004 3300046512 Bacteria 1006135
513 Ga0495610_0000488 3300046512 Bacteria 40459
514 Ga0495610_0003150 3300046512 Bacteria 13096
515 Ga0495610_0003558 3300046512 Bacteria 12062
516 Ga0495610_0040873 3300046512 Bacteria 2332
517 Ga0495610_0045311 3300046512 Bacteria 2177
518 Ga0495616_0000127 3300046513 Bacteria 66628
519 Ga0495616_0001387 3300046513 Bacteria 16877
520 Ga0495616_0002964 3300046513 Bacteria 11024
521 Ga0495616_0004969 3300046513 Bacteria 8300
522 Ga0495616_0006336 3300046513 Bacteria 7174
523 Ga0495616_0009563 3300046513 Bacteria 5659
524 Ga0495616_0011632 3300046513 Bacteria 5033
525 Ga0495616_0014397 3300046513 Bacteria 4427
526 Ga0495616_0018680 3300046513 Bacteria 3800
527 Ga0495616_0018693 3300046513 Bacteria 3797
528 Ga0495616_0026088 3300046513 Bacteria 3115
529 Ga0495616_0077252 3300046513 Bacteria 1598
530 Ga0495616_0172171 3300046513 Bacteria 967
531 Ga0495616_0196940 3300046513 Bacteria 887
532 Ga0495616_0273190 3300046513 Bacteria 720
533 Ga0495618_0001670 3300046514 Bacteria 14753
534 Ga0495620_0002814 3300046515 Bacteria 10001
535 Ga0495620_0123506 3300046515 Bacteria 1019
536 Ga0495628_0001597 3300046516 Bacteria 20781
537 Ga0495628_0071755 3300046516 Bacteria 2698
538 Ga0495631_0001340 3300046518 Bacteria 15068
539 Ga0495631_0007825 3300046518 Bacteria 5418
540 Ga0495631_0011904 3300046518 Bacteria 4265
541 Ga0495631_0016471 3300046518 Bacteria 3522
542 Ga0495631_0017741 3300046518 Bacteria 3360
543 Ga0495631_0021740 3300046518 Bacteria 2986
544 Ga0495631_0028009 3300046518 Bacteria 2573
545 Ga0495631_0029961 3300046518 Bacteria 2472
546 Ga0495631_0044461 3300046518 Bacteria 1956
547 Ga0495631_0326057 3300046518 Bacteria 653
548 Ga0495632_0000528 3300046519 Bacteria 36092
549 Ga0495632_0001000 3300046519 Bacteria 24627
550 Ga0495632_0003333 3300046519 Bacteria 11452
551 Ga0495632_0004780 3300046519 Bacteria 9119
552 Ga0495632_0009739 3300046519 Bacteria 5760
553 Ga0495632_0023994 3300046519 Bacteria 3247
554 Ga0495632_0033718 3300046519 Bacteria 2626
555 Ga0495632_0123448 3300046519 Bacteria 1208
556 Ga0495637_0000006 3300046520 Bacteria 435763
557 Ga0495637_0001248 3300046520 Bacteria 15384
558 Ga0495637_0001537 3300046520 Bacteria 13464
559 Ga0495637_0005830 3300046520 Bacteria 6235
560 Ga0495637_0026602 3300046520 Bacteria 2594
561 Ga0495637_0122791 3300046520 Bacteria 998
562 Ga0495643_0000310 3300046522 Bacteria 67156
563 Ga0495643_0000913 3300046522 Bacteria 31100
564 Ga0495643_0001020 3300046522 Bacteria 28577
565 Ga0495643_0001894 3300046522 Bacteria 17681
566 Ga0495643_0003186 3300046522 Bacteria 12189
567 Ga0495643_0003449 3300046522 Bacteria 11563
568 Ga0495643_0007599 3300046522 Bacteria 6969
569 Ga0495643_0011313 3300046522 Bacteria 5439
570 Ga0495643_0016610 3300046522 Bacteria 4323
571 Ga0495643_0023625 3300046522 Bacteria 3492
572 Ga0495643_0027069 3300046522 Bacteria 3227
573 Ga0495643_0027905 3300046522 Bacteria 3168
574 Ga0495643_0034089 3300046522 Bacteria 2811
575 Ga0495643_0034399 3300046522 Bacteria 2797
576 Ga0495643_0233991 3300046522 Bacteria 865
577 Ga0495644_0003634 3300046523 Bacteria 6076
578 Ga0495644_0006629 3300046523 Bacteria 4486
579 Ga0495644_0008058 3300046523 Bacteria 4052
580 Ga0495644_0010942 3300046523 Bacteria 3496
581 Ga0495644_0012694 3300046523 Bacteria 3238
582 Ga0495644_0014324 3300046523 Bacteria 3039
583 Ga0495644_0017417 3300046523 Bacteria 2747
584 Ga0495644_0019651 3300046523 Bacteria 2579
585 Ga0495644_0046800 3300046523 Bacteria 1625
586 Ga0495644_0158585 3300046523 Bacteria 867
587 Ga0495644_0305778 3300046523 Bacteria 622
588 Ga0495648_0000035 3300046524 Bacteria 196251
589 Ga0495648_0000044 3300046524 Bacteria 175587
590 Ga0495648_0001087 3300046524 Bacteria 27651
591 Ga0495648_0008151 3300046524 Bacteria 8271
592 Ga0495648_0008826 3300046524 Bacteria 7887
593 Ga0495648_0008883 3300046524 Bacteria 7854
594 Ga0495648_0010078 3300046524 Bacteria 7240
595 Ga0495648_0039687 3300046524 Bacteria 2993
596 Ga0495648_0045418 3300046524 Bacteria 2732
597 Ga0495648_0059065 3300046524 Bacteria 2290
598 Ga0495648_0064059 3300046524 Bacteria 2167
599 Ga0495648_0073126 3300046524 Bacteria 1980
600 Ga0495648_0089492 3300046524 Bacteria 1727
601 Ga0495648_0113466 3300046524 Bacteria 1469
602 Ga0495648_0115750 3300046524 Bacteria 1450
603 Ga0495663_0003747 3300046525 Bacteria 4335
604 Ga0495663_0007261 3300046525 Bacteria 3057
605 Ga0495663_0010314 3300046525 Bacteria 2597
606 Ga0495663_0014881 3300046525 Bacteria 2186
607 Ga0495663_0338524 3300046525 Bacteria 546
608 Ga0495666_0005259 3300046526 Bacteria 6527
609 Ga0495666_0076370 3300046526 Bacteria 1588
610 Ga0495642_0001209 3300046528 Bacteria 11871
611 Ga0495642_0001334 3300046528 Bacteria 11044
612 Ga0495642_0003266 3300046528 Bacteria 6416
613 Ga0495642_0004181 3300046528 Bacteria 5625
614 Ga0495642_0005739 3300046528 Bacteria 4761
615 Ga0495642_0006318 3300046528 Bacteria 4543
616 Ga0495642_0007043 3300046528 Bacteria 4315
617 Ga0495642_0008667 3300046528 Bacteria 3886
618 Ga0495642_0020970 3300046528 Bacteria 2568
619 Ga0495642_0024065 3300046528 Bacteria 2407
620 Ga0495642_0031286 3300046528 Bacteria 2133
621 Ga0495642_0044223 3300046528 Bacteria 1817
622 Ga0495642_0045035 3300046528 Bacteria 1802
623 Ga0495642_0050089 3300046528 Bacteria 1716
624 Ga0495642_0052815 3300046528 Bacteria 1674
625 Ga0495642_0071236 3300046528 Bacteria 1454
626 Ga0495642_0092942 3300046528 Bacteria 1278
627 Ga0495642_0111903 3300046528 Bacteria 1168
628 Ga0495642_0145842 3300046528 Bacteria 1023
629 Ga0495642_0213213 3300046528 Bacteria 842
630 Ga0495642_0289236 3300046528 Bacteria 717
631 Ga0495652_0017904 3300046529 Bacteria 6323
632 Ga0495652_0034379 3300046529 Bacteria 4417
633 Ga0495652_0267126 3300046529 Bacteria 1259
634 Ga0495654_0000005 3300046530 Bacteria 491381
635 Ga0495654_0006447 3300046530 Bacteria 6668
636 Ga0495654_0007512 3300046530 Bacteria 6086
637 Ga0495654_0010968 3300046530 Bacteria 4921
638 Ga0495654_0062130 3300046530 Bacteria 1791
639 Ga0495654_0067120 3300046530 Bacteria 1708
640 Ga0495654_0093499 3300046530 Bacteria 1392
641 Ga0495654_0250639 3300046530 Bacteria 737
642 Ga0495654_0283101 3300046530 Bacteria 681
643 Ga0495654_0323196 3300046530 Bacteria 625
644 Ga0495654_0326493 3300046530 Bacteria 621
645 Ga0495665_0025869 3300046531 Bacteria 3152
646 Ga0495640_0239436 3300046533 Bacteria 1139
647 Ga0495586_0001037 3300046535 Bacteria 15692
648 Ga0495598_0044705 3300046537 Bacteria 1309
649 Ga0495598_0216947 3300046537 Bacteria 697
650 Ga0495609_0000263 3300046538 Bacteria 49427
651 Ga0495609_0000522 3300046538 Bacteria 30810
652 Ga0495609_0001703 3300046538 Bacteria 14253
653 Ga0495609_0002206 3300046538 Bacteria 12199
654 Ga0495609_0006315 3300046538 Bacteria 6060
655 Ga0495609_0008047 3300046538 Bacteria 5197
656 Ga0495609_0008083 3300046538 Bacteria 5184
657 Ga0495609_0009501 3300046538 Bacteria 4704
658 Ga0495609_0013741 3300046538 Bacteria 3817
659 Ga0495609_0016289 3300046538 Bacteria 3463
660 Ga0495609_0021554 3300046538 Bacteria 2973
661 Ga0495609_0028846 3300046538 Bacteria 2530
662 Ga0495609_0038164 3300046538 Bacteria 2166
663 Ga0495609_0061253 3300046538 Bacteria 1662
664 Ga0495609_0066519 3300046538 Bacteria 1587
665 Ga0495609_0097307 3300046538 Bacteria 1276
666 Ga0495609_0125001 3300046538 Bacteria 1104
667 Ga0495609_0154109 3300046538 Bacteria 976
668 Ga0495609_0305392 3300046538 Bacteria 647
669 Ga0495621_0003609 3300046539 Bacteria 4275
670 Ga0495621_0018927 3300046539 Bacteria 2243
671 Ga0495621_0078933 3300046539 Bacteria 1225
672 Ga0495597_0000661 3300046542 Bacteria 28057
673 Ga0495597_0002790 3300046542 Bacteria 10737
674 Ga0495597_0009992 3300046542 Bacteria 4661
675 Ga0495597_0010760 3300046542 Bacteria 4457
676 Ga0495597_0015475 3300046542 Bacteria 3611
677 Ga0495597_0041789 3300046542 Bacteria 2046
678 Ga0495597_0065319 3300046542 Bacteria 1578
679 Ga0495597_0068246 3300046542 Bacteria 1536
680 Ga0495597_0071296 3300046542 Bacteria 1496
681 Ga0495597_0123067 3300046542 Bacteria 1080
682 Ga0495597_0142340 3300046542 Bacteria 988
683 Ga0495597_0147927 3300046542 Bacteria 965
684 Ga0495597_0240248 3300046542 Bacteria 714
685 Ga0495597_0268814 3300046542 Bacteria 666
686 Ga0495645_0001078 3300046543 Bacteria 18519
687 Ga0495645_0094871 3300046543 Bacteria 2127
688 Ga0495645_0499661 3300046543 Bacteria 760
689 Ga0495622_0000007 3300046557 Bacteria 239352
690 Ga0495622_0000647 3300046557 Bacteria 19881
691 Ga0495622_0012715 3300046557 Bacteria 3902
692 Ga0495622_0023641 3300046557 Bacteria 2866
693 Ga0495622_0043181 3300046557 Bacteria 2096
694 Ga0495622_0206844 3300046557 Bacteria 873
695 Ga0495633_0001178 3300046558 Bacteria 21003
696 Ga0495633_0001517 3300046558 Bacteria 17953
697 Ga0495633_0001537 3300046558 Bacteria 17720
698 Ga0495633_0001997 3300046558 Bacteria 14769
699 Ga0495633_0003566 3300046558 Bacteria 10287
700 Ga0495633_0003570 3300046558 Bacteria 10283
701 Ga0495633_0004499 3300046558 Bacteria 8833
702 Ga0495633_0006255 3300046558 Bacteria 7103
703 Ga0495633_0007718 3300046558 Bacteria 6154
704 Ga0495633_0009406 3300046558 Bacteria 5402
705 Ga0495633_0011366 3300046558 Bacteria 4802
706 Ga0495633_0011677 3300046558 Bacteria 4717
707 Ga0495633_0011725 3300046558 Bacteria 4706
708 Ga0495633_0013595 3300046558 Bacteria 4282
709 Ga0495633_0027396 3300046558 Bacteria 2786
710 Ga0495633_0032989 3300046558 Bacteria 2498
711 Ga0495633_0044205 3300046558 Bacteria 2111
712 Ga0495633_0083044 3300046558 Bacteria 1490
713 Ga0495633_0109516 3300046558 Bacteria 1280
714 Ga0495633_0140074 3300046558 Bacteria 1118
715 Ga0495633_0214205 3300046558 Bacteria 882
716 Ga0495656_0008255 3300046615 Bacteria 3713
717 Ga0495656_0070551 3300046615 Bacteria 1550
718 Ga0495656_0081229 3300046615 Bacteria 1463
719 Ga0495656_0104595 3300046615 Bacteria 1314
720 Ga0495656_0175050 3300046615 Bacteria 1051
721 Ga0495656_0194495 3300046615 Bacteria 1003
722 Ga0495656_0354871 3300046615 Bacteria 760
723 Ga0495656_0475357 3300046615 Bacteria 660
724 Ga0495668_0000049 3300046616 Bacteria 217657
725 Ga0495668_0000870 3300046616 Bacteria 34075
726 Ga0495668_0001126 3300046616 Bacteria 27544
727 Ga0495668_0001558 3300046616 Bacteria 21752
728 Ga0495668_0001735 3300046616 Bacteria 20052
729 Ga0495668_0001791 3300046616 Bacteria 19626
730 Ga0495668_0001845 3300046616 Bacteria 19083
731 Ga0495668_0003170 3300046616 Bacteria 12655
732 Ga0495668_0003180 3300046616 Bacteria 12604
733 Ga0495668_0021374 3300046616 Bacteria 3711
734 Ga0495668_0023008 3300046616 Bacteria 3558
735 Ga0495668_0029327 3300046616 Bacteria 3109
736 Ga0495668_0038466 3300046616 Bacteria 2672
737 Ga0495668_0053620 3300046616 Bacteria 2229
738 Ga0495668_0088368 3300046616 Bacteria 1699
739 Ga0495668_0091515 3300046616 Bacteria 1666
740 Ga0495668_0104988 3300046616 Bacteria 1545
741 Ga0495668_0120982 3300046616 Bacteria 1432
742 Ga0495668_0169135 3300046616 Bacteria 1197
743 Ga0495668_0571838 3300046616 Bacteria 624
744 Ga0495668_0775091 3300046616 Bacteria 531
745 Ga0495634_0275964 3300046642 Bacteria 1022
746 Ga0495634_0278362 3300046642 Bacteria 1017
747 Ga0495611_0000309 3300046648 Bacteria 33038
748 Ga0495611_0001713 3300046648 Bacteria 10645
749 Ga0495611_0017683 3300046648 Bacteria 3052
750 Ga0495611_0020206 3300046648 Bacteria 2865
751 Ga0495611_0069993 3300046648 Bacteria 1603
752 Ga0495611_0129245 3300046648 Bacteria 1178
753 Ga0495611_0131030 3300046648 Bacteria 1169
754 Ga0495611_0134353 3300046648 Bacteria 1154
755 Ga0495611_0136846 3300046648 Bacteria 1143
756 Ga0495611_0138632 3300046648 Bacteria 1135
757 Ga0495611_0250175 3300046648 Bacteria 821
758 Ga0495625_0002475 3300046660 Bacteria 19915
759 Ga0495625_0003554 3300046660 Bacteria 15381
760 Ga0495625_0004968 3300046660 Bacteria 12362
761 Ga0495625_0007783 3300046660 Bacteria 9250
762 Ga0495625_0010369 3300046660 Bacteria 7717
763 Ga0495625_0012192 3300046660 Bacteria 6972
764 Ga0495625_0021346 3300046660 Bacteria 4988
765 Ga0495625_0022981 3300046660 Bacteria 4770
766 Ga0495625_0232184 3300046660 Bacteria 1204
767 Ga0495625_0236363 3300046660 Bacteria 1191
768 Ga0495625_0478164 3300046660 Bacteria 765
769 Ga0495625_0479896 3300046660 Bacteria 763
770 Ga0495625_0518442 3300046660 Bacteria 726
771 Ga0495625_0702263 3300046660 Bacteria 597
772 Ga0495635_0007460 3300046663 Bacteria 7635
773 Ga0495635_0011840 3300046663 Bacteria 6114
774 Ga0495659_0000098 3300046664 Bacteria 38376
775 Ga0495659_0003068 3300046664 Bacteria 5362
776 Ga0495659_0003230 3300046664 Bacteria 5222
777 Ga0495659_0234042 3300046664 Bacteria 762
778 Ga0495661_0001348 3300046665 Bacteria 20803
779 Ga0495661_0001776 3300046665 Bacteria 17331
780 Ga0495661_0002306 3300046665 Bacteria 14733
781 Ga0495661_0002579 3300046665 Bacteria 13905
782 Ga0495661_0002865 3300046665 Bacteria 13040
783 Ga0495661_0004938 3300046665 Bacteria 9540
784 Ga0495661_0008128 3300046665 Bacteria 7274
785 Ga0495661_0009735 3300046665 Bacteria 6580
786 Ga0495661_0009828 3300046665 Bacteria 6545
787 Ga0495661_0015411 3300046665 Bacteria 5102
788 Ga0495661_0028103 3300046665 Bacteria 3604
789 Ga0495661_0035757 3300046665 Bacteria 3114
790 Ga0495661_0055279 3300046665 Bacteria 2380
791 Ga0495661_0061348 3300046665 Bacteria 2232
792 Ga0495661_0074609 3300046665 Bacteria 1973
793 Ga0495661_0087081 3300046665 Bacteria 1786
794 Ga0495661_0142818 3300046665 Bacteria 1300
795 Ga0495661_0198884 3300046665 Bacteria 1050
796 Ga0495661_0231139 3300046665 Bacteria 953
797 Ga0495661_0275657 3300046665 Bacteria 849
798 Ga0495661_0297967 3300046665 Bacteria 808
799 Ga0495661_0371209 3300046665 Bacteria 700
800 Ga0495588_0000135 3300046674 Bacteria 117387
801 Ga0495588_0007712 3300046674 Bacteria 4913
802 Ga0495588_0010214 3300046674 Bacteria 4357
803 Ga0495588_0014725 3300046674 Bacteria 3749
804 Ga0495588_0015013 3300046674 Bacteria 3719
805 Ga0495588_0026816 3300046674 Bacteria 2877
806 Ga0495588_0036480 3300046674 Bacteria 2494
807 Ga0495588_0132810 3300046674 Bacteria 1313
808 Ga0495588_0339675 3300046674 Bacteria 790
809 Ga0495657_0064708 3300046675 Bacteria 2407
810 Ga0495599_0025672 3300046678 Bacteria 3689
811 Ga0495623_0033229 3300046679 Bacteria 3311
812 Ga0495623_0033624 3300046679 Bacteria 3290
813 Ga0495646_0000285 3300046680 Bacteria 25868
814 Ga0495646_0239067 3300046680 Bacteria 976
815 Ga0495669_0000418 3300046684 Bacteria 20527
816 Ga0495669_0000709 3300046684 Bacteria 14509
817 Ga0495669_0006185 3300046684 Bacteria 4994
818 Ga0495669_0009028 3300046684 Bacteria 4200
819 Ga0495669_0013447 3300046684 Bacteria 3487
820 Ga0495669_0015227 3300046684 Bacteria 3292
821 Ga0495669_0015733 3300046684 Bacteria 3239
822 Ga0495669_0156418 3300046684 Bacteria 1080
823 Ga0495669_0291035 3300046684 Bacteria 786
824 Ga0495669_0417612 3300046684 Bacteria 650
825 Ga0495613_0007519 3300046689 Bacteria 8111
826 Ga0495624_0203742 3300046690 Bacteria 1201
827 Ga0495624_0228684 3300046690 Bacteria 1127
828 Ga0495670_0002227 3300046691 Bacteria 9576
829 Ga0495670_0002728 3300046691 Bacteria 8721
830 Ga0495670_0006284 3300046691 Bacteria 5830
831 Ga0495670_0010308 3300046691 Bacteria 4592
832 Ga0495670_0014762 3300046691 Bacteria 3844
833 Ga0495670_0022066 3300046691 Bacteria 3143
834 Ga0495670_0028077 3300046691 Bacteria 2789
835 Ga0495670_0036880 3300046691 Bacteria 2436
836 Ga0495670_0182120 3300046691 Bacteria 1109
837 Ga0495670_0206352 3300046691 Bacteria 1041
838 Ga0495670_0285283 3300046691 Bacteria 883
839 Ga0495670_0380929 3300046691 Bacteria 761
840 Ga0495670_0500903 3300046691 Bacteria 659
841 Ga0495670_0546673 3300046691 Bacteria 630
842 Ga0495670_0602023 3300046691 Bacteria 599
843 Ga0495670_0780680 3300046691 Bacteria 521
844 Ga0495671_0000522 3300046692 Bacteria 29251
845 Ga0495671_0001580 3300046692 Bacteria 15078
846 Ga0495671_0001604 3300046692 Bacteria 14924
847 Ga0495671_0004942 3300046692 Bacteria 7861
848 Ga0495671_0024470 3300046692 Bacteria 3144
849 Ga0495671_0060063 3300046692 Bacteria 1877
850 Ga0495671_0221640 3300046692 Bacteria 915
851 Ga0495671_0457872 3300046692 Bacteria 609
852 Ga0495671_0568508 3300046692 Bacteria 539
853 Ga0495649_0000625 3300046694 Bacteria 29147
854 Ga0495649_0001995 3300046694 Bacteria 14807
855 Ga0495649_0002444 3300046694 Bacteria 13075
856 Ga0495649_0003490 3300046694 Bacteria 10591
857 Ga0495649_0033838 3300046694 Bacteria 2812
858 Ga0495649_0035799 3300046694 Bacteria 2729
859 Ga0495649_0041594 3300046694 Bacteria 2513
860 Ga0495649_0051533 3300046694 Bacteria 2231
861 Ga0495649_0078605 3300046694 Bacteria 1765
862 Ga0495649_0119809 3300046694 Bacteria 1392
863 Ga0495649_0181300 3300046694 Bacteria 1098
864 Ga0495649_0262273 3300046694 Bacteria 885
865 Ga0495649_0676702 3300046694 Bacteria 507
866 Ga0495589_0000842 3300046794 Bacteria 19275
867 Ga0495589_0000949 3300046794 Bacteria 17777
868 Ga0495589_0002913 3300046794 Bacteria 9453
869 Ga0495589_0009623 3300046794 Bacteria 5025
870 Ga0495589_0018914 3300046794 Bacteria 3533
871 Ga0495589_0025725 3300046794 Bacteria 2985
872 Ga0495589_0027055 3300046794 Bacteria 2902
873 Ga0495589_0098429 3300046794 Bacteria 1416
874 Ga0495589_0123280 3300046794 Bacteria 1247
875 Ga0495589_0206579 3300046794 Bacteria 925
876 Ga0495589_0269778 3300046794 Bacteria 792
877 Ga0495589_0344888 3300046794 Bacteria 686
878 Ga0495589_0426032 3300046794 Bacteria 608
879 Ga0495600_0006927 3300046809 Bacteria 6915
880 Ga0495660_0000103 3300046810 Bacteria 91169
881 Ga0495660_0000292 3300046810 Bacteria 46230
882 Ga0495660_0001344 3300046810 Bacteria 16918
883 Ga0495660_0001351 3300046810 Bacteria 16865
884 Ga0495660_0008093 3300046810 Bacteria 6175
885 Ga0495660_0010404 3300046810 Bacteria 5411
886 Ga0495660_0016379 3300046810 Bacteria 4274
887 Ga0495660_0017917 3300046810 Bacteria 4074
888 Ga0495660_0034065 3300046810 Bacteria 2852
889 Ga0495660_0036009 3300046810 Bacteria 2762
890 Ga0495660_0036362 3300046810 Bacteria 2747
891 Ga0495660_0037909 3300046810 Bacteria 2683
892 Ga0495660_0038694 3300046810 Bacteria 2650
893 Ga0495660_0117131 3300046810 Bacteria 1352
894 Ga0495660_0182985 3300046810 Bacteria 1012
895 Ga0495660_0192990 3300046810 Bacteria 977
896 Ga0495660_0244801 3300046810 Bacteria 834
897 Ga0495581_0002842 3300047315 Bacteria 9888
898 Ga0495604_0004661 3300047317 Bacteria 10870
899 Ga0495604_0030816 3300047317 Bacteria 4256
900 Ga0495604_0173083 3300047317 Bacteria 1516
901 Ga0495636_0000150 3300047318 Bacteria 27664
902 Ga0495636_0004296 3300047318 Bacteria 5591
903 Ga0495636_0006568 3300047318 Bacteria 4571
904 Ga0495636_0026944 3300047318 Bacteria 2340
905 Ga0495636_0049261 3300047318 Bacteria 1761
906 Ga0495636_0052711 3300047318 Bacteria 1707
907 Ga0495636_0393213 3300047318 Bacteria 659
908 Ga0495636_0447040 3300047318 Bacteria 620
909 Ga0495672_0000060 3300047320 Bacteria 214547
910 Ga0495672_0000118 3300047320 Bacteria 124396
911 Ga0495672_0000287 3300047320 Bacteria 69547
912 Ga0495672_0000898 3300047320 Bacteria 31162
913 Ga0495672_0001340 3300047320 Bacteria 24446
914 Ga0495672_0001430 3300047320 Bacteria 23457
915 Ga0495672_0002971 3300047320 Bacteria 14922
916 Ga0495672_0010725 3300047320 Bacteria 6504
917 Ga0495672_0034099 3300047320 Bacteria 3148
918 Ga0495672_0064879 3300047320 Bacteria 2089
919 Ga0495672_0140221 3300047320 Bacteria 1263
920 Ga0495672_0149661 3300047320 Bacteria 1211
921 Ga0495672_0306288 3300047320 Bacteria 750
922 Ga0495672_0378575 3300047320 Bacteria 651
923 Ga0495676_0000627 3300047321 Bacteria 29238
924 Ga0495676_0096537 3300047321 Bacteria 2197
925 Ga0495680_0042131 3300047322 Bacteria 3625
926 Ga0495683_0000583 3300047323 Bacteria 27547
927 Ga0495683_0001699 3300047323 Bacteria 13992
928 Ga0495683_0003062 3300047323 Bacteria 9819
929 Ga0495683_0009992 3300047323 Bacteria 5037
930 Ga0495683_0016496 3300047323 Bacteria 3835
931 Ga0495683_0022174 3300047323 Bacteria 3267
932 Ga0495683_0043950 3300047323 Bacteria 2247
933 Ga0495683_0047302 3300047323 Bacteria 2159
934 Ga0495683_0068015 3300047323 Bacteria 1753
935 Ga0495683_0073567 3300047323 Bacteria 1675
936 Ga0495683_0090668 3300047323 Bacteria 1481
937 Ga0495683_0092763 3300047323 Bacteria 1460
938 Ga0495683_0184228 3300047323 Bacteria 951
939 Ga0495683_0219569 3300047323 Bacteria 848
940 Ga0495683_0449890 3300047323 Bacteria 528
941 Ga0495687_000166 3300047443 Bacteria 98891
942 Ga0495687_000643 3300047443 Bacteria 40048
943 Ga0495687_001343 3300047443 Bacteria 22915
944 Ga0495687_001347 3300047443 Bacteria 22860
945 Ga0495687_004217 3300047443 Bacteria 9856
946 Ga0495687_010853 3300047443 Bacteria 4949
947 Ga0495687_015152 3300047443 Bacteria 3931
948 Ga0495687_022739 3300047443 Bacteria 3005
949 Ga0495687_051024 3300047443 Bacteria 1759
950 Ga0495675_0002333 3300047444 Bacteria 11344
951 Ga0495677_0000591 3300047445 Bacteria 14861
952 Ga0495677_0000741 3300047445 Bacteria 13162
953 Ga0495677_0002907 3300047445 Bacteria 6664
954 Ga0495677_0004221 3300047445 Bacteria 5539
955 Ga0495677_0004236 3300047445 Bacteria 5524
956 Ga0495677_0006225 3300047445 Bacteria 4506
957 Ga0495677_0015589 3300047445 Bacteria 2761
958 Ga0495677_0018081 3300047445 Bacteria 2555
959 Ga0495677_0020160 3300047445 Bacteria 2417
960 Ga0495677_0028509 3300047445 Bacteria 2027
961 Ga0495677_0036812 3300047445 Bacteria 1787
962 Ga0495677_0043173 3300047445 Bacteria 1652
963 Ga0495677_0048108 3300047445 Bacteria 1566
964 Ga0495677_0058984 3300047445 Bacteria 1420
965 Ga0495677_0418340 3300047445 Bacteria 530
966 Ga0495679_002749 3300047446 Bacteria 8754
967 Ga0495679_012953 3300047446 Bacteria 3151
968 Ga0495679_016380 3300047446 Bacteria 2683
969 Ga0495679_206436 3300047446 Bacteria 515
970 Ga0495685_000005 3300047447 Bacteria 112142
971 Ga0495685_012012 3300047447 Bacteria 2929
972 Ga0495685_017039 3300047447 Bacteria 2485
973 Ga0495685_019160 3300047447 Bacteria 2350
974 Ga0495685_041442 3300047447 Bacteria 1573
975 Ga0495685_048078 3300047447 Bacteria 1450
976 Ga0495685_143138 3300047447 Bacteria 778
977 Ga0495673_0000017 3300047469 Bacteria 574970
978 Ga0495673_0000027 3300047469 Bacteria 475440
979 Ga0495673_0000037 3300047469 Bacteria 307717
980 Ga0495673_0013639 3300047469 Bacteria 4256
981 Ga0495673_0110443 3300047469 Bacteria 1100
982 Ga0495681_0001040 3300047470 Bacteria 21213
983 Ga0495681_0005013 3300047470 Bacteria 8926
984 Ga0495681_0011554 3300047470 Bacteria 5249
985 Ga0495681_0013834 3300047470 Bacteria 4664
986 Ga0495681_0016191 3300047470 Bacteria 4193
987 Ga0495681_0032233 3300047470 Bacteria 2640
988 Ga0495681_0035330 3300047470 Bacteria 2482
989 Ga0495681_0038865 3300047470 Bacteria 2328
990 Ga0495681_0044998 3300047470 Bacteria 2116
991 Ga0495681_0132569 3300047470 Bacteria 1059
992 Ga0495681_0199333 3300047470 Bacteria 813
993 Ga0495686_0000835 3300047472 Bacteria 39592
994 Ga0495686_0001637 3300047472 Bacteria 23398
995 Ga0495686_0001807 3300047472 Bacteria 21619
996 Ga0495686_0007776 3300047472 Bacteria 7979
997 Ga0495686_0033246 3300047472 Bacteria 3331
998 Ga0495686_0056647 3300047472 Bacteria 2448
999 Ga0495686_0060143 3300047472 Bacteria 2362
1000 Ga0495686_0170727 3300047472 Bacteria 1265
1001 Ga0495686_0194212 3300047472 Bacteria 1168
1002 Ga0495686_0438652 3300047472 Bacteria 695
1003 Ga0495593_0007449 3300047673 Bacteria 6403
1004 Ga0495602_0019738 3300048088 Bacteria 6680
1005 Ga0495602_0245230 3300048088 Bacteria 1338
1006 Ga0495614_0006146 3300048089 Bacteria 5397
1007 Ga0495615_0001550 3300048090 Bacteria 3458
1008 Ga0495615_0002620 3300048090 Bacteria 2907
1009 Ga0495615_0032635 3300048090 Bacteria 1257
1010 Ga0495626_0000006 3300048091 Bacteria 284977
1011 Ga0495626_0000034 3300048091 Bacteria 183391
1012 Ga0495626_0013376 3300048091 Bacteria 4264
1013 Ga0495626_0020564 3300048091 Bacteria 3287
1014 Ga0495626_0023237 3300048091 Bacteria 3055
1015 Ga0495626_0027647 3300048091 Bacteria 2756
1016 Ga0495626_0072542 3300048091 Bacteria 1544
1017 Ga0495626_0075080 3300048091 Bacteria 1511
1018 Ga0495626_0152932 3300048091 Bacteria 971
1019 Ga0495626_0195305 3300048091 Bacteria 832
1020 Ga0495626_0239452 3300048091 Bacteria 731
1021 Ga0495626_0298136 3300048091 Bacteria 637
1022 Ga0496100_0006489 3300048903 Bacteria 6379
1023 Ga0496100_0168078 3300048903 Bacteria 1577
1024 Ga0496100_0190911 3300048903 Bacteria 1487
1025 Ga0496100_0194521 3300048903 Bacteria 1474
1026 Ga0496101_0027034 3300048904 Bacteria 3991
1027 Ga0496101_0048199 3300048904 Bacteria 3061
1028 Ga0496101_0495374 3300048904 Bacteria 965
1029 Ga0496102_0000425 3300048905 Bacteria 48803
1030 Ga0496102_0006303 3300048905 Bacteria 10113
1031 Ga0496102_0022023 3300048905 Bacteria 5644
1032 Ga0496102_0046741 3300048905 Bacteria 3932
1033 Ga0496102_0465214 3300048905 Bacteria 1185
1034 Ga0496102_1548317 3300048905 Bacteria 581
1035 Ga0496102_1573258 3300048905 Bacteria 576
1036 Ga0496103_0018620 3300048906 Bacteria 4166
1037 Ga0496103_0021620 3300048906 Bacteria 3870
1038 Ga0496103_0023999 3300048906 Bacteria 3679
1039 Ga0496103_0026856 3300048906 Bacteria 3484
1040 Ga0496103_0058701 3300048906 Bacteria 2390
1041 Ga0496103_0093400 3300048906 Bacteria 1900
1042 Ga0496103_0093446 3300048906 Bacteria 1899
1043 Ga0496103_0266264 3300048906 Bacteria 1102
1044 Ga0496104_0120717 3300048907 Bacteria 2517
1045 Ga0496104_0295922 3300048907 Bacteria 1531
1046 Ga0496104_0760934 3300048907 Bacteria 875
1047 Ga0496104_1362985 3300048907 Bacteria 612
1048 Ga0496105_0044237 3300048908 Bacteria 3672
1049 Ga0496105_0247694 3300048908 Bacteria 1444
1050 Ga0496105_0440681 3300048908 Bacteria 1029
1051 Ga0496106_0030395 3300048909 Bacteria 4029
1052 Ga0496106_0354971 3300048909 Bacteria 1178
1053 Ga0496106_0373138 3300048909 Bacteria 1146
1054 Ga0496107_0046130 3300048910 Bacteria 3136
1055 Ga0496107_0190755 3300048910 Bacteria 1522
1056 Ga0496108_0038650 3300048911 Bacteria 3976
1057 Ga0496108_0333524 3300048911 Bacteria 1323
1058 Ga0496108_0476632 3300048911 Bacteria 1090
1059 Ga0496109_0014808 3300048912 Bacteria 6787
1060 Ga0496109_0053148 3300048912 Bacteria 3693
1061 Ga0496110_0001377 3300048913 Bacteria 17514
1062 Ga0496110_0228491 3300048913 Bacteria 1692
1063 Ga0496110_0445924 3300048913 Bacteria 1179
1064 Ga0496111_0006801 3300048914 Bacteria 7455
1065 Ga0496111_0025600 3300048914 Bacteria 4164
1066 Ga0496112_0345808 3300048915 Bacteria 1430
1067 Ga0496112_0502582 3300048915 Bacteria 1148
1068 Ga0496113_0008943 3300048916 Bacteria 6556
1069 Ga0496113_0805212 3300048916 Bacteria 746
1070 Ga0496114_0039572 3300048917 Bacteria 3901
1071 Ga0496114_0304003 3300048917 Bacteria 1408
1072 Ga0496114_0748214 3300048917 Bacteria 855
1073 Ga0496115_0075225 3300048918 Bacteria 2743
1074 Ga0496115_0227726 3300048918 Bacteria 1538
1075 Ga0496115_0464764 3300048918 Bacteria 1020
1076 Ga0496115_0781379 3300048918 Bacteria 744
1077 Ga0496116_0026546 3300048919 Bacteria 4234
1078 Ga0496116_0028076 3300048919 Bacteria 4084
1079 Ga0496116_0274062 3300048919 Bacteria 822
1080 Ga0496116_0307751 3300048919 Bacteria 750
1081 Ga0496117_0000010 3300048920 Bacteria 611954
1082 Ga0496118_0000009 3300048921 Bacteria 611954
1083 Ga0496118_0305518 3300048921 Bacteria 871
1084 Ga0496119_0099467 3300048922 Bacteria 1636
1085 Ga0496121_0005441 3300048924 Bacteria 16324
1086 Ga0496121_0071276 3300048924 Bacteria 2795
1087 Ga0496122_0004008 3300048925 Bacteria 18761
1088 Ga0496122_0004725 3300048925 Bacteria 16715
1089 Ga0496122_0005895 3300048925 Bacteria 14349
1090 Ga0496122_0046226 3300048925 Bacteria 3374
1091 Ga0496122_0081450 3300048925 Bacteria 2253
1092 Ga0496123_0003163 3300048926 Bacteria 18810
1093 Ga0496123_0003697 3300048926 Bacteria 16845
1094 Ga0496123_0004453 3300048926 Bacteria 14717
1095 Ga0496123_0042568 3300048926 Bacteria 3132
1096 Ga0496124_0002258 3300048927 Bacteria 25565
1097 Ga0496124_0118291 3300048927 Bacteria 2121
1098 Ga0496124_0136026 3300048927 Bacteria 1945
1099 Ga0496124_0174619 3300048927 Bacteria 1660
1100 Ga0496124_0176309 3300048927 Bacteria 1649
1101 Ga0496124_0213628 3300048927 Bacteria 1457
1102 Ga0496124_0256477 3300048927 Bacteria 1290
1103 Ga0496124_0308035 3300048927 Bacteria 1140
1104 Ga0496124_0332282 3300048927 Bacteria 1083
1105 Ga0496124_0336816 3300048927 Bacteria 1073
1106 Ga0496124_0695833 3300048927 Bacteria 645
1107 Ga0496125_0006778 3300048928 Bacteria 12305
1108 Ga0496125_0049161 3300048928 Bacteria 3507
1109 Ga0496125_0098615 3300048928 Bacteria 2161
1110 Ga0496126_0037909 3300048929 Bacteria 4489
1111 Ga0496126_0111809 3300048929 Bacteria 2379
1112 Ga0501306_028864 3300049127 Bacteria 815
1113 Ga0501306_055845 3300049127 Bacteria 642
1114 Ga0501309_091924 3300049129 Bacteria 518
1115 Ga0501310_004936 3300049130 Bacteria 1356
1116 Ga0501310_008208 3300049130 Bacteria 1131
1117 Ga0501310_072391 3300049130 Bacteria 530
1118 Ga0501343_003982 3300049132 Bacteria 1100
1119 Ga0501343_030060 3300049132 Bacteria 501
1120 Ga0501304_007634 3300049160 Bacteria 897
1121 Ga0501307_068869 3300049162 Bacteria 561
1122 Ga0495678_000001 3300049459 Bacteria 1060340
1123 Ga0495678_000113 3300049459 Bacteria 96866
1124 Ga0495678_000352 3300049459 Bacteria 47505
1125 Ga0495678_000601 3300049459 Bacteria 33888
1126 Ga0495678_001653 3300049459 Bacteria 16963
1127 Ga0495678_001698 3300049459 Bacteria 16628
1128 Ga0495678_002341 3300049459 Bacteria 13034
1129 Ga0495678_002373 3300049459 Bacteria 12911
1130 Ga0495678_009133 3300049459 Bacteria 4939
1131 Ga0495678_017225 3300049459 Bacteria 3281
1132 Ga0495678_022603 3300049459 Bacteria 2747
1133 Ga0495678_038668 3300049459 Bacteria 1928
1134 Ga0495682_0000842 3300049460 Bacteria 19200
1135 Ga0495682_0000910 3300049460 Bacteria 18047
1136 Ga0495682_0000929 3300049460 Bacteria 17756
1137 Ga0495682_0009389 3300049460 Bacteria 3817
1138 Ga0495682_0016480 3300049460 Bacteria 2797
1139 Ga0495682_0024231 3300049460 Bacteria 2263
1140 Ga0495682_0108682 3300049460 Bacteria 994
1141 Ga0495682_0255012 3300049460 Bacteria 620
1142 Ga0501311_018148 3300049527 Bacteria 933
1143 Ga0501316_011011 3300049532 Bacteria 1037
1144 Ga0501316_014465 3300049532 Bacteria 941
1145 Ga0501318_058669 3300049534 Bacteria 586
1146 Ga0501320_058740 3300049536 Bacteria 537
1147 Ga0501320_064152 3300049536 Bacteria 521
1148 Ga0501323_019418 3300049539 Bacteria 886
1149 Ga0501324_005909 3300049540 Bacteria 1016
1150 Ga0501324_014246 3300049540 Bacteria 761
1151 Ga0501329_05010 3300049545 Bacteria 723
1152 Ga0501034_1190702 3300049571 Bacteria 641
1153 Ga0501036_0222721 3300049572 Bacteria 1584
1154 Ga0501040_0132140 3300049576 Bacteria 1756
1155 Ga0501040_0463789 3300049576 Bacteria 912
1156 Ga0501041_0226244 3300049577 Bacteria 1174
1157 Ga0501048_0394603 3300049582 Bacteria 989
1158 Ga0501067_0342545 3300049583 Bacteria 833
1159 Ga0501072_1179658 3300049588 Bacteria 595
1160 Ga0501075_0846958 3300049591 Bacteria 695
1161 Ga0501217_224100 3300049661 Bacteria 595
1162 Ga0501227_005009 3300049665 Bacteria 2845
1163 Ga0501227_214703 3300049665 Bacteria 547
1164 Ga0501230_011361 3300049667 Bacteria 1408
1165 Ga0501235_129370 3300049669 Bacteria 638
1166 Ga0501238_012419 3300049671 Bacteria 1152
1167 Ga0501249_003650 3300049679 Bacteria 3102
1168 Ga0501079_0107492 3300049741 Bacteria 2166
1169 Ga0501080_0184168 3300049742 Bacteria 1921
1170 Ga0501081_0173249 3300049743 Bacteria 1559
1171 Ga0501241_103364 3300049758 Bacteria 616
1172 Ga0501269_000318 3300049766 Bacteria 12670
1173 Ga0501279_005893 3300049775 Bacteria 1613
1174 Ga0501035_0000968 3300049822 Bacteria 30332
1175 Ga0501035_0529656 3300049822 Bacteria 967
1176 Ga0501035_1413860 3300049822 Bacteria 533
1177 Ga0501035_1526061 3300049822 Bacteria 509
1178 Ga0501044_0057394 3300049823 Bacteria 3995
1179 Ga0501044_0290867 3300049823 Bacteria 1565
1180 Ga0501044_0675663 3300049823 Bacteria 920
1181 nmdc:mga03683_37955_c1 3300050489 Bacteria 1966
1182 nmdc:mga0yw44_67023_c1 3300050492 Bacteria 2217
1183 nmdc:mga0yw44_9122_c1 3300050492 Bacteria 4992
1184 nmdc:mga0k408_133096_c1 3300050493 Bacteria 1476
1185 nmdc:mga0k408_165335_c1 3300050493 Bacteria 1318
1186 nmdc:mga06z11_377710_c1 3300050494 Bacteria 851
1187 nmdc:mga04h51_3964_c1 3300050495 Bacteria 3643
1188 nmdc:mga07m45_91200_c1 3300050496 Bacteria 1746
1189 nmdc:mga0sz30_24680_c1 3300050516 Bacteria 2455
1190 nmdc:mga0sz30_32663_c1 3300050516 Bacteria 2159
1191 Ga0495601_0002361 3300053077 Bacteria 10687
1192 Ga0500644_0456285 3300053088 Bacteria 560
1193 Ga0500646_0003906 3300053090 Bacteria 3793
1194 Ga0500583_0023410 3300053092 Bacteria 2602
1195 Ga0500566_0412984 3300053094 Bacteria 601
1196 Ga0500641_0030801 3300053096 Bacteria 2112
1197 Ga0500555_007130 3300053103 Bacteria 3178
1198 Ga0500557_181669 3300053105 Bacteria 683
1199 Ga0500572_119071 3300053111 Bacteria 854
1200 Ga0500594_0011750 3300053118 Bacteria 2049
1201 Ga0500594_0037705 3300053118 Bacteria 1306
1202 Ga0500595_002361 3300053119 Bacteria 9427
1203 Ga0500607_110555 3300053121 Bacteria 1348
1204 Ga0500618_000576 3300053125 Bacteria 22679
1205 Ga0500621_067806 3300053126 Bacteria 1440
1206 Ga0500628_138899 3300053129 Bacteria 672
1207 Ga0500568_0011840 3300053139 Bacteria 4029
1208 Ga0500574_000146 3300053141 Bacteria 8066
1209 Ga0500586_005957 3300053145 Bacteria 3130
1210 Ga0500586_013597 3300053145 Bacteria 2401
1211 Ga0500604_0000415 3300053151 Bacteria 11736
1212 Ga0500619_001878 3300053154 Bacteria 3883
1213 Ga0500622_0231641 3300053156 Bacteria 822
1214 Ga0587066_013590 3300059490 Bacteria 1236
1215 Ga0587070_091243 3300059491 Bacteria 685
1216 Ga0587080_038257 3300059503 Bacteria 864
1217 Ga0587080_049842 3300059503 Bacteria 788
1218 Ga0587082_005918 3300059504 Bacteria 1610
1219 Ga0587083_0023230 3300059505 Bacteria 1168
1220 Ga0587128_097990 3300059630 Bacteria 610
1221 Ga0587067_021342 3300059640 Bacteria 1117
1222 Ga0587072_024251 3300059643 Bacteria 1095
1223 Ga0587079_006024 3300059647 Bacteria 1747
1224 Ga0587071_022367 3300060344 Bacteria 1167
1225 Ga0501082_1624969 3300060353 Bacteria 564

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0083044 Ga0495633_0083044_77_469 112
2 3300046665 Ga0495661_0061348 Ga0495661_0061348_520_906 113
3 3300046691 Ga0495670_0780680 Ga0495670_0780680_55_441 113
4 3300042145 Ga0450906_041782 Ga0450906_041782_145_546 114
5 3300049758 Ga0501241_103364 Ga0501241_103364_18_365 115
6 3300053118 Ga0500594_0037705 Ga0500594_0037705_715_1065 115
7 iso_pu_bacteria 2526164512 2526211460 117
8 iso_pu_bacteria 2600255292 2601670566 117
9 iso_pu_bacteria 2643221556 2643797797 117
10 iso_pu_bacteria 2643221645 2644249654 117
11 iso_pu_bacteria 2643221664 2644356220 117
12 iso_pu_bacteria 2643221684 2644472975 117
13 iso_pu_bacteria 2738541280 2738739130 117
14 iso_pu_bacteria 2738541297 2738825521 117
15 iso_pu_bacteria 2738541300 2738846365 117
16 iso_pu_bacteria 2738541357 2739149318 117
17 iso_pu_bacteria 2738543003 2739191237 117
18 iso_pu_bacteria 2738543018 2739274986 117
19 iso_pu_bacteria 2738543026 2739317714 117
20 iso_pu_bacteria 2738543029 2739335955 117
21 iso_pu_bacteria 2738543030 2739344030 117
22 iso_pu_bacteria 2808606418 2809144282 117
23 iso_pu_bacteria 2818991436 2819544730 117
24 iso_pu_bacteria 2821131069 2821134120 117
25 iso_pu_bacteria 2842711865 2842711940 117
26 iso_pu_bacteria 2857547612 2857548090 117
27 iso_pu_bacteria 2857553236 2857555749 117
28 iso_pu_bacteria 2857558681 2857561213 117
29 iso_pu_bacteria 2857564685 2857565936 117
30 iso_pu_bacteria 2885080285 2885082793 117
31 iso_pu_bacteria 2904424332 2904429067 117
32 iso_pu_bacteria 2919476304 2919479204 117
33 iso_pu_bacteria 2932410948 2932412681 117
34 iso_pu_bacteria 2932416698 2932420196 117
35 3300002737 JGI25162J39368_1000032 JGI25162J39368_100003289 121
36 3300002738 JGI25154J39366_1000513 JGI25154J39366_100051316 121
37 3300002772 JGI25164J39214_1007684 JGI25164J39214_10076841 121
38 3300002987 JGI25159J45721_1000973 JGI25159J45721_100097311 121
39 3300003163 Ga0006759J45824_1059780 Ga0006759J45824_10597802 121
40 3300003214 JGI25165J46597_1000067 JGI25165J46597_100006789 121
41 3300003322 rootL2_10006439 rootL2_100064392 121
42 3300003322 rootL2_10040613 rootL2_100406134 121
43 3300003544 Ga0007417J51691_1044202 Ga0007417J51691_10442023 121
44 3300003574 Ga0007410J51695_1030958 Ga0007410J51695_10309583 121
45 3300003575 Ga0007409J51694_1026388 Ga0007409J51694_10263883 121
46 3300003575 Ga0007409J51694_1038762 Ga0007409J51694_10387623 121
47 3300003577 Ga0007416J51690_1029738 Ga0007416J51690_10297383 121
48 3300003611 Ga0007411J51799_114674 Ga0007411J51799_1146742 121
49 3300003693 Ga0032354_1059071 Ga0032354_10590713 121
50 3300003751 Ga0055538_1000033 Ga0055538_100003389 121
51 3300003752 Ga0055539_1000045 Ga0055539_100004588 121
52 3300003756 Ga0055533_1000054 Ga0055533_100005489 121
53 3300003759 Ga0055525_1000009 Ga0055525_1000009313 121
54 3300003759 Ga0055525_1000065 Ga0055525_100006589 121
55 3300003762 Ga0055542_1006607 Ga0055542_10066073 121
56 3300003763 Ga0055529_1000127 Ga0055529_100012784 121
57 3300003771 Ga0055526_1000111 Ga0055526_100011132 121
58 3300003771 Ga0055526_1000179 Ga0055526_100017931 121
59 3300003771 Ga0055526_1000556 Ga0055526_10005564 121
60 3300003773 Ga0055537_1000056 Ga0055537_100005648 121
61 3300003775 Ga0055524_1000029 Ga0055524_100002937 121
62 3300003775 Ga0055524_1002563 Ga0055524_10025639 121
63 3300003775 Ga0055524_1008643 Ga0055524_10086434 121
64 3300003784 Ga0055534_1000178 Ga0055534_100017834 121
65 3300003790 Ga0055528_1000297 Ga0055528_10002975 121
66 3300003841 Ga0055541_1000031 Ga0055541_100003189 121
67 3300004625 Ga0055543_1003240 Ga0055543_10032404 121
68 3300005262 Ga0065165_1000447 Ga0065165_100044731 121
69 3300005262 Ga0065165_1000986 Ga0065165_100098632 121
70 3300005288 Ga0065714_10159014 Ga0065714_101590141 121
71 3300005288 Ga0065714_10287985 Ga0065714_102879851 121
72 3300005327 Ga0070658_10692533 Ga0070658_106925331 121
73 3300005327 Ga0070658_11439988 Ga0070658_114399881 121
74 3300005331 Ga0070670_100171357 Ga0070670_1001713572 121
75 3300005336 Ga0070680_100278490 Ga0070680_1002784902 121
76 3300005336 Ga0070680_100974658 Ga0070680_1009746582 121
77 3300005337 Ga0070682_100053028 Ga0070682_1000530284 121
78 3300005337 Ga0070682_100060325 Ga0070682_1000603253 121
79 3300005339 Ga0070660_100231247 Ga0070660_1002312472 121
80 3300005355 Ga0070671_101808380 Ga0070671_1018083801 121
81 3300005366 Ga0070659_100047634 Ga0070659_1000476342 121
82 3300005366 Ga0070659_100904427 Ga0070659_1009044271 121
83 3300005455 Ga0070663_101361576 Ga0070663_1013615761 121
84 3300005457 Ga0070662_100091440 Ga0070662_1000914403 121
85 3300005457 Ga0070662_100404071 Ga0070662_1004040712 121
86 3300005459 Ga0068867_101681342 Ga0068867_1016813422 121
87 3300005530 Ga0070679_100547407 Ga0070679_1005474072 121
88 3300005535 Ga0070684_100280441 Ga0070684_1002804412 121
89 3300005543 Ga0070672_101076794 Ga0070672_1010767942 121
90 3300005563 Ga0068855_100015626 Ga0068855_1000156264 121
91 3300005564 Ga0070664_100117201 Ga0070664_1001172011 121
92 3300005614 Ga0068856_100745090 Ga0068856_1007450902 121
93 3300005614 Ga0068856_101872247 Ga0068856_1018722472 121
94 3300005616 Ga0068852_100370802 Ga0068852_1003708022 121
95 3300005616 Ga0068852_101174441 Ga0068852_1011744412 121
96 3300005718 Ga0068866_10794180 Ga0068866_107941802 121
97 3300005844 Ga0068862_101602608 Ga0068862_1016026082 121
98 3300006028 Ga0070717_10039351 Ga0070717_100393513 121
99 3300006038 Ga0075365_10062826 Ga0075365_100628263 121
100 3300006042 Ga0075368_10013167 Ga0075368_100131673 121
101 3300006042 Ga0075368_10286426 Ga0075368_102864262 121
102 3300006048 Ga0075363_100001850 Ga0075363_1000018503 121
103 3300006048 Ga0075363_101048368 Ga0075363_1010483681 121
104 3300006051 Ga0075364_10310718 Ga0075364_103107183 121
105 3300006175 Ga0070712_100044051 Ga0070712_1000440513 121
106 3300006177 Ga0075362_10024716 Ga0075362_100247163 121
107 3300006178 Ga0075367_10002897 Ga0075367_100028974 121
108 3300006178 Ga0075367_10340463 Ga0075367_103404632 121
109 3300006186 Ga0075369_10012102 Ga0075369_100121023 121
110 3300006195 Ga0075366_10183688 Ga0075366_101836883 121
111 3300006195 Ga0075366_10257561 Ga0075366_102575612 121
112 3300006237 Ga0097621_100749287 Ga0097621_1007492872 121
113 3300006353 Ga0075370_10027705 Ga0075370_100277053 121
114 3300006358 Ga0068871_101368744 Ga0068871_1013687442 121
115 3300006881 Ga0068865_100120533 Ga0068865_1001205333 121
116 3300006881 Ga0068865_101089655 Ga0068865_1010896552 121
117 3300006946 Ga0079104_1004290 Ga0079104_10042905 121
118 3300006948 Ga0099826_10000003 Ga0099826_10000003563 121
119 3300009036 Ga0105244_10000592 Ga0105244_1000059226 121
120 3300009036 Ga0105244_10049230 Ga0105244_100492304 121
121 3300009093 Ga0105240_10368684 Ga0105240_103686843 121
122 3300009098 Ga0105245_10059404 Ga0105245_100594045 121
123 3300009148 Ga0105243_10100026 Ga0105243_101000264 121
124 3300009174 Ga0105241_10082522 Ga0105241_100825222 121
125 3300009551 Ga0105238_10933962 Ga0105238_109339622 121
126 3300010375 Ga0105239_10333714 Ga0105239_103337144 121
127 3300012506 Ga0157324_1017150 Ga0157324_10171502 121
128 3300013102 Ga0157371_10360574 Ga0157371_103605742 121
129 3300013102 Ga0157371_10439294 Ga0157371_104392942 121
130 3300013102 Ga0157371_10569972 Ga0157371_105699722 121
131 3300013296 Ga0157374_10615179 Ga0157374_106151792 121
132 3300013306 Ga0163162_10124770 Ga0163162_101247704 121
133 3300013306 Ga0163162_13273630 Ga0163162_132736301 121
134 3300014325 Ga0163163_11642229 Ga0163163_116422292 121
135 3300014497 Ga0182008_10000621 Ga0182008_1000062115 121
136 3300014497 Ga0182008_10160915 Ga0182008_101609152 121
137 3300015261 Ga0182006_1000046 Ga0182006_100004663 121
138 3300015261 Ga0182006_1000060 Ga0182006_100006091 121
139 3300015261 Ga0182006_1013996 Ga0182006_10139963 121
140 3300015261 Ga0182006_1024013 Ga0182006_10240135 121
141 3300015262 Ga0182007_10000044 Ga0182007_1000004439 121
142 3300015262 Ga0182007_10038009 Ga0182007_100380094 121
143 3300015262 Ga0182007_10041014 Ga0182007_100410142 121
144 3300015265 Ga0182005_1000003 Ga0182005_1000003436 121
145 3300015265 Ga0182005_1000032 Ga0182005_100003262 121
146 3300015265 Ga0182005_1001085 Ga0182005_10010854 121
147 3300017792 Ga0163161_10035625 Ga0163161_100356253 121
148 3300017792 Ga0163161_10035735 Ga0163161_100357352 121
149 3300017792 Ga0163161_10323043 Ga0163161_103230431 121
150 3300021361 Ga0213872_10001431 Ga0213872_1000143112 121
151 3300021361 Ga0213872_10002203 Ga0213872_100022036 121
152 3300021361 Ga0213872_10218566 Ga0213872_102185662 121
153 3300021361 Ga0213872_10374304 Ga0213872_103743041 121
154 3300025207 Ga0209760_105228 Ga0209760_1052282 121
155 3300025224 Ga0209784_100048 Ga0209784_10004889 121
156 3300025225 Ga0209566_100060 Ga0209566_10006089 121
157 3300025226 Ga0209674_100082 Ga0209674_10008289 121
158 3300025230 Ga0209563_100015 Ga0209563_100015427 121
159 3300025230 Ga0209563_100082 Ga0209563_10008289 121
160 3300025231 Ga0207427_100350 Ga0207427_10035013 121
161 3300025233 Ga0209437_100125 Ga0209437_10012588 121
162 3300025246 Ga0209646_1000047 Ga0209646_100004797 121
163 3300025250 Ga0209026_1003099 Ga0209026_10030997 121
164 3300025253 Ga0209677_100046 Ga0209677_10004688 121
165 3300025253 Ga0209677_102235 Ga0209677_1022354 121
166 3300025254 Ga0209148_1005704 Ga0209148_10057043 121
167 3300025261 Ga0209233_1000138 Ga0209233_100013888 121
168 3300025263 Ga0209565_1000006 Ga0209565_1000006280 121
169 3300025263 Ga0209565_1010682 Ga0209565_10106822 121
170 3300025272 Ga0209455_1000051 Ga0209455_1000051139 121
171 3300025273 Ga0209673_1000004 Ga0209673_1000004549 121
172 3300025284 Ga0209130_1000437 Ga0209130_10004379 121
173 3300025291 Ga0209675_1000006 Ga0209675_1000006279 121
174 3300025295 Ga0209564_1000006 Ga0209564_1000006475 121
175 3300025295 Ga0209564_1000085 Ga0209564_10000854 121
176 3300025295 Ga0209564_1000595 Ga0209564_100059531 121
177 3300025299 Ga0209256_1000013 Ga0209256_1000013166 121
178 3300025299 Ga0209256_1000179 Ga0209256_100017934 121
179 3300025728 Ga0207655_1015165 Ga0207655_10151653 121
180 3300025728 Ga0207655_1201680 Ga0207655_12016802 121
181 3300025899 Ga0207642_10658476 Ga0207642_106584762 121
182 3300025907 Ga0207645_10411928 Ga0207645_104119282 121
183 3300025909 Ga0207705_10015714 Ga0207705_100157144 121
184 3300025909 Ga0207705_10085898 Ga0207705_100858982 121
185 3300025911 Ga0207654_10008535 Ga0207654_100085354 121
186 3300025915 Ga0207693_10706047 Ga0207693_107060472 121
187 3300025917 Ga0207660_10532051 Ga0207660_105320512 121
188 3300025919 Ga0207657_10032579 Ga0207657_100325795 121
189 3300025919 Ga0207657_10051467 Ga0207657_100514673 121
190 3300025920 Ga0207649_10099574 Ga0207649_100995744 121
191 3300025921 Ga0207652_11302261 Ga0207652_113022612 121
192 3300025924 Ga0207694_10571020 Ga0207694_105710202 121
193 3300025925 Ga0207650_10111729 Ga0207650_101117292 121
194 3300025926 Ga0207659_10457263 Ga0207659_104572632 121
195 3300025932 Ga0207690_10025340 Ga0207690_100253404 121
196 3300025932 Ga0207690_10102307 Ga0207690_101023072 121
197 3300025933 Ga0207706_10271623 Ga0207706_102716231 121
198 3300025934 Ga0207686_10195403 Ga0207686_101954032 121
199 3300025935 Ga0207709_10204473 Ga0207709_102044732 121
200 3300025945 Ga0207679_10028128 Ga0207679_100281283 121
201 3300025945 Ga0207679_10073620 Ga0207679_100736205 121
202 3300025945 Ga0207679_10167898 Ga0207679_101678983 121
203 3300025949 Ga0207667_10041977 Ga0207667_100419775 121
204 3300025949 Ga0207667_10559284 Ga0207667_105592841 121
205 3300025981 Ga0207640_10093311 Ga0207640_100933113 121
206 3300026041 Ga0207639_10235180 Ga0207639_102351802 121
207 3300026067 Ga0207678_10277906 Ga0207678_102779062 121
208 3300026089 Ga0207648_10127573 Ga0207648_101275732 121
209 3300026116 Ga0207674_10068251 Ga0207674_100682515 121
210 3300026142 Ga0207698_11045460 Ga0207698_110454602 121
211 3300027111 Ga0209281_1001620 Ga0209281_10016202 121
212 3300027666 Ga0209282_1000002 Ga0209282_1000002435 121
213 3300027866 Ga0209813_10000697 Ga0209813_100006973 121
214 3300028794 Ga0307515_10199114 Ga0307515_101991143 121
215 3300029957 Ga0265324_10047655 Ga0265324_100476553 121
216 3300030521 Ga0307511_10006722 Ga0307511_100067222 121
217 3300030731 Ga0316177_1106398 Ga0316177_11063982 121
218 3300030731 Ga0316177_1159616 Ga0316177_11596162 121
219 3300030735 Ga0316178_1107042 Ga0316178_11070422 121
220 3300030735 Ga0316178_1137549 Ga0316178_11375492 121
221 3300030736 Ga0316180_1181545 Ga0316180_11815455 121
222 3300030744 Ga0316181_1169984 Ga0316181_11699842 121
223 3300030745 Ga0316182_1007163 Ga0316182_10071632 121
224 3300030745 Ga0316182_1057913 Ga0316182_10579132 121
225 3300030745 Ga0316182_1106132 Ga0316182_11061322 121
226 3300031238 Ga0265332_10110874 Ga0265332_101108742 121
227 3300031251 Ga0265327_10031635 Ga0265327_100316353 121
228 3300031344 Ga0265316_10031234 Ga0265316_100312343 121
229 3300031344 Ga0265316_10304104 Ga0265316_103041043 121
230 3300031456 Ga0307513_10300546 Ga0307513_103005462 121
231 3300031548 Ga0307408_100000120 Ga0307408_10000012067 121
232 3300031711 Ga0265314_10023296 Ga0265314_100232963 121
233 3300031711 Ga0265314_10151622 Ga0265314_101516222 121
234 3300031838 Ga0307518_10026109 Ga0307518_100261096 121
235 3300031901 Ga0307406_11107306 Ga0307406_111073061 121
236 3300031901 Ga0307406_11391361 Ga0307406_113913612 121
237 3300031901 Ga0307406_11422399 Ga0307406_114223992 121
238 3300032002 Ga0307416_100009981 Ga0307416_1000099816 121
239 3300032002 Ga0307416_100834297 Ga0307416_1008342972 121
240 3300032002 Ga0307416_101745207 Ga0307416_1017452072 121
241 3300032004 Ga0307414_10255082 Ga0307414_102550821 121
242 3300032004 Ga0307414_11010506 Ga0307414_110105061 121
243 3300032005 Ga0307411_10168806 Ga0307411_101688062 121
244 3300032005 Ga0307411_10852644 Ga0307411_108526442 121
245 3300032005 Ga0307411_10972724 Ga0307411_109727242 121
246 3300032005 Ga0307411_12074309 Ga0307411_120743092 121
247 3300033179 Ga0307507_10188729 Ga0307507_101887292 121
248 3300033179 Ga0307507_10209430 Ga0307507_102094302 121
249 3300034817 Ga0373948_0173085 Ga0373948_0173085_152_517 121
250 3300035084 Ga0373928_0094116 Ga0373928_0094116_344_709 121
251 3300035112 Ga0373932_0431836 Ga0373932_0431836_105_470 121
252 3300035692 Ga0373935_1471864 Ga0373935_1471864_58_423 121
253 3300037312 Ga0395899_0000166 Ga0395899_0000166_83345_83713 121
254 3300037312 Ga0395899_0001004 Ga0395899_0001004_18085_18450 121
255 3300037312 Ga0395899_0004846 Ga0395899_0004846_8711_9076 121
256 3300037312 Ga0395899_0587398 Ga0395899_0587398_175_540 121
257 3300037418 Ga0395900_0010881 Ga0395900_0010881_7152_7520 121
258 3300037418 Ga0395900_0032095 Ga0395900_0032095_149_514 121
259 3300037418 Ga0395900_0034117 Ga0395900_0034117_3655_4020 121
260 3300037418 Ga0395900_0151105 Ga0395900_0151105_1849_2238 121
261 3300037418 Ga0395900_0158171 Ga0395900_0158171_318_740 121
262 3300037418 Ga0395900_0594508 Ga0395900_0594508_662_1030 121
263 3300037418 Ga0395900_0629851 Ga0395900_0629851_292_657 121
264 3300037466 Ga0395898_0039718 Ga0395898_0039718_2426_2794 121
265 3300037466 Ga0395898_0070994 Ga0395898_0070994_1823_2188 121
266 3300037466 Ga0395898_0108068 Ga0395898_0108068_1807_2175 121
267 3300037466 Ga0395898_1215609 Ga0395898_1215609_190_591 121
268 3300037466 Ga0395898_1257169 Ga0395898_1257169_138_557 121
269 3300037466 Ga0395898_1956637 Ga0395898_1956637_19_387 121
270 3300037471 Ga0395905_0000256 Ga0395905_0000256_60072_60437 121
271 3300037471 Ga0395905_0003267 Ga0395905_0003267_6101_6466 121
272 3300037471 Ga0395905_0039759 Ga0395905_0039759_1505_1894 121
273 3300037471 Ga0395905_0041247 Ga0395905_0041247_285_650 121
274 3300037471 Ga0395905_0102715 Ga0395905_0102715_1881_2246 121
275 3300037471 Ga0395905_0149327 Ga0395905_0149327_1713_2078 121
276 3300037471 Ga0395905_0157363 Ga0395905_0157363_1641_2042 121
277 3300037471 Ga0395905_0181758 Ga0395905_0181758_259_627 121
278 3300037471 Ga0395905_0427291 Ga0395905_0427291_422_790 121
279 3300037471 Ga0395905_0457460 Ga0395905_0457460_758_1126 121
280 3300037471 Ga0395905_0694765 Ga0395905_0694765_172_591 121
281 3300038443 Ga0395901_0000596 Ga0395901_0000596_35855_36223 121
282 3300038443 Ga0395901_0001017 Ga0395901_0001017_1471_1836 121
283 3300038443 Ga0395901_0018415 Ga0395901_0018415_5947_6312 121
284 3300038443 Ga0395901_0018801 Ga0395901_0018801_3578_3946 121
285 3300038443 Ga0395901_0110860 Ga0395901_0110860_662_1081 121
286 3300038443 Ga0395901_0433649 Ga0395901_0433649_508_876 121
287 3300038443 Ga0395901_0530107 Ga0395901_0530107_779_1147 121
288 3300038443 Ga0395901_0867670 Ga0395901_0867670_433_852 121
289 3300038443 Ga0395901_1381318 Ga0395901_1381318_62_451 121
290 3300039447 Ga0436361_0008388 Ga0436361_0008388_274_639 121
291 3300039447 Ga0436361_0080684 Ga0436361_0080684_254_619 121
292 3300039447 Ga0436361_0330066 Ga0436361_0330066_481_846 121
293 3300039447 Ga0436361_0766678 Ga0436361_0766678_85_450 121
294 3300039447 Ga0436361_0811061 Ga0436361_0811061_37946_38311 121
295 3300039447 Ga0436361_0878062 Ga0436361_0878062_315_680 121
296 3300041498 Ga0451841_0939562 Ga0451841_0939562_42_416 121
297 3300041997 Ga0439431_0200760 Ga0439431_0200760_74_439 121
298 3300042005 Ga0439448_0040821 Ga0439448_0040821_794_1162 121
299 3300042007 Ga0439449_0139118 Ga0439449_0139118_92_460 121
300 3300042012 Ga0439455_0045037 Ga0439455_0045037_92_460 121
301 3300042012 Ga0439455_0122181 Ga0439455_0122181_166_534 121
302 3300042139 Ga0450904_000069 Ga0450904_000069_10595_10963 121
303 3300042157 Ga0439458_0029697 Ga0439458_0029697_520_888 121
304 3300042157 Ga0439458_0070312 Ga0439458_0070312_311_733 121
305 3300042157 Ga0439458_0187047 Ga0439458_0187047_27_395 121
306 3300042532 Ga0450893_0042705 Ga0450893_0042705_388_756 121
307 3300042876 Ga0451577_0009412 Ga0451577_0009412_1499_1864 121
308 3300042876 Ga0451577_0009848 Ga0451577_0009848_3626_3991 121
309 3300042876 Ga0451577_0033893 Ga0451577_0033893_2929_3294 121
310 3300044656 Ga0466969_0090918 Ga0466969_0090918_920_1288 121
311 3300044656 Ga0466969_0362602 Ga0466969_0362602_139_507 121
312 3300044658 Ga0466972_0000029 Ga0466972_0000029_130353_130718 121
313 3300044658 Ga0466972_0012159 Ga0466972_0012159_637_1002 121
314 3300044673 Ga0453683_0119321 Ga0453683_0119321_1021_1386 121
315 3300044683 Ga0466965_0000755 Ga0466965_0000755_3405_3770 121
316 3300044683 Ga0466965_0014568 Ga0466965_0014568_1914_2282 121
317 3300044683 Ga0466965_0081527 Ga0466965_0081527_264_629 121
318 3300044683 Ga0466965_0249649 Ga0466965_0249649_340_708 121
319 3300044684 Ga0466966_0052723 Ga0466966_0052723_1004_1372 121
320 3300044684 Ga0466966_0058873 Ga0466966_0058873_1847_2215 121
321 3300044684 Ga0466966_0209722 Ga0466966_0209722_596_964 121
322 3300044684 Ga0466966_0345283 Ga0466966_0345283_390_758 121
323 3300044693 Ga0466961_0127140 Ga0466961_0127140_436_804 121
324 3300044706 Ga0466964_0001533 Ga0466964_0001533_6953_7318 121
325 3300044706 Ga0466964_0005240 Ga0466964_0005240_4414_4782 121
326 3300044706 Ga0466964_0015479 Ga0466964_0015479_431_796 121
327 3300044706 Ga0466964_0061461 Ga0466964_0061461_807_1175 121
328 3300044712 Ga0453684_0002983 Ga0453684_0002983_11677_12042 121
329 3300044712 Ga0453684_0039091 Ga0453684_0039091_3858_4223 121
330 3300044712 Ga0453684_0056340 Ga0453684_0056340_740_1105 121
331 3300044712 Ga0453684_0100408 Ga0453684_0100408_2746_3111 121
332 3300044712 Ga0453684_0117152 Ga0453684_0117152_991_1356 121
333 3300044712 Ga0453684_1935268 Ga0453684_1935268_53_418 121
334 3300044712 Ga0453684_1975273 Ga0453684_1975273_118_483 121
335 3300044719 Ga0466971_0083280 Ga0466971_0083280_65_433 121
336 3300044719 Ga0466971_0270338 Ga0466971_0270338_14_382 121
337 3300044735 Ga0466968_0107668 Ga0466968_0107668_493_858 121
338 3300044735 Ga0466968_0164483 Ga0466968_0164483_173_592 121
339 3300044735 Ga0466968_0317123 Ga0466968_0317123_245_667 121
340 3300044735 Ga0466968_0419271 Ga0466968_0419271_59_424 121
341 3300044735 Ga0466968_0569446 Ga0466968_0569446_188_556 121
342 3300044735 Ga0466968_0683227 Ga0466968_0683227_31_396 121
343 3300044765 Ga0466970_0127077 Ga0466970_0127077_635_1009 121
344 3300044842 Ga0466957_0002203 Ga0466957_0002203_8182_8550 121
345 3300044842 Ga0466957_0168033 Ga0466957_0168033_641_1006 121
346 3300044842 Ga0466957_0820527 Ga0466957_0820527_25_426 121
347 3300044901 Ga0466960_0077963 Ga0466960_0077963_965_1333 121
348 3300044901 Ga0466960_0574437 Ga0466960_0574437_24_389 121
349 3300045049 Ga0466959_0027687 Ga0466959_0027687_3318_3692 121
350 3300045049 Ga0466959_0045456 Ga0466959_0045456_684_1052 121
351 3300045049 Ga0466959_0132453 Ga0466959_0132453_168_536 121
352 3300045049 Ga0466959_0587628 Ga0466959_0587628_324_725 121
353 3300045049 Ga0466959_0989054 Ga0466959_0989054_181_549 121
354 3300045051 Ga0451576_0000621 Ga0451576_0000621_11395_11760 121
355 3300045051 Ga0451576_0557944 Ga0451576_0557944_442_807 121
356 3300045836 Ga0466958_0034211 Ga0466958_0034211_679_1047 121
357 3300045836 Ga0466958_0672138 Ga0466958_0672138_69_434 121
358 3300045976 Ga0466967_0067081 Ga0466967_0067081_628_996 121
359 3300045976 Ga0466967_0091988 Ga0466967_0091988_1890_2258 121
360 3300045976 Ga0466967_0251181 Ga0466967_0251181_286_654 121
361 3300045976 Ga0466967_0952414 Ga0466967_0952414_26_391 121
362 3300046452 Ga0495617_000002 Ga0495617_000002_239336_239725 121
363 3300046452 Ga0495617_000056 Ga0495617_000056_12142_12507 121
364 3300046452 Ga0495617_000682 Ga0495617_000682_14417_14788 121
365 3300046452 Ga0495617_013062 Ga0495617_013062_2354_2719 121
366 3300046452 Ga0495617_019432 Ga0495617_019432_743_1111 121
367 3300046452 Ga0495617_074501 Ga0495617_074501_569_958 121
368 3300046452 Ga0495617_123118 Ga0495617_123118_313_681 121
369 3300046453 Ga0495627_000016 Ga0495627_000016_289110_289475 121
370 3300046453 Ga0495627_000500 Ga0495627_000500_26994_27383 121
371 3300046453 Ga0495627_002924 Ga0495627_002924_67_438 121
372 3300046453 Ga0495627_010880 Ga0495627_010880_2231_2620 121
373 3300046455 Ga0495603_0003211 Ga0495603_0003211_2406_2774 121
374 3300046455 Ga0495603_0035395 Ga0495603_0035395_2232_2621 121
375 3300046457 Ga0495590_0000007 Ga0495590_0000007_17215_17604 121
376 3300046457 Ga0495590_0000035 Ga0495590_0000035_79879_80244 121
377 3300046457 Ga0495590_0000635 Ga0495590_0000635_11983_12351 121
378 3300046457 Ga0495590_0002506 Ga0495590_0002506_3006_3395 121
379 3300046457 Ga0495590_0012687 Ga0495590_0012687_1220_1588 121
380 3300046457 Ga0495590_0162028 Ga0495590_0162028_23_394 121
381 3300046458 Ga0495591_001122 Ga0495591_001122_10207_10596 121
382 3300046459 Ga0495629_0043536 Ga0495629_0043536_489_857 121
383 3300046459 Ga0495629_0048948 Ga0495629_0048948_1311_1679 121
384 3300046460 Ga0495638_0000172 Ga0495638_0000172_243_608 121
385 3300046460 Ga0495638_0000172 Ga0495638_0000172_99965_100330 121
386 3300046460 Ga0495638_0001511 Ga0495638_0001511_8923_9291 121
387 3300046460 Ga0495638_0013415 Ga0495638_0013415_3638_4009 121
388 3300046460 Ga0495638_0014106 Ga0495638_0014106_3290_3661 121
389 3300046460 Ga0495638_0015707 Ga0495638_0015707_3541_3906 121
390 3300046460 Ga0495638_0021145 Ga0495638_0021145_254_622 121
391 3300046460 Ga0495638_0024993 Ga0495638_0024993_2603_2992 121
392 3300046460 Ga0495638_0054488 Ga0495638_0054488_381_770 121
393 3300046460 Ga0495638_0182910 Ga0495638_0182910_90_455 121
394 3300046460 Ga0495638_0213565 Ga0495638_0213565_175_564 121
395 3300046460 Ga0495638_0461762 Ga0495638_0461762_141_506 121
396 3300046460 Ga0495638_0634028 Ga0495638_0634028_51_419 121
397 3300046462 Ga0495651_0000518 Ga0495651_0000518_23011_23376 121
398 3300046462 Ga0495651_0047755 Ga0495651_0047755_2497_2862 121
399 3300046463 Ga0495653_0000007 Ga0495653_0000007_301824_302189 121
400 3300046463 Ga0495653_0831233 Ga0495653_0831233_144_509 121
401 3300046471 Ga0495650_0000056 Ga0495650_0000056_273865_274233 121
402 3300046471 Ga0495650_0000105 Ga0495650_0000105_185850_186215 121
403 3300046471 Ga0495650_0000551 Ga0495650_0000551_28642_29007 121
404 3300046471 Ga0495650_0000969 Ga0495650_0000969_12428_12796 121
405 3300046471 Ga0495650_0000987 Ga0495650_0000987_19907_20272 121
406 3300046471 Ga0495650_0002049 Ga0495650_0002049_12223_12588 121
407 3300046471 Ga0495650_0008835 Ga0495650_0008835_2909_3274 121
408 3300046471 Ga0495650_0020424 Ga0495650_0020424_2002_2370 121
409 3300046471 Ga0495650_0026101 Ga0495650_0026101_1492_1881 121
410 3300046471 Ga0495650_0034292 Ga0495650_0034292_1290_1655 121
411 3300046471 Ga0495650_0040617 Ga0495650_0040617_1530_1895 121
412 3300046471 Ga0495650_0043627 Ga0495650_0043627_62_451 121
413 3300046472 Ga0495580_0294000 Ga0495580_0294000_660_1028 121
414 3300046473 Ga0495582_0006590 Ga0495582_0006590_827_1195 121
415 3300046474 Ga0495605_0000015 Ga0495605_0000015_138495_138860 121
416 3300046474 Ga0495605_0000085 Ga0495605_0000085_32078_32500 121
417 3300046474 Ga0495605_0000108 Ga0495605_0000108_2936_3325 121
418 3300046474 Ga0495605_0002293 Ga0495605_0002293_7670_8038 121
419 3300046474 Ga0495605_0006435 Ga0495605_0006435_547_936 121
420 3300046474 Ga0495605_0016364 Ga0495605_0016364_1928_2317 121
421 3300046474 Ga0495605_0027714 Ga0495605_0027714_956_1324 121
422 3300046474 Ga0495605_0031339 Ga0495605_0031339_1859_2227 121
423 3300046474 Ga0495605_0039435 Ga0495605_0039435_430_795 121
424 3300046474 Ga0495605_0050389 Ga0495605_0050389_1649_2017 121
425 3300046474 Ga0495605_0071108 Ga0495605_0071108_288_653 121
426 3300046474 Ga0495605_0090102 Ga0495605_0090102_806_1195 121
427 3300046474 Ga0495605_0094903 Ga0495605_0094903_577_945 121
428 3300046474 Ga0495605_0114319 Ga0495605_0114319_750_1118 121
429 3300046474 Ga0495605_0359683 Ga0495605_0359683_227_595 121
430 3300046474 Ga0495605_0367577 Ga0495605_0367577_102_470 121
431 3300046474 Ga0495605_0433117 Ga0495605_0433117_46_417 121
432 3300046475 Ga0495639_0062346 Ga0495639_0062346_1163_1528 121
433 3300046477 Ga0495664_0143309 Ga0495664_0143309_583_951 121
434 3300046491 Ga0495584_0000022 Ga0495584_0000022_30034_30405 121
435 3300046491 Ga0495584_0001018 Ga0495584_0001018_11696_12067 121
436 3300046491 Ga0495584_0001378 Ga0495584_0001378_2449_2817 121
437 3300046491 Ga0495584_0002257 Ga0495584_0002257_7383_7751 121
438 3300046491 Ga0495584_0013733 Ga0495584_0013733_1707_2096 121
439 3300046491 Ga0495584_0024354 Ga0495584_0024354_2477_2848 121
440 3300046491 Ga0495584_0025290 Ga0495584_0025290_717_1088 121
441 3300046491 Ga0495584_0028581 Ga0495584_0028581_1161_1526 121
442 3300046491 Ga0495584_0034985 Ga0495584_0034985_1705_2094 121
443 3300046491 Ga0495584_0040894 Ga0495584_0040894_724_1092 121
444 3300046491 Ga0495584_0042872 Ga0495584_0042872_246_617 121
445 3300046491 Ga0495584_0060194 Ga0495584_0060194_1515_1883 121
446 3300046491 Ga0495584_0082672 Ga0495584_0082672_562_930 121
447 3300046491 Ga0495584_0114091 Ga0495584_0114091_905_1273 121
448 3300046491 Ga0495584_0115860 Ga0495584_0115860_293_664 121
449 3300046491 Ga0495584_0198283 Ga0495584_0198283_562_930 121
450 3300046492 Ga0495585_0000004 Ga0495585_0000004_255041_255412 121
451 3300046492 Ga0495585_0000332 Ga0495585_0000332_19623_19994 121
452 3300046492 Ga0495585_0000525 Ga0495585_0000525_23961_24329 121
453 3300046492 Ga0495585_0000788 Ga0495585_0000788_19660_20031 121
454 3300046492 Ga0495585_0000921 Ga0495585_0000921_18496_18861 121
455 3300046492 Ga0495585_0002433 Ga0495585_0002433_1863_2234 121
456 3300046492 Ga0495585_0006621 Ga0495585_0006621_2466_2855 121
457 3300046492 Ga0495585_0015644 Ga0495585_0015644_1199_1588 121
458 3300046492 Ga0495585_0017551 Ga0495585_0017551_1904_2272 121
459 3300046492 Ga0495585_0018403 Ga0495585_0018403_2712_3083 121
460 3300046492 Ga0495585_0020042 Ga0495585_0020042_3095_3463 121
461 3300046492 Ga0495585_0039006 Ga0495585_0039006_1889_2260 121
462 3300046492 Ga0495585_0049893 Ga0495585_0049893_1230_1619 121
463 3300046492 Ga0495585_0053657 Ga0495585_0053657_401_772 121
464 3300046492 Ga0495585_0063602 Ga0495585_0063602_228_614 121
465 3300046492 Ga0495585_0077260 Ga0495585_0077260_33_422 121
466 3300046492 Ga0495585_0108152 Ga0495585_0108152_82_453 121
467 3300046492 Ga0495585_0123437 Ga0495585_0123437_320_709 121
468 3300046492 Ga0495585_0137331 Ga0495585_0137331_283_651 121
469 3300046492 Ga0495585_0142471 Ga0495585_0142471_50_439 121
470 3300046492 Ga0495585_0193394 Ga0495585_0193394_84_452 121
471 3300046492 Ga0495585_0245269 Ga0495585_0245269_480_848 121
472 3300046492 Ga0495585_0425343 Ga0495585_0425343_222_590 121
473 3300046492 Ga0495585_0554916 Ga0495585_0554916_139_507 121
474 3300046499 Ga0495594_0003312 Ga0495594_0003312_551_919 121
475 3300046499 Ga0495594_0015227 Ga0495594_0015227_292_660 121
476 3300046499 Ga0495594_0058384 Ga0495594_0058384_1639_2028 121
477 3300046499 Ga0495594_0193612 Ga0495594_0193612_666_1034 121
478 3300046499 Ga0495594_0296826 Ga0495594_0296826_115_483 121
479 3300046499 Ga0495594_0306613 Ga0495594_0306613_324_713 121
480 3300046500 Ga0495596_0001322 Ga0495596_0001322_2098_2487 121
481 3300046500 Ga0495596_0002806 Ga0495596_0002806_4052_4438 121
482 3300046500 Ga0495596_0002844 Ga0495596_0002844_2932_3300 121
483 3300046500 Ga0495596_0005233 Ga0495596_0005233_316_687 121
484 3300046500 Ga0495596_0007034 Ga0495596_0007034_3109_3498 121
485 3300046500 Ga0495596_0009536 Ga0495596_0009536_3200_3571 121
486 3300046500 Ga0495596_0012656 Ga0495596_0012656_951_1319 121
487 3300046500 Ga0495596_0024991 Ga0495596_0024991_708_1097 121
488 3300046500 Ga0495596_0026244 Ga0495596_0026244_1846_2214 121
489 3300046500 Ga0495596_0027166 Ga0495596_0027166_58_426 121
490 3300046500 Ga0495596_0034057 Ga0495596_0034057_145_534 121
491 3300046500 Ga0495596_0059605 Ga0495596_0059605_574_963 121
492 3300046501 Ga0495607_0000834 Ga0495607_0000834_16633_17001 121
493 3300046501 Ga0495607_0002950 Ga0495607_0002950_10036_10401 121
494 3300046501 Ga0495607_0004212 Ga0495607_0004212_5605_5994 121
495 3300046501 Ga0495607_0006375 Ga0495607_0006375_3560_3982 121
496 3300046501 Ga0495607_0013188 Ga0495607_0013188_1435_1857 121
497 3300046501 Ga0495607_0019251 Ga0495607_0019251_356_745 121
498 3300046501 Ga0495607_0026032 Ga0495607_0026032_1793_2158 121
499 3300046501 Ga0495607_0031657 Ga0495607_0031657_1943_2308 121
500 3300046501 Ga0495607_0040218 Ga0495607_0040218_283_651 121
501 3300046501 Ga0495607_0057670 Ga0495607_0057670_1296_1664 121
502 3300046501 Ga0495607_0065107 Ga0495607_0065107_108_476 121
503 3300046501 Ga0495607_0082114 Ga0495607_0082114_806_1174 121
504 3300046501 Ga0495607_0086630 Ga0495607_0086630_789_1160 121
505 3300046501 Ga0495607_0094087 Ga0495607_0094087_616_981 121
506 3300046501 Ga0495607_0164068 Ga0495607_0164068_265_651 121
507 3300046501 Ga0495607_0204921 Ga0495607_0204921_108_476 121
508 3300046501 Ga0495607_0265911 Ga0495607_0265911_178_567 121
509 3300046501 Ga0495607_0475618 Ga0495607_0475618_137_508 121
510 3300046506 Ga0495583_0000004 Ga0495583_0000004_122660_123028 121
511 3300046506 Ga0495583_0000257 Ga0495583_0000257_26682_27053 121
512 3300046506 Ga0495583_0000892 Ga0495583_0000892_8131_8502 121
513 3300046506 Ga0495583_0000901 Ga0495583_0000901_18436_18801 121
514 3300046506 Ga0495583_0001085 Ga0495583_0001085_11854_12222 121
515 3300046506 Ga0495583_0001376 Ga0495583_0001376_12174_12542 121
516 3300046506 Ga0495583_0002774 Ga0495583_0002774_4235_4624 121
517 3300046506 Ga0495583_0002793 Ga0495583_0002793_12000_12371 121
518 3300046506 Ga0495583_0006861 Ga0495583_0006861_3937_4326 121
519 3300046506 Ga0495583_0014846 Ga0495583_0014846_1892_2281 121
520 3300046506 Ga0495583_0016280 Ga0495583_0016280_1915_2304 121
521 3300046506 Ga0495583_0033635 Ga0495583_0033635_1070_1441 121
522 3300046506 Ga0495583_0046827 Ga0495583_0046827_1076_1447 121
523 3300046506 Ga0495583_0052777 Ga0495583_0052777_194_559 121
524 3300046506 Ga0495583_0139200 Ga0495583_0139200_254_622 121
525 3300046506 Ga0495583_0218046 Ga0495583_0218046_18_386 121
526 3300046506 Ga0495583_0239944 Ga0495583_0239944_181_570 121
527 3300046507 Ga0495606_0000673 Ga0495606_0000673_37790_38155 121
528 3300046507 Ga0495606_0000690 Ga0495606_0000690_2972_3337 121
529 3300046507 Ga0495606_0000739 Ga0495606_0000739_29674_30039 121
530 3300046507 Ga0495606_0001449 Ga0495606_0001449_12044_12409 121
531 3300046507 Ga0495606_0001991 Ga0495606_0001991_22073_22438 121
532 3300046507 Ga0495606_0005173 Ga0495606_0005173_2415_2780 121
533 3300046507 Ga0495606_0005986 Ga0495606_0005986_8155_8520 121
534 3300046507 Ga0495606_0009760 Ga0495606_0009760_1944_2315 121
535 3300046507 Ga0495606_0014554 Ga0495606_0014554_3204_3569 121
536 3300046507 Ga0495606_0016068 Ga0495606_0016068_2990_3358 121
537 3300046507 Ga0495606_0034215 Ga0495606_0034215_1193_1561 121
538 3300046507 Ga0495606_0064873 Ga0495606_0064873_656_1027 121
539 3300046507 Ga0495606_0098452 Ga0495606_0098452_592_960 121
540 3300046507 Ga0495606_0165837 Ga0495606_0165837_193_564 121
541 3300046507 Ga0495606_0244541 Ga0495606_0244541_326_697 121
542 3300046507 Ga0495606_0299442 Ga0495606_0299442_239_607 121
543 3300046507 Ga0495606_0502114 Ga0495606_0502114_168_533 121
544 3300046511 Ga0495608_0003892 Ga0495608_0003892_722_1087 121
545 3300046511 Ga0495608_0179371 Ga0495608_0179371_738_1103 121
546 3300046512 Ga0495610_0000004 Ga0495610_0000004_808663_809028 121
547 3300046512 Ga0495610_0000488 Ga0495610_0000488_10015_10380 121
548 3300046512 Ga0495610_0003150 Ga0495610_0003150_3762_4151 121
549 3300046512 Ga0495610_0003558 Ga0495610_0003558_1754_2119 121
550 3300046512 Ga0495610_0040873 Ga0495610_0040873_374_739 121
551 3300046512 Ga0495610_0045311 Ga0495610_0045311_262_630 121
552 3300046513 Ga0495616_0000127 Ga0495616_0000127_16031_16402 121
553 3300046513 Ga0495616_0001387 Ga0495616_0001387_7791_8162 121
554 3300046513 Ga0495616_0002964 Ga0495616_0002964_9215_9583 121
555 3300046513 Ga0495616_0004969 Ga0495616_0004969_5916_6305 121
556 3300046513 Ga0495616_0006336 Ga0495616_0006336_5931_6299 121
557 3300046513 Ga0495616_0009563 Ga0495616_0009563_2102_2467 121
558 3300046513 Ga0495616_0011632 Ga0495616_0011632_2230_2619 121
559 3300046513 Ga0495616_0014397 Ga0495616_0014397_3552_3938 121
560 3300046513 Ga0495616_0018680 Ga0495616_0018680_869_1240 121
561 3300046513 Ga0495616_0018693 Ga0495616_0018693_440_808 121
562 3300046513 Ga0495616_0026088 Ga0495616_0026088_559_948 121
563 3300046513 Ga0495616_0077252 Ga0495616_0077252_434_802 121
564 3300046513 Ga0495616_0172171 Ga0495616_0172171_16_384 121
565 3300046513 Ga0495616_0196940 Ga0495616_0196940_358_747 121
566 3300046513 Ga0495616_0273190 Ga0495616_0273190_285_656 121
567 3300046514 Ga0495618_0001670 Ga0495618_0001670_12664_13029 121
568 3300046515 Ga0495620_0002814 Ga0495620_0002814_3084_3455 121
569 3300046515 Ga0495620_0123506 Ga0495620_0123506_567_956 121
570 3300046516 Ga0495628_0001597 Ga0495628_0001597_15373_15738 121
571 3300046516 Ga0495628_0071755 Ga0495628_0071755_461_826 121
572 3300046518 Ga0495631_0001340 Ga0495631_0001340_12241_12630 121
573 3300046518 Ga0495631_0007825 Ga0495631_0007825_2860_3249 121
574 3300046518 Ga0495631_0011904 Ga0495631_0011904_1677_2045 121
575 3300046518 Ga0495631_0016471 Ga0495631_0016471_1229_1597 121
576 3300046518 Ga0495631_0017741 Ga0495631_0017741_361_729 121
577 3300046518 Ga0495631_0021740 Ga0495631_0021740_13_384 121
578 3300046518 Ga0495631_0028009 Ga0495631_0028009_780_1151 121
579 3300046518 Ga0495631_0029961 Ga0495631_0029961_69_458 121
580 3300046518 Ga0495631_0044461 Ga0495631_0044461_1013_1381 121
581 3300046518 Ga0495631_0326057 Ga0495631_0326057_159_545 121
582 3300046519 Ga0495632_0000528 Ga0495632_0000528_26703_27092 121
583 3300046519 Ga0495632_0001000 Ga0495632_0001000_17376_17765 121
584 3300046519 Ga0495632_0003333 Ga0495632_0003333_2678_3049 121
585 3300046519 Ga0495632_0004780 Ga0495632_0004780_5240_5629 121
586 3300046519 Ga0495632_0009739 Ga0495632_0009739_2068_2436 121
587 3300046519 Ga0495632_0023994 Ga0495632_0023994_1970_2338 121
588 3300046519 Ga0495632_0033718 Ga0495632_0033718_1580_1945 121
589 3300046519 Ga0495632_0123448 Ga0495632_0123448_26_448 121
590 3300046520 Ga0495637_0000006 Ga0495637_0000006_268975_269364 121
591 3300046520 Ga0495637_0001248 Ga0495637_0001248_12020_12385 121
592 3300046520 Ga0495637_0001537 Ga0495637_0001537_7715_8080 121
593 3300046520 Ga0495637_0005830 Ga0495637_0005830_1208_1579 121
594 3300046520 Ga0495637_0026602 Ga0495637_0026602_1653_2042 121
595 3300046520 Ga0495637_0122791 Ga0495637_0122791_558_926 121
596 3300046522 Ga0495643_0000310 Ga0495643_0000310_18269_18634 121
597 3300046522 Ga0495643_0000913 Ga0495643_0000913_19818_20183 121
598 3300046522 Ga0495643_0001020 Ga0495643_0001020_16276_16644 121
599 3300046522 Ga0495643_0001894 Ga0495643_0001894_16446_16814 121
600 3300046522 Ga0495643_0003186 Ga0495643_0003186_5397_5762 121
601 3300046522 Ga0495643_0003449 Ga0495643_0003449_2688_3077 121
602 3300046522 Ga0495643_0007599 Ga0495643_0007599_4595_4963 121
603 3300046522 Ga0495643_0011313 Ga0495643_0011313_3560_3982 121
604 3300046522 Ga0495643_0016610 Ga0495643_0016610_1871_2239 121
605 3300046522 Ga0495643_0023625 Ga0495643_0023625_636_1025 121
606 3300046522 Ga0495643_0027069 Ga0495643_0027069_2702_3079 121
607 3300046522 Ga0495643_0027905 Ga0495643_0027905_1752_2123 121
608 3300046522 Ga0495643_0034089 Ga0495643_0034089_1221_1610 121
609 3300046522 Ga0495643_0034399 Ga0495643_0034399_96_485 121
610 3300046522 Ga0495643_0233991 Ga0495643_0233991_164_529 121
611 3300046523 Ga0495644_0003634 Ga0495644_0003634_3521_3889 121
612 3300046523 Ga0495644_0006629 Ga0495644_0006629_3417_3785 121
613 3300046523 Ga0495644_0008058 Ga0495644_0008058_2381_2746 121
614 3300046523 Ga0495644_0010942 Ga0495644_0010942_1206_1595 121
615 3300046523 Ga0495644_0012694 Ga0495644_0012694_397_786 121
616 3300046523 Ga0495644_0014324 Ga0495644_0014324_46_435 121
617 3300046523 Ga0495644_0017417 Ga0495644_0017417_2222_2611 121
618 3300046523 Ga0495644_0019651 Ga0495644_0019651_1892_2263 121
619 3300046523 Ga0495644_0046800 Ga0495644_0046800_873_1241 121
620 3300046523 Ga0495644_0158585 Ga0495644_0158585_400_786 121
621 3300046523 Ga0495644_0305778 Ga0495644_0305778_30_416 121
622 3300046524 Ga0495648_0000035 Ga0495648_0000035_16563_16928 121
623 3300046524 Ga0495648_0000044 Ga0495648_0000044_27294_27665 121
624 3300046524 Ga0495648_0001087 Ga0495648_0001087_12559_12927 121
625 3300046524 Ga0495648_0008151 Ga0495648_0008151_2098_2469 121
626 3300046524 Ga0495648_0008826 Ga0495648_0008826_145_510 121
627 3300046524 Ga0495648_0008883 Ga0495648_0008883_7287_7676 121
628 3300046524 Ga0495648_0010078 Ga0495648_0010078_2536_2925 121
629 3300046524 Ga0495648_0039687 Ga0495648_0039687_636_1001 121
630 3300046524 Ga0495648_0045418 Ga0495648_0045418_1563_1985 121
631 3300046524 Ga0495648_0059065 Ga0495648_0059065_245_616 121
632 3300046524 Ga0495648_0064059 Ga0495648_0064059_19_390 121
633 3300046524 Ga0495648_0073126 Ga0495648_0073126_276_665 121
634 3300046524 Ga0495648_0089492 Ga0495648_0089492_752_1141 121
635 3300046524 Ga0495648_0113466 Ga0495648_0113466_605_973 121
636 3300046524 Ga0495648_0115750 Ga0495648_0115750_737_1108 121
637 3300046525 Ga0495663_0003747 Ga0495663_0003747_2072_2446 121
638 3300046525 Ga0495663_0007261 Ga0495663_0007261_312_680 121
639 3300046525 Ga0495663_0010314 Ga0495663_0010314_2005_2376 121
640 3300046525 Ga0495663_0014881 Ga0495663_0014881_1342_1719 121
641 3300046525 Ga0495663_0338524 Ga0495663_0338524_15_386 121
642 3300046526 Ga0495666_0005259 Ga0495666_0005259_2320_2688 121
643 3300046526 Ga0495666_0076370 Ga0495666_0076370_410_778 121
644 3300046528 Ga0495642_0001209 Ga0495642_0001209_5738_6109 121
645 3300046528 Ga0495642_0001334 Ga0495642_0001334_6961_7332 121
646 3300046528 Ga0495642_0003266 Ga0495642_0003266_1746_2111 121
647 3300046528 Ga0495642_0004181 Ga0495642_0004181_629_1009 121
648 3300046528 Ga0495642_0005739 Ga0495642_0005739_562_951 121
649 3300046528 Ga0495642_0006318 Ga0495642_0006318_2203_2571 121
650 3300046528 Ga0495642_0007043 Ga0495642_0007043_2127_2492 121
651 3300046528 Ga0495642_0008667 Ga0495642_0008667_562_951 121
652 3300046528 Ga0495642_0020970 Ga0495642_0020970_1265_1654 121
653 3300046528 Ga0495642_0024065 Ga0495642_0024065_2022_2390 121
654 3300046528 Ga0495642_0031286 Ga0495642_0031286_756_1130 121
655 3300046528 Ga0495642_0044223 Ga0495642_0044223_1346_1714 121
656 3300046528 Ga0495642_0045035 Ga0495642_0045035_728_1117 121
657 3300046528 Ga0495642_0050089 Ga0495642_0050089_38_409 121
658 3300046528 Ga0495642_0052815 Ga0495642_0052815_436_801 121
659 3300046528 Ga0495642_0071236 Ga0495642_0071236_555_920 121
660 3300046528 Ga0495642_0092942 Ga0495642_0092942_107_496 121
661 3300046528 Ga0495642_0111903 Ga0495642_0111903_309_674 121
662 3300046528 Ga0495642_0145842 Ga0495642_0145842_407_778 121
663 3300046528 Ga0495642_0213213 Ga0495642_0213213_420_809 121
664 3300046528 Ga0495642_0289236 Ga0495642_0289236_90_479 121
665 3300046529 Ga0495652_0017904 Ga0495652_0017904_687_1052 121
666 3300046529 Ga0495652_0034379 Ga0495652_0034379_2539_2904 121
667 3300046529 Ga0495652_0267126 Ga0495652_0267126_434_799 121
668 3300046530 Ga0495654_0000005 Ga0495654_0000005_478857_479222 121
669 3300046530 Ga0495654_0006447 Ga0495654_0006447_2421_2810 121
670 3300046530 Ga0495654_0007512 Ga0495654_0007512_4348_4713 121
671 3300046530 Ga0495654_0010968 Ga0495654_0010968_246_614 121
672 3300046530 Ga0495654_0062130 Ga0495654_0062130_325_714 121
673 3300046530 Ga0495654_0067120 Ga0495654_0067120_193_558 121
674 3300046530 Ga0495654_0093499 Ga0495654_0093499_790_1179 121
675 3300046530 Ga0495654_0250639 Ga0495654_0250639_164_553 121
676 3300046530 Ga0495654_0283101 Ga0495654_0283101_88_453 121
677 3300046530 Ga0495654_0323196 Ga0495654_0323196_168_539 121
678 3300046530 Ga0495654_0326493 Ga0495654_0326493_62_433 121
679 3300046531 Ga0495665_0025869 Ga0495665_0025869_385_753 121
680 3300046533 Ga0495640_0239436 Ga0495640_0239436_186_554 121
681 3300046535 Ga0495586_0001037 Ga0495586_0001037_4490_4858 121
682 3300046537 Ga0495598_0044705 Ga0495598_0044705_342_707 121
683 3300046537 Ga0495598_0216947 Ga0495598_0216947_293_670 121
684 3300046538 Ga0495609_0000263 Ga0495609_0000263_14815_15180 121
685 3300046538 Ga0495609_0000522 Ga0495609_0000522_14341_14706 121
686 3300046538 Ga0495609_0001703 Ga0495609_0001703_12288_12656 121
687 3300046538 Ga0495609_0002206 Ga0495609_0002206_2311_2679 121
688 3300046538 Ga0495609_0006315 Ga0495609_0006315_2341_2709 121
689 3300046538 Ga0495609_0008047 Ga0495609_0008047_2787_3176 121
690 3300046538 Ga0495609_0008083 Ga0495609_0008083_2682_3047 121
691 3300046538 Ga0495609_0009501 Ga0495609_0009501_2083_2472 121
692 3300046538 Ga0495609_0013741 Ga0495609_0013741_1197_1568 121
693 3300046538 Ga0495609_0016289 Ga0495609_0016289_485_850 121
694 3300046538 Ga0495609_0021554 Ga0495609_0021554_76_444 121
695 3300046538 Ga0495609_0028846 Ga0495609_0028846_2070_2459 121
696 3300046538 Ga0495609_0038164 Ga0495609_0038164_1462_1833 121
697 3300046538 Ga0495609_0061253 Ga0495609_0061253_22_390 121
698 3300046538 Ga0495609_0066519 Ga0495609_0066519_546_935 121
699 3300046538 Ga0495609_0097307 Ga0495609_0097307_111_500 121
700 3300046538 Ga0495609_0125001 Ga0495609_0125001_59_427 121
701 3300046538 Ga0495609_0154109 Ga0495609_0154109_211_582 121
702 3300046538 Ga0495609_0305392 Ga0495609_0305392_259_627 121
703 3300046539 Ga0495621_0003609 Ga0495621_0003609_2465_2830 121
704 3300046539 Ga0495621_0018927 Ga0495621_0018927_1373_1750 121
705 3300046539 Ga0495621_0078933 Ga0495621_0078933_239_604 121
706 3300046542 Ga0495597_0000661 Ga0495597_0000661_7690_8055 121
707 3300046542 Ga0495597_0002790 Ga0495597_0002790_1688_2077 121
708 3300046542 Ga0495597_0009992 Ga0495597_0009992_1874_2239 121
709 3300046542 Ga0495597_0010760 Ga0495597_0010760_2008_2376 121
710 3300046542 Ga0495597_0015475 Ga0495597_0015475_1242_1610 121
711 3300046542 Ga0495597_0041789 Ga0495597_0041789_758_1129 121
712 3300046542 Ga0495597_0065319 Ga0495597_0065319_522_887 121
713 3300046542 Ga0495597_0068246 Ga0495597_0068246_555_926 121
714 3300046542 Ga0495597_0071296 Ga0495597_0071296_439_807 121
715 3300046542 Ga0495597_0123067 Ga0495597_0123067_202_570 121
716 3300046542 Ga0495597_0142340 Ga0495597_0142340_160_537 121
717 3300046542 Ga0495597_0147927 Ga0495597_0147927_213_635 121
718 3300046542 Ga0495597_0240248 Ga0495597_0240248_121_486 121
719 3300046542 Ga0495597_0268814 Ga0495597_0268814_192_569 121
720 3300046543 Ga0495645_0001078 Ga0495645_0001078_7158_7523 121
721 3300046543 Ga0495645_0094871 Ga0495645_0094871_800_1165 121
722 3300046543 Ga0495645_0499661 Ga0495645_0499661_80_448 121
723 3300046557 Ga0495622_0000007 Ga0495622_0000007_226906_227271 121
724 3300046557 Ga0495622_0000647 Ga0495622_0000647_2959_3324 121
725 3300046557 Ga0495622_0012715 Ga0495622_0012715_2534_2902 121
726 3300046557 Ga0495622_0023641 Ga0495622_0023641_515_883 121
727 3300046557 Ga0495622_0043181 Ga0495622_0043181_36_401 121
728 3300046557 Ga0495622_0206844 Ga0495622_0206844_490_858 121
729 3300046558 Ga0495633_0001178 Ga0495633_0001178_18380_18751 121
730 3300046558 Ga0495633_0001517 Ga0495633_0001517_825_1190 121
731 3300046558 Ga0495633_0001537 Ga0495633_0001537_16551_16916 121
732 3300046558 Ga0495633_0001997 Ga0495633_0001997_6172_6540 121
733 3300046558 Ga0495633_0003566 Ga0495633_0003566_9301_9669 121
734 3300046558 Ga0495633_0003570 Ga0495633_0003570_9792_10157 121
735 3300046558 Ga0495633_0004499 Ga0495633_0004499_5763_6152 121
736 3300046558 Ga0495633_0006255 Ga0495633_0006255_4312_4680 121
737 3300046558 Ga0495633_0007718 Ga0495633_0007718_2018_2389 121
738 3300046558 Ga0495633_0009406 Ga0495633_0009406_4566_4952 121
739 3300046558 Ga0495633_0011366 Ga0495633_0011366_1001_1369 121
740 3300046558 Ga0495633_0011677 Ga0495633_0011677_2866_3234 121
741 3300046558 Ga0495633_0011725 Ga0495633_0011725_1278_1643 121
742 3300046558 Ga0495633_0013595 Ga0495633_0013595_108_497 121
743 3300046558 Ga0495633_0027396 Ga0495633_0027396_1981_2352 121
744 3300046558 Ga0495633_0032989 Ga0495633_0032989_367_738 121
745 3300046558 Ga0495633_0044205 Ga0495633_0044205_406_777 121
746 3300046558 Ga0495633_0109516 Ga0495633_0109516_336_704 121
747 3300046558 Ga0495633_0140074 Ga0495633_0140074_243_614 121
748 3300046558 Ga0495633_0214205 Ga0495633_0214205_289_654 121
749 3300046615 Ga0495656_0008255 Ga0495656_0008255_2201_2566 121
750 3300046615 Ga0495656_0070551 Ga0495656_0070551_1075_1443 121
751 3300046615 Ga0495656_0081229 Ga0495656_0081229_217_585 121
752 3300046615 Ga0495656_0104595 Ga0495656_0104595_835_1206 121
753 3300046615 Ga0495656_0175050 Ga0495656_0175050_114_503 121
754 3300046615 Ga0495656_0194495 Ga0495656_0194495_329_718 121
755 3300046615 Ga0495656_0354871 Ga0495656_0354871_199_570 121
756 3300046615 Ga0495656_0475357 Ga0495656_0475357_147_536 121
757 3300046616 Ga0495668_0000049 Ga0495668_0000049_185998_186363 121
758 3300046616 Ga0495668_0000870 Ga0495668_0000870_12165_12530 121
759 3300046616 Ga0495668_0001126 Ga0495668_0001126_24820_25209 121
760 3300046616 Ga0495668_0001558 Ga0495668_0001558_4373_4762 121
761 3300046616 Ga0495668_0001735 Ga0495668_0001735_2428_2796 121
762 3300046616 Ga0495668_0001791 Ga0495668_0001791_2760_3125 121
763 3300046616 Ga0495668_0001845 Ga0495668_0001845_11244_11609 121
764 3300046616 Ga0495668_0003170 Ga0495668_0003170_928_1299 121
765 3300046616 Ga0495668_0003180 Ga0495668_0003180_11975_12340 121
766 3300046616 Ga0495668_0021374 Ga0495668_0021374_2681_3052 121
767 3300046616 Ga0495668_0023008 Ga0495668_0023008_1784_2152 121
768 3300046616 Ga0495668_0029327 Ga0495668_0029327_992_1360 121
769 3300046616 Ga0495668_0038466 Ga0495668_0038466_1879_2244 121
770 3300046616 Ga0495668_0053620 Ga0495668_0053620_1807_2178 121
771 3300046616 Ga0495668_0088368 Ga0495668_0088368_949_1326 121
772 3300046616 Ga0495668_0091515 Ga0495668_0091515_165_533 121
773 3300046616 Ga0495668_0104988 Ga0495668_0104988_54_443 121
774 3300046616 Ga0495668_0120982 Ga0495668_0120982_956_1321 121
775 3300046616 Ga0495668_0169135 Ga0495668_0169135_445_813 121
776 3300046616 Ga0495668_0571838 Ga0495668_0571838_165_551 121
777 3300046616 Ga0495668_0775091 Ga0495668_0775091_108_476 121
778 3300046642 Ga0495634_0275964 Ga0495634_0275964_378_746 121
779 3300046642 Ga0495634_0278362 Ga0495634_0278362_93_458 121
780 3300046648 Ga0495611_0000309 Ga0495611_0000309_17578_17967 121
781 3300046648 Ga0495611_0001713 Ga0495611_0001713_137_526 121
782 3300046648 Ga0495611_0017683 Ga0495611_0017683_2031_2402 121
783 3300046648 Ga0495611_0020206 Ga0495611_0020206_1858_2226 121
784 3300046648 Ga0495611_0069993 Ga0495611_0069993_317_706 121
785 3300046648 Ga0495611_0129245 Ga0495611_0129245_265_654 121
786 3300046648 Ga0495611_0131030 Ga0495611_0131030_306_677 121
787 3300046648 Ga0495611_0134353 Ga0495611_0134353_748_1116 121
788 3300046648 Ga0495611_0136846 Ga0495611_0136846_227_595 121
789 3300046648 Ga0495611_0138632 Ga0495611_0138632_319_690 121
790 3300046648 Ga0495611_0250175 Ga0495611_0250175_84_452 121
791 3300046660 Ga0495625_0002475 Ga0495625_0002475_2988_3353 121
792 3300046660 Ga0495625_0003554 Ga0495625_0003554_12112_12477 121
793 3300046660 Ga0495625_0004968 Ga0495625_0004968_8385_8750 121
794 3300046660 Ga0495625_0007783 Ga0495625_0007783_8722_9090 121
795 3300046660 Ga0495625_0010369 Ga0495625_0010369_3666_4034 121
796 3300046660 Ga0495625_0012192 Ga0495625_0012192_1889_2254 121
797 3300046660 Ga0495625_0021346 Ga0495625_0021346_2160_2549 121
798 3300046660 Ga0495625_0022981 Ga0495625_0022981_2018_2383 121
799 3300046660 Ga0495625_0232184 Ga0495625_0232184_365_733 121
800 3300046660 Ga0495625_0236363 Ga0495625_0236363_103_492 121
801 3300046660 Ga0495625_0478164 Ga0495625_0478164_361_750 121
802 3300046660 Ga0495625_0479896 Ga0495625_0479896_137_526 121
803 3300046660 Ga0495625_0518442 Ga0495625_0518442_211_579 121
804 3300046660 Ga0495625_0702263 Ga0495625_0702263_60_428 121
805 3300046663 Ga0495635_0007460 Ga0495635_0007460_4706_5074 121
806 3300046663 Ga0495635_0011840 Ga0495635_0011840_4255_4620 121
807 3300046664 Ga0495659_0000098 Ga0495659_0000098_25009_25377 121
808 3300046664 Ga0495659_0003068 Ga0495659_0003068_1864_2232 121
809 3300046664 Ga0495659_0003230 Ga0495659_0003230_3234_3599 121
810 3300046664 Ga0495659_0234042 Ga0495659_0234042_261_650 121
811 3300046665 Ga0495661_0001348 Ga0495661_0001348_16812_17234 121
812 3300046665 Ga0495661_0001776 Ga0495661_0001776_5440_5805 121
813 3300046665 Ga0495661_0002306 Ga0495661_0002306_12049_12438 121
814 3300046665 Ga0495661_0002579 Ga0495661_0002579_3310_3678 121
815 3300046665 Ga0495661_0002865 Ga0495661_0002865_4185_4553 121
816 3300046665 Ga0495661_0004938 Ga0495661_0004938_1789_2154 121
817 3300046665 Ga0495661_0008128 Ga0495661_0008128_2584_2973 121
818 3300046665 Ga0495661_0009735 Ga0495661_0009735_4917_5285 121
819 3300046665 Ga0495661_0009828 Ga0495661_0009828_1430_1795 121
820 3300046665 Ga0495661_0015411 Ga0495661_0015411_2561_2932 121
821 3300046665 Ga0495661_0028103 Ga0495661_0028103_1122_1490 121
822 3300046665 Ga0495661_0035757 Ga0495661_0035757_729_1118 121
823 3300046665 Ga0495661_0055279 Ga0495661_0055279_689_1078 121
824 3300046665 Ga0495661_0074609 Ga0495661_0074609_1292_1663 121
825 3300046665 Ga0495661_0087081 Ga0495661_0087081_472_843 121
826 3300046665 Ga0495661_0142818 Ga0495661_0142818_751_1140 121
827 3300046665 Ga0495661_0198884 Ga0495661_0198884_18_386 121
828 3300046665 Ga0495661_0231139 Ga0495661_0231139_310_699 121
829 3300046665 Ga0495661_0275657 Ga0495661_0275657_175_564 121
830 3300046665 Ga0495661_0297967 Ga0495661_0297967_298_663 121
831 3300046665 Ga0495661_0371209 Ga0495661_0371209_137_526 121
832 3300046674 Ga0495588_0000135 Ga0495588_0000135_99808_100188 121
833 3300046674 Ga0495588_0007712 Ga0495588_0007712_3326_3715 121
834 3300046674 Ga0495588_0010214 Ga0495588_0010214_2388_2777 121
835 3300046674 Ga0495588_0014725 Ga0495588_0014725_854_1222 121
836 3300046674 Ga0495588_0015013 Ga0495588_0015013_2085_2453 121
837 3300046674 Ga0495588_0026816 Ga0495588_0026816_2206_2574 121
838 3300046674 Ga0495588_0036480 Ga0495588_0036480_426_794 121
839 3300046674 Ga0495588_0132810 Ga0495588_0132810_292_660 121
840 3300046674 Ga0495588_0339675 Ga0495588_0339675_365_751 121
841 3300046675 Ga0495657_0064708 Ga0495657_0064708_328_693 121
842 3300046678 Ga0495599_0025672 Ga0495599_0025672_1457_1822 121
843 3300046679 Ga0495623_0033229 Ga0495623_0033229_1350_1718 121
844 3300046679 Ga0495623_0033624 Ga0495623_0033624_924_1289 121
845 3300046680 Ga0495646_0000285 Ga0495646_0000285_8419_8784 121
846 3300046680 Ga0495646_0239067 Ga0495646_0239067_44_409 121
847 3300046684 Ga0495669_0000418 Ga0495669_0000418_15727_16092 121
848 3300046684 Ga0495669_0000709 Ga0495669_0000709_11760_12128 121
849 3300046684 Ga0495669_0006185 Ga0495669_0006185_2178_2546 121
850 3300046684 Ga0495669_0009028 Ga0495669_0009028_2434_2823 121
851 3300046684 Ga0495669_0013447 Ga0495669_0013447_2131_2520 121
852 3300046684 Ga0495669_0015227 Ga0495669_0015227_791_1180 121
853 3300046684 Ga0495669_0015733 Ga0495669_0015733_1893_2279 121
854 3300046684 Ga0495669_0156418 Ga0495669_0156418_447_836 121
855 3300046684 Ga0495669_0291035 Ga0495669_0291035_88_459 121
856 3300046684 Ga0495669_0417612 Ga0495669_0417612_147_536 121
857 3300046689 Ga0495613_0007519 Ga0495613_0007519_393_761 121
858 3300046690 Ga0495624_0203742 Ga0495624_0203742_45_410 121
859 3300046690 Ga0495624_0228684 Ga0495624_0228684_121_489 121
860 3300046691 Ga0495670_0002227 Ga0495670_0002227_6995_7363 121
861 3300046691 Ga0495670_0002728 Ga0495670_0002728_5938_6309 121
862 3300046691 Ga0495670_0006284 Ga0495670_0006284_1448_1816 121
863 3300046691 Ga0495670_0010308 Ga0495670_0010308_2762_3133 121
864 3300046691 Ga0495670_0014762 Ga0495670_0014762_50_418 121
865 3300046691 Ga0495670_0022066 Ga0495670_0022066_2013_2399 121
866 3300046691 Ga0495670_0028077 Ga0495670_0028077_1919_2287 121
867 3300046691 Ga0495670_0036880 Ga0495670_0036880_1960_2349 121
868 3300046691 Ga0495670_0182120 Ga0495670_0182120_588_956 121
869 3300046691 Ga0495670_0206352 Ga0495670_0206352_151_540 121
870 3300046691 Ga0495670_0285283 Ga0495670_0285283_109_480 121
871 3300046691 Ga0495670_0380929 Ga0495670_0380929_339_704 121
872 3300046691 Ga0495670_0500903 Ga0495670_0500903_257_646 121
873 3300046691 Ga0495670_0546673 Ga0495670_0546673_136_507 121
874 3300046691 Ga0495670_0602023 Ga0495670_0602023_47_415 121
875 3300046692 Ga0495671_0000522 Ga0495671_0000522_13040_13408 121
876 3300046692 Ga0495671_0001580 Ga0495671_0001580_4615_4980 121
877 3300046692 Ga0495671_0001604 Ga0495671_0001604_5453_5842 121
878 3300046692 Ga0495671_0004942 Ga0495671_0004942_6794_7183 121
879 3300046692 Ga0495671_0024470 Ga0495671_0024470_906_1295 121
880 3300046692 Ga0495671_0060063 Ga0495671_0060063_753_1121 121
881 3300046692 Ga0495671_0221640 Ga0495671_0221640_351_716 121
882 3300046692 Ga0495671_0457872 Ga0495671_0457872_71_436 121
883 3300046692 Ga0495671_0568508 Ga0495671_0568508_138_503 121
884 3300046694 Ga0495649_0000625 Ga0495649_0000625_16685_17074 121
885 3300046694 Ga0495649_0001995 Ga0495649_0001995_4727_5092 121
886 3300046694 Ga0495649_0002444 Ga0495649_0002444_11550_11915 121
887 3300046694 Ga0495649_0003490 Ga0495649_0003490_4736_5104 121
888 3300046694 Ga0495649_0033838 Ga0495649_0033838_733_1122 121
889 3300046694 Ga0495649_0035799 Ga0495649_0035799_690_1058 121
890 3300046694 Ga0495649_0041594 Ga0495649_0041594_561_983 121
891 3300046694 Ga0495649_0051533 Ga0495649_0051533_667_1056 121
892 3300046694 Ga0495649_0078605 Ga0495649_0078605_861_1226 121
893 3300046694 Ga0495649_0119809 Ga0495649_0119809_133_498 121
894 3300046694 Ga0495649_0181300 Ga0495649_0181300_141_506 121
895 3300046694 Ga0495649_0262273 Ga0495649_0262273_120_500 121
896 3300046694 Ga0495649_0676702 Ga0495649_0676702_14_385 121
897 3300046794 Ga0495589_0000842 Ga0495589_0000842_18339_18728 121
898 3300046794 Ga0495589_0000949 Ga0495589_0000949_5498_5920 121
899 3300046794 Ga0495589_0002913 Ga0495589_0002913_4816_5205 121
900 3300046794 Ga0495589_0009623 Ga0495589_0009623_4604_4993 121
901 3300046794 Ga0495589_0018914 Ga0495589_0018914_2402_2770 121
902 3300046794 Ga0495589_0025725 Ga0495589_0025725_2136_2504 121
903 3300046794 Ga0495589_0027055 Ga0495589_0027055_2121_2492 121
904 3300046794 Ga0495589_0098429 Ga0495589_0098429_20_388 121
905 3300046794 Ga0495589_0123280 Ga0495589_0123280_309_677 121
906 3300046794 Ga0495589_0206579 Ga0495589_0206579_86_454 121
907 3300046794 Ga0495589_0269778 Ga0495589_0269778_53_421 121
908 3300046794 Ga0495589_0344888 Ga0495589_0344888_67_438 121
909 3300046794 Ga0495589_0426032 Ga0495589_0426032_119_484 121
910 3300046809 Ga0495600_0006927 Ga0495600_0006927_45_410 121
911 3300046810 Ga0495660_0000103 Ga0495660_0000103_58103_58525 121
912 3300046810 Ga0495660_0000292 Ga0495660_0000292_20306_20671 121
913 3300046810 Ga0495660_0001344 Ga0495660_0001344_7801_8166 121
914 3300046810 Ga0495660_0001351 Ga0495660_0001351_11919_12287 121
915 3300046810 Ga0495660_0008093 Ga0495660_0008093_332_721 121
916 3300046810 Ga0495660_0010404 Ga0495660_0010404_59_427 121
917 3300046810 Ga0495660_0016379 Ga0495660_0016379_1951_2322 121
918 3300046810 Ga0495660_0017917 Ga0495660_0017917_290_655 121
919 3300046810 Ga0495660_0034065 Ga0495660_0034065_792_1157 121
920 3300046810 Ga0495660_0036009 Ga0495660_0036009_1722_2087 121
921 3300046810 Ga0495660_0036362 Ga0495660_0036362_494_883 121
922 3300046810 Ga0495660_0037909 Ga0495660_0037909_667_1089 121
923 3300046810 Ga0495660_0038694 Ga0495660_0038694_2142_2531 121
924 3300046810 Ga0495660_0117131 Ga0495660_0117131_313_678 121
925 3300046810 Ga0495660_0182985 Ga0495660_0182985_98_487 121
926 3300046810 Ga0495660_0192990 Ga0495660_0192990_62_451 121
927 3300046810 Ga0495660_0244801 Ga0495660_0244801_32_397 121
928 3300047315 Ga0495581_0002842 Ga0495581_0002842_8728_9096 121
929 3300047317 Ga0495604_0004661 Ga0495604_0004661_6937_7302 121
930 3300047317 Ga0495604_0030816 Ga0495604_0030816_1709_2077 121
931 3300047317 Ga0495604_0173083 Ga0495604_0173083_1030_1398 121
932 3300047318 Ga0495636_0000150 Ga0495636_0000150_14660_15028 121
933 3300047318 Ga0495636_0004296 Ga0495636_0004296_1373_1744 121
934 3300047318 Ga0495636_0006568 Ga0495636_0006568_3778_4143 121
935 3300047318 Ga0495636_0026944 Ga0495636_0026944_684_1055 121
936 3300047318 Ga0495636_0049261 Ga0495636_0049261_474_848 121
937 3300047318 Ga0495636_0052711 Ga0495636_0052711_949_1326 121
938 3300047318 Ga0495636_0393213 Ga0495636_0393213_238_627 121
939 3300047318 Ga0495636_0447040 Ga0495636_0447040_229_597 121
940 3300047320 Ga0495672_0000060 Ga0495672_0000060_171336_171701 121
941 3300047320 Ga0495672_0000118 Ga0495672_0000118_22880_23269 121
942 3300047320 Ga0495672_0000287 Ga0495672_0000287_19590_19958 121
943 3300047320 Ga0495672_0000898 Ga0495672_0000898_12275_12640 121
944 3300047320 Ga0495672_0001340 Ga0495672_0001340_18274_18696 121
945 3300047320 Ga0495672_0001430 Ga0495672_0001430_12123_12512 121
946 3300047320 Ga0495672_0002971 Ga0495672_0002971_12486_12854 121
947 3300047320 Ga0495672_0010725 Ga0495672_0010725_3847_4215 121
948 3300047320 Ga0495672_0034099 Ga0495672_0034099_2006_2395 121
949 3300047320 Ga0495672_0064879 Ga0495672_0064879_458_826 121
950 3300047320 Ga0495672_0140221 Ga0495672_0140221_735_1103 121
951 3300047320 Ga0495672_0149661 Ga0495672_0149661_514_882 121
952 3300047320 Ga0495672_0306288 Ga0495672_0306288_70_438 121
953 3300047320 Ga0495672_0378575 Ga0495672_0378575_123_509 121
954 3300047321 Ga0495676_0000627 Ga0495676_0000627_16842_17210 121
955 3300047321 Ga0495676_0096537 Ga0495676_0096537_1392_1760 121
956 3300047322 Ga0495680_0042131 Ga0495680_0042131_2249_2617 121
957 3300047323 Ga0495683_0000583 Ga0495683_0000583_10028_10417 121
958 3300047323 Ga0495683_0001699 Ga0495683_0001699_2006_2374 121
959 3300047323 Ga0495683_0003062 Ga0495683_0003062_7900_8271 121
960 3300047323 Ga0495683_0009992 Ga0495683_0009992_2259_2624 121
961 3300047323 Ga0495683_0016496 Ga0495683_0016496_895_1263 121
962 3300047323 Ga0495683_0022174 Ga0495683_0022174_2402_2773 121
963 3300047323 Ga0495683_0043950 Ga0495683_0043950_70_438 121
964 3300047323 Ga0495683_0047302 Ga0495683_0047302_341_712 121
965 3300047323 Ga0495683_0068015 Ga0495683_0068015_668_1033 121
966 3300047323 Ga0495683_0073567 Ga0495683_0073567_165_533 121
967 3300047323 Ga0495683_0090668 Ga0495683_0090668_280_651 121
968 3300047323 Ga0495683_0092763 Ga0495683_0092763_547_936 121
969 3300047323 Ga0495683_0184228 Ga0495683_0184228_136_525 121
970 3300047323 Ga0495683_0219569 Ga0495683_0219569_344_712 121
971 3300047323 Ga0495683_0449890 Ga0495683_0449890_80_448 121
972 3300047443 Ga0495687_000166 Ga0495687_000166_31581_31970 121
973 3300047443 Ga0495687_000643 Ga0495687_000643_3340_3708 121
974 3300047443 Ga0495687_001343 Ga0495687_001343_20259_20624 121
975 3300047443 Ga0495687_001347 Ga0495687_001347_2286_2651 121
976 3300047443 Ga0495687_004217 Ga0495687_004217_3846_4211 121
977 3300047443 Ga0495687_010853 Ga0495687_010853_2731_3153 121
978 3300047443 Ga0495687_015152 Ga0495687_015152_2266_2631 121
979 3300047443 Ga0495687_022739 Ga0495687_022739_508_873 121
980 3300047443 Ga0495687_051024 Ga0495687_051024_326_697 121
981 3300047444 Ga0495675_0002333 Ga0495675_0002333_6327_6695 121
982 3300047445 Ga0495677_0000591 Ga0495677_0000591_12429_12818 121
983 3300047445 Ga0495677_0000741 Ga0495677_0000741_2625_2993 121
984 3300047445 Ga0495677_0002907 Ga0495677_0002907_5663_6085 121
985 3300047445 Ga0495677_0004221 Ga0495677_0004221_1326_1694 121
986 3300047445 Ga0495677_0004236 Ga0495677_0004236_1810_2196 121
987 3300047445 Ga0495677_0006225 Ga0495677_0006225_2172_2561 121
988 3300047445 Ga0495677_0015589 Ga0495677_0015589_1487_1855 121
989 3300047445 Ga0495677_0018081 Ga0495677_0018081_1001_1381 121
990 3300047445 Ga0495677_0020160 Ga0495677_0020160_621_986 121
991 3300047445 Ga0495677_0028509 Ga0495677_0028509_1572_1940 121
992 3300047445 Ga0495677_0036812 Ga0495677_0036812_1267_1632 121
993 3300047445 Ga0495677_0043173 Ga0495677_0043173_810_1181 121
994 3300047445 Ga0495677_0048108 Ga0495677_0048108_124_513 121
995 3300047445 Ga0495677_0058984 Ga0495677_0058984_997_1386 121
996 3300047445 Ga0495677_0418340 Ga0495677_0418340_49_417 121
997 3300047446 Ga0495679_002749 Ga0495679_002749_1342_1710 121
998 3300047446 Ga0495679_012953 Ga0495679_012953_827_1192 121
999 3300047446 Ga0495679_016380 Ga0495679_016380_950_1315 121
1000 3300047446 Ga0495679_206436 Ga0495679_206436_133_498 121
1001 3300047447 Ga0495685_000005 Ga0495685_000005_95484_95852 121
1002 3300047447 Ga0495685_012012 Ga0495685_012012_1915_2280 121
1003 3300047447 Ga0495685_017039 Ga0495685_017039_1896_2270 121
1004 3300047447 Ga0495685_019160 Ga0495685_019160_1698_2087 121
1005 3300047447 Ga0495685_041442 Ga0495685_041442_222_611 121
1006 3300047447 Ga0495685_048078 Ga0495685_048078_822_1190 121
1007 3300047447 Ga0495685_143138 Ga0495685_143138_53_424 121
1008 3300047469 Ga0495673_0000017 Ga0495673_0000017_493768_494133 121
1009 3300047469 Ga0495673_0000027 Ga0495673_0000027_313649_314014 121
1010 3300047469 Ga0495673_0000037 Ga0495673_0000037_276859_277227 121
1011 3300047469 Ga0495673_0013639 Ga0495673_0013639_1347_1715 121
1012 3300047469 Ga0495673_0110443 Ga0495673_0110443_693_1082 121
1013 3300047470 Ga0495681_0001040 Ga0495681_0001040_11795_12184 121
1014 3300047470 Ga0495681_0005013 Ga0495681_0005013_6377_6745 121
1015 3300047470 Ga0495681_0011554 Ga0495681_0011554_2171_2539 121
1016 3300047470 Ga0495681_0013834 Ga0495681_0013834_684_1049 121
1017 3300047470 Ga0495681_0016191 Ga0495681_0016191_14_379 121
1018 3300047470 Ga0495681_0032233 Ga0495681_0032233_1944_2315 121
1019 3300047470 Ga0495681_0035330 Ga0495681_0035330_1895_2266 121
1020 3300047470 Ga0495681_0038865 Ga0495681_0038865_1119_1490 121
1021 3300047470 Ga0495681_0044998 Ga0495681_0044998_453_821 121
1022 3300047470 Ga0495681_0132569 Ga0495681_0132569_424_792 121
1023 3300047470 Ga0495681_0199333 Ga0495681_0199333_187_558 121
1024 3300047472 Ga0495686_0000835 Ga0495686_0000835_22342_22710 121
1025 3300047472 Ga0495686_0001637 Ga0495686_0001637_3717_4109 121
1026 3300047472 Ga0495686_0001807 Ga0495686_0001807_9025_9390 121
1027 3300047472 Ga0495686_0007776 Ga0495686_0007776_5500_5865 121
1028 3300047472 Ga0495686_0033246 Ga0495686_0033246_1050_1439 121
1029 3300047472 Ga0495686_0056647 Ga0495686_0056647_1469_1858 121
1030 3300047472 Ga0495686_0060143 Ga0495686_0060143_1284_1649 121
1031 3300047472 Ga0495686_0170727 Ga0495686_0170727_631_1053 121
1032 3300047472 Ga0495686_0194212 Ga0495686_0194212_431_796 121
1033 3300047472 Ga0495686_0438652 Ga0495686_0438652_274_663 121
1034 3300047673 Ga0495593_0007449 Ga0495593_0007449_4724_5092 121
1035 3300048088 Ga0495602_0019738 Ga0495602_0019738_5722_6087 121
1036 3300048088 Ga0495602_0245230 Ga0495602_0245230_492_860 121
1037 3300048089 Ga0495614_0006146 Ga0495614_0006146_807_1175 121
1038 3300048090 Ga0495615_0001550 Ga0495615_0001550_763_1128 121
1039 3300048090 Ga0495615_0002620 Ga0495615_0002620_154_531 121
1040 3300048090 Ga0495615_0032635 Ga0495615_0032635_161_550 121
1041 3300048091 Ga0495626_0000006 Ga0495626_0000006_181822_182244 121
1042 3300048091 Ga0495626_0000034 Ga0495626_0000034_32957_33325 121
1043 3300048091 Ga0495626_0013376 Ga0495626_0013376_156_527 121
1044 3300048091 Ga0495626_0020564 Ga0495626_0020564_1814_2185 121
1045 3300048091 Ga0495626_0023237 Ga0495626_0023237_2078_2449 121
1046 3300048091 Ga0495626_0027647 Ga0495626_0027647_2218_2607 121
1047 3300048091 Ga0495626_0072542 Ga0495626_0072542_876_1241 121
1048 3300048091 Ga0495626_0075080 Ga0495626_0075080_687_1055 121
1049 3300048091 Ga0495626_0152932 Ga0495626_0152932_42_410 121
1050 3300048091 Ga0495626_0195305 Ga0495626_0195305_349_717 121
1051 3300048091 Ga0495626_0239452 Ga0495626_0239452_170_535 121
1052 3300048091 Ga0495626_0298136 Ga0495626_0298136_126_515 121
1053 3300048903 Ga0496100_0006489 Ga0496100_0006489_974_1363 121
1054 3300048903 Ga0496100_0168078 Ga0496100_0168078_692_1057 121
1055 3300048903 Ga0496100_0190911 Ga0496100_0190911_76_444 121
1056 3300048903 Ga0496100_0194521 Ga0496100_0194521_457_822 121
1057 3300048904 Ga0496101_0027034 Ga0496101_0027034_2559_2948 121
1058 3300048904 Ga0496101_0048199 Ga0496101_0048199_310_675 121
1059 3300048904 Ga0496101_0495374 Ga0496101_0495374_129_494 121
1060 3300048905 Ga0496102_0000425 Ga0496102_0000425_17378_17752 121
1061 3300048905 Ga0496102_0006303 Ga0496102_0006303_8998_9363 121
1062 3300048905 Ga0496102_0022023 Ga0496102_0022023_2522_2893 121
1063 3300048905 Ga0496102_0046741 Ga0496102_0046741_1115_1486 121
1064 3300048905 Ga0496102_0465214 Ga0496102_0465214_409_777 121
1065 3300048905 Ga0496102_1548317 Ga0496102_1548317_132_521 121
1066 3300048905 Ga0496102_1573258 Ga0496102_1573258_22_393 121
1067 3300048906 Ga0496103_0018620 Ga0496103_0018620_1278_1649 121
1068 3300048906 Ga0496103_0021620 Ga0496103_0021620_1241_1606 121
1069 3300048906 Ga0496103_0023999 Ga0496103_0023999_2530_2895 121
1070 3300048906 Ga0496103_0026856 Ga0496103_0026856_2407_2796 121
1071 3300048906 Ga0496103_0058701 Ga0496103_0058701_1503_1874 121
1072 3300048906 Ga0496103_0093400 Ga0496103_0093400_1304_1672 121
1073 3300048906 Ga0496103_0093446 Ga0496103_0093446_1279_1647 121
1074 3300048906 Ga0496103_0266264 Ga0496103_0266264_302_676 121
1075 3300048907 Ga0496104_0120717 Ga0496104_0120717_1518_1907 121
1076 3300048907 Ga0496104_0295922 Ga0496104_0295922_468_836 121
1077 3300048907 Ga0496104_0760934 Ga0496104_0760934_159_524 121
1078 3300048907 Ga0496104_1362985 Ga0496104_1362985_223_588 121
1079 3300048908 Ga0496105_0044237 Ga0496105_0044237_1260_1625 121
1080 3300048908 Ga0496105_0247694 Ga0496105_0247694_596_985 121
1081 3300048908 Ga0496105_0440681 Ga0496105_0440681_30_398 121
1082 3300048909 Ga0496106_0030395 Ga0496106_0030395_632_1033 121
1083 3300048909 Ga0496106_0354971 Ga0496106_0354971_113_481 121
1084 3300048909 Ga0496106_0373138 Ga0496106_0373138_216_581 121
1085 3300048910 Ga0496107_0046130 Ga0496107_0046130_1756_2121 121
1086 3300048910 Ga0496107_0190755 Ga0496107_0190755_860_1225 121
1087 3300048911 Ga0496108_0038650 Ga0496108_0038650_1519_1884 121
1088 3300048911 Ga0496108_0333524 Ga0496108_0333524_377_745 121
1089 3300048911 Ga0496108_0476632 Ga0496108_0476632_663_1052 121
1090 3300048912 Ga0496109_0014808 Ga0496109_0014808_3755_4120 121
1091 3300048912 Ga0496109_0053148 Ga0496109_0053148_2363_2752 121
1092 3300048913 Ga0496110_0001377 Ga0496110_0001377_5212_5601 121
1093 3300048913 Ga0496110_0228491 Ga0496110_0228491_373_741 121
1094 3300048913 Ga0496110_0445924 Ga0496110_0445924_301_666 121
1095 3300048914 Ga0496111_0006801 Ga0496111_0006801_1697_2098 121
1096 3300048914 Ga0496111_0025600 Ga0496111_0025600_3166_3531 121
1097 3300048915 Ga0496112_0345808 Ga0496112_0345808_298_720 121
1098 3300048915 Ga0496112_0502582 Ga0496112_0502582_250_639 121
1099 3300048916 Ga0496113_0008943 Ga0496113_0008943_2664_3032 121
1100 3300048916 Ga0496113_0805212 Ga0496113_0805212_87_455 121
1101 3300048917 Ga0496114_0039572 Ga0496114_0039572_1280_1645 121
1102 3300048917 Ga0496114_0304003 Ga0496114_0304003_359_724 121
1103 3300048917 Ga0496114_0748214 Ga0496114_0748214_238_606 121
1104 3300048918 Ga0496115_0075225 Ga0496115_0075225_1979_2344 121
1105 3300048918 Ga0496115_0227726 Ga0496115_0227726_612_1001 121
1106 3300048918 Ga0496115_0464764 Ga0496115_0464764_284_652 121
1107 3300048918 Ga0496115_0781379 Ga0496115_0781379_69_437 121
1108 3300048919 Ga0496116_0026546 Ga0496116_0026546_2730_3095 121
1109 3300048919 Ga0496116_0028076 Ga0496116_0028076_3060_3461 121
1110 3300048919 Ga0496116_0274062 Ga0496116_0274062_382_747 121
1111 3300048919 Ga0496116_0307751 Ga0496116_0307751_355_720 121
1112 3300048920 Ga0496117_0000010 Ga0496117_0000010_67127_67528 121
1113 3300048921 Ga0496118_0000009 Ga0496118_0000009_544427_544828 121
1114 3300048921 Ga0496118_0305518 Ga0496118_0305518_201_566 121
1115 3300048922 Ga0496119_0099467 Ga0496119_0099467_40_405 121
1116 3300048924 Ga0496121_0005441 Ga0496121_0005441_2245_2646 121
1117 3300048924 Ga0496121_0071276 Ga0496121_0071276_1375_1740 121
1118 3300048925 Ga0496122_0004008 Ga0496122_0004008_8306_8695 121
1119 3300048925 Ga0496122_0004725 Ga0496122_0004725_3024_3392 121
1120 3300048925 Ga0496122_0005895 Ga0496122_0005895_11931_12332 121
1121 3300048925 Ga0496122_0046226 Ga0496122_0046226_2458_2823 121
1122 3300048925 Ga0496122_0081450 Ga0496122_0081450_1025_1390 121
1123 3300048926 Ga0496123_0003163 Ga0496123_0003163_12980_13345 121
1124 3300048926 Ga0496123_0003697 Ga0496123_0003697_6001_6402 121
1125 3300048926 Ga0496123_0004453 Ga0496123_0004453_4181_4570 121
1126 3300048926 Ga0496123_0042568 Ga0496123_0042568_1823_2191 121
1127 3300048927 Ga0496124_0002258 Ga0496124_0002258_13239_13607 121
1128 3300048927 Ga0496124_0118291 Ga0496124_0118291_109_477 121
1129 3300048927 Ga0496124_0136026 Ga0496124_0136026_415_780 121
1130 3300048927 Ga0496124_0174619 Ga0496124_0174619_90_479 121
1131 3300048927 Ga0496124_0176309 Ga0496124_0176309_214_636 121
1132 3300048927 Ga0496124_0213628 Ga0496124_0213628_534_923 121
1133 3300048927 Ga0496124_0256477 Ga0496124_0256477_140_505 121
1134 3300048927 Ga0496124_0308035 Ga0496124_0308035_24_389 121
1135 3300048927 Ga0496124_0332282 Ga0496124_0332282_649_1014 121
1136 3300048927 Ga0496124_0336816 Ga0496124_0336816_290_655 121
1137 3300048927 Ga0496124_0695833 Ga0496124_0695833_121_489 121
1138 3300048928 Ga0496125_0006778 Ga0496125_0006778_4176_4565 121
1139 3300048928 Ga0496125_0049161 Ga0496125_0049161_2950_3315 121
1140 3300048928 Ga0496125_0098615 Ga0496125_0098615_1122_1523 121
1141 3300048929 Ga0496126_0037909 Ga0496126_0037909_1161_1526 121
1142 3300048929 Ga0496126_0111809 Ga0496126_0111809_1467_1832 121
1143 3300049127 Ga0501306_028864 Ga0501306_028864_233_601 121
1144 3300049127 Ga0501306_055845 Ga0501306_055845_54_422 121
1145 3300049129 Ga0501309_091924 Ga0501309_091924_139_507 121
1146 3300049130 Ga0501310_004936 Ga0501310_004936_560_928 121
1147 3300049130 Ga0501310_008208 Ga0501310_008208_575_943 121
1148 3300049130 Ga0501310_072391 Ga0501310_072391_35_403 121
1149 3300049132 Ga0501343_003982 Ga0501343_003982_98_463 121
1150 3300049132 Ga0501343_030060 Ga0501343_030060_32_397 121
1151 3300049160 Ga0501304_007634 Ga0501304_007634_452_874 121
1152 3300049162 Ga0501307_068869 Ga0501307_068869_93_458 121
1153 3300049459 Ga0495678_000001 Ga0495678_000001_707233_707598 121
1154 3300049459 Ga0495678_000113 Ga0495678_000113_17087_17476 121
1155 3300049459 Ga0495678_000352 Ga0495678_000352_35978_36343 121
1156 3300049459 Ga0495678_000601 Ga0495678_000601_16598_16987 121
1157 3300049459 Ga0495678_001653 Ga0495678_001653_12687_13055 121
1158 3300049459 Ga0495678_001698 Ga0495678_001698_472_861 121
1159 3300049459 Ga0495678_002341 Ga0495678_002341_5004_5372 121
1160 3300049459 Ga0495678_002373 Ga0495678_002373_11807_12196 121
1161 3300049459 Ga0495678_009133 Ga0495678_009133_2570_2938 121
1162 3300049459 Ga0495678_017225 Ga0495678_017225_875_1243 121
1163 3300049459 Ga0495678_022603 Ga0495678_022603_2102_2467 121
1164 3300049459 Ga0495678_038668 Ga0495678_038668_838_1203 121
1165 3300049460 Ga0495682_0000842 Ga0495682_0000842_11499_11888 121
1166 3300049460 Ga0495682_0000910 Ga0495682_0000910_7176_7544 121
1167 3300049460 Ga0495682_0000929 Ga0495682_0000929_10328_10696 121
1168 3300049460 Ga0495682_0009389 Ga0495682_0009389_1706_2095 121
1169 3300049460 Ga0495682_0016480 Ga0495682_0016480_1762_2127 121
1170 3300049460 Ga0495682_0024231 Ga0495682_0024231_1862_2233 121
1171 3300049460 Ga0495682_0108682 Ga0495682_0108682_420_791 121
1172 3300049460 Ga0495682_0255012 Ga0495682_0255012_202_567 121
1173 3300049527 Ga0501311_018148 Ga0501311_018148_14_385 121
1174 3300049532 Ga0501316_011011 Ga0501316_011011_40_411 121
1175 3300049532 Ga0501316_014465 Ga0501316_014465_24_392 121
1176 3300049534 Ga0501318_058669 Ga0501318_058669_29_397 121
1177 3300049536 Ga0501320_058740 Ga0501320_058740_27_392 121
1178 3300049536 Ga0501320_064152 Ga0501320_064152_66_434 121
1179 3300049539 Ga0501323_019418 Ga0501323_019418_232_600 121
1180 3300049540 Ga0501324_005909 Ga0501324_005909_35_403 121
1181 3300049540 Ga0501324_014246 Ga0501324_014246_280_648 121
1182 3300049545 Ga0501329_05010 Ga0501329_05010_245_610 121
1183 3300049571 Ga0501034_1190702 Ga0501034_1190702_186_608 121
1184 3300049572 Ga0501036_0222721 Ga0501036_0222721_783_1148 121
1185 3300049576 Ga0501040_0132140 Ga0501040_0132140_95_460 121
1186 3300049576 Ga0501040_0463789 Ga0501040_0463789_531_896 121
1187 3300049577 Ga0501041_0226244 Ga0501041_0226244_795_1160 121
1188 3300049582 Ga0501048_0394603 Ga0501048_0394603_63_428 121
1189 3300049583 Ga0501067_0342545 Ga0501067_0342545_19_384 121
1190 3300049588 Ga0501072_1179658 Ga0501072_1179658_50_415 121
1191 3300049591 Ga0501075_0846958 Ga0501075_0846958_31_396 121
1192 3300049661 Ga0501217_224100 Ga0501217_224100_72_440 121
1193 3300049665 Ga0501227_005009 Ga0501227_005009_1884_2249 121
1194 3300049665 Ga0501227_214703 Ga0501227_214703_14_391 121
1195 3300049667 Ga0501230_011361 Ga0501230_011361_136_504 121
1196 3300049669 Ga0501235_129370 Ga0501235_129370_63_431 121
1197 3300049671 Ga0501238_012419 Ga0501238_012419_543_908 121
1198 3300049679 Ga0501249_003650 Ga0501249_003650_586_951 121
1199 3300049741 Ga0501079_0107492 Ga0501079_0107492_1524_1889 121
1200 3300049742 Ga0501080_0184168 Ga0501080_0184168_203_568 121
1201 3300049743 Ga0501081_0173249 Ga0501081_0173249_13_378 121
1202 3300049766 Ga0501269_000318 Ga0501269_000318_10691_11056 121
1203 3300049775 Ga0501279_005893 Ga0501279_005893_327_692 121
1204 3300049822 Ga0501035_0000968 Ga0501035_0000968_8569_8937 121
1205 3300049822 Ga0501035_0529656 Ga0501035_0529656_261_626 121
1206 3300049822 Ga0501035_1413860 Ga0501035_1413860_58_423 121
1207 3300049822 Ga0501035_1526061 Ga0501035_1526061_47_412 121
1208 3300049823 Ga0501044_0057394 Ga0501044_0057394_3219_3587 121
1209 3300049823 Ga0501044_0290867 Ga0501044_0290867_815_1180 121
1210 3300049823 Ga0501044_0675663 Ga0501044_0675663_374_739 121
1211 3300050489 nmdc:mga03683_37955_c1 nmdc:mga03683_37955_c1_641_1006 121
1212 3300050492 nmdc:mga0yw44_67023_c1 nmdc:mga0yw44_67023_c1_779_1144 121
1213 3300050492 nmdc:mga0yw44_9122_c1 nmdc:mga0yw44_9122_c1_938_1303 121
1214 3300050493 nmdc:mga0k408_133096_c1 nmdc:mga0k408_133096_c1_367_732 121
1215 3300050493 nmdc:mga0k408_165335_c1 nmdc:mga0k408_165335_c1_869_1234 121
1216 3300050494 nmdc:mga06z11_377710_c1 nmdc:mga06z11_377710_c1_173_538 121
1217 3300050495 nmdc:mga04h51_3964_c1 nmdc:mga04h51_3964_c1_913_1278 121
1218 3300050496 nmdc:mga07m45_91200_c1 nmdc:mga07m45_91200_c1_1239_1604 121
1219 3300050516 nmdc:mga0sz30_24680_c1 nmdc:mga0sz30_24680_c1_1144_1509 121
1220 3300050516 nmdc:mga0sz30_32663_c1 nmdc:mga0sz30_32663_c1_922_1287 121
1221 3300053077 Ga0495601_0002361 Ga0495601_0002361_7705_8070 121
1222 3300053088 Ga0500644_0456285 Ga0500644_0456285_118_483 121
1223 3300053090 Ga0500646_0003906 Ga0500646_0003906_737_1102 121
1224 3300053092 Ga0500583_0023410 Ga0500583_0023410_894_1259 121
1225 3300053094 Ga0500566_0412984 Ga0500566_0412984_61_426 121
1226 3300053096 Ga0500641_0030801 Ga0500641_0030801_1037_1402 121
1227 3300053103 Ga0500555_007130 Ga0500555_007130_2709_3074 121
1228 3300053105 Ga0500557_181669 Ga0500557_181669_99_467 121
1229 3300053111 Ga0500572_119071 Ga0500572_119071_275_640 121
1230 3300053118 Ga0500594_0011750 Ga0500594_0011750_599_964 121
1231 3300053119 Ga0500595_002361 Ga0500595_002361_1896_2261 121
1232 3300053121 Ga0500607_110555 Ga0500607_110555_710_1075 121
1233 3300053125 Ga0500618_000576 Ga0500618_000576_2965_3330 121
1234 3300053126 Ga0500621_067806 Ga0500621_067806_738_1103 121
1235 3300053129 Ga0500628_138899 Ga0500628_138899_224_589 121
1236 3300053139 Ga0500568_0011840 Ga0500568_0011840_2245_2610 121
1237 3300053141 Ga0500574_000146 Ga0500574_000146_1896_2261 121
1238 3300053145 Ga0500586_005957 Ga0500586_005957_846_1214 121
1239 3300053145 Ga0500586_013597 Ga0500586_013597_1527_1892 121
1240 3300053151 Ga0500604_0000415 Ga0500604_0000415_355_720 121
1241 3300053154 Ga0500619_001878 Ga0500619_001878_834_1199 121
1242 3300053156 Ga0500622_0231641 Ga0500622_0231641_387_752 121
1243 3300059490 Ga0587066_013590 Ga0587066_013590_442_807 121
1244 3300059491 Ga0587070_091243 Ga0587070_091243_270_635 121
1245 3300059503 Ga0587080_038257 Ga0587080_038257_428_796 121
1246 3300059503 Ga0587080_049842 Ga0587080_049842_253_618 121
1247 3300059504 Ga0587082_005918 Ga0587082_005918_219_584 121
1248 3300059505 Ga0587083_0023230 Ga0587083_0023230_68_436 121
1249 3300059630 Ga0587128_097990 Ga0587128_097990_232_597 121
1250 3300059640 Ga0587067_021342 Ga0587067_021342_543_908 121
1251 3300059643 Ga0587072_024251 Ga0587072_024251_543_908 121
1252 3300059647 Ga0587079_006024 Ga0587079_006024_1162_1527 121
1253 3300060344 Ga0587071_022367 Ga0587071_022367_777_1145 121
1254 3300060353 Ga0501082_1624969 Ga0501082_1624969_142_507 121
1255 iso_pu_bacteria 8047673197 8047677794 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

136

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wb4-assembly1.cif.gz_B activated diguanylate cyclase pled in complex with c-di-gmp 0.9721 5 120
2v0n-assembly1.cif.gz_B activated response regulator pled in complex with c-digmp and gtp- alpha-s 0.9703 5 120
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9667 4 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9658 4 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9654 4 120
ID Description Score Start End Superfamily
2v0nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9724 5 120 3.40.50.2300
2wb4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9721 5 120 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9672 3 84 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9634 4 120 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9602 3 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6A5LG01-F1-model_v4 deleted 0.9888 2 121
AF-A0A1G6LF15-F1-model_v4 deleted 0.9863 2 120
AF-A0A4R7NWS4-F1-model_v4 Twitching motility two-component system response regulator PilH 0.9855 5 120 GO:0000160
AF-A0A2G8T6T7-F1-model_v4 Two-component system response regulator 0.9834 1 121 GO:0000160
AF-A0A7X1P7M9-F1-model_v4 Response regulator 0.9832 1 121 GO:0000160

Feature Viewer

pLDDT pTM Quality
94.98 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map