F492200

General Info

Members Datasets Scaffolds Average Seq Length
1251 698 1007 382

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0049392|Ga0373947_0049392_1118_2482
Length 454
Sequence LLHRVAPRDDGVARKHGFAFSPSASEAEFRAMHGSSHADERNPAGQYLSNGLIYALPRPRANNKIPFGANLMTTQRLGLIMNGVTGRMGLNQHLIRSIVAIRDQGGVALANGDRVMPDPILVGRDAGKVEALAKRFHVARWTTDLDKALADTNDSVFFDAATTQARPSLLTKAINAGKHVYCEKPIATNLDEAVAVVKLANSKGLKHGTVQDKLFLPGLKKLAFLRDSGFFGRMLSVRGEFGYWVFEGGWQEAQRPSWNYRNEDGGGIILDMVCHWRYVLDNLFGEVESVVCIGNTDIPERYDEKNRKYVATADDSAYATFKLKGGVIAHINMSWVTRVYRDDLVTFQVDGTHGSAVAGLTDCVIQARQMTPRPVWNPDEKRLHDFYADWQKLPDNVAYDNGFKEQWEMFIRHVCENAPYKYTLLEGAKGVQLAECALQSWKERRWIDVEAIRV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
20 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
21 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
22 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
23 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
24 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
25 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
26 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
27 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
28 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
29 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
30 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
31 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
32 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
33 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
34 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
35 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
36 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
37 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
38 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
39 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
40 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
41 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
42 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
43 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
44 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
45 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
46 2791355199
47 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
48 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
49 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
50 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
51 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
52 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
53 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
54 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
55 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
56 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
57 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
58 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
59 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
60 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
61 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
62 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
63 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
64 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
65 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
66 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
67 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
68 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
69 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
70 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
71 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
72 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
73 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
74 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
75 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
76 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
77 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
78 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
79 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
80 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
81 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
82 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
83 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
84 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
85 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
86 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
87 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
88 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
89 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
90 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
91 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
92 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
93 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
94 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
95 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
96 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
97 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
98 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
99 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
100 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
101 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
102 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
103 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
104 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
105 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
106 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
107 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
108 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
109 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
110 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
111 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
112 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
113 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
114 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
115 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
116 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
117 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
118 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
119 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
120 2904699407
121 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
122 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
123 2906610324
124 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
125 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
126 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
127 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
128 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
129 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
130 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
131 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
132 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
133 2922368715
134 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
135 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
136 2922425934
137 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
138 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
139 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
140 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
141 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
142 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
143 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
144 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
145 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
146 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
147 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
148 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
149 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
150 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
151 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
152 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
153 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
154 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
155 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
156 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
157 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
158 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
159 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
160 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
161 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
162 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
163 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
164 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
165 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
166 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
167 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
168 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
169 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
170 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
171 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
172 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
173 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
174 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
175 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
176 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
177 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
178 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
179 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
180 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
181 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
182 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
183 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
184 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
185 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
186 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
187 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
188 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
189 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
190 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
191 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
192 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
193 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
194 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
195 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
196 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
197 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
198 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
199 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
200 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
201 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
202 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
203 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
204 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
205 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
206 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
207 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
208 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
209 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
210 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
211 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
212 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
213 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
214 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
215 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
216 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
217 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
218 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
219 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
220 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
221 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
222 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
223 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
224 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
225 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
226 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
227 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
228 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
229 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
230 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
231 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
232 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
233 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
234 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
235 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
236 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
237 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
238 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
239 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
240 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
241 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
242 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
243 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
244 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
245 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
246 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
247 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
248 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
249 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
250 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
251 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
252 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
253 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
254 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
255 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
256 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
257 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
258 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
259 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
260 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
261 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
262 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
263 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
264 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
265 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
266 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
267 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
268 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
269 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
270 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
271 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
272 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
273 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
274 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
275 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
276 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
277 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
278 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
279 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
280 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
281 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
282 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
283 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
284 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
285 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
286 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
287 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
289 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
290 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
291 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
292 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
293 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
294 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
295 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
296 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
297 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
298 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
299 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
300 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
301 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
302 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
303 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
304 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
308 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
309 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
310 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
311 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
312 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
313 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
314 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
315 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
316 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
317 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
318 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
319 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
320 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
321 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
322 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
323 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
324 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
325 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
326 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
327 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
328 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
329 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
330 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
334 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
336 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
337 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
338 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
339 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
396 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
397 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
398 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
399 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
400 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
401 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
402 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
403 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
407 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
408 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
409 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
410 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
411 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
412 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
413 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
414 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
415 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
416 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
417 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
418 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
419 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
420 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
421 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
422 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
423 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
424 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
425 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
426 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
427 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
428 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
429 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
430 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
431 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
432 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
433 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
434 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
435 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
436 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
437 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
438 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
439 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
440 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
441 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
442 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
443 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
444 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
445 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
446 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
447 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
448 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
449 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
450 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
451 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
452 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
453 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
454 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
455 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
456 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
457 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
458 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
459 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
460 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
461 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
462 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
463 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
464 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
465 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
466 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
467 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
468 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
469 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
470 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
471 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
472 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
473 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
474 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
475 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
476 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
477 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
478 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
479 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
480 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
481 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
482 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
483 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
484 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
485 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
486 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
487 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
488 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
489 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
490 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
491 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
492 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
493 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
494 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
495 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
496 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
497 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
498 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
499 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
500 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
501 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
502 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
503 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
504 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
505 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
506 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
507 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
508 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
509 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
510 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
511 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
512 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
513 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
514 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
515 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
516 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
517 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
518 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
519 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
520 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
521 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
522 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
523 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
524 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
525 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
526 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
527 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
528 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
529 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
530 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
531 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
532 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
533 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
534 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
535 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
536 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
537 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
538 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
539 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
540 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
541 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
542 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
543 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
544 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
545 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
546 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
547 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
548 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
549 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
550 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
551 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
552 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
553 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
554 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
555 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
556 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
557 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
558 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
559 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
560 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
561 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
562 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
563 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
564 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
565 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
566 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
567 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
568 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
569 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
570 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
571 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
572 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
573 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
574 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
575 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
576 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
579 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
580 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
581 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
582 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
583 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
584 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
585 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
590 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
591 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
592 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
593 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
594 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
595 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
596 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
597 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
598 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
599 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
600 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
601 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
602 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
603 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
606 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
607 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
608 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
609 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
610 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
611 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
612 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
613 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
614 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
615 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
616 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
617 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
618 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
619 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
620 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
621 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
622 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
623 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
624 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
625 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
626 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
627 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
628 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
629 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
630 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
631 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
632 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
633 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
634 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
635 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
636 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
637 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
638 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
639 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
640 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
641 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
642 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
643 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
644 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
645 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
646 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
647 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
648 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
649 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
650 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
651 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
652 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
653 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
654 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
655 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
656 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
657 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
658 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
659 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
660 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
661 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
662 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
663 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
664 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
665 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
666 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
667 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
668 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
669 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
670 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
671 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
672 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
673 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
674 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
675 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
676 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
677 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
678 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
679 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
680 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
681 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
682 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
683 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
684 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
685 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
686 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
687 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
688 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
689 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
690 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
691 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
692 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
693 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
694 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
695 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
696 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
697 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
698 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.74
Metatranscriptomes 0.08
Isolates 19.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 15.19
Rhizoplane 5.36
Rhizosphere 56.04
Stem 0
Stem Tuber 0
Unclassified 11.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c002823 3300000043 Bacteria 1770
2 ARSoilOldRDRAFT_c003037 3300000044 Bacteria 1453
3 JGI24739J22299_10031571 3300001989 Bacteria 1829
4 JGI24737J22298_10039955 3300001990 Bacteria 1441
5 JGI24738J21930_10017994 3300002075 Bacteria 1480
6 JGI25406J46586_10000050 3300003203 Bacteria 54388
7 JGI25153J46596_10000297 3300003215 Bacteria 37155
8 JGI25153J46596_10001771 3300003215 Bacteria 12818
9 JGI25153J46596_10002178 3300003215 Bacteria 11436
10 JGI25153J46596_10003525 3300003215 Bacteria 8729
11 JGI25153J46596_10005376 3300003215 Bacteria 6725
12 JGI25153J46596_10007400 3300003215 Bacteria 5406
13 Ga0055542_1005691 3300003762 Bacteria 2766
14 Ga0055531_10012935 3300003794 Bacteria 3886
15 Ga0055543_1004359 3300004625 Bacteria 3881
16 Ga0065165_1001109 3300005262 Bacteria 31984
17 Ga0065165_1012799 3300005262 Bacteria 3389
18 Ga0065704_10111240 3300005289 Bacteria 1936
19 Ga0065712_10021991 3300005290 Bacteria 1758
20 Ga0065712_10080594 3300005290 Bacteria 3089
21 Ga0070676_10104133 3300005328 Bacteria 1758
22 Ga0070676_10119955 3300005328 Bacteria 1649
23 Ga0070683_100005122 3300005329 Bacteria 10899
24 Ga0070683_100088145 3300005329 Bacteria 2911
25 Ga0070670_100069412 3300005331 Bacteria 3025
26 Ga0070666_10041549 3300005335 Bacteria 3073
27 Ga0070680_100011806 3300005336 Bacteria 6775
28 Ga0070680_100074827 3300005336 Bacteria 2787
29 Ga0070680_100094123 3300005336 Bacteria 2483
30 Ga0070682_100232921 3300005337 Bacteria 1317
31 Ga0068868_100001939 3300005338 Bacteria 14194
32 Ga0068868_100037581 3300005338 Bacteria 3754
33 Ga0070660_100029848 3300005339 Bacteria 4088
34 Ga0070660_100103884 3300005339 Bacteria 2253
35 Ga0070660_100132353 3300005339 Bacteria 1996
36 Ga0070660_100296921 3300005339 Bacteria 1324
37 Ga0070689_100008156 3300005340 Bacteria 7360
38 Ga0070661_100038404 3300005344 Bacteria 3485
39 Ga0070661_100064072 3300005344 Bacteria 2701
40 Ga0070668_100027692 3300005347 Bacteria 4302
41 Ga0070668_100071610 3300005347 Bacteria 2701
42 Ga0070668_100088233 3300005347 Bacteria 2441
43 Ga0070669_100046473 3300005353 Bacteria 3166
44 Ga0070669_100152048 3300005353 Bacteria 1792
45 Ga0070675_100164085 3300005354 Bacteria 1912
46 Ga0070675_100269619 3300005354 Bacteria 1493
47 Ga0070671_100011229 3300005355 Bacteria 7193
48 Ga0070671_100015820 3300005355 Bacteria 6093
49 Ga0070671_100139747 3300005355 Bacteria 2044
50 Ga0070674_100052883 3300005356 Bacteria 2802
51 Ga0070673_100001119 3300005364 Bacteria 15383
52 Ga0070688_100034556 3300005365 Bacteria 3063
53 Ga0070667_100000427 3300005367 Bacteria 44426
54 Ga0070667_100058914 3300005367 Bacteria 3247
55 Ga0070667_100240126 3300005367 Bacteria 1617
56 Ga0070709_10001579 3300005434 Bacteria 12291
57 Ga0070709_10018524 3300005434 Bacteria 4011
58 Ga0070714_100009461 3300005435 Bacteria 7663
59 Ga0070714_100033299 3300005435 Bacteria 4307
60 Ga0070714_100041521 3300005435 Bacteria 3882
61 Ga0070714_100075963 3300005435 Bacteria 2916
62 Ga0070713_100050284 3300005436 Bacteria 3442
63 Ga0070713_100084103 3300005436 Bacteria 2722
64 Ga0070713_100154932 3300005436 Bacteria 2041
65 Ga0070713_100157884 3300005436 Bacteria 2023
66 Ga0070710_10008336 3300005437 Bacteria 5044
67 Ga0070711_100003453 3300005439 Bacteria 9209
68 Ga0070711_100010332 3300005439 Bacteria 5775
69 Ga0070711_100013079 3300005439 Bacteria 5204
70 Ga0070711_100027252 3300005439 Bacteria 3750
71 Ga0070711_100028382 3300005439 Bacteria 3682
72 Ga0070700_100113454 3300005441 Bacteria 1806
73 Ga0070694_100088723 3300005444 Bacteria 2165
74 Ga0070663_100009428 3300005455 Bacteria 6044
75 Ga0070663_100028430 3300005455 Bacteria 3806
76 Ga0070663_100096844 3300005455 Bacteria 2195
77 Ga0070678_100000866 3300005456 Bacteria 15460
78 Ga0070678_100030749 3300005456 Bacteria 3695
79 Ga0070678_100049636 3300005456 Bacteria 3030
80 Ga0070662_100269786 3300005457 Bacteria 1374
81 Ga0070681_10063853 3300005458 Bacteria 3655
82 Ga0068867_100027893 3300005459 Bacteria 4062
83 Ga0070706_100075117 3300005467 Bacteria 3128
84 Ga0070698_100142127 3300005471 Bacteria 2351
85 Ga0070679_100089458 3300005530 Bacteria 3066
86 Ga0070679_100143686 3300005530 Bacteria 2364
87 Ga0070684_100027728 3300005535 Bacteria 4784
88 Ga0070684_100058149 3300005535 Bacteria 3378
89 Ga0070684_100170508 3300005535 Bacteria 1977
90 Ga0070697_100012253 3300005536 Bacteria 6716
91 Ga0070672_100085986 3300005543 Bacteria 2528
92 Ga0070672_100115772 3300005543 Bacteria 2189
93 Ga0070693_100088214 3300005547 Bacteria 1865
94 Ga0070665_100103293 3300005548 Bacteria 2853
95 Ga0070665_100123255 3300005548 Bacteria 2594
96 Ga0070665_100381401 3300005548 Bacteria 1417
97 Ga0070704_100172906 3300005549 Bacteria 1720
98 Ga0068855_100044511 3300005563 Bacteria 5252
99 Ga0068855_100129697 3300005563 Bacteria 2880
100 Ga0070664_100004769 3300005564 Bacteria 10861
101 Ga0068857_100006913 3300005577 Bacteria 9770
102 Ga0068856_100001803 3300005614 Bacteria 22366
103 Ga0068856_100017040 3300005614 Bacteria 7042
104 Ga0068856_100200377 3300005614 Bacteria 2010
105 Ga0068852_100064623 3300005616 Bacteria 3190
106 Ga0068852_100075034 3300005616 Bacteria 2981
107 Ga0068852_100120886 3300005616 Bacteria 2397
108 Ga0068852_100370232 3300005616 Bacteria 1403
109 Ga0068859_100090741 3300005617 Bacteria 3106
110 Ga0068864_100001940 3300005618 Bacteria 16988
111 Ga0068864_100087884 3300005618 Bacteria 2737
112 Ga0068864_100214469 3300005618 Bacteria 1774
113 Ga0068866_10024437 3300005718 Bacteria 2825
114 Ga0068866_10117751 3300005718 Bacteria 1492
115 Ga0068861_100048457 3300005719 Bacteria 3212
116 Ga0068861_100081446 3300005719 Bacteria 2534
117 Ga0068863_100005859 3300005841 Bacteria 12041
118 Ga0068863_100219662 3300005841 Bacteria 1831
119 Ga0068858_100064249 3300005842 Bacteria 3397
120 Ga0068858_100132331 3300005842 Bacteria 2339
121 Ga0068858_100263622 3300005842 Bacteria 1638
122 Ga0068860_100000399 3300005843 Bacteria 56959
123 Ga0068860_100144833 3300005843 Bacteria 2285
124 Ga0081455_10000237 3300005937 Bacteria 71335
125 Ga0081455_10095265 3300005937 Bacteria 2403
126 Ga0081538_10018641 3300005981 Bacteria 5198
127 Ga0081540_1002658 3300005983 Bacteria 14535
128 Ga0081540_1012722 3300005983 Bacteria 5516
129 Ga0081540_1014792 3300005983 Bacteria 4975
130 Ga0081540_1019041 3300005983 Bacteria 4190
131 Ga0081539_10000325 3300005985 Bacteria 106431
132 Ga0081539_10000542 3300005985 Bacteria 78012
133 Ga0081539_10017927 3300005985 Bacteria 4941
134 Ga0081539_10041063 3300005985 Bacteria 2709
135 Ga0081539_10103757 3300005985 Bacteria 1444
136 Ga0070717_10004627 3300006028 Bacteria 9970
137 Ga0070717_10021548 3300006028 Bacteria 5079
138 Ga0070717_10075971 3300006028 Bacteria 2811
139 Ga0075365_10000416 3300006038 Bacteria 15693
140 Ga0075365_10066033 3300006038 Bacteria 2426
141 Ga0075365_10070334 3300006038 Bacteria 2353
142 Ga0075368_10012500 3300006042 Bacteria 3105
143 Ga0075368_10059682 3300006042 Bacteria 1526
144 Ga0075363_100001174 3300006048 Bacteria 9626
145 Ga0075363_100007935 3300006048 Bacteria 4916
146 Ga0075363_100014889 3300006048 Bacteria 3813
147 Ga0075364_10002830 3300006051 Bacteria 9764
148 Ga0075364_10036378 3300006051 Bacteria 3182
149 Ga0075364_10108105 3300006051 Bacteria 1855
150 Ga0070715_10037104 3300006163 Bacteria 2015
151 Ga0070715_10095856 3300006163 Bacteria 1374
152 Ga0070716_100036597 3300006173 Bacteria 2707
153 Ga0070712_100008334 3300006175 Bacteria 6517
154 Ga0070712_100116412 3300006175 Bacteria 2004
155 Ga0075367_10013317 3300006178 Bacteria 4417
156 Ga0075367_10027064 3300006178 Bacteria 3258
157 Ga0075367_10040805 3300006178 Bacteria 2711
158 Ga0075369_10014301 3300006186 Bacteria 3168
159 Ga0075366_10009516 3300006195 Bacteria 5426
160 Ga0075366_10022789 3300006195 Bacteria 3645
161 Ga0075366_10147024 3300006195 Bacteria 1426
162 Ga0097621_100044777 3300006237 Bacteria 3571
163 Ga0097621_100141994 3300006237 Bacteria 2053
164 Ga0097621_100146252 3300006237 Bacteria 2024
165 Ga0075370_10005713 3300006353 Bacteria 6209
166 Ga0075370_10011478 3300006353 Bacteria 4657
167 Ga0075370_10056711 3300006353 Bacteria 2226
168 Ga0075370_10097937 3300006353 Bacteria 1696
169 Ga0068871_100139545 3300006358 Bacteria 2061
170 Ga0075428_100128240 3300006844 Bacteria 2760
171 Ga0075431_100001980 3300006847 Bacteria 19546
172 Ga0075431_100254358 3300006847 Bacteria 1784
173 Ga0075434_100077954 3300006871 Bacteria 3309
174 Ga0068865_100060979 3300006881 Bacteria 2642
175 Ga0068865_100077175 3300006881 Bacteria 2380
176 Ga0068865_100229200 3300006881 Bacteria 1456
177 Ga0097620_100090743 3300006931 Bacteria 3106
178 Ga0099824_1019369 3300006942 Bacteria 5322
179 Ga0099824_1037786 3300006942 Bacteria 1322
180 Ga0099822_1001244 3300006943 Bacteria 29011
181 Ga0099794_10017117 3300007265 Bacteria 3226
182 Ga0099795_10006714 3300007788 Bacteria 3157
183 Ga0105240_10184409 3300009093 Bacteria 2459
184 Ga0111539_10033837 3300009094 Bacteria 6202
185 Ga0111539_10162670 3300009094 Bacteria 2610
186 Ga0105245_10050469 3300009098 Bacteria 3729
187 Ga0105245_10065537 3300009098 Bacteria 3285
188 Ga0114129_10069616 3300009147 Bacteria 4905
189 Ga0105243_10072375 3300009148 Bacteria 2790
190 Ga0105243_10111021 3300009148 Bacteria 2294
191 Ga0105241_10111029 3300009174 Bacteria 2194
192 Ga0105248_10135644 3300009177 Bacteria 2776
193 Ga0105237_10013607 3300009545 Bacteria 8525
194 Ga0105238_10041453 3300009551 Bacteria 4662
195 Ga0105238_10110140 3300009551 Bacteria 2735
196 Ga0105249_10025941 3300009553 Bacteria 5278
197 Ga0105249_10288149 3300009553 Bacteria 1643
198 Ga0105249_10406987 3300009553 Bacteria 1392
199 Ga0105239_10034550 3300010375 Bacteria 5552
200 Ga0105239_10087399 3300010375 Bacteria 3437
201 Ga0105239_10218278 3300010375 Bacteria 2138
202 Ga0105246_10134531 3300011119 Bacteria 1851
203 Ga0157373_10012937 3300013100 Bacteria 6127
204 Ga0157370_10087286 3300013104 Bacteria 2930
205 Ga0157370_10089633 3300013104 Bacteria 2889
206 Ga0157369_10011073 3300013105 Bacteria 10261
207 Ga0157369_10052856 3300013105 Bacteria 4393
208 Ga0157369_10172790 3300013105 Bacteria 2276
209 Ga0157374_10090805 3300013296 Bacteria 2912
210 Ga0163162_10042571 3300013306 Bacteria 4546
211 Ga0163162_10071836 3300013306 Bacteria 3515
212 Ga0163162_10122854 3300013306 Bacteria 2701
213 Ga0163162_10217062 3300013306 Bacteria 2043
214 Ga0157372_10145358 3300013307 Bacteria 2734
215 Ga0157372_10524700 3300013307 Bacteria 1380
216 Ga0157375_10122327 3300013308 Bacteria 2714
217 Ga0163163_10003896 3300014325 Bacteria 12723
218 Ga0163163_10005260 3300014325 Bacteria 11163
219 Ga0163163_10005988 3300014325 Bacteria 10575
220 Ga0163163_10012351 3300014325 Bacteria 7781
221 Ga0157380_10058124 3300014326 Bacteria 3082
222 Ga0157380_10115131 3300014326 Bacteria 2267
223 Ga0182008_10097894 3300014497 Unclassified 1448
224 Ga0157379_10023235 3300014968 Bacteria 5500
225 Ga0157379_10032090 3300014968 Bacteria 4680
226 Ga0157376_10231582 3300014969 Bacteria 1716
227 Ga0163161_10063621 3300017792 Bacteria 2689
228 Ga0163161_10066401 3300017792 Bacteria 2634
229 Ga0214544_1000001 3300021320 Bacteria 783667
230 Ga0214544_1026847 3300021320 Bacteria 2493
231 Ga0214544_1027275 3300021320 Bacteria 2400
232 Ga0214542_1000037 3300021321 Bacteria 159256
233 Ga0214542_1037377 3300021321 Bacteria 1387
234 Ga0214542_1037673 3300021321 Bacteria 1366
235 Ga0214545_1000003 3300021324 Bacteria 720274
236 Ga0214545_1019261 3300021324 Bacteria 5911
237 Ga0214543_1000002 3300021327 Bacteria 712733
238 Ga0214543_1026652 3300021327 Bacteria 3065
239 Ga0214543_1039585 3300021327 Bacteria 1294
240 Ga0213874_10001651 3300021377 Bacteria 4682
241 Ga0213874_10041435 3300021377 Bacteria 1379
242 Ga0213876_10002729 3300021384 Bacteria 10288
243 Ga0213876_10027514 3300021384 Bacteria 3000
244 Ga0213876_10097258 3300021384 Bacteria 1560
245 Ga0209563_104444 3300025230 Bacteria 2679
246 Ga0209677_100598 3300025253 Bacteria 19523
247 Ga0209677_107557 3300025253 Bacteria 2280
248 Ga0209148_1000462 3300025254 Bacteria 43711
249 Ga0209148_1004101 3300025254 Bacteria 3687
250 Ga0209233_1000654 3300025261 Bacteria 16891
251 Ga0209233_1007735 3300025261 Bacteria 3378
252 Ga0209233_1008472 3300025261 Bacteria 3183
253 Ga0209233_1014172 3300025261 Bacteria 2255
254 Ga0209455_1000926 3300025272 Bacteria 15102
255 Ga0209455_1000954 3300025272 Bacteria 14747
256 Ga0209564_1000468 3300025295 Bacteria 67696
257 Ga0209564_1008067 3300025295 Bacteria 5274
258 Ga0209758_1000011 3300025297 Bacteria 1049685
259 Ga0209758_1000133 3300025297 Bacteria 182442
260 Ga0209758_1000302 3300025297 Bacteria 96619
261 Ga0209758_1000845 3300025297 Bacteria 42737
262 Ga0209758_1001760 3300025297 Bacteria 24019
263 Ga0209758_1002308 3300025297 Bacteria 19720
264 Ga0209758_1008957 3300025297 Bacteria 6341
265 Ga0209758_1010383 3300025297 Bacteria 5584
266 Ga0209758_1052251 3300025297 Bacteria 1415
267 Ga0209256_1003911 3300025299 Bacteria 9844
268 Ga0207426_1000270 3300025302 Bacteria 108404
269 Ga0207426_1000292 3300025302 Bacteria 99342
270 Ga0207426_1002666 3300025302 Bacteria 10959
271 Ga0209257_1001242 3300025304 Bacteria 31529
272 Ga0207697_10021016 3300025315 Bacteria 2673
273 Ga0207656_10010329 3300025321 Bacteria 3495
274 Ga0207653_10001814 3300025885 Bacteria 6821
275 Ga0207692_10008873 3300025898 Bacteria 4178
276 Ga0207692_10013471 3300025898 Bacteria 3549
277 Ga0207692_10032938 3300025898 Bacteria 2495
278 Ga0207692_10168069 3300025898 Bacteria 1269
279 Ga0207642_10022066 3300025899 Bacteria 2518
280 Ga0207642_10042821 3300025899 Bacteria 1992
281 Ga0207647_10007857 3300025904 Bacteria 7673
282 Ga0207685_10000806 3300025905 Bacteria 5811
283 Ga0207699_10000503 3300025906 Bacteria 19503
284 Ga0207699_10015653 3300025906 Bacteria 3945
285 Ga0207699_10062610 3300025906 Bacteria 2243
286 Ga0207645_10079415 3300025907 Bacteria 2103
287 Ga0207645_10108318 3300025907 Bacteria 1797
288 Ga0207654_10071689 3300025911 Bacteria 2060
289 Ga0207654_10144311 3300025911 Bacteria 1522
290 Ga0207707_10001896 3300025912 Bacteria 19043
291 Ga0207707_10007520 3300025912 Bacteria 9493
292 Ga0207707_10019033 3300025912 Bacteria 5990
293 Ga0207707_10031890 3300025912 Bacteria 4613
294 Ga0207707_10057854 3300025912 Bacteria 3374
295 Ga0207707_10060997 3300025912 Bacteria 3281
296 Ga0207695_10000008 3300025913 Bacteria 1058268
297 Ga0207695_10010954 3300025913 Bacteria 11028
298 Ga0207695_10030077 3300025913 Bacteria 5985
299 Ga0207695_10230368 3300025913 Bacteria 1757
300 Ga0207695_10236614 3300025913 Bacteria 1729
301 Ga0207671_10004345 3300025914 Bacteria 13605
302 Ga0207671_10048241 3300025914 Bacteria 3152
303 Ga0207671_10161986 3300025914 Bacteria 1733
304 Ga0207693_10000085 3300025915 Bacteria 83879
305 Ga0207693_10016551 3300025915 Bacteria 5892
306 Ga0207663_10000739 3300025916 Bacteria 14580
307 Ga0207663_10023124 3300025916 Bacteria 3562
308 Ga0207663_10056741 3300025916 Bacteria 2465
309 Ga0207660_10018620 3300025917 Bacteria 4633
310 Ga0207660_10070860 3300025917 Bacteria 2535
311 Ga0207660_10096304 3300025917 Bacteria 2203
312 Ga0207657_10000245 3300025919 Bacteria 57819
313 Ga0207657_10061790 3300025919 Bacteria 3210
314 Ga0207657_10065902 3300025919 Bacteria 3085
315 Ga0207657_10109884 3300025919 Bacteria 2278
316 Ga0207657_10159485 3300025919 Bacteria 1833
317 Ga0207657_10210291 3300025919 Bacteria 1561
318 Ga0207649_10051062 3300025920 Bacteria 2560
319 Ga0207649_10229296 3300025920 Bacteria 1327
320 Ga0207652_10022732 3300025921 Bacteria 5192
321 Ga0207652_10048089 3300025921 Bacteria 3645
322 Ga0207652_10202865 3300025921 Bacteria 1785
323 Ga0207681_10076838 3300025923 Bacteria 2346
324 Ga0207694_10025256 3300025924 Bacteria 4515
325 Ga0207650_10049602 3300025925 Bacteria 3100
326 Ga0207659_10206837 3300025926 Bacteria 1571
327 Ga0207687_10205179 3300025927 Bacteria 1543
328 Ga0207700_10014467 3300025928 Bacteria 5170
329 Ga0207700_10118838 3300025928 Bacteria 2140
330 Ga0207700_10269725 3300025928 Bacteria 1460
331 Ga0207664_10004463 3300025929 Bacteria 9478
332 Ga0207664_10010699 3300025929 Bacteria 6487
333 Ga0207664_10128139 3300025929 Bacteria 2133
334 Ga0207644_10015614 3300025931 Bacteria 5100
335 Ga0207644_10048488 3300025931 Bacteria 3037
336 Ga0207690_10170538 3300025932 Bacteria 1630
337 Ga0207690_10229913 3300025932 Bacteria 1423
338 Ga0207706_10013176 3300025933 Bacteria 7524
339 Ga0207706_10018926 3300025933 Bacteria 6192
340 Ga0207686_10049526 3300025934 Bacteria 2608
341 Ga0207709_10094774 3300025935 Bacteria 1960
342 Ga0207670_10005208 3300025936 Bacteria 7112
343 Ga0207670_10032123 3300025936 Bacteria 3373
344 Ga0207669_10015366 3300025937 Bacteria 3859
345 Ga0207669_10046404 3300025937 Bacteria 2567
346 Ga0207704_10046849 3300025938 Bacteria 2580
347 Ga0207665_10000229 3300025939 Bacteria 38095
348 Ga0207665_10011145 3300025939 Bacteria 5899
349 Ga0207665_10035278 3300025939 Bacteria 3319
350 Ga0207691_10008150 3300025940 Bacteria 10057
351 Ga0207691_10150637 3300025940 Bacteria 2045
352 Ga0207711_10002271 3300025941 Bacteria 17262
353 Ga0207711_10030359 3300025941 Bacteria 4558
354 Ga0207711_10146522 3300025941 Bacteria 2128
355 Ga0207689_10109021 3300025942 Bacteria 2275
356 Ga0207661_10000917 3300025944 Bacteria 19380
357 Ga0207661_10018018 3300025944 Bacteria 5242
358 Ga0207661_10221537 3300025944 Bacteria 1672
359 Ga0207667_10037702 3300025949 Bacteria 5166
360 Ga0207667_10200099 3300025949 Bacteria 2049
361 Ga0207651_10048453 3300025960 Bacteria 2872
362 Ga0207651_10306848 3300025960 Bacteria 1322
363 Ga0207712_10016182 3300025961 Bacteria 4823
364 Ga0207712_10099233 3300025961 Bacteria 2162
365 Ga0207712_10146744 3300025961 Bacteria 1817
366 Ga0207668_10008285 3300025972 Bacteria 6194
367 Ga0207668_10014124 3300025972 Bacteria 4938
368 Ga0207668_10116133 3300025972 Bacteria 2017
369 Ga0207658_10001754 3300025986 Bacteria 16311
370 Ga0207658_10026085 3300025986 Bacteria 4095
371 Ga0207658_10162191 3300025986 Bacteria 1833
372 Ga0207677_10025562 3300026023 Bacteria 3686
373 Ga0207639_10002832 3300026041 Bacteria 11633
374 Ga0207678_10000788 3300026067 Bacteria 29001
375 Ga0207678_10024231 3300026067 Bacteria 5301
376 Ga0207678_10069922 3300026067 Bacteria 3010
377 Ga0207678_10094459 3300026067 Bacteria 2555
378 Ga0207678_10095328 3300026067 Bacteria 2543
379 Ga0207678_10123308 3300026067 Bacteria 2211
380 Ga0207702_10001708 3300026078 Bacteria 21655
381 Ga0207702_10130329 3300026078 Bacteria 2262
382 Ga0207641_10283667 3300026088 Bacteria 1559
383 Ga0207648_10072089 3300026089 Bacteria 3010
384 Ga0207648_10160704 3300026089 Bacteria 1984
385 Ga0207676_10006093 3300026095 Bacteria 8509
386 Ga0207676_10070618 3300026095 Bacteria 2801
387 Ga0207674_10000253 3300026116 Bacteria 66599
388 Ga0207674_10006543 3300026116 Bacteria 13703
389 Ga0207674_10222202 3300026116 Bacteria 1837
390 Ga0207675_100311200 3300026118 Bacteria 1536
391 Ga0207683_10001491 3300026121 Bacteria 21111
392 Ga0207683_10014022 3300026121 Bacteria 6833
393 Ga0207683_10019680 3300026121 Bacteria 5768
394 Ga0207683_10135537 3300026121 Bacteria 2216
395 Ga0207698_10135209 3300026142 Bacteria 2114
396 Ga0207698_10169769 3300026142 Bacteria 1919
397 Ga0207698_10175830 3300026142 Bacteria 1890
398 Ga0209389_1000001 3300027296 Bacteria 463799
399 Ga0209389_1000014 3300027296 Bacteria 188621
400 Ga0209589_1000011 3300027357 Bacteria 236981
401 Ga0209589_1000020 3300027357 Bacteria 188617
402 Ga0209489_100012 3300027361 Bacteria 236981
403 Ga0209489_100060 3300027361 Bacteria 147091
404 Ga0209489_101114 3300027361 Bacteria 54578
405 Ga0209700_100007 3300027363 Bacteria 454608
406 Ga0209700_100019 3300027363 Bacteria 236981
407 Ga0209999_1018986 3300027543 Bacteria 1259
408 Ga0209966_1002395 3300027695 Bacteria 3124
409 Ga0209813_10036052 3300027866 Bacteria 1484
410 Ga0207428_10143682 3300027907 Bacteria 1819
411 Ga0268266_10001272 3300028379 Bacteria 30802
412 Ga0268266_10045429 3300028379 Bacteria 3757
413 Ga0268266_10113881 3300028379 Bacteria 2399
414 Ga0268265_10033549 3300028380 Bacteria 3733
415 Ga0268265_10071486 3300028380 Bacteria 2702
416 Ga0268265_10365416 3300028380 Bacteria 1322
417 Ga0268264_10000030 3300028381 Bacteria 418542
418 Ga0268264_10145744 3300028381 Bacteria 2117
419 Ga0268264_10499558 3300028381 Bacteria 1186
420 Ga0265334_10059873 3300028573 Bacteria 1438
421 Ga0265336_10001051 3300028666 Bacteria 13495
422 Ga0307517_10001377 3300028786 Bacteria 40867
423 Ga0307515_10000417 3300028794 Bacteria 102343
424 Ga0307515_10000477 3300028794 Bacteria 95378
425 Ga0307515_10071901 3300028794 Bacteria 4678
426 Ga0307515_10093229 3300028794 Bacteria 3737
427 Ga0265338_10004642 3300028800 Bacteria 18461
428 Ga0265338_10010144 3300028800 Bacteria 11110
429 Ga0265330_10040262 3300031235 Bacteria 2076
430 Ga0265320_10001942 3300031240 Bacteria 14608
431 Ga0265325_10000031 3300031241 Bacteria 102905
432 Ga0265325_10044396 3300031241 Bacteria 2315
433 Ga0265340_10062699 3300031247 Bacteria 1775
434 Ga0265339_10037898 3300031249 Bacteria 2692
435 Ga0265327_10002606 3300031251 Bacteria 18665
436 Ga0265327_10013461 3300031251 Bacteria 5431
437 Ga0265316_10121496 3300031344 Bacteria 1972
438 Ga0307513_10022829 3300031456 Bacteria 7341
439 Ga0307513_10046501 3300031456 Bacteria 4730
440 Ga0307509_10156515 3300031507 Bacteria 2184
441 Ga0307509_10171185 3300031507 Bacteria 2050
442 Ga0307408_100047872 3300031548 Bacteria 3064
443 Ga0265313_10013689 3300031595 Bacteria 4846
444 Ga0307508_10000015 3300031616 Bacteria 210182
445 Ga0265314_10002234 3300031711 Bacteria 20137
446 Ga0265314_10002758 3300031711 Bacteria 17547
447 Ga0265314_10013252 3300031711 Bacteria 6673
448 Ga0265342_10024663 3300031712 Bacteria 3794
449 Ga0307516_10002523 3300031730 Bacteria 24368
450 Ga0307516_10004543 3300031730 Bacteria 17074
451 Ga0307516_10010277 3300031730 Bacteria 10309
452 Ga0307413_10042181 3300031824 Bacteria 2679
453 Ga0307410_10070931 3300031852 Bacteria 2415
454 Ga0307410_10106018 3300031852 Bacteria 2024
455 Ga0307406_10045617 3300031901 Bacteria 2753
456 Ga0307407_10049465 3300031903 Bacteria 2399
457 Ga0307412_10061387 3300031911 Bacteria 2527
458 Ga0307416_100070997 3300032002 Bacteria 2890
459 Ga0307411_10057952 3300032005 Bacteria 2561
460 Ga0316583_10005887 3300032133 Bacteria 4409
461 Ga0307507_10034988 3300033179 Bacteria 5172
462 Ga0307510_10007552 3300033180 Bacteria 12952
463 Ga0307510_10010054 3300033180 Bacteria 11245
464 Ga0307510_10148735 3300033180 Bacteria 1967
465 Ga0315911_1000002 3300033442 Bacteria 926833
466 Ga0373930_0013432 3300034816 Bacteria 1509
467 Ga0373948_0011963 3300034817 Bacteria 1543
468 Ga0373950_0017092 3300034818 Bacteria 1247
469 Ga0373929_0028456 3300035085 Bacteria 1180
470 Ga0373934_0029448 3300035086 Bacteria 2144
471 Ga0373949_0008964 3300035090 Bacteria 2191
472 Ga0373939_0007131 3300035114 Bacteria 2710
473 Ga0373953_0003240 3300035117 Bacteria 5042
474 Ga0373953_0026586 3300035117 Bacteria 2217
475 Ga0373954_0000003 3300035118 Bacteria 137757
476 Ga0373954_0002051 3300035118 Bacteria 8373
477 Ga0373954_0014777 3300035118 Bacteria 3484
478 Ga0373954_0110339 3300035118 Bacteria 1330
479 Ga0373956_0019312 3300035119 Bacteria 2889
480 Ga0373956_0034057 3300035119 Bacteria 2243
481 Ga0373946_0009678 3300035171 Bacteria 3557
482 Ga0373955_0008741 3300035172 Bacteria 4715
483 Ga0373961_0005467 3300035241 Bacteria 3052
484 Ga0373961_0021351 3300035241 Bacteria 1721
485 Ga0373924_0011463 3300035410 Bacteria 3293
486 Ga0373935_0002404 3300035692 Bacteria 10710
487 Ga0373935_0047935 3300035692 Bacteria 2703
488 Ga0373935_0125490 3300035692 Bacteria 1719
489 Ga0373927_0000783 3300035695 Bacteria 24265
490 Ga0373927_0004757 3300035695 Bacteria 9451
491 Ga0373927_0020827 3300035695 Bacteria 4298
492 Ga0373927_0050912 3300035695 Bacteria 2678
493 Ga0373927_0157191 3300035695 Bacteria 1489
494 Ga0373927_0170245 3300035695 Bacteria 1428
495 Ga0373933_0011065 3300035724 Bacteria 4959
496 Ga0373933_0019929 3300035724 Bacteria 3796
497 Ga0373933_0043148 3300035724 Bacteria 2667
498 Ga0373933_0085873 3300035724 Bacteria 1935
499 Ga0373933_0110932 3300035724 Bacteria 1711
500 Ga0373947_0002483 3300035725 Bacteria 11091
501 Ga0373947_0005531 3300035725 Bacteria 7369
502 Ga0373947_0049392 3300035725 Bacteria 2526
503 Ga0373947_0174368 3300035725 Bacteria 1397
504 Ga0373937_0000131 3300036401 Bacteria 72767
505 Ga0373937_0116679 3300036401 Bacteria 2486
506 Ga0373937_0262907 3300036401 Bacteria 1627
507 Ga0372808_010978 3300036459 Bacteria 1279
508 Ga0373925_0033388 3300037068 Bacteria 3792
509 Ga0373925_0035982 3300037068 Bacteria 3655
510 Ga0373925_0062989 3300037068 Bacteria 2789
511 Ga0373925_0123348 3300037068 Bacteria 2013
512 Ga0373925_0131653 3300037068 Bacteria 1950
513 Ga0373925_0173635 3300037068 Unclassified 1702
514 Ga0395899_0003168 3300037312 Bacteria 13054
515 Ga0395899_0119155 3300037312 Bacteria 1892
516 Ga0395900_0001070 3300037418 Bacteria 34841
517 Ga0395900_0005737 3300037418 Bacteria 12976
518 Ga0395900_0074549 3300037418 Bacteria 3488
519 Ga0395900_0170764 3300037418 Bacteria 2214
520 Ga0395898_0003538 3300037466 Bacteria 17416
521 Ga0395898_0009135 3300037466 Bacteria 10443
522 Ga0395898_0030821 3300037466 Bacteria 5364
523 Ga0395898_0030823 3300037466 Bacteria 5364
524 Ga0395898_0066901 3300037466 Bacteria 3480
525 Ga0395898_0170035 3300037466 Bacteria 2083
526 Ga0395898_0367021 3300037466 Bacteria 1373
527 Ga0395905_0009454 3300037471 Bacteria 9525
528 Ga0395905_0154216 3300037471 Bacteria 2160
529 Ga0395905_0167690 3300037471 Bacteria 2063
530 Ga0395905_0465460 3300037471 Bacteria 1163
531 Ga0436364_1166954 3300037853 Bacteria 5572
532 Ga0436364_1341441 3300037853 Bacteria 2709
533 Ga0395901_0037136 3300038443 Bacteria 5039
534 Ga0395901_0046711 3300038443 Bacteria 4498
535 Ga0395901_0059645 3300038443 Bacteria 3970
536 Ga0395901_0122876 3300038443 Bacteria 2728
537 Ga0395901_0182148 3300038443 Bacteria 2203
538 Ga0395901_0239195 3300038443 Bacteria 1894
539 Ga0395901_0392404 3300038443 Bacteria 1427
540 Ga0436365_0052183 3300039437 Bacteria 13005
541 Ga0436365_0828830 3300039437 Bacteria 2326
542 Ga0436365_0873719 3300039437 Bacteria 4710
543 Ga0436365_1136356 3300039437 Bacteria 11455
544 Ga0436363_1246162 3300039450 Bacteria 2496
545 Ga0439453_0005883 3300041408 Bacteria 1889
546 Ga0439446_0034412 3300042156 Bacteria 1474
547 Ga0439458_0005150 3300042157 Bacteria 2947
548 Ga0451577_0166812 3300042876 Bacteria 1984
549 Ga0466972_0000113 3300044658 Bacteria 69042
550 Ga0466972_0008577 3300044658 Bacteria 5129
551 Ga0466966_0000094 3300044684 Bacteria 54427
552 Ga0466961_0000118 3300044693 Bacteria 52882
553 Ga0466963_0026149 3300044694 Bacteria 3731
554 Ga0466963_0028581 3300044694 Bacteria 3582
555 Ga0466963_0053875 3300044694 Bacteria 2672
556 Ga0466970_0031842 3300044765 Bacteria 2786
557 Ga0466957_0006157 3300044842 Bacteria 6773
558 Ga0466960_0120251 3300044901 Bacteria 1375
559 Ga0466959_0065076 3300045049 Bacteria 2646
560 Ga0466959_0113703 3300045049 Bacteria 1930
561 Ga0466958_0006856 3300045836 Bacteria 6227
562 Ga0466958_0026812 3300045836 Bacteria 3406
563 Ga0466967_0263578 3300045976 Bacteria 1649
564 Ga0495617_011415 3300046452 Bacteria 3030
565 Ga0495627_034423 3300046453 Bacteria 1583
566 Ga0495592_0025176 3300046454 Bacteria 4518
567 Ga0495592_0037086 3300046454 Bacteria 3670
568 Ga0495592_0045952 3300046454 Bacteria 3256
569 Ga0495592_0046108 3300046454 Bacteria 3250
570 Ga0495603_0001681 3300046455 Bacteria 13000
571 Ga0495603_0002554 3300046455 Bacteria 10727
572 Ga0495603_0131829 3300046455 Bacteria 1455
573 Ga0495629_0000077 3300046459 Bacteria 85931
574 Ga0495629_0000165 3300046459 Bacteria 58366
575 Ga0495629_0033399 3300046459 Bacteria 3639
576 Ga0495638_0018892 3300046460 Bacteria 4568
577 Ga0495638_0045820 3300046460 Bacteria 2750
578 Ga0495638_0050514 3300046460 Bacteria 2596
579 Ga0495641_0000929 3300046461 Bacteria 24998
580 Ga0495641_0024336 3300046461 Bacteria 2991
581 Ga0495651_0009827 3300046462 Bacteria 7354
582 Ga0495651_0045132 3300046462 Bacteria 3414
583 Ga0495651_0106556 3300046462 Bacteria 2077
584 Ga0495651_0135609 3300046462 Bacteria 1791
585 Ga0495653_0002848 3300046463 Bacteria 13821
586 Ga0495653_0018166 3300046463 Bacteria 5715
587 Ga0495580_0000913 3300046472 Bacteria 25774
588 Ga0495580_0093205 3300046472 Bacteria 2096
589 Ga0495580_0102210 3300046472 Bacteria 1993
590 Ga0495582_0000016 3300046473 Bacteria 100714
591 Ga0495582_0018865 3300046473 Bacteria 3772
592 Ga0495582_0020941 3300046473 Bacteria 3581
593 Ga0495639_0000014 3300046475 Bacteria 82866
594 Ga0495639_0019480 3300046475 Bacteria 2963
595 Ga0495662_0000086 3300046476 Bacteria 33465
596 Ga0495662_0032757 3300046476 Bacteria 2511
597 Ga0495662_0071470 3300046476 Bacteria 1681
598 Ga0495664_0008014 3300046477 Bacteria 5882
599 Ga0495664_0100608 3300046477 Bacteria 1741
600 Ga0495664_0180595 3300046477 Bacteria 1280
601 Ga0495585_0021846 3300046492 Bacteria 3674
602 Ga0495594_0000420 3300046499 Bacteria 21403
603 Ga0495594_0046653 3300046499 Bacteria 2379
604 Ga0495607_0140319 3300046501 Bacteria 1247
605 Ga0495606_0000196 3300046507 Bacteria 105765
606 Ga0495606_0030531 3300046507 Bacteria 3765
607 Ga0495606_0033015 3300046507 Bacteria 3576
608 Ga0495608_0037100 3300046511 Bacteria 3278
609 Ga0495610_0031313 3300046512 Bacteria 2776
610 Ga0495610_0042674 3300046512 Bacteria 2266
611 Ga0495616_0048545 3300046513 Bacteria 2132
612 Ga0495616_0052358 3300046513 Bacteria 2033
613 Ga0495616_0083181 3300046513 Bacteria 1527
614 Ga0495618_0024388 3300046514 Bacteria 3745
615 Ga0495628_0027342 3300046516 Bacteria 4642
616 Ga0495628_0048184 3300046516 Bacteria 3378
617 Ga0495628_0079685 3300046516 Bacteria 2546
618 Ga0495630_0003176 3300046517 Bacteria 11417
619 Ga0495630_0034979 3300046517 Bacteria 3753
620 Ga0495630_0117521 3300046517 Bacteria 2016
621 Ga0495631_0017160 3300046518 Bacteria 3431
622 Ga0495632_0034239 3300046519 Bacteria 2601
623 Ga0495643_0040171 3300046522 Bacteria 2555
624 Ga0495648_0011613 3300046524 Bacteria 6620
625 Ga0495648_0030140 3300046524 Bacteria 3592
626 Ga0495652_0004103 3300046529 Bacteria 14051
627 Ga0495652_0028184 3300046529 Bacteria 4945
628 Ga0495652_0032661 3300046529 Bacteria 4550
629 Ga0495652_0070350 3300046529 Bacteria 2925
630 Ga0495652_0082876 3300046529 Bacteria 2641
631 Ga0495654_0008669 3300046530 Bacteria 5605
632 Ga0495665_0000665 3300046531 Bacteria 17688
633 Ga0495640_0007412 3300046533 Bacteria 8626
634 Ga0495640_0008807 3300046533 Bacteria 7893
635 Ga0495640_0013123 3300046533 Bacteria 6306
636 Ga0495640_0047285 3300046533 Bacteria 2978
637 Ga0495640_0085945 3300046533 Bacteria 2083
638 Ga0495640_0130271 3300046533 Bacteria 1628
639 Ga0495587_0004996 3300046536 Bacteria 8684
640 Ga0495645_0018393 3300046543 Bacteria 5017
641 Ga0495645_0100232 3300046543 Bacteria 2060
642 Ga0495622_0005435 3300046557 Bacteria 5912
643 Ga0495622_0048603 3300046557 Bacteria 1971
644 Ga0495622_0048651 3300046557 Bacteria 1969
645 Ga0495622_0056184 3300046557 Bacteria 1825
646 Ga0495622_0081871 3300046557 Bacteria 1485
647 Ga0495667_0007840 3300046559 Bacteria 7236
648 Ga0495667_0039628 3300046559 Bacteria 3132
649 Ga0495667_0064174 3300046559 Bacteria 2402
650 Ga0495656_0002336 3300046615 Bacteria 6275
651 Ga0495656_0025305 3300046615 Bacteria 2352
652 Ga0495668_0041374 3300046616 Bacteria 2567
653 Ga0495668_0078731 3300046616 Bacteria 1809
654 Ga0495634_0000859 3300046642 Bacteria 29254
655 Ga0495634_0114515 3300046642 Bacteria 1731
656 Ga0495625_0106401 3300046660 Bacteria 1921
657 Ga0495625_0219120 3300046660 Bacteria 1248
658 Ga0495635_0000160 3300046663 Bacteria 41557
659 Ga0495635_0010832 3300046663 Bacteria 6389
660 Ga0495635_0082903 3300046663 Bacteria 2194
661 Ga0495635_0090783 3300046663 Bacteria 2089
662 Ga0495661_0055948 3300046665 Bacteria 2362
663 Ga0495588_0073067 3300046674 Bacteria 1785
664 Ga0495657_0001362 3300046675 Bacteria 21216
665 Ga0495657_0005563 3300046675 Bacteria 9946
666 Ga0495657_0030874 3300046675 Bacteria 3749
667 Ga0495599_0002061 3300046678 Bacteria 11651
668 Ga0495599_0031531 3300046678 Bacteria 3326
669 Ga0495623_0001444 3300046679 Bacteria 16112
670 Ga0495623_0014196 3300046679 Bacteria 5159
671 Ga0495623_0079339 3300046679 Bacteria 2034
672 Ga0495646_0004949 3300046680 Bacteria 8413
673 Ga0495646_0040336 3300046680 Bacteria 2876
674 Ga0495646_0046774 3300046680 Bacteria 2636
675 Ga0495647_0010678 3300046681 Bacteria 3131
676 Ga0495658_0001756 3300046683 Bacteria 11202
677 Ga0495658_0097814 3300046683 Bacteria 1747
678 Ga0495669_0001159 3300046684 Bacteria 10954
679 Ga0495624_0000138 3300046690 Bacteria 52220
680 Ga0495624_0015049 3300046690 Bacteria 5237
681 Ga0495624_0112777 3300046690 Bacteria 1671
682 Ga0495624_0124961 3300046690 Bacteria 1579
683 Ga0495624_0135809 3300046690 Bacteria 1508
684 Ga0495670_0081736 3300046691 Bacteria 1646
685 Ga0495671_0070797 3300046692 Bacteria 1713
686 Ga0495649_0105837 3300046694 Bacteria 1493
687 Ga0495600_0003305 3300046809 Bacteria 9460
688 Ga0495600_0005469 3300046809 Bacteria 7659
689 Ga0495600_0005851 3300046809 Bacteria 7437
690 Ga0495581_0000001 3300047315 Bacteria 104278
691 Ga0495581_0040728 3300047315 Bacteria 2687
692 Ga0495604_0001234 3300047317 Bacteria 20953
693 Ga0495604_0005301 3300047317 Bacteria 10230
694 Ga0495604_0006543 3300047317 Bacteria 9235
695 Ga0495604_0039854 3300047317 Bacteria 3690
696 Ga0495604_0071998 3300047317 Bacteria 2613
697 Ga0495674_0002545 3300047319 Bacteria 17760
698 Ga0495674_0008583 3300047319 Bacteria 9724
699 Ga0495674_0020945 3300047319 Bacteria 6050
700 Ga0495674_0027892 3300047319 Bacteria 5156
701 Ga0495674_0052039 3300047319 Bacteria 3606
702 Ga0495674_0119699 3300047319 Bacteria 2225
703 Ga0495672_0073357 3300047320 Bacteria 1930
704 Ga0495672_0104025 3300047320 Bacteria 1535
705 Ga0495676_0032214 3300047321 Bacteria 4428
706 Ga0495680_0003866 3300047322 Bacteria 14497
707 Ga0495680_0012183 3300047322 Bacteria 7585
708 Ga0495683_0050327 3300047323 Bacteria 2085
709 Ga0495687_055047 3300047443 Bacteria 1665
710 Ga0495675_0000579 3300047444 Bacteria 23601
711 Ga0495675_0002075 3300047444 Bacteria 11965
712 Ga0495675_0002727 3300047444 Bacteria 10591
713 Ga0495675_0161884 3300047444 Bacteria 1377
714 Ga0495677_0024754 3300047445 Bacteria 2178
715 Ga0495673_0021201 3300047469 Bacteria 3215
716 Ga0495673_0036636 3300047469 Bacteria 2247
717 Ga0495684_0001407 3300047471 Bacteria 19272
718 Ga0495684_0015407 3300047471 Bacteria 5884
719 Ga0495684_0095266 3300047471 Bacteria 2253
720 Ga0495684_0198589 3300047471 Bacteria 1479
721 Ga0495686_0093016 3300047472 Bacteria 1828
722 Ga0495593_0021689 3300047673 Bacteria 3584
723 Ga0495593_0044214 3300047673 Bacteria 2383
724 Ga0495593_0081635 3300047673 Bacteria 1671
725 Ga0495602_0073830 3300048088 Bacteria 2901
726 Ga0495602_0115391 3300048088 Bacteria 2172
727 Ga0495602_0135074 3300048088 Bacteria 1961
728 Ga0495614_0081336 3300048089 Bacteria 1403
729 Ga0496100_0138796 3300048903 Bacteria 1720
730 Ga0496101_0024277 3300048904 Bacteria 4194
731 Ga0496101_0081094 3300048904 Bacteria 2399
732 Ga0496102_0004364 3300048905 Bacteria 11951
733 Ga0496102_0026902 3300048905 Bacteria 5135
734 Ga0496102_0126693 3300048905 Bacteria 2387
735 Ga0496102_0183178 3300048905 Bacteria 1973
736 Ga0496103_0030153 3300048906 Bacteria 3299
737 Ga0496104_0023586 3300048907 Bacteria 5657
738 Ga0496104_0291444 3300048907 Bacteria 1544
739 Ga0496105_0004690 3300048908 Bacteria 10303
740 Ga0496105_0021651 3300048908 Bacteria 5202
741 Ga0496105_0026924 3300048908 Bacteria 4692
742 Ga0496106_0005916 3300048909 Bacteria 9043
743 Ga0496106_0027070 3300048909 Bacteria 4269
744 Ga0496106_0228735 3300048909 Bacteria 1484
745 Ga0496106_0346451 3300048909 Bacteria 1193
746 Ga0496107_0048041 3300048910 Bacteria 3073
747 Ga0496107_0108444 3300048910 Bacteria 2039
748 Ga0496107_0114635 3300048910 Bacteria 1983
749 Ga0496108_0023518 3300048911 Bacteria 5071
750 Ga0496108_0066473 3300048911 Bacteria 3040
751 Ga0496108_0136458 3300048911 Bacteria 2111
752 Ga0496109_0005410 3300048912 Bacteria 10678
753 Ga0496109_0012331 3300048912 Bacteria 7379
754 Ga0496109_0020991 3300048912 Bacteria 5774
755 Ga0496109_0104237 3300048912 Bacteria 2633
756 Ga0496109_0221039 3300048912 Bacteria 1781
757 Ga0496110_0029267 3300048913 Bacteria 4739
758 Ga0496110_0031172 3300048913 Bacteria 4599
759 Ga0496110_0043984 3300048913 Bacteria 3899
760 Ga0496110_0087682 3300048913 Bacteria 2779
761 Ga0496110_0089255 3300048913 Bacteria 2755
762 Ga0496110_0327100 3300048913 Bacteria 1396
763 Ga0496110_0338654 3300048913 Bacteria 1370
764 Ga0496111_0028518 3300048914 Bacteria 3956
765 Ga0496111_0040389 3300048914 Bacteria 3347
766 Ga0496111_0042641 3300048914 Bacteria 3259
767 Ga0496111_0132461 3300048914 Bacteria 1845
768 Ga0496111_0196314 3300048914 Bacteria 1500
769 Ga0496111_0254972 3300048914 Bacteria 1302
770 Ga0496112_0000044 3300048915 Bacteria 86865
771 Ga0496112_0000342 3300048915 Bacteria 30306
772 Ga0496112_0014805 3300048915 Bacteria 7253
773 Ga0496112_0018318 3300048915 Bacteria 6592
774 Ga0496112_0021871 3300048915 Bacteria 6086
775 Ga0496112_0093681 3300048915 Bacteria 2974
776 Ga0496112_0255827 3300048915 Bacteria 1701
777 Ga0496112_0271698 3300048915 Bacteria 1643
778 Ga0496112_0323815 3300048915 Bacteria 1485
779 Ga0496113_0005475 3300048916 Bacteria 7920
780 Ga0496113_0015669 3300048916 Bacteria 5219
781 Ga0496113_0029593 3300048916 Bacteria 3957
782 Ga0496113_0085949 3300048916 Bacteria 2416
783 Ga0496114_0017464 3300048917 Bacteria 5790
784 Ga0496114_0051070 3300048917 Bacteria 3442
785 Ga0496114_0144403 3300048917 Bacteria 2062
786 Ga0496114_0198310 3300048917 Bacteria 1757
787 Ga0496115_0000619 3300048918 Bacteria 26938
788 Ga0496115_0002089 3300048918 Bacteria 14308
789 Ga0496115_0012493 3300048918 Bacteria 6393
790 Ga0496115_0025238 3300048918 Bacteria 4626
791 Ga0496115_0089498 3300048918 Bacteria 2514
792 Ga0496115_0110379 3300048918 Bacteria 2259
793 Ga0496115_0139608 3300048918 Bacteria 1999
794 Ga0496117_0010855 3300048920 Bacteria 8216
795 Ga0496117_0022245 3300048920 Bacteria 5090
796 Ga0496117_0061701 3300048920 Bacteria 2575
797 Ga0496118_0006532 3300048921 Bacteria 12757
798 Ga0496118_0020316 3300048921 Bacteria 5893
799 Ga0496119_0019407 3300048922 Bacteria 5009
800 Ga0496119_0073072 3300048922 Bacteria 2001
801 Ga0496119_0083148 3300048922 Bacteria 1839
802 Ga0496121_0000041 3300048924 Bacteria 346686
803 Ga0496121_0001183 3300048924 Bacteria 45653
804 Ga0496121_0001244 3300048924 Bacteria 44194
805 Ga0496121_0003563 3300048924 Bacteria 22031
806 Ga0496121_0012601 3300048924 Bacteria 9188
807 Ga0496121_0023065 3300048924 Bacteria 6012
808 Ga0496121_0026867 3300048924 Bacteria 5406
809 Ga0496121_0057954 3300048924 Bacteria 3206
810 Ga0496121_0063495 3300048924 Bacteria 3017
811 Ga0496121_0073802 3300048924 Bacteria 2732
812 Ga0496121_0106593 3300048924 Bacteria 2148
813 Ga0496121_0147697 3300048924 Bacteria 1734
814 Ga0496122_0029843 3300048925 Bacteria 4586
815 Ga0496122_0115546 3300048925 Bacteria 1747
816 Ga0496123_0037136 3300048926 Bacteria 3444
817 Ga0496124_0000624 3300048927 Bacteria 58976
818 Ga0496125_0000504 3300048928 Bacteria 67902
819 Ga0496125_0000712 3300048928 Bacteria 54983
820 Ga0496125_0009811 3300048928 Bacteria 9757
821 Ga0496125_0051838 3300048928 Bacteria 3380
822 Ga0496126_0001799 3300048929 Bacteria 31424
823 Ga0496126_0007021 3300048929 Bacteria 12429
824 Ga0496126_0008123 3300048929 Bacteria 11360
825 Ga0496126_0008842 3300048929 Bacteria 10799
826 Ga0496126_0010850 3300048929 Bacteria 9499
827 Ga0496126_0011784 3300048929 Bacteria 9001
828 Ga0496126_0020974 3300048929 Bacteria 6394
829 Ga0496126_0031915 3300048929 Bacteria 4969
830 Ga0496126_0049331 3300048929 Bacteria 3844
831 Ga0496126_0134140 3300048929 Bacteria 2137
832 Ga0496126_0145793 3300048929 Bacteria 2033
833 Ga0496126_0148587 3300048929 Bacteria 2010
834 Ga0501031_0000657 3300049568 Bacteria 20491
835 Ga0501031_0006130 3300049568 Bacteria 7848
836 Ga0501032_0000198 3300049569 Bacteria 50120
837 Ga0501032_0001779 3300049569 Bacteria 17008
838 Ga0501033_0000091 3300049570 Bacteria 85666
839 Ga0501033_0001037 3300049570 Bacteria 25294
840 Ga0501034_0000039 3300049571 Bacteria 237357
841 Ga0501034_0007438 3300049571 Bacteria 11658
842 Ga0501034_0008754 3300049571 Bacteria 10652
843 Ga0501034_0095199 3300049571 Bacteria 2975
844 Ga0501036_0000134 3300049572 Bacteria 47683
845 Ga0501036_0000347 3300049572 Bacteria 32588
846 Ga0501037_0000025 3300049573 Bacteria 143276
847 Ga0501037_0004145 3300049573 Bacteria 10513
848 Ga0501038_0000929 3300049574 Bacteria 26055
849 Ga0501038_0002497 3300049574 Bacteria 17114
850 Ga0501039_0000550 3300049575 Bacteria 27148
851 Ga0501039_0005656 3300049575 Bacteria 9465
852 Ga0501042_0028182 3300049578 Bacteria 3954
853 Ga0501043_0000233 3300049579 Bacteria 50329
854 Ga0501043_0021633 3300049579 Bacteria 5042
855 Ga0501046_0000995 3300049580 Bacteria 27709
856 Ga0501046_0058683 3300049580 Bacteria 3016
857 Ga0501046_0088815 3300049580 Bacteria 2380
858 Ga0501047_0004251 3300049581 Bacteria 13481
859 Ga0501047_0045211 3300049581 Bacteria 4257
860 Ga0501048_0000218 3300049582 Bacteria 37734
861 Ga0501048_0178806 3300049582 Bacteria 1504
862 Ga0501067_0000973 3300049583 Bacteria 15393
863 Ga0501067_0029581 3300049583 Bacteria 3036
864 Ga0501068_0000785 3300049584 Bacteria 16408
865 Ga0501068_0165689 3300049584 Bacteria 1394
866 Ga0501069_0015183 3300049585 Bacteria 4127
867 Ga0501069_0019027 3300049585 Bacteria 3710
868 Ga0501070_0002981 3300049586 Bacteria 14743
869 Ga0501070_0026807 3300049586 Bacteria 4833
870 Ga0501070_0174986 3300049586 Bacteria 1767
871 Ga0501071_0056067 3300049587 Bacteria 2846
872 Ga0501072_0007128 3300049588 Bacteria 8484
873 Ga0501072_0050543 3300049588 Bacteria 3273
874 Ga0501072_0101782 3300049588 Bacteria 2283
875 Ga0501072_0113554 3300049588 Bacteria 2157
876 Ga0501073_0000118 3300049589 Bacteria 50886
877 Ga0501074_0000724 3300049590 Bacteria 20696
878 Ga0501076_0046016 3300049592 Bacteria 3447
879 Ga0501079_0000590 3300049741 Bacteria 24020
880 Ga0501080_0000124 3300049742 Bacteria 54519
881 Ga0501080_0023280 3300049742 Bacteria 5743
882 Ga0501080_0114361 3300049742 Bacteria 2502
883 Ga0501080_0350293 3300049742 Bacteria 1334
884 Ga0501083_0000184 3300049744 Bacteria 40201
885 Ga0501262_004277 3300049759 Bacteria 1656
886 Ga0501265_001763 3300049762 Bacteria 2458
887 Ga0501035_0000052 3300049822 Bacteria 143038
888 Ga0501035_0008174 3300049822 Bacteria 9749
889 Ga0501044_0001974 3300049823 Bacteria 23731
890 Ga0501044_0005964 3300049823 Bacteria 13483
891 Ga0501045_0009338 3300049824 Bacteria 6856
892 nmdc:mga03683_103077_c1 3300050489 Bacteria 1255
893 nmdc:mga03683_37826_c1 3300050489 Bacteria 1968
894 nmdc:mga03683_52171_c1 3300050489 Bacteria 1709
895 nmdc:mga03n38_11303_c1 3300050490 Bacteria 3320
896 nmdc:mga03n38_421_c1 3300050490 Bacteria 10501
897 nmdc:mga03n38_58325_c1 3300050490 Bacteria 1749
898 nmdc:mga00v17_20073_c1 3300050491 Bacteria 3824
899 nmdc:mga00v17_21986_c1 3300050491 Bacteria 3676
900 nmdc:mga00v17_39489_c1 3300050491 Bacteria 2827
901 nmdc:mga00v17_54704_c1 3300050491 Bacteria 2435
902 nmdc:mga00v17_71107_c1 3300050491 Bacteria 2156
903 nmdc:mga0k408_173388_c1 3300050493 Bacteria 1286
904 nmdc:mga0k408_8907_c1 3300050493 Bacteria 5400
905 nmdc:mga06z11_138917_c1 3300050494 Bacteria 1372
906 nmdc:mga06z11_1539_c1 3300050494 Bacteria 8561
907 nmdc:mga06z11_15566_c1 3300050494 Bacteria 3398
908 nmdc:mga06z11_26257_c1 3300050494 Bacteria 2770
909 nmdc:mga06z11_27713_c1 3300050494 Bacteria 2710
910 nmdc:mga06z11_3403_c1 3300050494 Bacteria 6146
911 nmdc:mga06z11_9669_c1 3300050494 Bacteria 4073
912 nmdc:mga06z11_99692_c1 3300050494 Bacteria 1592
913 nmdc:mga04h51_43205_c1 3300050495 Bacteria 1482
914 nmdc:mga04h51_46672_c1 3300050495 Bacteria 1437
915 nmdc:mga04h51_54831_c1 3300050495 Bacteria 1349
916 nmdc:mga07m45_104020_c1 3300050496 Bacteria 1632
917 nmdc:mga07m45_19907_c1 3300050496 Bacteria 3641
918 nmdc:mga07m45_50561_c1 3300050496 Bacteria 2342
919 nmdc:mga07m45_92466_c1 3300050496 Bacteria 1734
920 nmdc:mga05p37_88061_c1 3300050507 Bacteria 3827
921 nmdc:mga09592_238708_c1 3300050508 Bacteria 1575
922 nmdc:mga06r32_14185_c1 3300050510 Bacteria 7228
923 nmdc:mga06r32_158105_c1 3300050510 Bacteria 2248
924 nmdc:mga08y16_101861_c1 3300050511 Bacteria 2989
925 nmdc:mga08y16_136369_c1 3300050511 Bacteria 2551
926 nmdc:mga08y16_335756_c1 3300050511 Bacteria 1554
927 nmdc:mga08y16_90800_c1 3300050511 Bacteria 3184
928 nmdc:mga0n895_169243_c1 3300050512 Bacteria 2217
929 nmdc:mga0rr50_53185_c1 3300050513 Bacteria 3012
930 nmdc:mga0a205_121136_c1 3300050515 Bacteria 2515
931 nmdc:mga0sz30_892_c1 3300050516 Bacteria 10764
932 Ga0495601_0051532 3300053077 Bacteria 2598
933 Ga0495601_0058890 3300053077 Bacteria 2435
934 Ga0495612_0004090 3300053078 Bacteria 6044
935 Ga0495612_0059233 3300053078 Bacteria 1583
936 Ga0495595_0000314 3300053084 Bacteria 18872
937 Ga0495619_0001159 3300053085 Bacteria 17308
938 Ga0495619_0010035 3300053085 Bacteria 5960
939 Ga0495619_0012831 3300053085 Bacteria 5277
940 Ga0495619_0045760 3300053085 Bacteria 2875
941 Ga0500643_001368 3300053087 Bacteria 14139
942 Ga0500643_004397 3300053087 Bacteria 6392
943 Ga0500651_0001603 3300053093 Bacteria 11492
944 Ga0500651_0029129 3300053093 Bacteria 3470
945 Ga0500651_0042209 3300053093 Bacteria 2874
946 Ga0500651_0052622 3300053093 Bacteria 2553
947 Ga0500566_0000112 3300053094 Bacteria 41687
948 Ga0500566_0000977 3300053094 Bacteria 16463
949 Ga0500566_0001893 3300053094 Bacteria 12317
950 Ga0500566_0019034 3300053094 Bacteria 4032
951 Ga0500566_0050249 3300053094 Bacteria 2388
952 Ga0500640_001798 3300053095 Bacteria 6749
953 Ga0500641_0019500 3300053096 Bacteria 2565
954 Ga0500641_0021052 3300053096 Bacteria 2480
955 Ga0500641_0076775 3300053096 Bacteria 1413
956 Ga0500650_0012794 3300053098 Bacteria 3500
957 Ga0500555_006850 3300053103 Bacteria 3240
958 Ga0500556_0000002 3300053104 Bacteria 773626
959 Ga0500556_0003137 3300053104 Bacteria 4928
960 Ga0500557_000003 3300053105 Bacteria 228429
961 Ga0500562_019507 3300053108 Bacteria 1754
962 Ga0500569_012395 3300053109 Bacteria 2061
963 Ga0500569_014417 3300053109 Bacteria 1956
964 Ga0500572_001579 3300053111 Bacteria 6051
965 Ga0500592_002202 3300053116 Bacteria 3147
966 Ga0500593_002237 3300053117 Bacteria 7064
967 Ga0500595_000001 3300053119 Bacteria 1088438
968 Ga0500595_000906 3300053119 Bacteria 16896
969 Ga0500595_005109 3300053119 Bacteria 5759
970 Ga0500595_012231 3300053119 Bacteria 3327
971 Ga0500595_013615 3300053119 Bacteria 3112
972 Ga0500607_048600 3300053121 Bacteria 2267
973 Ga0500607_066703 3300053121 Bacteria 1866
974 Ga0500614_005002 3300053123 Bacteria 2785
975 Ga0500642_0000026 3300053130 Bacteria 127731
976 Ga0500642_0000051 3300053130 Bacteria 77123
977 Ga0500642_0003882 3300053130 Bacteria 4597
978 Ga0500652_002679 3300053131 Bacteria 5378
979 Ga0500559_0000502 3300053136 Bacteria 27452
980 Ga0500559_0042677 3300053136 Bacteria 1979
981 Ga0500559_0053929 3300053136 Bacteria 1780
982 Ga0500568_0000519 3300053139 Bacteria 28419
983 Ga0500568_0010252 3300053139 Bacteria 4399
984 Ga0500577_0007028 3300053142 Bacteria 3137
985 Ga0500586_003947 3300053145 Bacteria 3569
986 Ga0500603_000746 3300053150 Bacteria 7921
987 Ga0500604_0000440 3300053151 Bacteria 11390
988 Ga0500616_0000031 3300053153 Bacteria 415013
989 Ga0500616_0000547 3300053153 Bacteria 46727
990 Ga0500616_0094226 3300053153 Bacteria 1476
991 Ga0500622_0000106 3300053156 Bacteria 85750
992 Ga0500622_0004681 3300053156 Bacteria 8463
993 Ga0500622_0029022 3300053156 Bacteria 2911
994 Ga0500630_003177 3300053159 Bacteria 7941
995 Ga0500639_000061 3300053163 Bacteria 49500
996 Ga0500636_0007886 3300053177 Bacteria 6158
997 Ga0500637_0000098 3300053178 Bacteria 31362
998 Ga0500625_008055 3300053729 Bacteria 4625
999 Ga0500609_001453 3300053731 Bacteria 3468
1000 Ga0500609_003779 3300053731 Bacteria 2112
1001 Ga0500596_001455 3300053735 Bacteria 4795
1002 Ga0500601_000504 3300053737 Bacteria 6010
1003 Ga0501084_0002419 3300054114 Bacteria 15019
1004 Ga0501084_0042743 3300054114 Bacteria 3791
1005 Ga0501082_0000457 3300060353 Bacteria 36134
1006 Ga0530510_0125277 3300061734 Bacteria 1888
1007 Ga0530510_0242905 3300061734 Bacteria 1341

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0350293 Ga0501080_0350293_245_1291 332
2 iso_pu_bacteria 8016539877 8016546972 355
3 3300013307 Ga0157372_10524700 Ga0157372_105247002 365
4 3300034818 Ga0373950_0017092 Ga0373950_0017092_16_1119 365
5 3300046660 Ga0495625_0106401 Ga0495625_0106401_10_1113 365
6 3300046694 Ga0495649_0105837 Ga0495649_0105837_372_1475 365
7 3300048089 Ga0495614_0081336 Ga0495614_0081336_14_1117 365
8 3300048929 Ga0496126_0148587 Ga0496126_0148587_20_1123 365
9 3300050490 nmdc:mga03n38_11303_c1 nmdc:mga03n38_11303_c1_2125_3228 365
10 3300050491 nmdc:mga00v17_39489_c1 nmdc:mga00v17_39489_c1_700_1803 365
11 3300050494 nmdc:mga06z11_3403_c1 nmdc:mga06z11_3403_c1_4921_6024 365
12 3300050495 nmdc:mga04h51_54831_c1 nmdc:mga04h51_54831_c1_23_1126 365
13 3300050496 nmdc:mga07m45_50561_c1 nmdc:mga07m45_50561_c1_66_1169 365
14 3300053109 Ga0500569_014417 Ga0500569_014417_839_1942 365
15 3300035695 Ga0373927_0157191 Ga0373927_0157191_204_1367 367
16 3300046681 Ga0495647_0010678 Ga0495647_0010678_1748_2911 367
17 3300014968 Ga0157379_10023235 Ga0157379_100232354 371
18 3300005347 Ga0070668_100027692 Ga0070668_1000276923 372
19 3300005435 Ga0070714_100075963 Ga0070714_1000759631 372
20 3300006048 Ga0075363_100007935 Ga0075363_1000079354 372
21 3300009553 Ga0105249_10288149 Ga0105249_102881492 372
22 3300009553 Ga0105249_10406987 Ga0105249_104069872 372
23 3300013104 Ga0157370_10089633 Ga0157370_100896332 372
24 3300013306 Ga0163162_10071836 Ga0163162_100718363 372
25 3300014325 Ga0163163_10005260 Ga0163163_100052602 372
26 3300014326 Ga0157380_10058124 Ga0157380_100581242 372
27 3300017792 Ga0163161_10063621 Ga0163161_100636212 372
28 3300025914 Ga0207671_10048241 Ga0207671_100482412 372
29 3300025929 Ga0207664_10128139 Ga0207664_101281392 372
30 3300028380 Ga0268265_10033549 Ga0268265_100335493 372
31 3300028666 Ga0265336_10001051 Ga0265336_100010513 372
32 3300028800 Ga0265338_10010144 Ga0265338_1001014410 372
33 3300031240 Ga0265320_10001942 Ga0265320_100019422 372
34 3300031241 Ga0265325_10044396 Ga0265325_100443962 372
35 3300031251 Ga0265327_10002606 Ga0265327_100026065 372
36 3300034816 Ga0373930_0013432 Ga0373930_0013432_98_1216 372
37 3300034817 Ga0373948_0011963 Ga0373948_0011963_33_1151 372
38 3300035085 Ga0373929_0028456 Ga0373929_0028456_21_1139 372
39 3300035090 Ga0373949_0008964 Ga0373949_0008964_455_1573 372
40 3300035117 Ga0373953_0026586 Ga0373953_0026586_441_1565 372
41 3300035118 Ga0373954_0014777 Ga0373954_0014777_1999_3123 372
42 3300035119 Ga0373956_0019312 Ga0373956_0019312_582_1706 372
43 3300035172 Ga0373955_0008741 Ga0373955_0008741_2824_3948 372
44 3300035241 Ga0373961_0005467 Ga0373961_0005467_595_1713 372
45 3300035241 Ga0373961_0021351 Ga0373961_0021351_443_1561 372
46 3300035724 Ga0373933_0043148 Ga0373933_0043148_221_1345 372
47 3300035725 Ga0373947_0174368 Ga0373947_0174368_251_1375 372
48 3300036401 Ga0373937_0262907 Ga0373937_0262907_99_1223 372
49 3300037068 Ga0373925_0131653 Ga0373925_0131653_655_1779 372
50 3300037471 Ga0395905_0465460 Ga0395905_0465460_22_1146 372
51 3300038443 Ga0395901_0059645 Ga0395901_0059645_2230_3354 372
52 3300042876 Ga0451577_0166812 Ga0451577_0166812_186_1304 372
53 3300046461 Ga0495641_0024336 Ga0495641_0024336_1248_2372 372
54 3300046462 Ga0495651_0135609 Ga0495651_0135609_601_1725 372
55 3300046463 Ga0495653_0018166 Ga0495653_0018166_3694_4818 372
56 3300046472 Ga0495580_0093205 Ga0495580_0093205_874_1998 372
57 3300046472 Ga0495580_0102210 Ga0495580_0102210_12_1136 372
58 3300046475 Ga0495639_0019480 Ga0495639_0019480_1054_2178 372
59 3300046476 Ga0495662_0071470 Ga0495662_0071470_224_1348 372
60 3300046477 Ga0495664_0100608 Ga0495664_0100608_24_1148 372
61 3300046499 Ga0495594_0046653 Ga0495594_0046653_944_2068 372
62 3300046511 Ga0495608_0037100 Ga0495608_0037100_1023_2147 372
63 3300046514 Ga0495618_0024388 Ga0495618_0024388_1822_2946 372
64 3300046516 Ga0495628_0027342 Ga0495628_0027342_1023_2147 372
65 3300046517 Ga0495630_0117521 Ga0495630_0117521_488_1612 372
66 3300046529 Ga0495652_0082876 Ga0495652_0082876_13_1137 372
67 3300046533 Ga0495640_0013123 Ga0495640_0013123_4561_5685 372
68 3300046533 Ga0495640_0085945 Ga0495640_0085945_358_1482 372
69 3300046536 Ga0495587_0004996 Ga0495587_0004996_6538_7662 372
70 3300046557 Ga0495622_0081871 Ga0495622_0081871_76_1200 372
71 3300046559 Ga0495667_0007840 Ga0495667_0007840_5341_6465 372
72 3300046642 Ga0495634_0114515 Ga0495634_0114515_217_1341 372
73 3300046663 Ga0495635_0082903 Ga0495635_0082903_859_1983 372
74 3300046674 Ga0495588_0073067 Ga0495588_0073067_535_1659 372
75 3300046675 Ga0495657_0001362 Ga0495657_0001362_19828_20952 372
76 3300046678 Ga0495599_0031531 Ga0495599_0031531_1231_2355 372
77 3300046679 Ga0495623_0001444 Ga0495623_0001444_14393_15517 372
78 3300046680 Ga0495646_0004949 Ga0495646_0004949_6645_7769 372
79 3300046683 Ga0495658_0097814 Ga0495658_0097814_430_1554 372
80 3300046690 Ga0495624_0112777 Ga0495624_0112777_361_1485 372
81 3300047315 Ga0495581_0040728 Ga0495581_0040728_858_1982 372
82 3300047317 Ga0495604_0001234 Ga0495604_0001234_17056_18180 372
83 3300047319 Ga0495674_0027892 Ga0495674_0027892_2521_3645 372
84 3300047319 Ga0495674_0052039 Ga0495674_0052039_1001_2125 372
85 3300047322 Ga0495680_0012183 Ga0495680_0012183_1423_2547 372
86 3300047444 Ga0495675_0000579 Ga0495675_0000579_468_1592 372
87 3300047471 Ga0495684_0198589 Ga0495684_0198589_23_1147 372
88 3300047673 Ga0495593_0081635 Ga0495593_0081635_186_1310 372
89 3300048088 Ga0495602_0073830 Ga0495602_0073830_1133_2257 372
90 3300048904 Ga0496101_0024277 Ga0496101_0024277_2715_3839 372
91 3300048905 Ga0496102_0026902 Ga0496102_0026902_2272_3396 372
92 3300048905 Ga0496102_0183178 Ga0496102_0183178_250_1374 372
93 3300048908 Ga0496105_0026924 Ga0496105_0026924_2546_3670 372
94 3300048909 Ga0496106_0027070 Ga0496106_0027070_184_1308 372
95 3300048909 Ga0496106_0228735 Ga0496106_0228735_311_1435 372
96 3300048910 Ga0496107_0048041 Ga0496107_0048041_187_1311 372
97 3300048911 Ga0496108_0023518 Ga0496108_0023518_365_1489 372
98 3300048911 Ga0496108_0066473 Ga0496108_0066473_1780_2904 372
99 3300048911 Ga0496108_0136458 Ga0496108_0136458_348_1466 372
100 3300048912 Ga0496109_0005410 Ga0496109_0005410_5831_6949 372
101 3300048912 Ga0496109_0012331 Ga0496109_0012331_4309_5433 372
102 3300048912 Ga0496109_0020991 Ga0496109_0020991_1217_2341 372
103 3300048913 Ga0496110_0029267 Ga0496110_0029267_3196_4314 372
104 3300048914 Ga0496111_0042641 Ga0496111_0042641_1518_2642 372
105 3300048914 Ga0496111_0254972 Ga0496111_0254972_49_1167 372
106 3300048915 Ga0496112_0018318 Ga0496112_0018318_1310_2428 372
107 3300048916 Ga0496113_0015669 Ga0496113_0015669_1587_2705 372
108 3300048917 Ga0496114_0198310 Ga0496114_0198310_367_1491 372
109 3300048918 Ga0496115_0012493 Ga0496115_0012493_4867_5991 372
110 3300048918 Ga0496115_0025238 Ga0496115_0025238_1763_2887 372
111 3300048929 Ga0496126_0001799 Ga0496126_0001799_2019_3146 372
112 3300049587 Ga0501071_0056067 Ga0501071_0056067_269_1387 372
113 3300050494 nmdc:mga06z11_15566_c1 nmdc:mga06z11_15566_c1_467_1591 372
114 3300050511 nmdc:mga08y16_136369_c1 nmdc:mga08y16_136369_c1_276_1394 372
115 3300050511 nmdc:mga08y16_335756_c1 nmdc:mga08y16_335756_c1_304_1422 372
116 3300053077 Ga0495601_0051532 Ga0495601_0051532_1444_2568 372
117 3300053078 Ga0495612_0004090 Ga0495612_0004090_3062_4186 372
118 3300053084 Ga0495595_0000314 Ga0495595_0000314_11278_12402 372
119 3300053085 Ga0495619_0010035 Ga0495619_0010035_188_1312 372
120 3300053085 Ga0495619_0012831 Ga0495619_0012831_406_1530 372
121 3300053139 Ga0500568_0010252 Ga0500568_0010252_3250_4374 372
122 3300053153 Ga0500616_0000547 Ga0500616_0000547_8675_9799 372
123 3300061734 Ga0530510_0242905 Ga0530510_0242905_55_1173 372
124 3300005435 Ga0070714_100009461 Ga0070714_1000094612 374
125 3300006028 Ga0070717_10075971 Ga0070717_100759713 374
126 iso_pu_bacteria 2874123672 2874128766 375
127 3300050512 nmdc:mga0n895_169243_c1 nmdc:mga0n895_169243_c1_774_1910 376
128 3300050515 nmdc:mga0a205_121136_c1 nmdc:mga0a205_121136_c1_1279_2415 376
129 iso_pu_bacteria 2507262055 2507507564 377
130 iso_pu_bacteria 2508501009 2508541683 377
131 iso_pu_bacteria 2508501042 2508692779 377
132 iso_pu_bacteria 2508501114 2509074862 377
133 iso_pu_bacteria 2508501128 2509152962 377
134 iso_pu_bacteria 2511231028 2511394859 377
135 iso_pu_bacteria 2513237092 2513621759 377
136 iso_pu_bacteria 2513237094 2513636799 377
137 iso_pu_bacteria 2513237095 2513651259 377
138 iso_pu_bacteria 2513237096 2513654186 377
139 iso_pu_bacteria 2513237098 2513674865 377
140 iso_pu_bacteria 2513237101 2513697128 377
141 iso_pu_bacteria 2513237102 2513704464 377
142 iso_pu_bacteria 2513237104 2513720775 377
143 iso_pu_bacteria 2513237137 2513856941 377
144 iso_pu_bacteria 2513237139 2513878743 377
145 iso_pu_bacteria 2513237141 2513894163 377
146 iso_pu_bacteria 2513237145 2513918526 377
147 iso_pu_bacteria 2513237161 2514009330 377
148 iso_pu_bacteria 2515154112 2515626173 377
149 iso_pu_bacteria 2517093001 2517104266 377
150 iso_pu_bacteria 2517572143 2517891238 377
151 iso_pu_bacteria 2522572158 2523106010 377
152 iso_pu_bacteria 2524023205 2524436179 377
153 iso_pu_bacteria 2524023210 2524468243 377
154 iso_pu_bacteria 2524023228 2524533567 377
155 iso_pu_bacteria 2528768022 2528848878 377
156 iso_pu_bacteria 2585428058 2587732231 377
157 iso_pu_bacteria 2585428062 2587758485 377
158 iso_pu_bacteria 2588253510 2588292200 377
159 iso_pu_bacteria 2602042107 2603861395 377
160 iso_pu_bacteria 2617270735 2617346900 377
161 iso_pu_bacteria 2617270741 2617372830 377
162 iso_pu_bacteria 2643221545 2643748306 377
163 iso_pu_bacteria 2643221592 2643971837 377
164 iso_pu_bacteria 2643221625 2644139326 377
165 iso_pu_bacteria 2643221648 2644274936 377
166 iso_pu_bacteria 2643221691 2644508159 377
167 iso_pu_bacteria 2667528175 2671123768 377
168 iso_pu_bacteria 2721755755 2723843598 377
169 iso_pu_bacteria 2728368998 2728749936 377
170 iso_pu_bacteria 2744054633 2745080865 377
171 iso_pu_bacteria 2775506901 2776262744 377
172 iso_pu_bacteria 2791355196 2793060973 377
173 iso_pu_bacteria 2791355197 2793066593 377
174 iso_pu_bacteria 2791355199 2793083884 377
175 iso_pu_bacteria 2802429603 2805921392 377
176 iso_pu_bacteria 2816332527 2818236662 377
177 iso_pu_bacteria 2824600985 2824602882 377
178 iso_pu_bacteria 2824609381 2824611895 377
179 iso_pu_bacteria 2824617872 2824621468 377
180 iso_pu_bacteria 2824626560 2824630580 377
181 iso_pu_bacteria 2824635225 2824643023 377
182 iso_pu_bacteria 2824644064 2824651241 377
183 iso_pu_bacteria 2824653114 2824659657 377
184 iso_pu_bacteria 2824661429 2824664509 377
185 iso_pu_bacteria 2824671348 2824672204 377
186 iso_pu_bacteria 2824679649 2824685510 377
187 iso_pu_bacteria 2824687955 2824688913 377
188 iso_pu_bacteria 2824696289 2824703557 377
189 iso_pu_bacteria 2824704595 2824712692 377
190 iso_pu_bacteria 2824714736 2824721276 377
191 iso_pu_bacteria 2824723954 2824729844 377
192 iso_pu_bacteria 2824732956 2824733912 377
193 iso_pu_bacteria 2824746037 2824748345 377
194 iso_pu_bacteria 2824753945 2824756089 377
195 iso_pu_bacteria 2824763712 2824766436 377
196 iso_pu_bacteria 2824773399 2824776563 377
197 iso_pu_bacteria 2835312727 2835318616 377
198 iso_pu_bacteria 2838122688 2838129321 377
199 iso_pu_bacteria 2841941048 2841948023 377
200 iso_pu_bacteria 2841949485 2841953579 377
201 iso_pu_bacteria 2841957949 2841962814 377
202 iso_pu_bacteria 2841966195 2841973016 377
203 iso_pu_bacteria 2841974524 2841978306 377
204 iso_pu_bacteria 2841983080 2841990526 377
205 iso_pu_bacteria 2842038055 2842040747 377
206 iso_pu_bacteria 2842045827 2842046307 377
207 iso_pu_bacteria 2844315083 2844320127 377
208 iso_pu_bacteria 2847930680 2847937422 377
209 iso_pu_bacteria 2847939898 2847947846 377
210 iso_pu_bacteria 2849076700 2849078299 377
211 iso_pu_bacteria 2857509624 2857512675 377
212 iso_pu_bacteria 2857524615 2857530168 377
213 iso_pu_bacteria 2874590934 2874598679 377
214 iso_pu_bacteria 2874604998 2874607193 377
215 iso_pu_bacteria 2874612657 2874614465 377
216 iso_pu_bacteria 2874620515 2874628178 377
217 iso_pu_bacteria 2874628541 2874630219 377
218 iso_pu_bacteria 2874645413 2874652134 377
219 iso_pu_bacteria 2876761206 2876768189 377
220 iso_pu_bacteria 2876771140 2876778718 377
221 iso_pu_bacteria 2876808645 2876818305 377
222 iso_pu_bacteria 2876818435 2876823522 377
223 iso_pu_bacteria 2879074833 2879082511 377
224 iso_pu_bacteria 2879083081 2879086722 377
225 iso_pu_bacteria 2879099564 2879107812 377
226 iso_pu_bacteria 2879110137 2879114083 377
227 iso_pu_bacteria 2879127579 2879131709 377
228 iso_pu_bacteria 2879142872 2879150045 377
229 iso_pu_bacteria 2881364244 2881371359 377
230 iso_pu_bacteria 2881665667 2881672213 377
231 iso_pu_bacteria 2885366525 2885370067 377
232 iso_pu_bacteria 2885374607 2885383133 377
233 iso_pu_bacteria 2885383462 2885386073 377
234 iso_pu_bacteria 2885409591 2885415631 377
235 iso_pu_bacteria 2888378607 2888385564 377
236 iso_pu_bacteria 2888388044 2888392685 377
237 iso_pu_bacteria 2888419890 2888425693 377
238 iso_pu_bacteria 2889033259 2889037916 377
239 iso_pu_bacteria 2889415604 2889416342 377
240 iso_pu_bacteria 2893066018 2893066060 377
241 iso_pu_bacteria 2894232714 2894241251 377
242 iso_pu_bacteria 2903727486 2903734621 377
243 iso_pu_bacteria 2903748898 2903754667 377
244 iso_pu_bacteria 2903768456 2903774865 377
245 iso_pu_bacteria 2904666416 2904674204 377
246 iso_pu_bacteria 2904690495 2904694140 377
247 iso_pu_bacteria 2904699407 2904701144 377
248 iso_pu_bacteria 2904711408 2904711866 377
249 iso_pu_bacteria 2906602504 2906609952 377
250 iso_pu_bacteria 2906610324 2906616422 377
251 iso_pu_bacteria 2906626472 2906627707 377
252 iso_pu_bacteria 2906635258 2906638123 377
253 iso_pu_bacteria 2906643746 2906649626 377
254 iso_pu_bacteria 2906660503 2906662918 377
255 iso_pu_bacteria 2908739725 2908741567 377
256 iso_pu_bacteria 2908756301 2908758986 377
257 iso_pu_bacteria 2908775508 2908781277 377
258 iso_pu_bacteria 2919073203 2919079560 377
259 iso_pu_bacteria 2922361189 2922361853 377
260 iso_pu_bacteria 2922368715 2922372302 377
261 iso_pu_bacteria 2922386360 2922386913 377
262 iso_pu_bacteria 2922393267 2922396970 377
263 iso_pu_bacteria 2922425934 2922431573 377
264 iso_pu_bacteria 2929615660 2929621132 377
265 iso_pu_bacteria 2929624759 2929626037 377
266 iso_pu_bacteria 2932784394 2932785083 377
267 iso_pu_bacteria 2932794094 2932795045 377
268 iso_pu_bacteria 2932801729 2932805573 377
269 iso_pu_bacteria 2932809354 2932810111 377
270 iso_pu_bacteria 2932818245 2932821684 377
271 iso_pu_bacteria 2932828146 2932828920 377
272 iso_pu_bacteria 2933577622 2933582999 377
273 iso_pu_bacteria 2935608549 2935609929 377
274 iso_pu_bacteria 2935616580 2935619661 377
275 iso_pu_bacteria 2935630451 2935636126 377
276 iso_pu_bacteria 2935638405 2935638641 377
277 iso_pu_bacteria 2935648319 2935652040 377
278 iso_pu_bacteria 2935656913 2935659987 377
279 iso_pu_bacteria 2935665750 2935666507 377
280 iso_pu_bacteria 2935675223 2935676450 377
281 iso_pu_bacteria 2935684952 2935691034 377
282 iso_pu_bacteria 2935694250 2935694532 377
283 iso_pu_bacteria 2935703347 2935703647 377
284 iso_pu_bacteria 2935713505 2935718415 377
285 iso_pu_bacteria 2935722832 2935727605 377
286 iso_pu_bacteria 2935732158 2935736308 377
287 iso_pu_bacteria 2935741537 2935745688 377
288 iso_pu_bacteria 2935750917 2935756069 377
289 iso_pu_bacteria 2935760218 2935760671 377
290 iso_pu_bacteria 2935769743 2935776087 377
291 iso_pu_bacteria 2935777560 2935785157 377
292 iso_pu_bacteria 2935785616 2935791900 377
293 iso_pu_bacteria 2935793552 2935800290 377
294 iso_pu_bacteria 2935801545 2935801785 377
295 iso_pu_bacteria 2935810662 2935814800 377
296 iso_pu_bacteria 2935819856 2935823089 377
297 iso_pu_bacteria 2935827899 2935828135 377
298 iso_pu_bacteria 2935837841 2935842340 377
299 iso_pu_bacteria 2935847175 2935848671 377
300 iso_pu_bacteria 2935855204 2935858024 377
301 iso_pu_bacteria 2935864058 2935867928 377
302 iso_pu_bacteria 2935873716 2935874048 377
303 iso_pu_bacteria 2935883170 2935885774 377
304 iso_pu_bacteria 2935908558 2935909524 377
305 iso_pu_bacteria 2935916978 2935917248 377
306 iso_pu_bacteria 2935926038 2935927005 377
307 iso_pu_bacteria 2935934488 2935937151 377
308 iso_pu_bacteria 2935942939 2935944546 377
309 iso_pu_bacteria 2935951376 2935952983 377
310 iso_pu_bacteria 2935959822 2935962824 377
311 iso_pu_bacteria 2935967501 2935969823 377
312 iso_pu_bacteria 2935975950 2935976420 377
313 iso_pu_bacteria 2935984226 2935987132 377
314 iso_pu_bacteria 2935992306 2935993027 377
315 iso_pu_bacteria 2936002035 2936002939 377
316 iso_pu_bacteria 2936011229 2936014403 377
317 iso_pu_bacteria 2936019824 2936023757 377
318 iso_pu_bacteria 2936028420 2936031400 377
319 iso_pu_bacteria 2936037263 2936040557 377
320 iso_pu_bacteria 2936046547 2936049509 377
321 iso_pu_bacteria 2936055302 2936061275 377
322 iso_pu_bacteria 2940556831 2940561956 377
323 iso_pu_bacteria 2941507105 2941512757 377
324 iso_pu_bacteria 2941515067 2941520676 377
325 iso_pu_bacteria 2941523033 2941528690 377
326 iso_pu_bacteria 2941531003 2941531309 377
327 iso_pu_bacteria 2941538514 2941542389 377
328 iso_pu_bacteria 3005474847 3005481366 377
329 iso_pu_bacteria 3005483717 3005485505 377
330 iso_pu_bacteria 3005506211 3005508338 377
331 iso_pu_bacteria 3005587118 3005588161 377
332 iso_pu_bacteria 3005594810 3005600426 377
333 iso_pu_bacteria 3005710791 3005715907 377
334 iso_pu_bacteria 3005718088 3005723262 377
335 iso_pu_bacteria 8006926726 8006933204 377
336 iso_pu_bacteria 8006933436 8006939342 377
337 iso_pu_bacteria 8006964411 8006968853 377
338 iso_pu_bacteria 8006973647 8006978999 377
339 iso_pu_bacteria 8006984368 8006984532 377
340 iso_pu_bacteria 8006994254 8006997159 377
341 iso_pu_bacteria 8016511872 8016520543 377
342 iso_pu_bacteria 8016522445 8016528584 377
343 iso_pu_bacteria 8016530956 8016533754 377
344 iso_pu_bacteria 8016566248 8016572087 377
345 iso_pu_bacteria 8016575299 8016576286 377
346 iso_pu_bacteria 8016583857 8016594471 377
347 iso_pu_bacteria 8016595262 8016601250 377
348 iso_pu_bacteria 8016603502 8016609185 377
349 iso_pu_bacteria 8016622563 8016625509 377
350 iso_pu_bacteria 8016630954 8016639065 377
351 iso_pu_bacteria 8017057580 8017065032 377
352 iso_pu_bacteria 8019530166 8019533529 377
353 iso_pu_bacteria 8019538911 8019546148 377
354 iso_pu_bacteria 8019547302 8019552561 377
355 iso_pu_bacteria 8019555841 8019565213 377
356 iso_pu_bacteria 8019565922 8019575312 377
357 iso_pu_bacteria 8019597564 8019599096 377
358 iso_pu_bacteria 8019608314 8019609264 377
359 iso_pu_bacteria 8019629233 8019633195 377
360 iso_pu_bacteria 8019638758 8019646704 377
361 iso_pu_bacteria 8019659431 8019661067 377
362 iso_pu_bacteria 8019668869 8019675850 377
363 iso_pu_bacteria 8019678201 8019680243 377
364 iso_pu_bacteria 8019678201 8019685604 377
365 iso_pu_bacteria 8019687851 8019691175 377
366 iso_pu_bacteria 8055742211 8055745006 377
367 iso_pu_bacteria 8056673599 8056677509 377
368 iso_pu_bacteria 8056681323 8056684818 377
369 iso_pu_bacteria 8056689827 8056690695 377
370 iso_pu_bacteria 8056967851 8056974959 377
371 3300014325 Ga0163163_10003896 Ga0163163_100038966 378
372 3300037068 Ga0373925_0035982 Ga0373925_0035982_333_1475 378
373 3300048903 Ga0496100_0138796 Ga0496100_0138796_515_1657 378
374 3300048908 Ga0496105_0004690 Ga0496105_0004690_6864_8006 378
375 3300048913 Ga0496110_0043984 Ga0496110_0043984_1819_2961 378
376 3300048918 Ga0496115_0002089 Ga0496115_0002089_7552_8694 378
377 3300003215 JGI25153J46596_10001771 JGI25153J46596_100017712 379
378 3300003215 JGI25153J46596_10005376 JGI25153J46596_100053764 379
379 3300005328 Ga0070676_10104133 Ga0070676_101041331 379
380 3300005340 Ga0070689_100008156 Ga0070689_1000081565 379
381 3300005353 Ga0070669_100046473 Ga0070669_1000464733 379
382 3300005456 Ga0070678_100049636 Ga0070678_1000496364 379
383 3300005457 Ga0070662_100269786 Ga0070662_1002697862 379
384 3300006042 Ga0075368_10059682 Ga0075368_100596821 379
385 3300006195 Ga0075366_10147024 Ga0075366_101470242 379
386 3300006353 Ga0075370_10056711 Ga0075370_100567112 379
387 3300006881 Ga0068865_100077175 Ga0068865_1000771752 379
388 3300014325 Ga0163163_10012351 Ga0163163_100123515 379
389 3300014497 Ga0182008_10097894 Ga0182008_100978942 379
390 3300021377 Ga0213874_10001651 Ga0213874_100016515 379
391 3300025297 Ga0209758_1000302 Ga0209758_100030246 379
392 3300025907 Ga0207645_10108318 Ga0207645_101083182 379
393 3300025936 Ga0207670_10005208 Ga0207670_100052085 379
394 3300025937 Ga0207669_10046404 Ga0207669_100464042 379
395 3300025941 Ga0207711_10146522 Ga0207711_101465222 379
396 3300025960 Ga0207651_10306848 Ga0207651_103068481 379
397 3300025961 Ga0207712_10146744 Ga0207712_101467441 379
398 3300026121 Ga0207683_10135537 Ga0207683_101355372 379
399 3300027866 Ga0209813_10036052 Ga0209813_100360522 379
400 3300028381 Ga0268264_10145744 Ga0268264_101457441 379
401 3300031241 Ga0265325_10000031 Ga0265325_1000003148 379
402 3300035114 Ga0373939_0007131 Ga0373939_0007131_659_1801 379
403 3300035695 Ga0373927_0170245 Ga0373927_0170245_176_1318 379
404 3300037068 Ga0373925_0123348 Ga0373925_0123348_454_1596 379
405 3300041408 Ga0439453_0005883 Ga0439453_0005883_92_1237 379
406 3300044694 Ga0466963_0026149 Ga0466963_0026149_689_1834 379
407 3300044842 Ga0466957_0006157 Ga0466957_0006157_642_1787 379
408 3300045836 Ga0466958_0026812 Ga0466958_0026812_1485_2630 379
409 3300048904 Ga0496101_0081094 Ga0496101_0081094_184_1326 379
410 3300048910 Ga0496107_0108444 Ga0496107_0108444_434_1576 379
411 3300048913 Ga0496110_0338654 Ga0496110_0338654_79_1221 379
412 3300048915 Ga0496112_0093681 Ga0496112_0093681_607_1749 379
413 3300048915 Ga0496112_0271698 Ga0496112_0271698_446_1588 379
414 3300048918 Ga0496115_0110379 Ga0496115_0110379_104_1246 379
415 3300048918 Ga0496115_0139608 Ga0496115_0139608_734_1882 379
416 3300049571 Ga0501034_0095199 Ga0501034_0095199_760_1908 379
417 3300049742 Ga0501080_0114361 Ga0501080_0114361_1249_2397 379
418 3300050489 nmdc:mga03683_37826_c1 nmdc:mga03683_37826_c1_807_1949 379
419 3300050489 nmdc:mga03683_52171_c1 nmdc:mga03683_52171_c1_251_1393 379
420 3300050490 nmdc:mga03n38_58325_c1 nmdc:mga03n38_58325_c1_533_1675 379
421 3300050491 nmdc:mga00v17_21986_c1 nmdc:mga00v17_21986_c1_496_1638 379
422 3300050493 nmdc:mga0k408_173388_c1 nmdc:mga0k408_173388_c1_70_1212 379
423 3300050494 nmdc:mga06z11_138917_c1 nmdc:mga06z11_138917_c1_89_1231 379
424 3300050494 nmdc:mga06z11_26257_c1 nmdc:mga06z11_26257_c1_459_1685 379
425 3300050495 nmdc:mga04h51_43205_c1 nmdc:mga04h51_43205_c1_322_1464 379
426 3300050496 nmdc:mga07m45_92466_c1 nmdc:mga07m45_92466_c1_310_1452 379
427 3300050511 nmdc:mga08y16_101861_c1 nmdc:mga08y16_101861_c1_1617_2759 379
428 3300053096 Ga0500641_0021052 Ga0500641_0021052_963_2105 379
429 3300053119 Ga0500595_013615 Ga0500595_013615_1162_2304 379
430 3300005436 Ga0070713_100154932 Ga0070713_1001549322 380
431 3300007265 Ga0099794_10017117 Ga0099794_100171174 380
432 3300025916 Ga0207663_10023124 Ga0207663_100231242 380
433 3300025928 Ga0207700_10269725 Ga0207700_102697251 380
434 3300035086 Ga0373934_0029448 Ga0373934_0029448_458_1606 380
435 3300035118 Ga0373954_0000003 Ga0373954_0000003_39872_41020 380
436 3300035119 Ga0373956_0034057 Ga0373956_0034057_664_1812 380
437 3300035695 Ga0373927_0020827 Ga0373927_0020827_2472_3626 380
438 3300035724 Ga0373933_0011065 Ga0373933_0011065_1753_2901 380
439 3300036401 Ga0373937_0000131 Ga0373937_0000131_58707_59855 380
440 3300037068 Ga0373925_0173635 Ga0373925_0173635_297_1451 380
441 3300046679 Ga0495623_0079339 Ga0495623_0079339_763_1911 380
442 3300000043 ARcpr5yngRDRAFT_c002823 ARcpr5yngRDRAFT_0028232 381
443 3300000044 ARSoilOldRDRAFT_c003037 ARSoilOldRDRAFT_0030372 381
444 3300001989 JGI24739J22299_10031571 JGI24739J22299_100315712 381
445 3300001990 JGI24737J22298_10039955 JGI24737J22298_100399552 381
446 3300002075 JGI24738J21930_10017994 JGI24738J21930_100179942 381
447 3300003203 JGI25406J46586_10000050 JGI25406J46586_1000005036 381
448 3300003215 JGI25153J46596_10000297 JGI25153J46596_100002974 381
449 3300003215 JGI25153J46596_10002178 JGI25153J46596_100021788 381
450 3300003215 JGI25153J46596_10003525 JGI25153J46596_100035252 381
451 3300003215 JGI25153J46596_10007400 JGI25153J46596_100074005 381
452 3300003762 Ga0055542_1005691 Ga0055542_10056913 381
453 3300003794 Ga0055531_10012935 Ga0055531_100129352 381
454 3300004625 Ga0055543_1004359 Ga0055543_10043592 381
455 3300005262 Ga0065165_1001109 Ga0065165_100110925 381
456 3300005262 Ga0065165_1012799 Ga0065165_10127992 381
457 3300005289 Ga0065704_10111240 Ga0065704_101112402 381
458 3300005290 Ga0065712_10021991 Ga0065712_100219911 381
459 3300005290 Ga0065712_10080594 Ga0065712_100805943 381
460 3300005328 Ga0070676_10119955 Ga0070676_101199552 381
461 3300005329 Ga0070683_100005122 Ga0070683_1000051223 381
462 3300005329 Ga0070683_100088145 Ga0070683_1000881453 381
463 3300005331 Ga0070670_100069412 Ga0070670_1000694122 381
464 3300005335 Ga0070666_10041549 Ga0070666_100415493 381
465 3300005336 Ga0070680_100011806 Ga0070680_1000118062 381
466 3300005336 Ga0070680_100074827 Ga0070680_1000748272 381
467 3300005336 Ga0070680_100094123 Ga0070680_1000941232 381
468 3300005337 Ga0070682_100232921 Ga0070682_1002329212 381
469 3300005338 Ga0068868_100001939 Ga0068868_1000019393 381
470 3300005338 Ga0068868_100037581 Ga0068868_1000375812 381
471 3300005339 Ga0070660_100029848 Ga0070660_1000298483 381
472 3300005339 Ga0070660_100103884 Ga0070660_1001038841 381
473 3300005339 Ga0070660_100132353 Ga0070660_1001323532 381
474 3300005339 Ga0070660_100296921 Ga0070660_1002969211 381
475 3300005344 Ga0070661_100038404 Ga0070661_1000384042 381
476 3300005344 Ga0070661_100064072 Ga0070661_1000640722 381
477 3300005347 Ga0070668_100071610 Ga0070668_1000716102 381
478 3300005347 Ga0070668_100088233 Ga0070668_1000882332 381
479 3300005353 Ga0070669_100152048 Ga0070669_1001520482 381
480 3300005354 Ga0070675_100164085 Ga0070675_1001640852 381
481 3300005354 Ga0070675_100269619 Ga0070675_1002696191 381
482 3300005355 Ga0070671_100011229 Ga0070671_1000112295 381
483 3300005355 Ga0070671_100015820 Ga0070671_1000158205 381
484 3300005355 Ga0070671_100139747 Ga0070671_1001397472 381
485 3300005356 Ga0070674_100052883 Ga0070674_1000528832 381
486 3300005364 Ga0070673_100001119 Ga0070673_1000011193 381
487 3300005365 Ga0070688_100034556 Ga0070688_1000345561 381
488 3300005367 Ga0070667_100000427 Ga0070667_10000042725 381
489 3300005367 Ga0070667_100058914 Ga0070667_1000589142 381
490 3300005367 Ga0070667_100240126 Ga0070667_1002401262 381
491 3300005434 Ga0070709_10001579 Ga0070709_1000157910 381
492 3300005434 Ga0070709_10018524 Ga0070709_100185244 381
493 3300005435 Ga0070714_100033299 Ga0070714_1000332993 381
494 3300005435 Ga0070714_100041521 Ga0070714_1000415212 381
495 3300005436 Ga0070713_100050284 Ga0070713_1000502842 381
496 3300005436 Ga0070713_100084103 Ga0070713_1000841032 381
497 3300005436 Ga0070713_100157884 Ga0070713_1001578841 381
498 3300005437 Ga0070710_10008336 Ga0070710_100083363 381
499 3300005439 Ga0070711_100003453 Ga0070711_10000345310 381
500 3300005439 Ga0070711_100010332 Ga0070711_1000103322 381
501 3300005439 Ga0070711_100013079 Ga0070711_1000130795 381
502 3300005439 Ga0070711_100027252 Ga0070711_1000272523 381
503 3300005439 Ga0070711_100028382 Ga0070711_1000283822 381
504 3300005441 Ga0070700_100113454 Ga0070700_1001134542 381
505 3300005444 Ga0070694_100088723 Ga0070694_1000887232 381
506 3300005455 Ga0070663_100009428 Ga0070663_1000094281 381
507 3300005455 Ga0070663_100028430 Ga0070663_1000284303 381
508 3300005455 Ga0070663_100096844 Ga0070663_1000968442 381
509 3300005456 Ga0070678_100000866 Ga0070678_10000086610 381
510 3300005456 Ga0070678_100030749 Ga0070678_1000307494 381
511 3300005458 Ga0070681_10063853 Ga0070681_100638533 381
512 3300005459 Ga0068867_100027893 Ga0068867_1000278933 381
513 3300005467 Ga0070706_100075117 Ga0070706_1000751172 381
514 3300005471 Ga0070698_100142127 Ga0070698_1001421272 381
515 3300005530 Ga0070679_100089458 Ga0070679_1000894582 381
516 3300005530 Ga0070679_100143686 Ga0070679_1001436862 381
517 3300005535 Ga0070684_100027728 Ga0070684_1000277285 381
518 3300005535 Ga0070684_100058149 Ga0070684_1000581493 381
519 3300005535 Ga0070684_100170508 Ga0070684_1001705081 381
520 3300005536 Ga0070697_100012253 Ga0070697_1000122535 381
521 3300005543 Ga0070672_100085986 Ga0070672_1000859862 381
522 3300005543 Ga0070672_100115772 Ga0070672_1001157722 381
523 3300005547 Ga0070693_100088214 Ga0070693_1000882142 381
524 3300005548 Ga0070665_100103293 Ga0070665_1001032932 381
525 3300005548 Ga0070665_100123255 Ga0070665_1001232552 381
526 3300005548 Ga0070665_100381401 Ga0070665_1003814011 381
527 3300005549 Ga0070704_100172906 Ga0070704_1001729062 381
528 3300005563 Ga0068855_100044511 Ga0068855_1000445113 381
529 3300005563 Ga0068855_100129697 Ga0068855_1001296973 381
530 3300005564 Ga0070664_100004769 Ga0070664_1000047696 381
531 3300005577 Ga0068857_100006913 Ga0068857_1000069132 381
532 3300005614 Ga0068856_100001803 Ga0068856_10000180318 381
533 3300005614 Ga0068856_100017040 Ga0068856_1000170404 381
534 3300005614 Ga0068856_100200377 Ga0068856_1002003772 381
535 3300005616 Ga0068852_100064623 Ga0068852_1000646232 381
536 3300005616 Ga0068852_100075034 Ga0068852_1000750342 381
537 3300005616 Ga0068852_100120886 Ga0068852_1001208862 381
538 3300005616 Ga0068852_100370232 Ga0068852_1003702322 381
539 3300005617 Ga0068859_100090741 Ga0068859_1000907412 381
540 3300005618 Ga0068864_100001940 Ga0068864_10000194013 381
541 3300005618 Ga0068864_100087884 Ga0068864_1000878842 381
542 3300005618 Ga0068864_100214469 Ga0068864_1002144692 381
543 3300005718 Ga0068866_10024437 Ga0068866_100244372 381
544 3300005718 Ga0068866_10117751 Ga0068866_101177512 381
545 3300005719 Ga0068861_100048457 Ga0068861_1000484573 381
546 3300005719 Ga0068861_100081446 Ga0068861_1000814463 381
547 3300005841 Ga0068863_100005859 Ga0068863_1000058592 381
548 3300005841 Ga0068863_100219662 Ga0068863_1002196622 381
549 3300005842 Ga0068858_100064249 Ga0068858_1000642492 381
550 3300005842 Ga0068858_100132331 Ga0068858_1001323312 381
551 3300005842 Ga0068858_100263622 Ga0068858_1002636221 381
552 3300005843 Ga0068860_100000399 Ga0068860_1000003997 381
553 3300005843 Ga0068860_100144833 Ga0068860_1001448332 381
554 3300005937 Ga0081455_10000237 Ga0081455_1000023765 381
555 3300005937 Ga0081455_10095265 Ga0081455_100952653 381
556 3300005981 Ga0081538_10018641 Ga0081538_100186414 381
557 3300005983 Ga0081540_1002658 Ga0081540_10026588 381
558 3300005983 Ga0081540_1012722 Ga0081540_10127225 381
559 3300005983 Ga0081540_1014792 Ga0081540_10147922 381
560 3300005983 Ga0081540_1019041 Ga0081540_10190413 381
561 3300005985 Ga0081539_10000325 Ga0081539_1000032525 381
562 3300005985 Ga0081539_10000542 Ga0081539_1000054214 381
563 3300005985 Ga0081539_10017927 Ga0081539_100179274 381
564 3300005985 Ga0081539_10041063 Ga0081539_100410632 381
565 3300005985 Ga0081539_10103757 Ga0081539_101037571 381
566 3300006028 Ga0070717_10004627 Ga0070717_100046272 381
567 3300006028 Ga0070717_10021548 Ga0070717_100215483 381
568 3300006038 Ga0075365_10000416 Ga0075365_100004163 381
569 3300006038 Ga0075365_10066033 Ga0075365_100660332 381
570 3300006038 Ga0075365_10070334 Ga0075365_100703342 381
571 3300006042 Ga0075368_10012500 Ga0075368_100125003 381
572 3300006048 Ga0075363_100001174 Ga0075363_1000011742 381
573 3300006048 Ga0075363_100014889 Ga0075363_1000148893 381
574 3300006051 Ga0075364_10002830 Ga0075364_100028302 381
575 3300006051 Ga0075364_10036378 Ga0075364_100363783 381
576 3300006051 Ga0075364_10108105 Ga0075364_101081052 381
577 3300006163 Ga0070715_10037104 Ga0070715_100371042 381
578 3300006163 Ga0070715_10095856 Ga0070715_100958562 381
579 3300006173 Ga0070716_100036597 Ga0070716_1000365972 381
580 3300006175 Ga0070712_100008334 Ga0070712_1000083347 381
581 3300006175 Ga0070712_100116412 Ga0070712_1001164122 381
582 3300006178 Ga0075367_10013317 Ga0075367_100133172 381
583 3300006178 Ga0075367_10027064 Ga0075367_100270642 381
584 3300006178 Ga0075367_10040805 Ga0075367_100408053 381
585 3300006186 Ga0075369_10014301 Ga0075369_100143012 381
586 3300006195 Ga0075366_10009516 Ga0075366_100095164 381
587 3300006195 Ga0075366_10022789 Ga0075366_100227893 381
588 3300006237 Ga0097621_100044777 Ga0097621_1000447773 381
589 3300006237 Ga0097621_100141994 Ga0097621_1001419942 381
590 3300006237 Ga0097621_100146252 Ga0097621_1001462522 381
591 3300006353 Ga0075370_10005713 Ga0075370_100057132 381
592 3300006353 Ga0075370_10011478 Ga0075370_100114783 381
593 3300006353 Ga0075370_10097937 Ga0075370_100979371 381
594 3300006358 Ga0068871_100139545 Ga0068871_1001395451 381
595 3300006844 Ga0075428_100128240 Ga0075428_1001282402 381
596 3300006847 Ga0075431_100001980 Ga0075431_10000198015 381
597 3300006847 Ga0075431_100254358 Ga0075431_1002543582 381
598 3300006871 Ga0075434_100077954 Ga0075434_1000779543 381
599 3300006881 Ga0068865_100060979 Ga0068865_1000609792 381
600 3300006881 Ga0068865_100229200 Ga0068865_1002292002 381
601 3300006931 Ga0097620_100090743 Ga0097620_1000907432 381
602 3300006942 Ga0099824_1019369 Ga0099824_10193692 381
603 3300006942 Ga0099824_1037786 Ga0099824_10377862 381
604 3300006943 Ga0099822_1001244 Ga0099822_100124413 381
605 3300007788 Ga0099795_10006714 Ga0099795_100067143 381
606 3300009093 Ga0105240_10184409 Ga0105240_101844092 381
607 3300009094 Ga0111539_10033837 Ga0111539_100338372 381
608 3300009094 Ga0111539_10162670 Ga0111539_101626702 381
609 3300009098 Ga0105245_10050469 Ga0105245_100504692 381
610 3300009098 Ga0105245_10065537 Ga0105245_100655372 381
611 3300009147 Ga0114129_10069616 Ga0114129_100696164 381
612 3300009148 Ga0105243_10072375 Ga0105243_100723752 381
613 3300009148 Ga0105243_10111021 Ga0105243_101110211 381
614 3300009174 Ga0105241_10111029 Ga0105241_101110292 381
615 3300009177 Ga0105248_10135644 Ga0105248_101356442 381
616 3300009545 Ga0105237_10013607 Ga0105237_100136074 381
617 3300009551 Ga0105238_10041453 Ga0105238_100414532 381
618 3300009551 Ga0105238_10110140 Ga0105238_101101402 381
619 3300009553 Ga0105249_10025941 Ga0105249_100259416 381
620 3300010375 Ga0105239_10034550 Ga0105239_100345502 381
621 3300010375 Ga0105239_10087399 Ga0105239_100873992 381
622 3300010375 Ga0105239_10218278 Ga0105239_102182782 381
623 3300011119 Ga0105246_10134531 Ga0105246_101345312 381
624 3300013100 Ga0157373_10012937 Ga0157373_100129374 381
625 3300013104 Ga0157370_10087286 Ga0157370_100872862 381
626 3300013105 Ga0157369_10011073 Ga0157369_100110736 381
627 3300013105 Ga0157369_10052856 Ga0157369_100528565 381
628 3300013105 Ga0157369_10172790 Ga0157369_101727902 381
629 3300013296 Ga0157374_10090805 Ga0157374_100908051 381
630 3300013306 Ga0163162_10042571 Ga0163162_100425713 381
631 3300013306 Ga0163162_10122854 Ga0163162_101228543 381
632 3300013306 Ga0163162_10217062 Ga0163162_102170622 381
633 3300013307 Ga0157372_10145358 Ga0157372_101453582 381
634 3300013308 Ga0157375_10122327 Ga0157375_101223272 381
635 3300014325 Ga0163163_10005988 Ga0163163_1000598810 381
636 3300014326 Ga0157380_10115131 Ga0157380_101151312 381
637 3300014968 Ga0157379_10032090 Ga0157379_100320903 381
638 3300014969 Ga0157376_10231582 Ga0157376_102315822 381
639 3300017792 Ga0163161_10066401 Ga0163161_100664012 381
640 3300021320 Ga0214544_1000001 Ga0214544_1000001657 381
641 3300021320 Ga0214544_1026847 Ga0214544_10268472 381
642 3300021320 Ga0214544_1027275 Ga0214544_10272752 381
643 3300021321 Ga0214542_1000037 Ga0214542_100003742 381
644 3300021321 Ga0214542_1037377 Ga0214542_10373771 381
645 3300021321 Ga0214542_1037673 Ga0214542_10376731 381
646 3300021324 Ga0214545_1000003 Ga0214545_1000003103 381
647 3300021324 Ga0214545_1019261 Ga0214545_10192611 381
648 3300021327 Ga0214543_1000002 Ga0214543_1000002662 381
649 3300021327 Ga0214543_1026652 Ga0214543_10266521 381
650 3300021327 Ga0214543_1039585 Ga0214543_10395851 381
651 3300021377 Ga0213874_10041435 Ga0213874_100414351 381
652 3300021384 Ga0213876_10002729 Ga0213876_1000272910 381
653 3300021384 Ga0213876_10027514 Ga0213876_100275142 381
654 3300021384 Ga0213876_10097258 Ga0213876_100972582 381
655 3300025230 Ga0209563_104444 Ga0209563_1044442 381
656 3300025253 Ga0209677_100598 Ga0209677_10059816 381
657 3300025253 Ga0209677_107557 Ga0209677_1075571 381
658 3300025254 Ga0209148_1000462 Ga0209148_100046234 381
659 3300025254 Ga0209148_1004101 Ga0209148_10041012 381
660 3300025261 Ga0209233_1000654 Ga0209233_100065410 381
661 3300025261 Ga0209233_1007735 Ga0209233_10077353 381
662 3300025261 Ga0209233_1008472 Ga0209233_10084722 381
663 3300025261 Ga0209233_1014172 Ga0209233_10141722 381
664 3300025272 Ga0209455_1000926 Ga0209455_100092611 381
665 3300025272 Ga0209455_1000954 Ga0209455_100095411 381
666 3300025295 Ga0209564_1000468 Ga0209564_100046818 381
667 3300025295 Ga0209564_1008067 Ga0209564_10080674 381
668 3300025297 Ga0209758_1000011 Ga0209758_1000011424 381
669 3300025297 Ga0209758_1000133 Ga0209758_1000133157 381
670 3300025297 Ga0209758_1000845 Ga0209758_100084511 381
671 3300025297 Ga0209758_1001760 Ga0209758_100176019 381
672 3300025297 Ga0209758_1002308 Ga0209758_10023088 381
673 3300025297 Ga0209758_1008957 Ga0209758_10089573 381
674 3300025297 Ga0209758_1010383 Ga0209758_10103833 381
675 3300025297 Ga0209758_1052251 Ga0209758_10522511 381
676 3300025299 Ga0209256_1003911 Ga0209256_10039119 381
677 3300025302 Ga0207426_1000270 Ga0207426_100027077 381
678 3300025302 Ga0207426_1000292 Ga0207426_100029272 381
679 3300025302 Ga0207426_1002666 Ga0207426_10026663 381
680 3300025304 Ga0209257_1001242 Ga0209257_100124212 381
681 3300025315 Ga0207697_10021016 Ga0207697_100210162 381
682 3300025321 Ga0207656_10010329 Ga0207656_100103292 381
683 3300025885 Ga0207653_10001814 Ga0207653_100018145 381
684 3300025898 Ga0207692_10008873 Ga0207692_100088733 381
685 3300025898 Ga0207692_10013471 Ga0207692_100134713 381
686 3300025898 Ga0207692_10032938 Ga0207692_100329382 381
687 3300025898 Ga0207692_10168069 Ga0207692_101680691 381
688 3300025899 Ga0207642_10022066 Ga0207642_100220661 381
689 3300025899 Ga0207642_10042821 Ga0207642_100428212 381
690 3300025904 Ga0207647_10007857 Ga0207647_100078577 381
691 3300025905 Ga0207685_10000806 Ga0207685_100008063 381
692 3300025906 Ga0207699_10000503 Ga0207699_100005034 381
693 3300025906 Ga0207699_10015653 Ga0207699_100156532 381
694 3300025906 Ga0207699_10062610 Ga0207699_100626101 381
695 3300025907 Ga0207645_10079415 Ga0207645_100794152 381
696 3300025911 Ga0207654_10071689 Ga0207654_100716891 381
697 3300025911 Ga0207654_10144311 Ga0207654_101443112 381
698 3300025912 Ga0207707_10001896 Ga0207707_100018965 381
699 3300025912 Ga0207707_10007520 Ga0207707_100075209 381
700 3300025912 Ga0207707_10019033 Ga0207707_100190334 381
701 3300025912 Ga0207707_10031890 Ga0207707_100318902 381
702 3300025912 Ga0207707_10057854 Ga0207707_100578543 381
703 3300025912 Ga0207707_10060997 Ga0207707_100609973 381
704 3300025913 Ga0207695_10000008 Ga0207695_10000008905 381
705 3300025913 Ga0207695_10010954 Ga0207695_100109545 381
706 3300025913 Ga0207695_10030077 Ga0207695_100300775 381
707 3300025913 Ga0207695_10230368 Ga0207695_102303681 381
708 3300025913 Ga0207695_10236614 Ga0207695_102366142 381
709 3300025914 Ga0207671_10004345 Ga0207671_100043455 381
710 3300025914 Ga0207671_10161986 Ga0207671_101619862 381
711 3300025915 Ga0207693_10000085 Ga0207693_1000008544 381
712 3300025915 Ga0207693_10016551 Ga0207693_100165512 381
713 3300025916 Ga0207663_10000739 Ga0207663_100007394 381
714 3300025916 Ga0207663_10056741 Ga0207663_100567413 381
715 3300025917 Ga0207660_10018620 Ga0207660_100186202 381
716 3300025917 Ga0207660_10070860 Ga0207660_100708602 381
717 3300025917 Ga0207660_10096304 Ga0207660_100963042 381
718 3300025919 Ga0207657_10000245 Ga0207657_100002454 381
719 3300025919 Ga0207657_10061790 Ga0207657_100617903 381
720 3300025919 Ga0207657_10065902 Ga0207657_100659022 381
721 3300025919 Ga0207657_10109884 Ga0207657_101098842 381
722 3300025919 Ga0207657_10159485 Ga0207657_101594851 381
723 3300025919 Ga0207657_10210291 Ga0207657_102102911 381
724 3300025920 Ga0207649_10051062 Ga0207649_100510622 381
725 3300025920 Ga0207649_10229296 Ga0207649_102292961 381
726 3300025921 Ga0207652_10022732 Ga0207652_100227324 381
727 3300025921 Ga0207652_10048089 Ga0207652_100480892 381
728 3300025921 Ga0207652_10202865 Ga0207652_102028652 381
729 3300025923 Ga0207681_10076838 Ga0207681_100768382 381
730 3300025924 Ga0207694_10025256 Ga0207694_100252563 381
731 3300025925 Ga0207650_10049602 Ga0207650_100496022 381
732 3300025926 Ga0207659_10206837 Ga0207659_102068371 381
733 3300025927 Ga0207687_10205179 Ga0207687_102051792 381
734 3300025928 Ga0207700_10014467 Ga0207700_100144672 381
735 3300025928 Ga0207700_10118838 Ga0207700_101188382 381
736 3300025929 Ga0207664_10004463 Ga0207664_100044634 381
737 3300025929 Ga0207664_10010699 Ga0207664_100106992 381
738 3300025931 Ga0207644_10015614 Ga0207644_100156143 381
739 3300025931 Ga0207644_10048488 Ga0207644_100484882 381
740 3300025932 Ga0207690_10170538 Ga0207690_101705382 381
741 3300025932 Ga0207690_10229913 Ga0207690_102299132 381
742 3300025933 Ga0207706_10013176 Ga0207706_100131766 381
743 3300025933 Ga0207706_10018926 Ga0207706_100189265 381
744 3300025934 Ga0207686_10049526 Ga0207686_100495262 381
745 3300025935 Ga0207709_10094774 Ga0207709_100947742 381
746 3300025936 Ga0207670_10032123 Ga0207670_100321232 381
747 3300025937 Ga0207669_10015366 Ga0207669_100153662 381
748 3300025938 Ga0207704_10046849 Ga0207704_100468492 381
749 3300025939 Ga0207665_10000229 Ga0207665_1000022927 381
750 3300025939 Ga0207665_10011145 Ga0207665_100111454 381
751 3300025939 Ga0207665_10035278 Ga0207665_100352782 381
752 3300025940 Ga0207691_10008150 Ga0207691_100081509 381
753 3300025940 Ga0207691_10150637 Ga0207691_101506372 381
754 3300025941 Ga0207711_10002271 Ga0207711_1000227110 381
755 3300025941 Ga0207711_10030359 Ga0207711_100303592 381
756 3300025942 Ga0207689_10109021 Ga0207689_101090212 381
757 3300025944 Ga0207661_10000917 Ga0207661_100009179 381
758 3300025944 Ga0207661_10018018 Ga0207661_100180183 381
759 3300025944 Ga0207661_10221537 Ga0207661_102215372 381
760 3300025949 Ga0207667_10037702 Ga0207667_100377023 381
761 3300025949 Ga0207667_10200099 Ga0207667_102000992 381
762 3300025960 Ga0207651_10048453 Ga0207651_100484532 381
763 3300025961 Ga0207712_10016182 Ga0207712_100161822 381
764 3300025961 Ga0207712_10099233 Ga0207712_100992332 381
765 3300025972 Ga0207668_10008285 Ga0207668_100082854 381
766 3300025972 Ga0207668_10014124 Ga0207668_100141243 381
767 3300025972 Ga0207668_10116133 Ga0207668_101161332 381
768 3300025986 Ga0207658_10001754 Ga0207658_1000175415 381
769 3300025986 Ga0207658_10026085 Ga0207658_100260852 381
770 3300025986 Ga0207658_10162191 Ga0207658_101621912 381
771 3300026023 Ga0207677_10025562 Ga0207677_100255623 381
772 3300026041 Ga0207639_10002832 Ga0207639_100028326 381
773 3300026067 Ga0207678_10000788 Ga0207678_100007883 381
774 3300026067 Ga0207678_10024231 Ga0207678_100242313 381
775 3300026067 Ga0207678_10069922 Ga0207678_100699222 381
776 3300026067 Ga0207678_10094459 Ga0207678_100944592 381
777 3300026067 Ga0207678_10095328 Ga0207678_100953282 381
778 3300026067 Ga0207678_10123308 Ga0207678_101233082 381
779 3300026078 Ga0207702_10001708 Ga0207702_1000170818 381
780 3300026078 Ga0207702_10130329 Ga0207702_101303292 381
781 3300026088 Ga0207641_10283667 Ga0207641_102836672 381
782 3300026089 Ga0207648_10072089 Ga0207648_100720893 381
783 3300026089 Ga0207648_10160704 Ga0207648_101607041 381
784 3300026095 Ga0207676_10006093 Ga0207676_100060933 381
785 3300026095 Ga0207676_10070618 Ga0207676_100706182 381
786 3300026116 Ga0207674_10000253 Ga0207674_1000025340 381
787 3300026116 Ga0207674_10006543 Ga0207674_100065433 381
788 3300026116 Ga0207674_10222202 Ga0207674_102222022 381
789 3300026118 Ga0207675_100311200 Ga0207675_1003112001 381
790 3300026121 Ga0207683_10001491 Ga0207683_100014918 381
791 3300026121 Ga0207683_10014022 Ga0207683_100140223 381
792 3300026121 Ga0207683_10019680 Ga0207683_100196803 381
793 3300026142 Ga0207698_10135209 Ga0207698_101352092 381
794 3300026142 Ga0207698_10169769 Ga0207698_101697692 381
795 3300026142 Ga0207698_10175830 Ga0207698_101758301 381
796 3300027296 Ga0209389_1000001 Ga0209389_100000132 381
797 3300027296 Ga0209389_1000014 Ga0209389_100001465 381
798 3300027357 Ga0209589_1000011 Ga0209589_1000011120 381
799 3300027357 Ga0209589_1000020 Ga0209589_100002065 381
800 3300027361 Ga0209489_100012 Ga0209489_100012120 381
801 3300027361 Ga0209489_100060 Ga0209489_10006024 381
802 3300027361 Ga0209489_101114 Ga0209489_10111429 381
803 3300027363 Ga0209700_100007 Ga0209700_100007372 381
804 3300027363 Ga0209700_100019 Ga0209700_100019120 381
805 3300027543 Ga0209999_1018986 Ga0209999_10189861 381
806 3300027695 Ga0209966_1002395 Ga0209966_10023953 381
807 3300027907 Ga0207428_10143682 Ga0207428_101436822 381
808 3300028379 Ga0268266_10001272 Ga0268266_1000127211 381
809 3300028379 Ga0268266_10045429 Ga0268266_100454292 381
810 3300028379 Ga0268266_10113881 Ga0268266_101138812 381
811 3300028380 Ga0268265_10071486 Ga0268265_100714862 381
812 3300028380 Ga0268265_10365416 Ga0268265_103654162 381
813 3300028381 Ga0268264_10000030 Ga0268264_10000030352 381
814 3300028381 Ga0268264_10499558 Ga0268264_104995581 381
815 3300028573 Ga0265334_10059873 Ga0265334_100598732 381
816 3300028786 Ga0307517_10001377 Ga0307517_1000137730 381
817 3300028794 Ga0307515_10000417 Ga0307515_1000041729 381
818 3300028794 Ga0307515_10000477 Ga0307515_1000047751 381
819 3300028794 Ga0307515_10071901 Ga0307515_100719014 381
820 3300028794 Ga0307515_10093229 Ga0307515_100932293 381
821 3300028800 Ga0265338_10004642 Ga0265338_1000464210 381
822 3300031235 Ga0265330_10040262 Ga0265330_100402622 381
823 3300031247 Ga0265340_10062699 Ga0265340_100626991 381
824 3300031249 Ga0265339_10037898 Ga0265339_100378983 381
825 3300031251 Ga0265327_10013461 Ga0265327_100134612 381
826 3300031344 Ga0265316_10121496 Ga0265316_101214962 381
827 3300031456 Ga0307513_10022829 Ga0307513_100228294 381
828 3300031456 Ga0307513_10046501 Ga0307513_100465012 381
829 3300031507 Ga0307509_10156515 Ga0307509_101565152 381
830 3300031507 Ga0307509_10171185 Ga0307509_101711852 381
831 3300031548 Ga0307408_100047872 Ga0307408_1000478722 381
832 3300031595 Ga0265313_10013689 Ga0265313_100136891 381
833 3300031616 Ga0307508_10000015 Ga0307508_10000015119 381
834 3300031711 Ga0265314_10002234 Ga0265314_1000223416 381
835 3300031711 Ga0265314_10002758 Ga0265314_100027585 381
836 3300031711 Ga0265314_10013252 Ga0265314_100132524 381
837 3300031712 Ga0265342_10024663 Ga0265342_100246633 381
838 3300031730 Ga0307516_10002523 Ga0307516_1000252321 381
839 3300031730 Ga0307516_10004543 Ga0307516_100045438 381
840 3300031730 Ga0307516_10010277 Ga0307516_1001027713 381
841 3300031824 Ga0307413_10042181 Ga0307413_100421812 381
842 3300031852 Ga0307410_10070931 Ga0307410_100709312 381
843 3300031852 Ga0307410_10106018 Ga0307410_101060182 381
844 3300031901 Ga0307406_10045617 Ga0307406_100456172 381
845 3300031903 Ga0307407_10049465 Ga0307407_100494652 381
846 3300031911 Ga0307412_10061387 Ga0307412_100613872 381
847 3300032002 Ga0307416_100070997 Ga0307416_1000709972 381
848 3300032005 Ga0307411_10057952 Ga0307411_100579521 381
849 3300032133 Ga0316583_10005887 Ga0316583_100058874 381
850 3300033179 Ga0307507_10034988 Ga0307507_100349882 381
851 3300033180 Ga0307510_10007552 Ga0307510_1000755210 381
852 3300033180 Ga0307510_10010054 Ga0307510_100100547 381
853 3300033180 Ga0307510_10148735 Ga0307510_101487352 381
854 3300033442 Ga0315911_1000002 Ga0315911_100000234 381
855 3300035117 Ga0373953_0003240 Ga0373953_0003240_1215_2366 381
856 3300035118 Ga0373954_0002051 Ga0373954_0002051_1320_2471 381
857 3300035118 Ga0373954_0110339 Ga0373954_0110339_153_1304 381
858 3300035171 Ga0373946_0009678 Ga0373946_0009678_566_1837 381
859 3300035410 Ga0373924_0011463 Ga0373924_0011463_1216_2367 381
860 3300035692 Ga0373935_0002404 Ga0373935_0002404_7557_8708 381
861 3300035692 Ga0373935_0047935 Ga0373935_0047935_1483_2634 381
862 3300035692 Ga0373935_0125490 Ga0373935_0125490_388_1539 381
863 3300035695 Ga0373927_0000783 Ga0373927_0000783_11603_12754 381
864 3300035695 Ga0373927_0004757 Ga0373927_0004757_1454_2605 381
865 3300035695 Ga0373927_0050912 Ga0373927_0050912_726_1877 381
866 3300035724 Ga0373933_0019929 Ga0373933_0019929_232_1383 381
867 3300035724 Ga0373933_0085873 Ga0373933_0085873_271_1422 381
868 3300035724 Ga0373933_0110932 Ga0373933_0110932_27_1178 381
869 3300035725 Ga0373947_0002483 Ga0373947_0002483_812_1963 381
870 3300035725 Ga0373947_0005531 Ga0373947_0005531_2192_3343 381
871 3300035725 Ga0373947_0049392 Ga0373947_0049392_1118_2482 381
872 3300036401 Ga0373937_0116679 Ga0373937_0116679_252_1403 381
873 3300036459 Ga0372808_010978 Ga0372808_010978_71_1222 381
874 3300037068 Ga0373925_0033388 Ga0373925_0033388_1168_2319 381
875 3300037068 Ga0373925_0062989 Ga0373925_0062989_267_1418 381
876 3300037312 Ga0395899_0003168 Ga0395899_0003168_6410_7561 381
877 3300037312 Ga0395899_0119155 Ga0395899_0119155_471_1622 381
878 3300037418 Ga0395900_0001070 Ga0395900_0001070_15828_16979 381
879 3300037418 Ga0395900_0005737 Ga0395900_0005737_1877_3028 381
880 3300037418 Ga0395900_0074549 Ga0395900_0074549_2288_3439 381
881 3300037418 Ga0395900_0170764 Ga0395900_0170764_153_1304 381
882 3300037466 Ga0395898_0003538 Ga0395898_0003538_4358_5509 381
883 3300037466 Ga0395898_0009135 Ga0395898_0009135_79_1230 381
884 3300037466 Ga0395898_0030821 Ga0395898_0030821_3387_4538 381
885 3300037466 Ga0395898_0030823 Ga0395898_0030823_3286_4437 381
886 3300037466 Ga0395898_0066901 Ga0395898_0066901_2013_3164 381
887 3300037466 Ga0395898_0170035 Ga0395898_0170035_305_1456 381
888 3300037466 Ga0395898_0367021 Ga0395898_0367021_186_1337 381
889 3300037471 Ga0395905_0009454 Ga0395905_0009454_2449_3600 381
890 3300037471 Ga0395905_0154216 Ga0395905_0154216_69_1220 381
891 3300037471 Ga0395905_0167690 Ga0395905_0167690_390_1541 381
892 3300037853 Ga0436364_1166954 Ga0436364_1166954_3801_4952 381
893 3300037853 Ga0436364_1341441 Ga0436364_1341441_1386_2543 381
894 3300038443 Ga0395901_0037136 Ga0395901_0037136_1438_2589 381
895 3300038443 Ga0395901_0046711 Ga0395901_0046711_2072_3223 381
896 3300038443 Ga0395901_0122876 Ga0395901_0122876_40_1191 381
897 3300038443 Ga0395901_0182148 Ga0395901_0182148_624_1775 381
898 3300038443 Ga0395901_0239195 Ga0395901_0239195_666_1817 381
899 3300038443 Ga0395901_0392404 Ga0395901_0392404_165_1316 381
900 3300039437 Ga0436365_0052183 Ga0436365_0052183_11491_12636 381
901 3300039437 Ga0436365_0828830 Ga0436365_0828830_256_1401 381
902 3300039437 Ga0436365_0873719 Ga0436365_0873719_2409_3557 381
903 3300039437 Ga0436365_1136356 Ga0436365_1136356_4882_6033 381
904 3300039450 Ga0436363_1246162 Ga0436363_1246162_978_2129 381
905 3300042156 Ga0439446_0034412 Ga0439446_0034412_284_1438 381
906 3300042157 Ga0439458_0005150 Ga0439458_0005150_805_1956 381
907 3300044658 Ga0466972_0000113 Ga0466972_0000113_1267_2418 381
908 3300044658 Ga0466972_0008577 Ga0466972_0008577_2847_3998 381
909 3300044684 Ga0466966_0000094 Ga0466966_0000094_29393_30544 381
910 3300044693 Ga0466961_0000118 Ga0466961_0000118_12824_13975 381
911 3300044694 Ga0466963_0028581 Ga0466963_0028581_2071_3222 381
912 3300044694 Ga0466963_0053875 Ga0466963_0053875_1299_2477 381
913 3300044765 Ga0466970_0031842 Ga0466970_0031842_197_1348 381
914 3300044901 Ga0466960_0120251 Ga0466960_0120251_128_1279 381
915 3300045049 Ga0466959_0065076 Ga0466959_0065076_788_1939 381
916 3300045049 Ga0466959_0113703 Ga0466959_0113703_746_1897 381
917 3300045836 Ga0466958_0006856 Ga0466958_0006856_2062_3222 381
918 3300045976 Ga0466967_0263578 Ga0466967_0263578_358_1509 381
919 3300046452 Ga0495617_011415 Ga0495617_011415_319_1470 381
920 3300046453 Ga0495627_034423 Ga0495627_034423_208_1359 381
921 3300046454 Ga0495592_0025176 Ga0495592_0025176_1003_2154 381
922 3300046454 Ga0495592_0037086 Ga0495592_0037086_25_1176 381
923 3300046454 Ga0495592_0045952 Ga0495592_0045952_54_1205 381
924 3300046454 Ga0495592_0046108 Ga0495592_0046108_101_1252 381
925 3300046455 Ga0495603_0001681 Ga0495603_0001681_3698_4849 381
926 3300046455 Ga0495603_0002554 Ga0495603_0002554_8804_9955 381
927 3300046455 Ga0495603_0131829 Ga0495603_0131829_77_1441 381
928 3300046459 Ga0495629_0000077 Ga0495629_0000077_79388_80539 381
929 3300046459 Ga0495629_0000165 Ga0495629_0000165_52408_53559 381
930 3300046459 Ga0495629_0033399 Ga0495629_0033399_334_1485 381
931 3300046460 Ga0495638_0018892 Ga0495638_0018892_1632_2783 381
932 3300046460 Ga0495638_0045820 Ga0495638_0045820_327_1478 381
933 3300046460 Ga0495638_0050514 Ga0495638_0050514_432_1583 381
934 3300046461 Ga0495641_0000929 Ga0495641_0000929_4033_5184 381
935 3300046462 Ga0495651_0009827 Ga0495651_0009827_3906_5057 381
936 3300046462 Ga0495651_0045132 Ga0495651_0045132_2231_3382 381
937 3300046462 Ga0495651_0106556 Ga0495651_0106556_464_1615 381
938 3300046463 Ga0495653_0002848 Ga0495653_0002848_7231_8382 381
939 3300046472 Ga0495580_0000913 Ga0495580_0000913_198_1349 381
940 3300046473 Ga0495582_0000016 Ga0495582_0000016_93879_95030 381
941 3300046473 Ga0495582_0018865 Ga0495582_0018865_2355_3719 381
942 3300046473 Ga0495582_0020941 Ga0495582_0020941_2001_3152 381
943 3300046475 Ga0495639_0000014 Ga0495639_0000014_13037_14188 381
944 3300046476 Ga0495662_0000086 Ga0495662_0000086_10239_11390 381
945 3300046476 Ga0495662_0032757 Ga0495662_0032757_268_1419 381
946 3300046477 Ga0495664_0008014 Ga0495664_0008014_1052_2203 381
947 3300046477 Ga0495664_0180595 Ga0495664_0180595_30_1181 381
948 3300046492 Ga0495585_0021846 Ga0495585_0021846_1847_2998 381
949 3300046499 Ga0495594_0000420 Ga0495594_0000420_13760_14911 381
950 3300046501 Ga0495607_0140319 Ga0495607_0140319_53_1204 381
951 3300046507 Ga0495606_0000196 Ga0495606_0000196_57310_58461 381
952 3300046507 Ga0495606_0030531 Ga0495606_0030531_1084_2235 381
953 3300046507 Ga0495606_0033015 Ga0495606_0033015_646_1797 381
954 3300046512 Ga0495610_0031313 Ga0495610_0031313_1056_2207 381
955 3300046512 Ga0495610_0042674 Ga0495610_0042674_262_1413 381
956 3300046513 Ga0495616_0048545 Ga0495616_0048545_915_2066 381
957 3300046513 Ga0495616_0052358 Ga0495616_0052358_619_1770 381
958 3300046513 Ga0495616_0083181 Ga0495616_0083181_318_1469 381
959 3300046516 Ga0495628_0048184 Ga0495628_0048184_2099_3250 381
960 3300046516 Ga0495628_0079685 Ga0495628_0079685_1196_2347 381
961 3300046517 Ga0495630_0003176 Ga0495630_0003176_5812_6963 381
962 3300046517 Ga0495630_0034979 Ga0495630_0034979_511_1662 381
963 3300046518 Ga0495631_0017160 Ga0495631_0017160_1823_2974 381
964 3300046519 Ga0495632_0034239 Ga0495632_0034239_1062_2213 381
965 3300046522 Ga0495643_0040171 Ga0495643_0040171_534_1685 381
966 3300046524 Ga0495648_0011613 Ga0495648_0011613_3340_4491 381
967 3300046524 Ga0495648_0030140 Ga0495648_0030140_809_1960 381
968 3300046529 Ga0495652_0004103 Ga0495652_0004103_11731_12882 381
969 3300046529 Ga0495652_0028184 Ga0495652_0028184_2447_3598 381
970 3300046529 Ga0495652_0032661 Ga0495652_0032661_1697_2848 381
971 3300046529 Ga0495652_0070350 Ga0495652_0070350_838_1989 381
972 3300046530 Ga0495654_0008669 Ga0495654_0008669_3158_4309 381
973 3300046531 Ga0495665_0000665 Ga0495665_0000665_1802_2953 381
974 3300046533 Ga0495640_0007412 Ga0495640_0007412_6622_7773 381
975 3300046533 Ga0495640_0008807 Ga0495640_0008807_981_2132 381
976 3300046533 Ga0495640_0047285 Ga0495640_0047285_19_1170 381
977 3300046533 Ga0495640_0130271 Ga0495640_0130271_18_1169 381
978 3300046543 Ga0495645_0018393 Ga0495645_0018393_3036_4187 381
979 3300046543 Ga0495645_0100232 Ga0495645_0100232_419_1570 381
980 3300046557 Ga0495622_0005435 Ga0495622_0005435_2404_3555 381
981 3300046557 Ga0495622_0048603 Ga0495622_0048603_44_1195 381
982 3300046557 Ga0495622_0048651 Ga0495622_0048651_703_1854 381
983 3300046557 Ga0495622_0056184 Ga0495622_0056184_207_1358 381
984 3300046559 Ga0495667_0039628 Ga0495667_0039628_1576_2727 381
985 3300046559 Ga0495667_0064174 Ga0495667_0064174_477_1628 381
986 3300046615 Ga0495656_0002336 Ga0495656_0002336_2750_3901 381
987 3300046615 Ga0495656_0025305 Ga0495656_0025305_1179_2330 381
988 3300046616 Ga0495668_0041374 Ga0495668_0041374_298_1449 381
989 3300046616 Ga0495668_0078731 Ga0495668_0078731_435_1586 381
990 3300046642 Ga0495634_0000859 Ga0495634_0000859_24104_25255 381
991 3300046660 Ga0495625_0219120 Ga0495625_0219120_50_1201 381
992 3300046663 Ga0495635_0000160 Ga0495635_0000160_2460_3611 381
993 3300046663 Ga0495635_0010832 Ga0495635_0010832_2781_3932 381
994 3300046663 Ga0495635_0090783 Ga0495635_0090783_448_1599 381
995 3300046665 Ga0495661_0055948 Ga0495661_0055948_1155_2306 381
996 3300046675 Ga0495657_0005563 Ga0495657_0005563_7351_8502 381
997 3300046675 Ga0495657_0030874 Ga0495657_0030874_666_1817 381
998 3300046678 Ga0495599_0002061 Ga0495599_0002061_10342_11493 381
999 3300046679 Ga0495623_0014196 Ga0495623_0014196_1889_3040 381
1000 3300046680 Ga0495646_0040336 Ga0495646_0040336_939_2090 381
1001 3300046680 Ga0495646_0046774 Ga0495646_0046774_514_1665 381
1002 3300046683 Ga0495658_0001756 Ga0495658_0001756_8038_9189 381
1003 3300046684 Ga0495669_0001159 Ga0495669_0001159_9549_10700 381
1004 3300046690 Ga0495624_0000138 Ga0495624_0000138_18237_19388 381
1005 3300046690 Ga0495624_0015049 Ga0495624_0015049_4063_5214 381
1006 3300046690 Ga0495624_0124961 Ga0495624_0124961_19_1170 381
1007 3300046690 Ga0495624_0135809 Ga0495624_0135809_220_1371 381
1008 3300046691 Ga0495670_0081736 Ga0495670_0081736_93_1244 381
1009 3300046692 Ga0495671_0070797 Ga0495671_0070797_526_1677 381
1010 3300046809 Ga0495600_0003305 Ga0495600_0003305_2597_3748 381
1011 3300046809 Ga0495600_0005469 Ga0495600_0005469_2349_3500 381
1012 3300046809 Ga0495600_0005851 Ga0495600_0005851_4165_5316 381
1013 3300047315 Ga0495581_0000001 Ga0495581_0000001_61384_62535 381
1014 3300047317 Ga0495604_0005301 Ga0495604_0005301_120_1271 381
1015 3300047317 Ga0495604_0006543 Ga0495604_0006543_6600_7751 381
1016 3300047317 Ga0495604_0039854 Ga0495604_0039854_1139_2290 381
1017 3300047317 Ga0495604_0071998 Ga0495604_0071998_702_1853 381
1018 3300047319 Ga0495674_0002545 Ga0495674_0002545_15_1166 381
1019 3300047319 Ga0495674_0008583 Ga0495674_0008583_4473_5624 381
1020 3300047319 Ga0495674_0020945 Ga0495674_0020945_3051_4202 381
1021 3300047319 Ga0495674_0119699 Ga0495674_0119699_100_1464 381
1022 3300047320 Ga0495672_0073357 Ga0495672_0073357_413_1564 381
1023 3300047320 Ga0495672_0104025 Ga0495672_0104025_349_1500 381
1024 3300047321 Ga0495676_0032214 Ga0495676_0032214_2323_3474 381
1025 3300047322 Ga0495680_0003866 Ga0495680_0003866_12849_14000 381
1026 3300047323 Ga0495683_0050327 Ga0495683_0050327_577_1728 381
1027 3300047443 Ga0495687_055047 Ga0495687_055047_191_1342 381
1028 3300047444 Ga0495675_0002075 Ga0495675_0002075_1814_2965 381
1029 3300047444 Ga0495675_0002727 Ga0495675_0002727_1139_2290 381
1030 3300047444 Ga0495675_0161884 Ga0495675_0161884_90_1241 381
1031 3300047445 Ga0495677_0024754 Ga0495677_0024754_261_1412 381
1032 3300047469 Ga0495673_0021201 Ga0495673_0021201_1224_2375 381
1033 3300047469 Ga0495673_0036636 Ga0495673_0036636_675_1826 381
1034 3300047471 Ga0495684_0001407 Ga0495684_0001407_14267_15418 381
1035 3300047471 Ga0495684_0015407 Ga0495684_0015407_1924_3075 381
1036 3300047471 Ga0495684_0095266 Ga0495684_0095266_860_2011 381
1037 3300047472 Ga0495686_0093016 Ga0495686_0093016_366_1517 381
1038 3300047673 Ga0495593_0021689 Ga0495593_0021689_1786_2937 381
1039 3300047673 Ga0495593_0044214 Ga0495593_0044214_868_2019 381
1040 3300048088 Ga0495602_0115391 Ga0495602_0115391_224_1375 381
1041 3300048088 Ga0495602_0135074 Ga0495602_0135074_604_1755 381
1042 3300048905 Ga0496102_0004364 Ga0496102_0004364_3576_4727 381
1043 3300048905 Ga0496102_0126693 Ga0496102_0126693_825_1976 381
1044 3300048906 Ga0496103_0030153 Ga0496103_0030153_438_1589 381
1045 3300048907 Ga0496104_0023586 Ga0496104_0023586_2694_3845 381
1046 3300048907 Ga0496104_0291444 Ga0496104_0291444_13_1164 381
1047 3300048908 Ga0496105_0021651 Ga0496105_0021651_3340_4491 381
1048 3300048909 Ga0496106_0005916 Ga0496106_0005916_6404_7555 381
1049 3300048909 Ga0496106_0346451 Ga0496106_0346451_15_1166 381
1050 3300048910 Ga0496107_0114635 Ga0496107_0114635_159_1310 381
1051 3300048912 Ga0496109_0104237 Ga0496109_0104237_208_1359 381
1052 3300048912 Ga0496109_0221039 Ga0496109_0221039_131_1282 381
1053 3300048913 Ga0496110_0031172 Ga0496110_0031172_2377_3528 381
1054 3300048913 Ga0496110_0087682 Ga0496110_0087682_1253_2404 381
1055 3300048913 Ga0496110_0089255 Ga0496110_0089255_118_1269 381
1056 3300048913 Ga0496110_0327100 Ga0496110_0327100_192_1343 381
1057 3300048914 Ga0496111_0028518 Ga0496111_0028518_2445_3596 381
1058 3300048914 Ga0496111_0040389 Ga0496111_0040389_907_2058 381
1059 3300048914 Ga0496111_0132461 Ga0496111_0132461_220_1371 381
1060 3300048914 Ga0496111_0196314 Ga0496111_0196314_69_1220 381
1061 3300048915 Ga0496112_0000044 Ga0496112_0000044_21213_22364 381
1062 3300048915 Ga0496112_0000342 Ga0496112_0000342_8454_9605 381
1063 3300048915 Ga0496112_0014805 Ga0496112_0014805_4691_5842 381
1064 3300048915 Ga0496112_0021871 Ga0496112_0021871_4253_5404 381
1065 3300048915 Ga0496112_0255827 Ga0496112_0255827_153_1304 381
1066 3300048915 Ga0496112_0323815 Ga0496112_0323815_320_1471 381
1067 3300048916 Ga0496113_0005475 Ga0496113_0005475_1225_2376 381
1068 3300048916 Ga0496113_0029593 Ga0496113_0029593_2489_3640 381
1069 3300048916 Ga0496113_0085949 Ga0496113_0085949_229_1380 381
1070 3300048917 Ga0496114_0017464 Ga0496114_0017464_744_1895 381
1071 3300048917 Ga0496114_0051070 Ga0496114_0051070_1936_3087 381
1072 3300048917 Ga0496114_0144403 Ga0496114_0144403_439_1602 381
1073 3300048918 Ga0496115_0000619 Ga0496115_0000619_19936_21147 381
1074 3300048918 Ga0496115_0089498 Ga0496115_0089498_721_1872 381
1075 3300048920 Ga0496117_0010855 Ga0496117_0010855_510_1661 381
1076 3300048920 Ga0496117_0022245 Ga0496117_0022245_1127_2278 381
1077 3300048920 Ga0496117_0061701 Ga0496117_0061701_1403_2554 381
1078 3300048921 Ga0496118_0006532 Ga0496118_0006532_8131_9282 381
1079 3300048921 Ga0496118_0020316 Ga0496118_0020316_3542_4693 381
1080 3300048922 Ga0496119_0019407 Ga0496119_0019407_2839_3990 381
1081 3300048922 Ga0496119_0073072 Ga0496119_0073072_438_1589 381
1082 3300048922 Ga0496119_0083148 Ga0496119_0083148_504_1655 381
1083 3300048924 Ga0496121_0000041 Ga0496121_0000041_125918_127069 381
1084 3300048924 Ga0496121_0001183 Ga0496121_0001183_1763_2914 381
1085 3300048924 Ga0496121_0001244 Ga0496121_0001244_6152_7303 381
1086 3300048924 Ga0496121_0003563 Ga0496121_0003563_13791_14942 381
1087 3300048924 Ga0496121_0012601 Ga0496121_0012601_4170_5321 381
1088 3300048924 Ga0496121_0023065 Ga0496121_0023065_1999_3150 381
1089 3300048924 Ga0496121_0026867 Ga0496121_0026867_2121_3272 381
1090 3300048924 Ga0496121_0057954 Ga0496121_0057954_1646_2893 381
1091 3300048924 Ga0496121_0063495 Ga0496121_0063495_1255_2406 381
1092 3300048924 Ga0496121_0073802 Ga0496121_0073802_620_1771 381
1093 3300048924 Ga0496121_0106593 Ga0496121_0106593_454_1605 381
1094 3300048924 Ga0496121_0147697 Ga0496121_0147697_117_1268 381
1095 3300048925 Ga0496122_0029843 Ga0496122_0029843_1864_3015 381
1096 3300048925 Ga0496122_0115546 Ga0496122_0115546_119_1270 381
1097 3300048926 Ga0496123_0037136 Ga0496123_0037136_1653_2804 381
1098 3300048927 Ga0496124_0000624 Ga0496124_0000624_30738_31889 381
1099 3300048928 Ga0496125_0000504 Ga0496125_0000504_23519_24670 381
1100 3300048928 Ga0496125_0000712 Ga0496125_0000712_40457_41608 381
1101 3300048928 Ga0496125_0009811 Ga0496125_0009811_5946_7097 381
1102 3300048928 Ga0496125_0051838 Ga0496125_0051838_346_1497 381
1103 3300048929 Ga0496126_0007021 Ga0496126_0007021_5772_6923 381
1104 3300048929 Ga0496126_0008123 Ga0496126_0008123_8256_9407 381
1105 3300048929 Ga0496126_0008842 Ga0496126_0008842_1505_2656 381
1106 3300048929 Ga0496126_0010850 Ga0496126_0010850_3288_4439 381
1107 3300048929 Ga0496126_0011784 Ga0496126_0011784_6005_7156 381
1108 3300048929 Ga0496126_0020974 Ga0496126_0020974_4672_5823 381
1109 3300048929 Ga0496126_0031915 Ga0496126_0031915_492_1643 381
1110 3300048929 Ga0496126_0049331 Ga0496126_0049331_1075_2226 381
1111 3300048929 Ga0496126_0134140 Ga0496126_0134140_86_1237 381
1112 3300048929 Ga0496126_0145793 Ga0496126_0145793_488_1639 381
1113 3300049568 Ga0501031_0000657 Ga0501031_0000657_9592_10764 381
1114 3300049568 Ga0501031_0006130 Ga0501031_0006130_3910_5061 381
1115 3300049569 Ga0501032_0000198 Ga0501032_0000198_14730_15881 381
1116 3300049569 Ga0501032_0001779 Ga0501032_0001779_15114_16265 381
1117 3300049570 Ga0501033_0000091 Ga0501033_0000091_46585_47736 381
1118 3300049570 Ga0501033_0001037 Ga0501033_0001037_8533_9684 381
1119 3300049571 Ga0501034_0000039 Ga0501034_0000039_104866_106017 381
1120 3300049571 Ga0501034_0007438 Ga0501034_0007438_2739_3890 381
1121 3300049571 Ga0501034_0008754 Ga0501034_0008754_7157_8308 381
1122 3300049572 Ga0501036_0000134 Ga0501036_0000134_37794_38945 381
1123 3300049572 Ga0501036_0000347 Ga0501036_0000347_5436_6587 381
1124 3300049573 Ga0501037_0000025 Ga0501037_0000025_7455_8606 381
1125 3300049573 Ga0501037_0004145 Ga0501037_0004145_1900_3051 381
1126 3300049574 Ga0501038_0000929 Ga0501038_0000929_16038_17189 381
1127 3300049574 Ga0501038_0002497 Ga0501038_0002497_1256_2407 381
1128 3300049575 Ga0501039_0000550 Ga0501039_0000550_23130_24281 381
1129 3300049575 Ga0501039_0005656 Ga0501039_0005656_2172_3323 381
1130 3300049578 Ga0501042_0028182 Ga0501042_0028182_787_1938 381
1131 3300049579 Ga0501043_0000233 Ga0501043_0000233_43743_44894 381
1132 3300049579 Ga0501043_0021633 Ga0501043_0021633_2739_3890 381
1133 3300049580 Ga0501046_0000995 Ga0501046_0000995_18212_19363 381
1134 3300049580 Ga0501046_0058683 Ga0501046_0058683_278_1429 381
1135 3300049580 Ga0501046_0088815 Ga0501046_0088815_1121_2272 381
1136 3300049581 Ga0501047_0004251 Ga0501047_0004251_6895_8046 381
1137 3300049581 Ga0501047_0045211 Ga0501047_0045211_1840_2991 381
1138 3300049582 Ga0501048_0000218 Ga0501048_0000218_5125_6276 381
1139 3300049582 Ga0501048_0178806 Ga0501048_0178806_200_1351 381
1140 3300049583 Ga0501067_0000973 Ga0501067_0000973_12060_13211 381
1141 3300049583 Ga0501067_0029581 Ga0501067_0029581_231_1382 381
1142 3300049584 Ga0501068_0000785 Ga0501068_0000785_4160_5311 381
1143 3300049584 Ga0501068_0165689 Ga0501068_0165689_67_1218 381
1144 3300049585 Ga0501069_0015183 Ga0501069_0015183_304_1455 381
1145 3300049585 Ga0501069_0019027 Ga0501069_0019027_2181_3332 381
1146 3300049586 Ga0501070_0002981 Ga0501070_0002981_5958_7109 381
1147 3300049586 Ga0501070_0026807 Ga0501070_0026807_1731_2882 381
1148 3300049586 Ga0501070_0174986 Ga0501070_0174986_598_1749 381
1149 3300049588 Ga0501072_0007128 Ga0501072_0007128_1756_2907 381
1150 3300049588 Ga0501072_0050543 Ga0501072_0050543_1167_2318 381
1151 3300049588 Ga0501072_0101782 Ga0501072_0101782_91_1242 381
1152 3300049588 Ga0501072_0113554 Ga0501072_0113554_850_2001 381
1153 3300049589 Ga0501073_0000118 Ga0501073_0000118_44300_45451 381
1154 3300049590 Ga0501074_0000724 Ga0501074_0000724_2187_3338 381
1155 3300049592 Ga0501076_0046016 Ga0501076_0046016_178_1329 381
1156 3300049741 Ga0501079_0000590 Ga0501079_0000590_22681_23832 381
1157 3300049742 Ga0501080_0000124 Ga0501080_0000124_38403_39554 381
1158 3300049742 Ga0501080_0023280 Ga0501080_0023280_1269_2420 381
1159 3300049744 Ga0501083_0000184 Ga0501083_0000184_30379_31530 381
1160 3300049759 Ga0501262_004277 Ga0501262_004277_110_1273 381
1161 3300049762 Ga0501265_001763 Ga0501265_001763_329_1492 381
1162 3300049822 Ga0501035_0000052 Ga0501035_0000052_94606_95757 381
1163 3300049822 Ga0501035_0008174 Ga0501035_0008174_1315_2466 381
1164 3300049823 Ga0501044_0001974 Ga0501044_0001974_17145_18296 381
1165 3300049823 Ga0501044_0005964 Ga0501044_0005964_8049_9200 381
1166 3300049824 Ga0501045_0009338 Ga0501045_0009338_3754_4905 381
1167 3300050489 nmdc:mga03683_103077_c1 nmdc:mga03683_103077_c1_52_1203 381
1168 3300050490 nmdc:mga03n38_421_c1 nmdc:mga03n38_421_c1_8265_9416 381
1169 3300050491 nmdc:mga00v17_20073_c1 nmdc:mga00v17_20073_c1_1960_3135 381
1170 3300050491 nmdc:mga00v17_54704_c1 nmdc:mga00v17_54704_c1_698_1849 381
1171 3300050491 nmdc:mga00v17_71107_c1 nmdc:mga00v17_71107_c1_172_1323 381
1172 3300050493 nmdc:mga0k408_8907_c1 nmdc:mga0k408_8907_c1_272_1423 381
1173 3300050494 nmdc:mga06z11_1539_c1 nmdc:mga06z11_1539_c1_215_1366 381
1174 3300050494 nmdc:mga06z11_27713_c1 nmdc:mga06z11_27713_c1_1528_2679 381
1175 3300050494 nmdc:mga06z11_9669_c1 nmdc:mga06z11_9669_c1_780_1931 381
1176 3300050494 nmdc:mga06z11_99692_c1 nmdc:mga06z11_99692_c1_169_1320 381
1177 3300050495 nmdc:mga04h51_46672_c1 nmdc:mga04h51_46672_c1_245_1396 381
1178 3300050496 nmdc:mga07m45_104020_c1 nmdc:mga07m45_104020_c1_328_1479 381
1179 3300050496 nmdc:mga07m45_19907_c1 nmdc:mga07m45_19907_c1_1711_2862 381
1180 3300050507 nmdc:mga05p37_88061_c1 nmdc:mga05p37_88061_c1_1569_2720 381
1181 3300050508 nmdc:mga09592_238708_c1 nmdc:mga09592_238708_c1_345_1496 381
1182 3300050510 nmdc:mga06r32_14185_c1 nmdc:mga06r32_14185_c1_3435_4586 381
1183 3300050510 nmdc:mga06r32_158105_c1 nmdc:mga06r32_158105_c1_254_1405 381
1184 3300050511 nmdc:mga08y16_90800_c1 nmdc:mga08y16_90800_c1_62_1213 381
1185 3300050513 nmdc:mga0rr50_53185_c1 nmdc:mga0rr50_53185_c1_203_1354 381
1186 3300050516 nmdc:mga0sz30_892_c1 nmdc:mga0sz30_892_c1_3633_4784 381
1187 3300053077 Ga0495601_0058890 Ga0495601_0058890_180_1331 381
1188 3300053078 Ga0495612_0059233 Ga0495612_0059233_27_1178 381
1189 3300053085 Ga0495619_0001159 Ga0495619_0001159_10385_11536 381
1190 3300053085 Ga0495619_0045760 Ga0495619_0045760_63_1214 381
1191 3300053087 Ga0500643_001368 Ga0500643_001368_8221_9372 381
1192 3300053087 Ga0500643_004397 Ga0500643_004397_1460_2611 381
1193 3300053093 Ga0500651_0001603 Ga0500651_0001603_8775_9926 381
1194 3300053093 Ga0500651_0029129 Ga0500651_0029129_140_1291 381
1195 3300053093 Ga0500651_0042209 Ga0500651_0042209_358_1509 381
1196 3300053093 Ga0500651_0052622 Ga0500651_0052622_801_1952 381
1197 3300053094 Ga0500566_0000112 Ga0500566_0000112_20708_21859 381
1198 3300053094 Ga0500566_0000977 Ga0500566_0000977_5656_6807 381
1199 3300053094 Ga0500566_0001893 Ga0500566_0001893_5216_6367 381
1200 3300053094 Ga0500566_0019034 Ga0500566_0019034_1017_2168 381
1201 3300053094 Ga0500566_0050249 Ga0500566_0050249_251_1402 381
1202 3300053095 Ga0500640_001798 Ga0500640_001798_3450_4601 381
1203 3300053096 Ga0500641_0019500 Ga0500641_0019500_602_1753 381
1204 3300053096 Ga0500641_0076775 Ga0500641_0076775_232_1383 381
1205 3300053098 Ga0500650_0012794 Ga0500650_0012794_1923_3074 381
1206 3300053103 Ga0500555_006850 Ga0500555_006850_683_1834 381
1207 3300053104 Ga0500556_0000002 Ga0500556_0000002_83542_84693 381
1208 3300053104 Ga0500556_0003137 Ga0500556_0003137_2376_3527 381
1209 3300053105 Ga0500557_000003 Ga0500557_000003_142070_143221 381
1210 3300053108 Ga0500562_019507 Ga0500562_019507_356_1507 381
1211 3300053109 Ga0500569_012395 Ga0500569_012395_116_1267 381
1212 3300053111 Ga0500572_001579 Ga0500572_001579_1416_2567 381
1213 3300053116 Ga0500592_002202 Ga0500592_002202_283_1434 381
1214 3300053117 Ga0500593_002237 Ga0500593_002237_1921_3072 381
1215 3300053119 Ga0500595_000001 Ga0500595_000001_497953_499104 381
1216 3300053119 Ga0500595_000906 Ga0500595_000906_5890_7041 381
1217 3300053119 Ga0500595_005109 Ga0500595_005109_2977_4128 381
1218 3300053119 Ga0500595_012231 Ga0500595_012231_240_1391 381
1219 3300053121 Ga0500607_048600 Ga0500607_048600_733_1884 381
1220 3300053121 Ga0500607_066703 Ga0500607_066703_580_1731 381
1221 3300053123 Ga0500614_005002 Ga0500614_005002_510_1661 381
1222 3300053130 Ga0500642_0000026 Ga0500642_0000026_90651_91802 381
1223 3300053130 Ga0500642_0000051 Ga0500642_0000051_69102_70253 381
1224 3300053130 Ga0500642_0003882 Ga0500642_0003882_2750_3901 381
1225 3300053131 Ga0500652_002679 Ga0500652_002679_1282_2433 381
1226 3300053136 Ga0500559_0000502 Ga0500559_0000502_15624_16775 381
1227 3300053136 Ga0500559_0042677 Ga0500559_0042677_230_1381 381
1228 3300053136 Ga0500559_0053929 Ga0500559_0053929_36_1187 381
1229 3300053139 Ga0500568_0000519 Ga0500568_0000519_6427_7578 381
1230 3300053142 Ga0500577_0007028 Ga0500577_0007028_158_1309 381
1231 3300053145 Ga0500586_003947 Ga0500586_003947_488_1639 381
1232 3300053150 Ga0500603_000746 Ga0500603_000746_1949_3100 381
1233 3300053151 Ga0500604_0000440 Ga0500604_0000440_6568_7719 381
1234 3300053153 Ga0500616_0000031 Ga0500616_0000031_67933_69084 381
1235 3300053153 Ga0500616_0094226 Ga0500616_0094226_20_1171 381
1236 3300053156 Ga0500622_0000106 Ga0500622_0000106_35031_36182 381
1237 3300053156 Ga0500622_0004681 Ga0500622_0004681_4086_5237 381
1238 3300053156 Ga0500622_0029022 Ga0500622_0029022_983_2134 381
1239 3300053159 Ga0500630_003177 Ga0500630_003177_5240_6391 381
1240 3300053163 Ga0500639_000061 Ga0500639_000061_5951_7102 381
1241 3300053177 Ga0500636_0007886 Ga0500636_0007886_1088_2239 381
1242 3300053178 Ga0500637_0000098 Ga0500637_0000098_19603_20754 381
1243 3300053729 Ga0500625_008055 Ga0500625_008055_2118_3269 381
1244 3300053731 Ga0500609_001453 Ga0500609_001453_1026_2177 381
1245 3300053731 Ga0500609_003779 Ga0500609_003779_148_1299 381
1246 3300053735 Ga0500596_001455 Ga0500596_001455_2455_3606 381
1247 3300053737 Ga0500601_000504 Ga0500601_000504_3377_4528 381
1248 3300054114 Ga0501084_0002419 Ga0501084_0002419_1256_2407 381
1249 3300054114 Ga0501084_0042743 Ga0501084_0042743_2488_3639 381
1250 3300060353 Ga0501082_0000457 Ga0501082_0000457_23033_24184 381
1251 3300061734 Ga0530510_0125277 Ga0530510_0125277_322_1473 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

219

357

0.96

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

119

210

0.91

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

227

449

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oqb-assembly1.cif.gz_H crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.982 3 381
3oqb-assembly1.cif.gz_A crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9807 3 381
3oqb-assembly1.cif.gz_C crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9799 3 381
3oqb-assembly1.cif.gz_H crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9769 3 381
3oqb-assembly1.cif.gz_G crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9764 3 381
ID Description Score Start End Superfamily
3oqbF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9837 3 139 3.40.50.720
3oqbH02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9684 142 381 3.30.360.10
3oqbF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 3 139 3.40.50.720
3oqbH02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9603 142 381 3.30.360.10
3uuwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8764 4 139 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535CEX2-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9827 61 381 GO:0000166
GO:0016491
AF-A0A535CEX2-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9619 61 381 GO:0000166
GO:0016491
AF-A0A6D0LXU9-F1-model_v4 deleted 0.9025 71 287
AF-U3TMX4-F1-model_v4 Oxidoreductase domain-containing protein 0.901 49 158 GO:0000166
AF-A0A836BGI8-F1-model_v4 Oxidoreductase domain-containing protein 0.9007 74 379 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.15 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map