F492200
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1251 | 698 | 1007 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300035725|Ga0373947_0049392|Ga0373947_0049392_1118_2482 |
| Length | 454 |
| Sequence | LLHRVAPRDDGVARKHGFAFSPSASEAEFRAMHGSSHADERNPAGQYLSNGLIYALPRPRANNKIPFGANLMTTQRLGLIMNGVTGRMGLNQHLIRSIVAIRDQGGVALANGDRVMPDPILVGRDAGKVEALAKRFHVARWTTDLDKALADTNDSVFFDAATTQARPSLLTKAINAGKHVYCEKPIATNLDEAVAVVKLANSKGLKHGTVQDKLFLPGLKKLAFLRDSGFFGRMLSVRGEFGYWVFEGGWQEAQRPSWNYRNEDGGGIILDMVCHWRYVLDNLFGEVESVVCIGNTDIPERYDEKNRKYVATADDSAYATFKLKGGVIAHINMSWVTRVYRDDLVTFQVDGTHGSAVAGLTDCVIQARQMTPRPVWNPDEKRLHDFYADWQKLPDNVAYDNGFKEQWEMFIRHVCENAPYKYTLLEGAKGVQLAECALQSWKERRWIDVEAIRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 17 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 18 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 19 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 20 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 21 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 22 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 23 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 24 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 25 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 26 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 27 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 28 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 29 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 30 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 31 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 32 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 33 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 34 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 35 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 36 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 37 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 38 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 39 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 40 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 41 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 42 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 43 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 44 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 45 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 46 | 2791355199 | |||
| 47 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 48 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 49 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 50 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 51 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 52 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 53 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 54 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 55 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 56 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 57 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 58 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 59 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 60 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 61 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 62 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 63 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 64 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 65 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 66 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 67 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 68 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 69 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 70 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 71 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 72 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 73 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 74 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 75 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 76 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 77 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 78 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 79 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 80 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 81 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 82 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 83 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 84 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 85 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 86 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 87 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 88 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 89 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 90 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 91 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 92 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 93 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 94 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 95 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 96 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 97 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 98 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 99 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 100 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 101 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 102 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 103 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 104 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 105 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 106 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 107 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 108 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 109 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 110 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 111 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 112 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 113 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 114 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 115 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 116 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 117 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 118 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 119 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 120 | 2904699407 | |||
| 121 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 122 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 123 | 2906610324 | |||
| 124 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 125 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 126 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 127 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 128 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 129 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 130 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 131 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 132 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 133 | 2922368715 | |||
| 134 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 135 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 136 | 2922425934 | |||
| 137 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 138 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 139 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 140 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 141 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 142 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 143 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 144 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 145 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 146 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 147 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 148 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 149 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 150 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 151 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 152 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 153 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 154 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 155 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 156 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 157 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 158 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 159 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 160 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 161 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 162 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 163 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 164 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 165 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 166 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 167 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 168 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 169 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 170 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 171 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 172 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 173 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 174 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 175 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 176 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 177 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 178 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 179 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 180 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 181 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 182 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 183 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 184 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 185 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 186 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 187 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 188 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 189 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 190 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 191 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 192 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 193 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 194 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 195 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 196 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 197 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 198 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 199 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 200 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 201 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 202 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 203 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 204 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 205 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 206 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 207 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 208 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 210 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 211 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 212 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 213 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 214 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 215 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 216 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 217 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 218 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 219 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 220 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 221 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 223 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 226 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 227 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 228 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 230 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 238 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 245 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 250 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 251 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 252 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 253 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 254 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 255 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 256 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 260 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 261 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 263 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 264 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 265 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 266 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 267 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 268 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 269 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 270 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 271 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 272 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 273 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 274 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 275 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 276 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 278 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 279 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 280 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 281 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 282 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 283 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 284 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 285 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 286 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 287 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 289 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 290 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 291 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 292 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 293 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 294 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 296 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 297 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 298 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 299 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 304 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 321 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 325 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 326 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 327 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 328 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 329 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 330 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 333 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 336 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 337 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 338 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 396 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 397 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 398 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 399 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 403 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 407 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 408 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 409 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 410 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 411 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 412 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 413 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 414 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 415 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 416 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 417 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 418 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 419 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 420 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 421 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 422 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 423 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 424 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 425 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 426 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 427 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 428 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 429 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 430 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 431 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 432 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 433 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 434 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 435 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 436 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 437 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 438 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 439 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 440 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 441 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 442 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 443 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 444 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 445 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 446 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 447 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 448 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 449 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 450 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 451 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 452 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 453 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 454 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 455 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 456 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 457 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 458 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 459 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 460 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 461 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 462 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 463 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 464 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 465 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 466 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 467 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 468 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 469 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 470 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 471 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 472 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 473 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 474 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 475 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 476 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 477 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 478 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 479 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 480 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 552 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 553 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 554 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 555 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 556 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 557 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 558 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 559 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 560 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 561 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 562 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 563 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 564 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 565 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 566 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 567 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 568 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 569 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 570 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 571 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 572 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 573 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 574 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 575 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 576 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 602 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 603 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 607 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 608 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 609 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 610 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 611 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 612 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 613 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 615 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 616 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 617 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 618 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 619 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 620 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 621 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 626 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 627 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 628 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 629 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 630 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 631 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 632 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 633 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 634 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 635 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 636 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 637 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 638 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 639 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 640 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 641 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 642 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 643 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 644 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 645 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 646 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 647 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 648 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 649 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 650 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 651 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 652 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 653 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 654 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 655 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 656 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 657 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 658 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 659 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 660 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 661 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 662 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 663 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 664 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 665 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 666 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 667 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 668 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 669 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 670 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 671 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 672 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 673 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 674 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 675 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 676 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 677 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 678 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 679 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 680 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 681 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 682 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 683 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 684 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 685 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 686 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 687 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 688 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 689 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 690 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 691 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 692 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 693 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 694 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 695 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 696 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 697 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 698 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.74 |
| Metatranscriptomes | 0.08 |
| Isolates | 19.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.15 |
| Nodule | 15.19 |
| Rhizoplane | 5.36 |
| Rhizosphere | 56.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c002823 | 3300000043 | Bacteria | 1770 |
| 2 | ARSoilOldRDRAFT_c003037 | 3300000044 | Bacteria | 1453 |
| 3 | JGI24739J22299_10031571 | 3300001989 | Bacteria | 1829 |
| 4 | JGI24737J22298_10039955 | 3300001990 | Bacteria | 1441 |
| 5 | JGI24738J21930_10017994 | 3300002075 | Bacteria | 1480 |
| 6 | JGI25406J46586_10000050 | 3300003203 | Bacteria | 54388 |
| 7 | JGI25153J46596_10000297 | 3300003215 | Bacteria | 37155 |
| 8 | JGI25153J46596_10001771 | 3300003215 | Bacteria | 12818 |
| 9 | JGI25153J46596_10002178 | 3300003215 | Bacteria | 11436 |
| 10 | JGI25153J46596_10003525 | 3300003215 | Bacteria | 8729 |
| 11 | JGI25153J46596_10005376 | 3300003215 | Bacteria | 6725 |
| 12 | JGI25153J46596_10007400 | 3300003215 | Bacteria | 5406 |
| 13 | Ga0055542_1005691 | 3300003762 | Bacteria | 2766 |
| 14 | Ga0055531_10012935 | 3300003794 | Bacteria | 3886 |
| 15 | Ga0055543_1004359 | 3300004625 | Bacteria | 3881 |
| 16 | Ga0065165_1001109 | 3300005262 | Bacteria | 31984 |
| 17 | Ga0065165_1012799 | 3300005262 | Bacteria | 3389 |
| 18 | Ga0065704_10111240 | 3300005289 | Bacteria | 1936 |
| 19 | Ga0065712_10021991 | 3300005290 | Bacteria | 1758 |
| 20 | Ga0065712_10080594 | 3300005290 | Bacteria | 3089 |
| 21 | Ga0070676_10104133 | 3300005328 | Bacteria | 1758 |
| 22 | Ga0070676_10119955 | 3300005328 | Bacteria | 1649 |
| 23 | Ga0070683_100005122 | 3300005329 | Bacteria | 10899 |
| 24 | Ga0070683_100088145 | 3300005329 | Bacteria | 2911 |
| 25 | Ga0070670_100069412 | 3300005331 | Bacteria | 3025 |
| 26 | Ga0070666_10041549 | 3300005335 | Bacteria | 3073 |
| 27 | Ga0070680_100011806 | 3300005336 | Bacteria | 6775 |
| 28 | Ga0070680_100074827 | 3300005336 | Bacteria | 2787 |
| 29 | Ga0070680_100094123 | 3300005336 | Bacteria | 2483 |
| 30 | Ga0070682_100232921 | 3300005337 | Bacteria | 1317 |
| 31 | Ga0068868_100001939 | 3300005338 | Bacteria | 14194 |
| 32 | Ga0068868_100037581 | 3300005338 | Bacteria | 3754 |
| 33 | Ga0070660_100029848 | 3300005339 | Bacteria | 4088 |
| 34 | Ga0070660_100103884 | 3300005339 | Bacteria | 2253 |
| 35 | Ga0070660_100132353 | 3300005339 | Bacteria | 1996 |
| 36 | Ga0070660_100296921 | 3300005339 | Bacteria | 1324 |
| 37 | Ga0070689_100008156 | 3300005340 | Bacteria | 7360 |
| 38 | Ga0070661_100038404 | 3300005344 | Bacteria | 3485 |
| 39 | Ga0070661_100064072 | 3300005344 | Bacteria | 2701 |
| 40 | Ga0070668_100027692 | 3300005347 | Bacteria | 4302 |
| 41 | Ga0070668_100071610 | 3300005347 | Bacteria | 2701 |
| 42 | Ga0070668_100088233 | 3300005347 | Bacteria | 2441 |
| 43 | Ga0070669_100046473 | 3300005353 | Bacteria | 3166 |
| 44 | Ga0070669_100152048 | 3300005353 | Bacteria | 1792 |
| 45 | Ga0070675_100164085 | 3300005354 | Bacteria | 1912 |
| 46 | Ga0070675_100269619 | 3300005354 | Bacteria | 1493 |
| 47 | Ga0070671_100011229 | 3300005355 | Bacteria | 7193 |
| 48 | Ga0070671_100015820 | 3300005355 | Bacteria | 6093 |
| 49 | Ga0070671_100139747 | 3300005355 | Bacteria | 2044 |
| 50 | Ga0070674_100052883 | 3300005356 | Bacteria | 2802 |
| 51 | Ga0070673_100001119 | 3300005364 | Bacteria | 15383 |
| 52 | Ga0070688_100034556 | 3300005365 | Bacteria | 3063 |
| 53 | Ga0070667_100000427 | 3300005367 | Bacteria | 44426 |
| 54 | Ga0070667_100058914 | 3300005367 | Bacteria | 3247 |
| 55 | Ga0070667_100240126 | 3300005367 | Bacteria | 1617 |
| 56 | Ga0070709_10001579 | 3300005434 | Bacteria | 12291 |
| 57 | Ga0070709_10018524 | 3300005434 | Bacteria | 4011 |
| 58 | Ga0070714_100009461 | 3300005435 | Bacteria | 7663 |
| 59 | Ga0070714_100033299 | 3300005435 | Bacteria | 4307 |
| 60 | Ga0070714_100041521 | 3300005435 | Bacteria | 3882 |
| 61 | Ga0070714_100075963 | 3300005435 | Bacteria | 2916 |
| 62 | Ga0070713_100050284 | 3300005436 | Bacteria | 3442 |
| 63 | Ga0070713_100084103 | 3300005436 | Bacteria | 2722 |
| 64 | Ga0070713_100154932 | 3300005436 | Bacteria | 2041 |
| 65 | Ga0070713_100157884 | 3300005436 | Bacteria | 2023 |
| 66 | Ga0070710_10008336 | 3300005437 | Bacteria | 5044 |
| 67 | Ga0070711_100003453 | 3300005439 | Bacteria | 9209 |
| 68 | Ga0070711_100010332 | 3300005439 | Bacteria | 5775 |
| 69 | Ga0070711_100013079 | 3300005439 | Bacteria | 5204 |
| 70 | Ga0070711_100027252 | 3300005439 | Bacteria | 3750 |
| 71 | Ga0070711_100028382 | 3300005439 | Bacteria | 3682 |
| 72 | Ga0070700_100113454 | 3300005441 | Bacteria | 1806 |
| 73 | Ga0070694_100088723 | 3300005444 | Bacteria | 2165 |
| 74 | Ga0070663_100009428 | 3300005455 | Bacteria | 6044 |
| 75 | Ga0070663_100028430 | 3300005455 | Bacteria | 3806 |
| 76 | Ga0070663_100096844 | 3300005455 | Bacteria | 2195 |
| 77 | Ga0070678_100000866 | 3300005456 | Bacteria | 15460 |
| 78 | Ga0070678_100030749 | 3300005456 | Bacteria | 3695 |
| 79 | Ga0070678_100049636 | 3300005456 | Bacteria | 3030 |
| 80 | Ga0070662_100269786 | 3300005457 | Bacteria | 1374 |
| 81 | Ga0070681_10063853 | 3300005458 | Bacteria | 3655 |
| 82 | Ga0068867_100027893 | 3300005459 | Bacteria | 4062 |
| 83 | Ga0070706_100075117 | 3300005467 | Bacteria | 3128 |
| 84 | Ga0070698_100142127 | 3300005471 | Bacteria | 2351 |
| 85 | Ga0070679_100089458 | 3300005530 | Bacteria | 3066 |
| 86 | Ga0070679_100143686 | 3300005530 | Bacteria | 2364 |
| 87 | Ga0070684_100027728 | 3300005535 | Bacteria | 4784 |
| 88 | Ga0070684_100058149 | 3300005535 | Bacteria | 3378 |
| 89 | Ga0070684_100170508 | 3300005535 | Bacteria | 1977 |
| 90 | Ga0070697_100012253 | 3300005536 | Bacteria | 6716 |
| 91 | Ga0070672_100085986 | 3300005543 | Bacteria | 2528 |
| 92 | Ga0070672_100115772 | 3300005543 | Bacteria | 2189 |
| 93 | Ga0070693_100088214 | 3300005547 | Bacteria | 1865 |
| 94 | Ga0070665_100103293 | 3300005548 | Bacteria | 2853 |
| 95 | Ga0070665_100123255 | 3300005548 | Bacteria | 2594 |
| 96 | Ga0070665_100381401 | 3300005548 | Bacteria | 1417 |
| 97 | Ga0070704_100172906 | 3300005549 | Bacteria | 1720 |
| 98 | Ga0068855_100044511 | 3300005563 | Bacteria | 5252 |
| 99 | Ga0068855_100129697 | 3300005563 | Bacteria | 2880 |
| 100 | Ga0070664_100004769 | 3300005564 | Bacteria | 10861 |
| 101 | Ga0068857_100006913 | 3300005577 | Bacteria | 9770 |
| 102 | Ga0068856_100001803 | 3300005614 | Bacteria | 22366 |
| 103 | Ga0068856_100017040 | 3300005614 | Bacteria | 7042 |
| 104 | Ga0068856_100200377 | 3300005614 | Bacteria | 2010 |
| 105 | Ga0068852_100064623 | 3300005616 | Bacteria | 3190 |
| 106 | Ga0068852_100075034 | 3300005616 | Bacteria | 2981 |
| 107 | Ga0068852_100120886 | 3300005616 | Bacteria | 2397 |
| 108 | Ga0068852_100370232 | 3300005616 | Bacteria | 1403 |
| 109 | Ga0068859_100090741 | 3300005617 | Bacteria | 3106 |
| 110 | Ga0068864_100001940 | 3300005618 | Bacteria | 16988 |
| 111 | Ga0068864_100087884 | 3300005618 | Bacteria | 2737 |
| 112 | Ga0068864_100214469 | 3300005618 | Bacteria | 1774 |
| 113 | Ga0068866_10024437 | 3300005718 | Bacteria | 2825 |
| 114 | Ga0068866_10117751 | 3300005718 | Bacteria | 1492 |
| 115 | Ga0068861_100048457 | 3300005719 | Bacteria | 3212 |
| 116 | Ga0068861_100081446 | 3300005719 | Bacteria | 2534 |
| 117 | Ga0068863_100005859 | 3300005841 | Bacteria | 12041 |
| 118 | Ga0068863_100219662 | 3300005841 | Bacteria | 1831 |
| 119 | Ga0068858_100064249 | 3300005842 | Bacteria | 3397 |
| 120 | Ga0068858_100132331 | 3300005842 | Bacteria | 2339 |
| 121 | Ga0068858_100263622 | 3300005842 | Bacteria | 1638 |
| 122 | Ga0068860_100000399 | 3300005843 | Bacteria | 56959 |
| 123 | Ga0068860_100144833 | 3300005843 | Bacteria | 2285 |
| 124 | Ga0081455_10000237 | 3300005937 | Bacteria | 71335 |
| 125 | Ga0081455_10095265 | 3300005937 | Bacteria | 2403 |
| 126 | Ga0081538_10018641 | 3300005981 | Bacteria | 5198 |
| 127 | Ga0081540_1002658 | 3300005983 | Bacteria | 14535 |
| 128 | Ga0081540_1012722 | 3300005983 | Bacteria | 5516 |
| 129 | Ga0081540_1014792 | 3300005983 | Bacteria | 4975 |
| 130 | Ga0081540_1019041 | 3300005983 | Bacteria | 4190 |
| 131 | Ga0081539_10000325 | 3300005985 | Bacteria | 106431 |
| 132 | Ga0081539_10000542 | 3300005985 | Bacteria | 78012 |
| 133 | Ga0081539_10017927 | 3300005985 | Bacteria | 4941 |
| 134 | Ga0081539_10041063 | 3300005985 | Bacteria | 2709 |
| 135 | Ga0081539_10103757 | 3300005985 | Bacteria | 1444 |
| 136 | Ga0070717_10004627 | 3300006028 | Bacteria | 9970 |
| 137 | Ga0070717_10021548 | 3300006028 | Bacteria | 5079 |
| 138 | Ga0070717_10075971 | 3300006028 | Bacteria | 2811 |
| 139 | Ga0075365_10000416 | 3300006038 | Bacteria | 15693 |
| 140 | Ga0075365_10066033 | 3300006038 | Bacteria | 2426 |
| 141 | Ga0075365_10070334 | 3300006038 | Bacteria | 2353 |
| 142 | Ga0075368_10012500 | 3300006042 | Bacteria | 3105 |
| 143 | Ga0075368_10059682 | 3300006042 | Bacteria | 1526 |
| 144 | Ga0075363_100001174 | 3300006048 | Bacteria | 9626 |
| 145 | Ga0075363_100007935 | 3300006048 | Bacteria | 4916 |
| 146 | Ga0075363_100014889 | 3300006048 | Bacteria | 3813 |
| 147 | Ga0075364_10002830 | 3300006051 | Bacteria | 9764 |
| 148 | Ga0075364_10036378 | 3300006051 | Bacteria | 3182 |
| 149 | Ga0075364_10108105 | 3300006051 | Bacteria | 1855 |
| 150 | Ga0070715_10037104 | 3300006163 | Bacteria | 2015 |
| 151 | Ga0070715_10095856 | 3300006163 | Bacteria | 1374 |
| 152 | Ga0070716_100036597 | 3300006173 | Bacteria | 2707 |
| 153 | Ga0070712_100008334 | 3300006175 | Bacteria | 6517 |
| 154 | Ga0070712_100116412 | 3300006175 | Bacteria | 2004 |
| 155 | Ga0075367_10013317 | 3300006178 | Bacteria | 4417 |
| 156 | Ga0075367_10027064 | 3300006178 | Bacteria | 3258 |
| 157 | Ga0075367_10040805 | 3300006178 | Bacteria | 2711 |
| 158 | Ga0075369_10014301 | 3300006186 | Bacteria | 3168 |
| 159 | Ga0075366_10009516 | 3300006195 | Bacteria | 5426 |
| 160 | Ga0075366_10022789 | 3300006195 | Bacteria | 3645 |
| 161 | Ga0075366_10147024 | 3300006195 | Bacteria | 1426 |
| 162 | Ga0097621_100044777 | 3300006237 | Bacteria | 3571 |
| 163 | Ga0097621_100141994 | 3300006237 | Bacteria | 2053 |
| 164 | Ga0097621_100146252 | 3300006237 | Bacteria | 2024 |
| 165 | Ga0075370_10005713 | 3300006353 | Bacteria | 6209 |
| 166 | Ga0075370_10011478 | 3300006353 | Bacteria | 4657 |
| 167 | Ga0075370_10056711 | 3300006353 | Bacteria | 2226 |
| 168 | Ga0075370_10097937 | 3300006353 | Bacteria | 1696 |
| 169 | Ga0068871_100139545 | 3300006358 | Bacteria | 2061 |
| 170 | Ga0075428_100128240 | 3300006844 | Bacteria | 2760 |
| 171 | Ga0075431_100001980 | 3300006847 | Bacteria | 19546 |
| 172 | Ga0075431_100254358 | 3300006847 | Bacteria | 1784 |
| 173 | Ga0075434_100077954 | 3300006871 | Bacteria | 3309 |
| 174 | Ga0068865_100060979 | 3300006881 | Bacteria | 2642 |
| 175 | Ga0068865_100077175 | 3300006881 | Bacteria | 2380 |
| 176 | Ga0068865_100229200 | 3300006881 | Bacteria | 1456 |
| 177 | Ga0097620_100090743 | 3300006931 | Bacteria | 3106 |
| 178 | Ga0099824_1019369 | 3300006942 | Bacteria | 5322 |
| 179 | Ga0099824_1037786 | 3300006942 | Bacteria | 1322 |
| 180 | Ga0099822_1001244 | 3300006943 | Bacteria | 29011 |
| 181 | Ga0099794_10017117 | 3300007265 | Bacteria | 3226 |
| 182 | Ga0099795_10006714 | 3300007788 | Bacteria | 3157 |
| 183 | Ga0105240_10184409 | 3300009093 | Bacteria | 2459 |
| 184 | Ga0111539_10033837 | 3300009094 | Bacteria | 6202 |
| 185 | Ga0111539_10162670 | 3300009094 | Bacteria | 2610 |
| 186 | Ga0105245_10050469 | 3300009098 | Bacteria | 3729 |
| 187 | Ga0105245_10065537 | 3300009098 | Bacteria | 3285 |
| 188 | Ga0114129_10069616 | 3300009147 | Bacteria | 4905 |
| 189 | Ga0105243_10072375 | 3300009148 | Bacteria | 2790 |
| 190 | Ga0105243_10111021 | 3300009148 | Bacteria | 2294 |
| 191 | Ga0105241_10111029 | 3300009174 | Bacteria | 2194 |
| 192 | Ga0105248_10135644 | 3300009177 | Bacteria | 2776 |
| 193 | Ga0105237_10013607 | 3300009545 | Bacteria | 8525 |
| 194 | Ga0105238_10041453 | 3300009551 | Bacteria | 4662 |
| 195 | Ga0105238_10110140 | 3300009551 | Bacteria | 2735 |
| 196 | Ga0105249_10025941 | 3300009553 | Bacteria | 5278 |
| 197 | Ga0105249_10288149 | 3300009553 | Bacteria | 1643 |
| 198 | Ga0105249_10406987 | 3300009553 | Bacteria | 1392 |
| 199 | Ga0105239_10034550 | 3300010375 | Bacteria | 5552 |
| 200 | Ga0105239_10087399 | 3300010375 | Bacteria | 3437 |
| 201 | Ga0105239_10218278 | 3300010375 | Bacteria | 2138 |
| 202 | Ga0105246_10134531 | 3300011119 | Bacteria | 1851 |
| 203 | Ga0157373_10012937 | 3300013100 | Bacteria | 6127 |
| 204 | Ga0157370_10087286 | 3300013104 | Bacteria | 2930 |
| 205 | Ga0157370_10089633 | 3300013104 | Bacteria | 2889 |
| 206 | Ga0157369_10011073 | 3300013105 | Bacteria | 10261 |
| 207 | Ga0157369_10052856 | 3300013105 | Bacteria | 4393 |
| 208 | Ga0157369_10172790 | 3300013105 | Bacteria | 2276 |
| 209 | Ga0157374_10090805 | 3300013296 | Bacteria | 2912 |
| 210 | Ga0163162_10042571 | 3300013306 | Bacteria | 4546 |
| 211 | Ga0163162_10071836 | 3300013306 | Bacteria | 3515 |
| 212 | Ga0163162_10122854 | 3300013306 | Bacteria | 2701 |
| 213 | Ga0163162_10217062 | 3300013306 | Bacteria | 2043 |
| 214 | Ga0157372_10145358 | 3300013307 | Bacteria | 2734 |
| 215 | Ga0157372_10524700 | 3300013307 | Bacteria | 1380 |
| 216 | Ga0157375_10122327 | 3300013308 | Bacteria | 2714 |
| 217 | Ga0163163_10003896 | 3300014325 | Bacteria | 12723 |
| 218 | Ga0163163_10005260 | 3300014325 | Bacteria | 11163 |
| 219 | Ga0163163_10005988 | 3300014325 | Bacteria | 10575 |
| 220 | Ga0163163_10012351 | 3300014325 | Bacteria | 7781 |
| 221 | Ga0157380_10058124 | 3300014326 | Bacteria | 3082 |
| 222 | Ga0157380_10115131 | 3300014326 | Bacteria | 2267 |
| 223 | Ga0182008_10097894 | 3300014497 | Unclassified | 1448 |
| 224 | Ga0157379_10023235 | 3300014968 | Bacteria | 5500 |
| 225 | Ga0157379_10032090 | 3300014968 | Bacteria | 4680 |
| 226 | Ga0157376_10231582 | 3300014969 | Bacteria | 1716 |
| 227 | Ga0163161_10063621 | 3300017792 | Bacteria | 2689 |
| 228 | Ga0163161_10066401 | 3300017792 | Bacteria | 2634 |
| 229 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 230 | Ga0214544_1026847 | 3300021320 | Bacteria | 2493 |
| 231 | Ga0214544_1027275 | 3300021320 | Bacteria | 2400 |
| 232 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 233 | Ga0214542_1037377 | 3300021321 | Bacteria | 1387 |
| 234 | Ga0214542_1037673 | 3300021321 | Bacteria | 1366 |
| 235 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 236 | Ga0214545_1019261 | 3300021324 | Bacteria | 5911 |
| 237 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 238 | Ga0214543_1026652 | 3300021327 | Bacteria | 3065 |
| 239 | Ga0214543_1039585 | 3300021327 | Bacteria | 1294 |
| 240 | Ga0213874_10001651 | 3300021377 | Bacteria | 4682 |
| 241 | Ga0213874_10041435 | 3300021377 | Bacteria | 1379 |
| 242 | Ga0213876_10002729 | 3300021384 | Bacteria | 10288 |
| 243 | Ga0213876_10027514 | 3300021384 | Bacteria | 3000 |
| 244 | Ga0213876_10097258 | 3300021384 | Bacteria | 1560 |
| 245 | Ga0209563_104444 | 3300025230 | Bacteria | 2679 |
| 246 | Ga0209677_100598 | 3300025253 | Bacteria | 19523 |
| 247 | Ga0209677_107557 | 3300025253 | Bacteria | 2280 |
| 248 | Ga0209148_1000462 | 3300025254 | Bacteria | 43711 |
| 249 | Ga0209148_1004101 | 3300025254 | Bacteria | 3687 |
| 250 | Ga0209233_1000654 | 3300025261 | Bacteria | 16891 |
| 251 | Ga0209233_1007735 | 3300025261 | Bacteria | 3378 |
| 252 | Ga0209233_1008472 | 3300025261 | Bacteria | 3183 |
| 253 | Ga0209233_1014172 | 3300025261 | Bacteria | 2255 |
| 254 | Ga0209455_1000926 | 3300025272 | Bacteria | 15102 |
| 255 | Ga0209455_1000954 | 3300025272 | Bacteria | 14747 |
| 256 | Ga0209564_1000468 | 3300025295 | Bacteria | 67696 |
| 257 | Ga0209564_1008067 | 3300025295 | Bacteria | 5274 |
| 258 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 259 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 260 | Ga0209758_1000302 | 3300025297 | Bacteria | 96619 |
| 261 | Ga0209758_1000845 | 3300025297 | Bacteria | 42737 |
| 262 | Ga0209758_1001760 | 3300025297 | Bacteria | 24019 |
| 263 | Ga0209758_1002308 | 3300025297 | Bacteria | 19720 |
| 264 | Ga0209758_1008957 | 3300025297 | Bacteria | 6341 |
| 265 | Ga0209758_1010383 | 3300025297 | Bacteria | 5584 |
| 266 | Ga0209758_1052251 | 3300025297 | Bacteria | 1415 |
| 267 | Ga0209256_1003911 | 3300025299 | Bacteria | 9844 |
| 268 | Ga0207426_1000270 | 3300025302 | Bacteria | 108404 |
| 269 | Ga0207426_1000292 | 3300025302 | Bacteria | 99342 |
| 270 | Ga0207426_1002666 | 3300025302 | Bacteria | 10959 |
| 271 | Ga0209257_1001242 | 3300025304 | Bacteria | 31529 |
| 272 | Ga0207697_10021016 | 3300025315 | Bacteria | 2673 |
| 273 | Ga0207656_10010329 | 3300025321 | Bacteria | 3495 |
| 274 | Ga0207653_10001814 | 3300025885 | Bacteria | 6821 |
| 275 | Ga0207692_10008873 | 3300025898 | Bacteria | 4178 |
| 276 | Ga0207692_10013471 | 3300025898 | Bacteria | 3549 |
| 277 | Ga0207692_10032938 | 3300025898 | Bacteria | 2495 |
| 278 | Ga0207692_10168069 | 3300025898 | Bacteria | 1269 |
| 279 | Ga0207642_10022066 | 3300025899 | Bacteria | 2518 |
| 280 | Ga0207642_10042821 | 3300025899 | Bacteria | 1992 |
| 281 | Ga0207647_10007857 | 3300025904 | Bacteria | 7673 |
| 282 | Ga0207685_10000806 | 3300025905 | Bacteria | 5811 |
| 283 | Ga0207699_10000503 | 3300025906 | Bacteria | 19503 |
| 284 | Ga0207699_10015653 | 3300025906 | Bacteria | 3945 |
| 285 | Ga0207699_10062610 | 3300025906 | Bacteria | 2243 |
| 286 | Ga0207645_10079415 | 3300025907 | Bacteria | 2103 |
| 287 | Ga0207645_10108318 | 3300025907 | Bacteria | 1797 |
| 288 | Ga0207654_10071689 | 3300025911 | Bacteria | 2060 |
| 289 | Ga0207654_10144311 | 3300025911 | Bacteria | 1522 |
| 290 | Ga0207707_10001896 | 3300025912 | Bacteria | 19043 |
| 291 | Ga0207707_10007520 | 3300025912 | Bacteria | 9493 |
| 292 | Ga0207707_10019033 | 3300025912 | Bacteria | 5990 |
| 293 | Ga0207707_10031890 | 3300025912 | Bacteria | 4613 |
| 294 | Ga0207707_10057854 | 3300025912 | Bacteria | 3374 |
| 295 | Ga0207707_10060997 | 3300025912 | Bacteria | 3281 |
| 296 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 297 | Ga0207695_10010954 | 3300025913 | Bacteria | 11028 |
| 298 | Ga0207695_10030077 | 3300025913 | Bacteria | 5985 |
| 299 | Ga0207695_10230368 | 3300025913 | Bacteria | 1757 |
| 300 | Ga0207695_10236614 | 3300025913 | Bacteria | 1729 |
| 301 | Ga0207671_10004345 | 3300025914 | Bacteria | 13605 |
| 302 | Ga0207671_10048241 | 3300025914 | Bacteria | 3152 |
| 303 | Ga0207671_10161986 | 3300025914 | Bacteria | 1733 |
| 304 | Ga0207693_10000085 | 3300025915 | Bacteria | 83879 |
| 305 | Ga0207693_10016551 | 3300025915 | Bacteria | 5892 |
| 306 | Ga0207663_10000739 | 3300025916 | Bacteria | 14580 |
| 307 | Ga0207663_10023124 | 3300025916 | Bacteria | 3562 |
| 308 | Ga0207663_10056741 | 3300025916 | Bacteria | 2465 |
| 309 | Ga0207660_10018620 | 3300025917 | Bacteria | 4633 |
| 310 | Ga0207660_10070860 | 3300025917 | Bacteria | 2535 |
| 311 | Ga0207660_10096304 | 3300025917 | Bacteria | 2203 |
| 312 | Ga0207657_10000245 | 3300025919 | Bacteria | 57819 |
| 313 | Ga0207657_10061790 | 3300025919 | Bacteria | 3210 |
| 314 | Ga0207657_10065902 | 3300025919 | Bacteria | 3085 |
| 315 | Ga0207657_10109884 | 3300025919 | Bacteria | 2278 |
| 316 | Ga0207657_10159485 | 3300025919 | Bacteria | 1833 |
| 317 | Ga0207657_10210291 | 3300025919 | Bacteria | 1561 |
| 318 | Ga0207649_10051062 | 3300025920 | Bacteria | 2560 |
| 319 | Ga0207649_10229296 | 3300025920 | Bacteria | 1327 |
| 320 | Ga0207652_10022732 | 3300025921 | Bacteria | 5192 |
| 321 | Ga0207652_10048089 | 3300025921 | Bacteria | 3645 |
| 322 | Ga0207652_10202865 | 3300025921 | Bacteria | 1785 |
| 323 | Ga0207681_10076838 | 3300025923 | Bacteria | 2346 |
| 324 | Ga0207694_10025256 | 3300025924 | Bacteria | 4515 |
| 325 | Ga0207650_10049602 | 3300025925 | Bacteria | 3100 |
| 326 | Ga0207659_10206837 | 3300025926 | Bacteria | 1571 |
| 327 | Ga0207687_10205179 | 3300025927 | Bacteria | 1543 |
| 328 | Ga0207700_10014467 | 3300025928 | Bacteria | 5170 |
| 329 | Ga0207700_10118838 | 3300025928 | Bacteria | 2140 |
| 330 | Ga0207700_10269725 | 3300025928 | Bacteria | 1460 |
| 331 | Ga0207664_10004463 | 3300025929 | Bacteria | 9478 |
| 332 | Ga0207664_10010699 | 3300025929 | Bacteria | 6487 |
| 333 | Ga0207664_10128139 | 3300025929 | Bacteria | 2133 |
| 334 | Ga0207644_10015614 | 3300025931 | Bacteria | 5100 |
| 335 | Ga0207644_10048488 | 3300025931 | Bacteria | 3037 |
| 336 | Ga0207690_10170538 | 3300025932 | Bacteria | 1630 |
| 337 | Ga0207690_10229913 | 3300025932 | Bacteria | 1423 |
| 338 | Ga0207706_10013176 | 3300025933 | Bacteria | 7524 |
| 339 | Ga0207706_10018926 | 3300025933 | Bacteria | 6192 |
| 340 | Ga0207686_10049526 | 3300025934 | Bacteria | 2608 |
| 341 | Ga0207709_10094774 | 3300025935 | Bacteria | 1960 |
| 342 | Ga0207670_10005208 | 3300025936 | Bacteria | 7112 |
| 343 | Ga0207670_10032123 | 3300025936 | Bacteria | 3373 |
| 344 | Ga0207669_10015366 | 3300025937 | Bacteria | 3859 |
| 345 | Ga0207669_10046404 | 3300025937 | Bacteria | 2567 |
| 346 | Ga0207704_10046849 | 3300025938 | Bacteria | 2580 |
| 347 | Ga0207665_10000229 | 3300025939 | Bacteria | 38095 |
| 348 | Ga0207665_10011145 | 3300025939 | Bacteria | 5899 |
| 349 | Ga0207665_10035278 | 3300025939 | Bacteria | 3319 |
| 350 | Ga0207691_10008150 | 3300025940 | Bacteria | 10057 |
| 351 | Ga0207691_10150637 | 3300025940 | Bacteria | 2045 |
| 352 | Ga0207711_10002271 | 3300025941 | Bacteria | 17262 |
| 353 | Ga0207711_10030359 | 3300025941 | Bacteria | 4558 |
| 354 | Ga0207711_10146522 | 3300025941 | Bacteria | 2128 |
| 355 | Ga0207689_10109021 | 3300025942 | Bacteria | 2275 |
| 356 | Ga0207661_10000917 | 3300025944 | Bacteria | 19380 |
| 357 | Ga0207661_10018018 | 3300025944 | Bacteria | 5242 |
| 358 | Ga0207661_10221537 | 3300025944 | Bacteria | 1672 |
| 359 | Ga0207667_10037702 | 3300025949 | Bacteria | 5166 |
| 360 | Ga0207667_10200099 | 3300025949 | Bacteria | 2049 |
| 361 | Ga0207651_10048453 | 3300025960 | Bacteria | 2872 |
| 362 | Ga0207651_10306848 | 3300025960 | Bacteria | 1322 |
| 363 | Ga0207712_10016182 | 3300025961 | Bacteria | 4823 |
| 364 | Ga0207712_10099233 | 3300025961 | Bacteria | 2162 |
| 365 | Ga0207712_10146744 | 3300025961 | Bacteria | 1817 |
| 366 | Ga0207668_10008285 | 3300025972 | Bacteria | 6194 |
| 367 | Ga0207668_10014124 | 3300025972 | Bacteria | 4938 |
| 368 | Ga0207668_10116133 | 3300025972 | Bacteria | 2017 |
| 369 | Ga0207658_10001754 | 3300025986 | Bacteria | 16311 |
| 370 | Ga0207658_10026085 | 3300025986 | Bacteria | 4095 |
| 371 | Ga0207658_10162191 | 3300025986 | Bacteria | 1833 |
| 372 | Ga0207677_10025562 | 3300026023 | Bacteria | 3686 |
| 373 | Ga0207639_10002832 | 3300026041 | Bacteria | 11633 |
| 374 | Ga0207678_10000788 | 3300026067 | Bacteria | 29001 |
| 375 | Ga0207678_10024231 | 3300026067 | Bacteria | 5301 |
| 376 | Ga0207678_10069922 | 3300026067 | Bacteria | 3010 |
| 377 | Ga0207678_10094459 | 3300026067 | Bacteria | 2555 |
| 378 | Ga0207678_10095328 | 3300026067 | Bacteria | 2543 |
| 379 | Ga0207678_10123308 | 3300026067 | Bacteria | 2211 |
| 380 | Ga0207702_10001708 | 3300026078 | Bacteria | 21655 |
| 381 | Ga0207702_10130329 | 3300026078 | Bacteria | 2262 |
| 382 | Ga0207641_10283667 | 3300026088 | Bacteria | 1559 |
| 383 | Ga0207648_10072089 | 3300026089 | Bacteria | 3010 |
| 384 | Ga0207648_10160704 | 3300026089 | Bacteria | 1984 |
| 385 | Ga0207676_10006093 | 3300026095 | Bacteria | 8509 |
| 386 | Ga0207676_10070618 | 3300026095 | Bacteria | 2801 |
| 387 | Ga0207674_10000253 | 3300026116 | Bacteria | 66599 |
| 388 | Ga0207674_10006543 | 3300026116 | Bacteria | 13703 |
| 389 | Ga0207674_10222202 | 3300026116 | Bacteria | 1837 |
| 390 | Ga0207675_100311200 | 3300026118 | Bacteria | 1536 |
| 391 | Ga0207683_10001491 | 3300026121 | Bacteria | 21111 |
| 392 | Ga0207683_10014022 | 3300026121 | Bacteria | 6833 |
| 393 | Ga0207683_10019680 | 3300026121 | Bacteria | 5768 |
| 394 | Ga0207683_10135537 | 3300026121 | Bacteria | 2216 |
| 395 | Ga0207698_10135209 | 3300026142 | Bacteria | 2114 |
| 396 | Ga0207698_10169769 | 3300026142 | Bacteria | 1919 |
| 397 | Ga0207698_10175830 | 3300026142 | Bacteria | 1890 |
| 398 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 399 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 400 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 401 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 402 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 403 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 404 | Ga0209489_101114 | 3300027361 | Bacteria | 54578 |
| 405 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 406 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 407 | Ga0209999_1018986 | 3300027543 | Bacteria | 1259 |
| 408 | Ga0209966_1002395 | 3300027695 | Bacteria | 3124 |
| 409 | Ga0209813_10036052 | 3300027866 | Bacteria | 1484 |
| 410 | Ga0207428_10143682 | 3300027907 | Bacteria | 1819 |
| 411 | Ga0268266_10001272 | 3300028379 | Bacteria | 30802 |
| 412 | Ga0268266_10045429 | 3300028379 | Bacteria | 3757 |
| 413 | Ga0268266_10113881 | 3300028379 | Bacteria | 2399 |
| 414 | Ga0268265_10033549 | 3300028380 | Bacteria | 3733 |
| 415 | Ga0268265_10071486 | 3300028380 | Bacteria | 2702 |
| 416 | Ga0268265_10365416 | 3300028380 | Bacteria | 1322 |
| 417 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 418 | Ga0268264_10145744 | 3300028381 | Bacteria | 2117 |
| 419 | Ga0268264_10499558 | 3300028381 | Bacteria | 1186 |
| 420 | Ga0265334_10059873 | 3300028573 | Bacteria | 1438 |
| 421 | Ga0265336_10001051 | 3300028666 | Bacteria | 13495 |
| 422 | Ga0307517_10001377 | 3300028786 | Bacteria | 40867 |
| 423 | Ga0307515_10000417 | 3300028794 | Bacteria | 102343 |
| 424 | Ga0307515_10000477 | 3300028794 | Bacteria | 95378 |
| 425 | Ga0307515_10071901 | 3300028794 | Bacteria | 4678 |
| 426 | Ga0307515_10093229 | 3300028794 | Bacteria | 3737 |
| 427 | Ga0265338_10004642 | 3300028800 | Bacteria | 18461 |
| 428 | Ga0265338_10010144 | 3300028800 | Bacteria | 11110 |
| 429 | Ga0265330_10040262 | 3300031235 | Bacteria | 2076 |
| 430 | Ga0265320_10001942 | 3300031240 | Bacteria | 14608 |
| 431 | Ga0265325_10000031 | 3300031241 | Bacteria | 102905 |
| 432 | Ga0265325_10044396 | 3300031241 | Bacteria | 2315 |
| 433 | Ga0265340_10062699 | 3300031247 | Bacteria | 1775 |
| 434 | Ga0265339_10037898 | 3300031249 | Bacteria | 2692 |
| 435 | Ga0265327_10002606 | 3300031251 | Bacteria | 18665 |
| 436 | Ga0265327_10013461 | 3300031251 | Bacteria | 5431 |
| 437 | Ga0265316_10121496 | 3300031344 | Bacteria | 1972 |
| 438 | Ga0307513_10022829 | 3300031456 | Bacteria | 7341 |
| 439 | Ga0307513_10046501 | 3300031456 | Bacteria | 4730 |
| 440 | Ga0307509_10156515 | 3300031507 | Bacteria | 2184 |
| 441 | Ga0307509_10171185 | 3300031507 | Bacteria | 2050 |
| 442 | Ga0307408_100047872 | 3300031548 | Bacteria | 3064 |
| 443 | Ga0265313_10013689 | 3300031595 | Bacteria | 4846 |
| 444 | Ga0307508_10000015 | 3300031616 | Bacteria | 210182 |
| 445 | Ga0265314_10002234 | 3300031711 | Bacteria | 20137 |
| 446 | Ga0265314_10002758 | 3300031711 | Bacteria | 17547 |
| 447 | Ga0265314_10013252 | 3300031711 | Bacteria | 6673 |
| 448 | Ga0265342_10024663 | 3300031712 | Bacteria | 3794 |
| 449 | Ga0307516_10002523 | 3300031730 | Bacteria | 24368 |
| 450 | Ga0307516_10004543 | 3300031730 | Bacteria | 17074 |
| 451 | Ga0307516_10010277 | 3300031730 | Bacteria | 10309 |
| 452 | Ga0307413_10042181 | 3300031824 | Bacteria | 2679 |
| 453 | Ga0307410_10070931 | 3300031852 | Bacteria | 2415 |
| 454 | Ga0307410_10106018 | 3300031852 | Bacteria | 2024 |
| 455 | Ga0307406_10045617 | 3300031901 | Bacteria | 2753 |
| 456 | Ga0307407_10049465 | 3300031903 | Bacteria | 2399 |
| 457 | Ga0307412_10061387 | 3300031911 | Bacteria | 2527 |
| 458 | Ga0307416_100070997 | 3300032002 | Bacteria | 2890 |
| 459 | Ga0307411_10057952 | 3300032005 | Bacteria | 2561 |
| 460 | Ga0316583_10005887 | 3300032133 | Bacteria | 4409 |
| 461 | Ga0307507_10034988 | 3300033179 | Bacteria | 5172 |
| 462 | Ga0307510_10007552 | 3300033180 | Bacteria | 12952 |
| 463 | Ga0307510_10010054 | 3300033180 | Bacteria | 11245 |
| 464 | Ga0307510_10148735 | 3300033180 | Bacteria | 1967 |
| 465 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 466 | Ga0373930_0013432 | 3300034816 | Bacteria | 1509 |
| 467 | Ga0373948_0011963 | 3300034817 | Bacteria | 1543 |
| 468 | Ga0373950_0017092 | 3300034818 | Bacteria | 1247 |
| 469 | Ga0373929_0028456 | 3300035085 | Bacteria | 1180 |
| 470 | Ga0373934_0029448 | 3300035086 | Bacteria | 2144 |
| 471 | Ga0373949_0008964 | 3300035090 | Bacteria | 2191 |
| 472 | Ga0373939_0007131 | 3300035114 | Bacteria | 2710 |
| 473 | Ga0373953_0003240 | 3300035117 | Bacteria | 5042 |
| 474 | Ga0373953_0026586 | 3300035117 | Bacteria | 2217 |
| 475 | Ga0373954_0000003 | 3300035118 | Bacteria | 137757 |
| 476 | Ga0373954_0002051 | 3300035118 | Bacteria | 8373 |
| 477 | Ga0373954_0014777 | 3300035118 | Bacteria | 3484 |
| 478 | Ga0373954_0110339 | 3300035118 | Bacteria | 1330 |
| 479 | Ga0373956_0019312 | 3300035119 | Bacteria | 2889 |
| 480 | Ga0373956_0034057 | 3300035119 | Bacteria | 2243 |
| 481 | Ga0373946_0009678 | 3300035171 | Bacteria | 3557 |
| 482 | Ga0373955_0008741 | 3300035172 | Bacteria | 4715 |
| 483 | Ga0373961_0005467 | 3300035241 | Bacteria | 3052 |
| 484 | Ga0373961_0021351 | 3300035241 | Bacteria | 1721 |
| 485 | Ga0373924_0011463 | 3300035410 | Bacteria | 3293 |
| 486 | Ga0373935_0002404 | 3300035692 | Bacteria | 10710 |
| 487 | Ga0373935_0047935 | 3300035692 | Bacteria | 2703 |
| 488 | Ga0373935_0125490 | 3300035692 | Bacteria | 1719 |
| 489 | Ga0373927_0000783 | 3300035695 | Bacteria | 24265 |
| 490 | Ga0373927_0004757 | 3300035695 | Bacteria | 9451 |
| 491 | Ga0373927_0020827 | 3300035695 | Bacteria | 4298 |
| 492 | Ga0373927_0050912 | 3300035695 | Bacteria | 2678 |
| 493 | Ga0373927_0157191 | 3300035695 | Bacteria | 1489 |
| 494 | Ga0373927_0170245 | 3300035695 | Bacteria | 1428 |
| 495 | Ga0373933_0011065 | 3300035724 | Bacteria | 4959 |
| 496 | Ga0373933_0019929 | 3300035724 | Bacteria | 3796 |
| 497 | Ga0373933_0043148 | 3300035724 | Bacteria | 2667 |
| 498 | Ga0373933_0085873 | 3300035724 | Bacteria | 1935 |
| 499 | Ga0373933_0110932 | 3300035724 | Bacteria | 1711 |
| 500 | Ga0373947_0002483 | 3300035725 | Bacteria | 11091 |
| 501 | Ga0373947_0005531 | 3300035725 | Bacteria | 7369 |
| 502 | Ga0373947_0049392 | 3300035725 | Bacteria | 2526 |
| 503 | Ga0373947_0174368 | 3300035725 | Bacteria | 1397 |
| 504 | Ga0373937_0000131 | 3300036401 | Bacteria | 72767 |
| 505 | Ga0373937_0116679 | 3300036401 | Bacteria | 2486 |
| 506 | Ga0373937_0262907 | 3300036401 | Bacteria | 1627 |
| 507 | Ga0372808_010978 | 3300036459 | Bacteria | 1279 |
| 508 | Ga0373925_0033388 | 3300037068 | Bacteria | 3792 |
| 509 | Ga0373925_0035982 | 3300037068 | Bacteria | 3655 |
| 510 | Ga0373925_0062989 | 3300037068 | Bacteria | 2789 |
| 511 | Ga0373925_0123348 | 3300037068 | Bacteria | 2013 |
| 512 | Ga0373925_0131653 | 3300037068 | Bacteria | 1950 |
| 513 | Ga0373925_0173635 | 3300037068 | Unclassified | 1702 |
| 514 | Ga0395899_0003168 | 3300037312 | Bacteria | 13054 |
| 515 | Ga0395899_0119155 | 3300037312 | Bacteria | 1892 |
| 516 | Ga0395900_0001070 | 3300037418 | Bacteria | 34841 |
| 517 | Ga0395900_0005737 | 3300037418 | Bacteria | 12976 |
| 518 | Ga0395900_0074549 | 3300037418 | Bacteria | 3488 |
| 519 | Ga0395900_0170764 | 3300037418 | Bacteria | 2214 |
| 520 | Ga0395898_0003538 | 3300037466 | Bacteria | 17416 |
| 521 | Ga0395898_0009135 | 3300037466 | Bacteria | 10443 |
| 522 | Ga0395898_0030821 | 3300037466 | Bacteria | 5364 |
| 523 | Ga0395898_0030823 | 3300037466 | Bacteria | 5364 |
| 524 | Ga0395898_0066901 | 3300037466 | Bacteria | 3480 |
| 525 | Ga0395898_0170035 | 3300037466 | Bacteria | 2083 |
| 526 | Ga0395898_0367021 | 3300037466 | Bacteria | 1373 |
| 527 | Ga0395905_0009454 | 3300037471 | Bacteria | 9525 |
| 528 | Ga0395905_0154216 | 3300037471 | Bacteria | 2160 |
| 529 | Ga0395905_0167690 | 3300037471 | Bacteria | 2063 |
| 530 | Ga0395905_0465460 | 3300037471 | Bacteria | 1163 |
| 531 | Ga0436364_1166954 | 3300037853 | Bacteria | 5572 |
| 532 | Ga0436364_1341441 | 3300037853 | Bacteria | 2709 |
| 533 | Ga0395901_0037136 | 3300038443 | Bacteria | 5039 |
| 534 | Ga0395901_0046711 | 3300038443 | Bacteria | 4498 |
| 535 | Ga0395901_0059645 | 3300038443 | Bacteria | 3970 |
| 536 | Ga0395901_0122876 | 3300038443 | Bacteria | 2728 |
| 537 | Ga0395901_0182148 | 3300038443 | Bacteria | 2203 |
| 538 | Ga0395901_0239195 | 3300038443 | Bacteria | 1894 |
| 539 | Ga0395901_0392404 | 3300038443 | Bacteria | 1427 |
| 540 | Ga0436365_0052183 | 3300039437 | Bacteria | 13005 |
| 541 | Ga0436365_0828830 | 3300039437 | Bacteria | 2326 |
| 542 | Ga0436365_0873719 | 3300039437 | Bacteria | 4710 |
| 543 | Ga0436365_1136356 | 3300039437 | Bacteria | 11455 |
| 544 | Ga0436363_1246162 | 3300039450 | Bacteria | 2496 |
| 545 | Ga0439453_0005883 | 3300041408 | Bacteria | 1889 |
| 546 | Ga0439446_0034412 | 3300042156 | Bacteria | 1474 |
| 547 | Ga0439458_0005150 | 3300042157 | Bacteria | 2947 |
| 548 | Ga0451577_0166812 | 3300042876 | Bacteria | 1984 |
| 549 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 550 | Ga0466972_0008577 | 3300044658 | Bacteria | 5129 |
| 551 | Ga0466966_0000094 | 3300044684 | Bacteria | 54427 |
| 552 | Ga0466961_0000118 | 3300044693 | Bacteria | 52882 |
| 553 | Ga0466963_0026149 | 3300044694 | Bacteria | 3731 |
| 554 | Ga0466963_0028581 | 3300044694 | Bacteria | 3582 |
| 555 | Ga0466963_0053875 | 3300044694 | Bacteria | 2672 |
| 556 | Ga0466970_0031842 | 3300044765 | Bacteria | 2786 |
| 557 | Ga0466957_0006157 | 3300044842 | Bacteria | 6773 |
| 558 | Ga0466960_0120251 | 3300044901 | Bacteria | 1375 |
| 559 | Ga0466959_0065076 | 3300045049 | Bacteria | 2646 |
| 560 | Ga0466959_0113703 | 3300045049 | Bacteria | 1930 |
| 561 | Ga0466958_0006856 | 3300045836 | Bacteria | 6227 |
| 562 | Ga0466958_0026812 | 3300045836 | Bacteria | 3406 |
| 563 | Ga0466967_0263578 | 3300045976 | Bacteria | 1649 |
| 564 | Ga0495617_011415 | 3300046452 | Bacteria | 3030 |
| 565 | Ga0495627_034423 | 3300046453 | Bacteria | 1583 |
| 566 | Ga0495592_0025176 | 3300046454 | Bacteria | 4518 |
| 567 | Ga0495592_0037086 | 3300046454 | Bacteria | 3670 |
| 568 | Ga0495592_0045952 | 3300046454 | Bacteria | 3256 |
| 569 | Ga0495592_0046108 | 3300046454 | Bacteria | 3250 |
| 570 | Ga0495603_0001681 | 3300046455 | Bacteria | 13000 |
| 571 | Ga0495603_0002554 | 3300046455 | Bacteria | 10727 |
| 572 | Ga0495603_0131829 | 3300046455 | Bacteria | 1455 |
| 573 | Ga0495629_0000077 | 3300046459 | Bacteria | 85931 |
| 574 | Ga0495629_0000165 | 3300046459 | Bacteria | 58366 |
| 575 | Ga0495629_0033399 | 3300046459 | Bacteria | 3639 |
| 576 | Ga0495638_0018892 | 3300046460 | Bacteria | 4568 |
| 577 | Ga0495638_0045820 | 3300046460 | Bacteria | 2750 |
| 578 | Ga0495638_0050514 | 3300046460 | Bacteria | 2596 |
| 579 | Ga0495641_0000929 | 3300046461 | Bacteria | 24998 |
| 580 | Ga0495641_0024336 | 3300046461 | Bacteria | 2991 |
| 581 | Ga0495651_0009827 | 3300046462 | Bacteria | 7354 |
| 582 | Ga0495651_0045132 | 3300046462 | Bacteria | 3414 |
| 583 | Ga0495651_0106556 | 3300046462 | Bacteria | 2077 |
| 584 | Ga0495651_0135609 | 3300046462 | Bacteria | 1791 |
| 585 | Ga0495653_0002848 | 3300046463 | Bacteria | 13821 |
| 586 | Ga0495653_0018166 | 3300046463 | Bacteria | 5715 |
| 587 | Ga0495580_0000913 | 3300046472 | Bacteria | 25774 |
| 588 | Ga0495580_0093205 | 3300046472 | Bacteria | 2096 |
| 589 | Ga0495580_0102210 | 3300046472 | Bacteria | 1993 |
| 590 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 591 | Ga0495582_0018865 | 3300046473 | Bacteria | 3772 |
| 592 | Ga0495582_0020941 | 3300046473 | Bacteria | 3581 |
| 593 | Ga0495639_0000014 | 3300046475 | Bacteria | 82866 |
| 594 | Ga0495639_0019480 | 3300046475 | Bacteria | 2963 |
| 595 | Ga0495662_0000086 | 3300046476 | Bacteria | 33465 |
| 596 | Ga0495662_0032757 | 3300046476 | Bacteria | 2511 |
| 597 | Ga0495662_0071470 | 3300046476 | Bacteria | 1681 |
| 598 | Ga0495664_0008014 | 3300046477 | Bacteria | 5882 |
| 599 | Ga0495664_0100608 | 3300046477 | Bacteria | 1741 |
| 600 | Ga0495664_0180595 | 3300046477 | Bacteria | 1280 |
| 601 | Ga0495585_0021846 | 3300046492 | Bacteria | 3674 |
| 602 | Ga0495594_0000420 | 3300046499 | Bacteria | 21403 |
| 603 | Ga0495594_0046653 | 3300046499 | Bacteria | 2379 |
| 604 | Ga0495607_0140319 | 3300046501 | Bacteria | 1247 |
| 605 | Ga0495606_0000196 | 3300046507 | Bacteria | 105765 |
| 606 | Ga0495606_0030531 | 3300046507 | Bacteria | 3765 |
| 607 | Ga0495606_0033015 | 3300046507 | Bacteria | 3576 |
| 608 | Ga0495608_0037100 | 3300046511 | Bacteria | 3278 |
| 609 | Ga0495610_0031313 | 3300046512 | Bacteria | 2776 |
| 610 | Ga0495610_0042674 | 3300046512 | Bacteria | 2266 |
| 611 | Ga0495616_0048545 | 3300046513 | Bacteria | 2132 |
| 612 | Ga0495616_0052358 | 3300046513 | Bacteria | 2033 |
| 613 | Ga0495616_0083181 | 3300046513 | Bacteria | 1527 |
| 614 | Ga0495618_0024388 | 3300046514 | Bacteria | 3745 |
| 615 | Ga0495628_0027342 | 3300046516 | Bacteria | 4642 |
| 616 | Ga0495628_0048184 | 3300046516 | Bacteria | 3378 |
| 617 | Ga0495628_0079685 | 3300046516 | Bacteria | 2546 |
| 618 | Ga0495630_0003176 | 3300046517 | Bacteria | 11417 |
| 619 | Ga0495630_0034979 | 3300046517 | Bacteria | 3753 |
| 620 | Ga0495630_0117521 | 3300046517 | Bacteria | 2016 |
| 621 | Ga0495631_0017160 | 3300046518 | Bacteria | 3431 |
| 622 | Ga0495632_0034239 | 3300046519 | Bacteria | 2601 |
| 623 | Ga0495643_0040171 | 3300046522 | Bacteria | 2555 |
| 624 | Ga0495648_0011613 | 3300046524 | Bacteria | 6620 |
| 625 | Ga0495648_0030140 | 3300046524 | Bacteria | 3592 |
| 626 | Ga0495652_0004103 | 3300046529 | Bacteria | 14051 |
| 627 | Ga0495652_0028184 | 3300046529 | Bacteria | 4945 |
| 628 | Ga0495652_0032661 | 3300046529 | Bacteria | 4550 |
| 629 | Ga0495652_0070350 | 3300046529 | Bacteria | 2925 |
| 630 | Ga0495652_0082876 | 3300046529 | Bacteria | 2641 |
| 631 | Ga0495654_0008669 | 3300046530 | Bacteria | 5605 |
| 632 | Ga0495665_0000665 | 3300046531 | Bacteria | 17688 |
| 633 | Ga0495640_0007412 | 3300046533 | Bacteria | 8626 |
| 634 | Ga0495640_0008807 | 3300046533 | Bacteria | 7893 |
| 635 | Ga0495640_0013123 | 3300046533 | Bacteria | 6306 |
| 636 | Ga0495640_0047285 | 3300046533 | Bacteria | 2978 |
| 637 | Ga0495640_0085945 | 3300046533 | Bacteria | 2083 |
| 638 | Ga0495640_0130271 | 3300046533 | Bacteria | 1628 |
| 639 | Ga0495587_0004996 | 3300046536 | Bacteria | 8684 |
| 640 | Ga0495645_0018393 | 3300046543 | Bacteria | 5017 |
| 641 | Ga0495645_0100232 | 3300046543 | Bacteria | 2060 |
| 642 | Ga0495622_0005435 | 3300046557 | Bacteria | 5912 |
| 643 | Ga0495622_0048603 | 3300046557 | Bacteria | 1971 |
| 644 | Ga0495622_0048651 | 3300046557 | Bacteria | 1969 |
| 645 | Ga0495622_0056184 | 3300046557 | Bacteria | 1825 |
| 646 | Ga0495622_0081871 | 3300046557 | Bacteria | 1485 |
| 647 | Ga0495667_0007840 | 3300046559 | Bacteria | 7236 |
| 648 | Ga0495667_0039628 | 3300046559 | Bacteria | 3132 |
| 649 | Ga0495667_0064174 | 3300046559 | Bacteria | 2402 |
| 650 | Ga0495656_0002336 | 3300046615 | Bacteria | 6275 |
| 651 | Ga0495656_0025305 | 3300046615 | Bacteria | 2352 |
| 652 | Ga0495668_0041374 | 3300046616 | Bacteria | 2567 |
| 653 | Ga0495668_0078731 | 3300046616 | Bacteria | 1809 |
| 654 | Ga0495634_0000859 | 3300046642 | Bacteria | 29254 |
| 655 | Ga0495634_0114515 | 3300046642 | Bacteria | 1731 |
| 656 | Ga0495625_0106401 | 3300046660 | Bacteria | 1921 |
| 657 | Ga0495625_0219120 | 3300046660 | Bacteria | 1248 |
| 658 | Ga0495635_0000160 | 3300046663 | Bacteria | 41557 |
| 659 | Ga0495635_0010832 | 3300046663 | Bacteria | 6389 |
| 660 | Ga0495635_0082903 | 3300046663 | Bacteria | 2194 |
| 661 | Ga0495635_0090783 | 3300046663 | Bacteria | 2089 |
| 662 | Ga0495661_0055948 | 3300046665 | Bacteria | 2362 |
| 663 | Ga0495588_0073067 | 3300046674 | Bacteria | 1785 |
| 664 | Ga0495657_0001362 | 3300046675 | Bacteria | 21216 |
| 665 | Ga0495657_0005563 | 3300046675 | Bacteria | 9946 |
| 666 | Ga0495657_0030874 | 3300046675 | Bacteria | 3749 |
| 667 | Ga0495599_0002061 | 3300046678 | Bacteria | 11651 |
| 668 | Ga0495599_0031531 | 3300046678 | Bacteria | 3326 |
| 669 | Ga0495623_0001444 | 3300046679 | Bacteria | 16112 |
| 670 | Ga0495623_0014196 | 3300046679 | Bacteria | 5159 |
| 671 | Ga0495623_0079339 | 3300046679 | Bacteria | 2034 |
| 672 | Ga0495646_0004949 | 3300046680 | Bacteria | 8413 |
| 673 | Ga0495646_0040336 | 3300046680 | Bacteria | 2876 |
| 674 | Ga0495646_0046774 | 3300046680 | Bacteria | 2636 |
| 675 | Ga0495647_0010678 | 3300046681 | Bacteria | 3131 |
| 676 | Ga0495658_0001756 | 3300046683 | Bacteria | 11202 |
| 677 | Ga0495658_0097814 | 3300046683 | Bacteria | 1747 |
| 678 | Ga0495669_0001159 | 3300046684 | Bacteria | 10954 |
| 679 | Ga0495624_0000138 | 3300046690 | Bacteria | 52220 |
| 680 | Ga0495624_0015049 | 3300046690 | Bacteria | 5237 |
| 681 | Ga0495624_0112777 | 3300046690 | Bacteria | 1671 |
| 682 | Ga0495624_0124961 | 3300046690 | Bacteria | 1579 |
| 683 | Ga0495624_0135809 | 3300046690 | Bacteria | 1508 |
| 684 | Ga0495670_0081736 | 3300046691 | Bacteria | 1646 |
| 685 | Ga0495671_0070797 | 3300046692 | Bacteria | 1713 |
| 686 | Ga0495649_0105837 | 3300046694 | Bacteria | 1493 |
| 687 | Ga0495600_0003305 | 3300046809 | Bacteria | 9460 |
| 688 | Ga0495600_0005469 | 3300046809 | Bacteria | 7659 |
| 689 | Ga0495600_0005851 | 3300046809 | Bacteria | 7437 |
| 690 | Ga0495581_0000001 | 3300047315 | Bacteria | 104278 |
| 691 | Ga0495581_0040728 | 3300047315 | Bacteria | 2687 |
| 692 | Ga0495604_0001234 | 3300047317 | Bacteria | 20953 |
| 693 | Ga0495604_0005301 | 3300047317 | Bacteria | 10230 |
| 694 | Ga0495604_0006543 | 3300047317 | Bacteria | 9235 |
| 695 | Ga0495604_0039854 | 3300047317 | Bacteria | 3690 |
| 696 | Ga0495604_0071998 | 3300047317 | Bacteria | 2613 |
| 697 | Ga0495674_0002545 | 3300047319 | Bacteria | 17760 |
| 698 | Ga0495674_0008583 | 3300047319 | Bacteria | 9724 |
| 699 | Ga0495674_0020945 | 3300047319 | Bacteria | 6050 |
| 700 | Ga0495674_0027892 | 3300047319 | Bacteria | 5156 |
| 701 | Ga0495674_0052039 | 3300047319 | Bacteria | 3606 |
| 702 | Ga0495674_0119699 | 3300047319 | Bacteria | 2225 |
| 703 | Ga0495672_0073357 | 3300047320 | Bacteria | 1930 |
| 704 | Ga0495672_0104025 | 3300047320 | Bacteria | 1535 |
| 705 | Ga0495676_0032214 | 3300047321 | Bacteria | 4428 |
| 706 | Ga0495680_0003866 | 3300047322 | Bacteria | 14497 |
| 707 | Ga0495680_0012183 | 3300047322 | Bacteria | 7585 |
| 708 | Ga0495683_0050327 | 3300047323 | Bacteria | 2085 |
| 709 | Ga0495687_055047 | 3300047443 | Bacteria | 1665 |
| 710 | Ga0495675_0000579 | 3300047444 | Bacteria | 23601 |
| 711 | Ga0495675_0002075 | 3300047444 | Bacteria | 11965 |
| 712 | Ga0495675_0002727 | 3300047444 | Bacteria | 10591 |
| 713 | Ga0495675_0161884 | 3300047444 | Bacteria | 1377 |
| 714 | Ga0495677_0024754 | 3300047445 | Bacteria | 2178 |
| 715 | Ga0495673_0021201 | 3300047469 | Bacteria | 3215 |
| 716 | Ga0495673_0036636 | 3300047469 | Bacteria | 2247 |
| 717 | Ga0495684_0001407 | 3300047471 | Bacteria | 19272 |
| 718 | Ga0495684_0015407 | 3300047471 | Bacteria | 5884 |
| 719 | Ga0495684_0095266 | 3300047471 | Bacteria | 2253 |
| 720 | Ga0495684_0198589 | 3300047471 | Bacteria | 1479 |
| 721 | Ga0495686_0093016 | 3300047472 | Bacteria | 1828 |
| 722 | Ga0495593_0021689 | 3300047673 | Bacteria | 3584 |
| 723 | Ga0495593_0044214 | 3300047673 | Bacteria | 2383 |
| 724 | Ga0495593_0081635 | 3300047673 | Bacteria | 1671 |
| 725 | Ga0495602_0073830 | 3300048088 | Bacteria | 2901 |
| 726 | Ga0495602_0115391 | 3300048088 | Bacteria | 2172 |
| 727 | Ga0495602_0135074 | 3300048088 | Bacteria | 1961 |
| 728 | Ga0495614_0081336 | 3300048089 | Bacteria | 1403 |
| 729 | Ga0496100_0138796 | 3300048903 | Bacteria | 1720 |
| 730 | Ga0496101_0024277 | 3300048904 | Bacteria | 4194 |
| 731 | Ga0496101_0081094 | 3300048904 | Bacteria | 2399 |
| 732 | Ga0496102_0004364 | 3300048905 | Bacteria | 11951 |
| 733 | Ga0496102_0026902 | 3300048905 | Bacteria | 5135 |
| 734 | Ga0496102_0126693 | 3300048905 | Bacteria | 2387 |
| 735 | Ga0496102_0183178 | 3300048905 | Bacteria | 1973 |
| 736 | Ga0496103_0030153 | 3300048906 | Bacteria | 3299 |
| 737 | Ga0496104_0023586 | 3300048907 | Bacteria | 5657 |
| 738 | Ga0496104_0291444 | 3300048907 | Bacteria | 1544 |
| 739 | Ga0496105_0004690 | 3300048908 | Bacteria | 10303 |
| 740 | Ga0496105_0021651 | 3300048908 | Bacteria | 5202 |
| 741 | Ga0496105_0026924 | 3300048908 | Bacteria | 4692 |
| 742 | Ga0496106_0005916 | 3300048909 | Bacteria | 9043 |
| 743 | Ga0496106_0027070 | 3300048909 | Bacteria | 4269 |
| 744 | Ga0496106_0228735 | 3300048909 | Bacteria | 1484 |
| 745 | Ga0496106_0346451 | 3300048909 | Bacteria | 1193 |
| 746 | Ga0496107_0048041 | 3300048910 | Bacteria | 3073 |
| 747 | Ga0496107_0108444 | 3300048910 | Bacteria | 2039 |
| 748 | Ga0496107_0114635 | 3300048910 | Bacteria | 1983 |
| 749 | Ga0496108_0023518 | 3300048911 | Bacteria | 5071 |
| 750 | Ga0496108_0066473 | 3300048911 | Bacteria | 3040 |
| 751 | Ga0496108_0136458 | 3300048911 | Bacteria | 2111 |
| 752 | Ga0496109_0005410 | 3300048912 | Bacteria | 10678 |
| 753 | Ga0496109_0012331 | 3300048912 | Bacteria | 7379 |
| 754 | Ga0496109_0020991 | 3300048912 | Bacteria | 5774 |
| 755 | Ga0496109_0104237 | 3300048912 | Bacteria | 2633 |
| 756 | Ga0496109_0221039 | 3300048912 | Bacteria | 1781 |
| 757 | Ga0496110_0029267 | 3300048913 | Bacteria | 4739 |
| 758 | Ga0496110_0031172 | 3300048913 | Bacteria | 4599 |
| 759 | Ga0496110_0043984 | 3300048913 | Bacteria | 3899 |
| 760 | Ga0496110_0087682 | 3300048913 | Bacteria | 2779 |
| 761 | Ga0496110_0089255 | 3300048913 | Bacteria | 2755 |
| 762 | Ga0496110_0327100 | 3300048913 | Bacteria | 1396 |
| 763 | Ga0496110_0338654 | 3300048913 | Bacteria | 1370 |
| 764 | Ga0496111_0028518 | 3300048914 | Bacteria | 3956 |
| 765 | Ga0496111_0040389 | 3300048914 | Bacteria | 3347 |
| 766 | Ga0496111_0042641 | 3300048914 | Bacteria | 3259 |
| 767 | Ga0496111_0132461 | 3300048914 | Bacteria | 1845 |
| 768 | Ga0496111_0196314 | 3300048914 | Bacteria | 1500 |
| 769 | Ga0496111_0254972 | 3300048914 | Bacteria | 1302 |
| 770 | Ga0496112_0000044 | 3300048915 | Bacteria | 86865 |
| 771 | Ga0496112_0000342 | 3300048915 | Bacteria | 30306 |
| 772 | Ga0496112_0014805 | 3300048915 | Bacteria | 7253 |
| 773 | Ga0496112_0018318 | 3300048915 | Bacteria | 6592 |
| 774 | Ga0496112_0021871 | 3300048915 | Bacteria | 6086 |
| 775 | Ga0496112_0093681 | 3300048915 | Bacteria | 2974 |
| 776 | Ga0496112_0255827 | 3300048915 | Bacteria | 1701 |
| 777 | Ga0496112_0271698 | 3300048915 | Bacteria | 1643 |
| 778 | Ga0496112_0323815 | 3300048915 | Bacteria | 1485 |
| 779 | Ga0496113_0005475 | 3300048916 | Bacteria | 7920 |
| 780 | Ga0496113_0015669 | 3300048916 | Bacteria | 5219 |
| 781 | Ga0496113_0029593 | 3300048916 | Bacteria | 3957 |
| 782 | Ga0496113_0085949 | 3300048916 | Bacteria | 2416 |
| 783 | Ga0496114_0017464 | 3300048917 | Bacteria | 5790 |
| 784 | Ga0496114_0051070 | 3300048917 | Bacteria | 3442 |
| 785 | Ga0496114_0144403 | 3300048917 | Bacteria | 2062 |
| 786 | Ga0496114_0198310 | 3300048917 | Bacteria | 1757 |
| 787 | Ga0496115_0000619 | 3300048918 | Bacteria | 26938 |
| 788 | Ga0496115_0002089 | 3300048918 | Bacteria | 14308 |
| 789 | Ga0496115_0012493 | 3300048918 | Bacteria | 6393 |
| 790 | Ga0496115_0025238 | 3300048918 | Bacteria | 4626 |
| 791 | Ga0496115_0089498 | 3300048918 | Bacteria | 2514 |
| 792 | Ga0496115_0110379 | 3300048918 | Bacteria | 2259 |
| 793 | Ga0496115_0139608 | 3300048918 | Bacteria | 1999 |
| 794 | Ga0496117_0010855 | 3300048920 | Bacteria | 8216 |
| 795 | Ga0496117_0022245 | 3300048920 | Bacteria | 5090 |
| 796 | Ga0496117_0061701 | 3300048920 | Bacteria | 2575 |
| 797 | Ga0496118_0006532 | 3300048921 | Bacteria | 12757 |
| 798 | Ga0496118_0020316 | 3300048921 | Bacteria | 5893 |
| 799 | Ga0496119_0019407 | 3300048922 | Bacteria | 5009 |
| 800 | Ga0496119_0073072 | 3300048922 | Bacteria | 2001 |
| 801 | Ga0496119_0083148 | 3300048922 | Bacteria | 1839 |
| 802 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 803 | Ga0496121_0001183 | 3300048924 | Bacteria | 45653 |
| 804 | Ga0496121_0001244 | 3300048924 | Bacteria | 44194 |
| 805 | Ga0496121_0003563 | 3300048924 | Bacteria | 22031 |
| 806 | Ga0496121_0012601 | 3300048924 | Bacteria | 9188 |
| 807 | Ga0496121_0023065 | 3300048924 | Bacteria | 6012 |
| 808 | Ga0496121_0026867 | 3300048924 | Bacteria | 5406 |
| 809 | Ga0496121_0057954 | 3300048924 | Bacteria | 3206 |
| 810 | Ga0496121_0063495 | 3300048924 | Bacteria | 3017 |
| 811 | Ga0496121_0073802 | 3300048924 | Bacteria | 2732 |
| 812 | Ga0496121_0106593 | 3300048924 | Bacteria | 2148 |
| 813 | Ga0496121_0147697 | 3300048924 | Bacteria | 1734 |
| 814 | Ga0496122_0029843 | 3300048925 | Bacteria | 4586 |
| 815 | Ga0496122_0115546 | 3300048925 | Bacteria | 1747 |
| 816 | Ga0496123_0037136 | 3300048926 | Bacteria | 3444 |
| 817 | Ga0496124_0000624 | 3300048927 | Bacteria | 58976 |
| 818 | Ga0496125_0000504 | 3300048928 | Bacteria | 67902 |
| 819 | Ga0496125_0000712 | 3300048928 | Bacteria | 54983 |
| 820 | Ga0496125_0009811 | 3300048928 | Bacteria | 9757 |
| 821 | Ga0496125_0051838 | 3300048928 | Bacteria | 3380 |
| 822 | Ga0496126_0001799 | 3300048929 | Bacteria | 31424 |
| 823 | Ga0496126_0007021 | 3300048929 | Bacteria | 12429 |
| 824 | Ga0496126_0008123 | 3300048929 | Bacteria | 11360 |
| 825 | Ga0496126_0008842 | 3300048929 | Bacteria | 10799 |
| 826 | Ga0496126_0010850 | 3300048929 | Bacteria | 9499 |
| 827 | Ga0496126_0011784 | 3300048929 | Bacteria | 9001 |
| 828 | Ga0496126_0020974 | 3300048929 | Bacteria | 6394 |
| 829 | Ga0496126_0031915 | 3300048929 | Bacteria | 4969 |
| 830 | Ga0496126_0049331 | 3300048929 | Bacteria | 3844 |
| 831 | Ga0496126_0134140 | 3300048929 | Bacteria | 2137 |
| 832 | Ga0496126_0145793 | 3300048929 | Bacteria | 2033 |
| 833 | Ga0496126_0148587 | 3300048929 | Bacteria | 2010 |
| 834 | Ga0501031_0000657 | 3300049568 | Bacteria | 20491 |
| 835 | Ga0501031_0006130 | 3300049568 | Bacteria | 7848 |
| 836 | Ga0501032_0000198 | 3300049569 | Bacteria | 50120 |
| 837 | Ga0501032_0001779 | 3300049569 | Bacteria | 17008 |
| 838 | Ga0501033_0000091 | 3300049570 | Bacteria | 85666 |
| 839 | Ga0501033_0001037 | 3300049570 | Bacteria | 25294 |
| 840 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 841 | Ga0501034_0007438 | 3300049571 | Bacteria | 11658 |
| 842 | Ga0501034_0008754 | 3300049571 | Bacteria | 10652 |
| 843 | Ga0501034_0095199 | 3300049571 | Bacteria | 2975 |
| 844 | Ga0501036_0000134 | 3300049572 | Bacteria | 47683 |
| 845 | Ga0501036_0000347 | 3300049572 | Bacteria | 32588 |
| 846 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 847 | Ga0501037_0004145 | 3300049573 | Bacteria | 10513 |
| 848 | Ga0501038_0000929 | 3300049574 | Bacteria | 26055 |
| 849 | Ga0501038_0002497 | 3300049574 | Bacteria | 17114 |
| 850 | Ga0501039_0000550 | 3300049575 | Bacteria | 27148 |
| 851 | Ga0501039_0005656 | 3300049575 | Bacteria | 9465 |
| 852 | Ga0501042_0028182 | 3300049578 | Bacteria | 3954 |
| 853 | Ga0501043_0000233 | 3300049579 | Bacteria | 50329 |
| 854 | Ga0501043_0021633 | 3300049579 | Bacteria | 5042 |
| 855 | Ga0501046_0000995 | 3300049580 | Bacteria | 27709 |
| 856 | Ga0501046_0058683 | 3300049580 | Bacteria | 3016 |
| 857 | Ga0501046_0088815 | 3300049580 | Bacteria | 2380 |
| 858 | Ga0501047_0004251 | 3300049581 | Bacteria | 13481 |
| 859 | Ga0501047_0045211 | 3300049581 | Bacteria | 4257 |
| 860 | Ga0501048_0000218 | 3300049582 | Bacteria | 37734 |
| 861 | Ga0501048_0178806 | 3300049582 | Bacteria | 1504 |
| 862 | Ga0501067_0000973 | 3300049583 | Bacteria | 15393 |
| 863 | Ga0501067_0029581 | 3300049583 | Bacteria | 3036 |
| 864 | Ga0501068_0000785 | 3300049584 | Bacteria | 16408 |
| 865 | Ga0501068_0165689 | 3300049584 | Bacteria | 1394 |
| 866 | Ga0501069_0015183 | 3300049585 | Bacteria | 4127 |
| 867 | Ga0501069_0019027 | 3300049585 | Bacteria | 3710 |
| 868 | Ga0501070_0002981 | 3300049586 | Bacteria | 14743 |
| 869 | Ga0501070_0026807 | 3300049586 | Bacteria | 4833 |
| 870 | Ga0501070_0174986 | 3300049586 | Bacteria | 1767 |
| 871 | Ga0501071_0056067 | 3300049587 | Bacteria | 2846 |
| 872 | Ga0501072_0007128 | 3300049588 | Bacteria | 8484 |
| 873 | Ga0501072_0050543 | 3300049588 | Bacteria | 3273 |
| 874 | Ga0501072_0101782 | 3300049588 | Bacteria | 2283 |
| 875 | Ga0501072_0113554 | 3300049588 | Bacteria | 2157 |
| 876 | Ga0501073_0000118 | 3300049589 | Bacteria | 50886 |
| 877 | Ga0501074_0000724 | 3300049590 | Bacteria | 20696 |
| 878 | Ga0501076_0046016 | 3300049592 | Bacteria | 3447 |
| 879 | Ga0501079_0000590 | 3300049741 | Bacteria | 24020 |
| 880 | Ga0501080_0000124 | 3300049742 | Bacteria | 54519 |
| 881 | Ga0501080_0023280 | 3300049742 | Bacteria | 5743 |
| 882 | Ga0501080_0114361 | 3300049742 | Bacteria | 2502 |
| 883 | Ga0501080_0350293 | 3300049742 | Bacteria | 1334 |
| 884 | Ga0501083_0000184 | 3300049744 | Bacteria | 40201 |
| 885 | Ga0501262_004277 | 3300049759 | Bacteria | 1656 |
| 886 | Ga0501265_001763 | 3300049762 | Bacteria | 2458 |
| 887 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 888 | Ga0501035_0008174 | 3300049822 | Bacteria | 9749 |
| 889 | Ga0501044_0001974 | 3300049823 | Bacteria | 23731 |
| 890 | Ga0501044_0005964 | 3300049823 | Bacteria | 13483 |
| 891 | Ga0501045_0009338 | 3300049824 | Bacteria | 6856 |
| 892 | nmdc:mga03683_103077_c1 | 3300050489 | Bacteria | 1255 |
| 893 | nmdc:mga03683_37826_c1 | 3300050489 | Bacteria | 1968 |
| 894 | nmdc:mga03683_52171_c1 | 3300050489 | Bacteria | 1709 |
| 895 | nmdc:mga03n38_11303_c1 | 3300050490 | Bacteria | 3320 |
| 896 | nmdc:mga03n38_421_c1 | 3300050490 | Bacteria | 10501 |
| 897 | nmdc:mga03n38_58325_c1 | 3300050490 | Bacteria | 1749 |
| 898 | nmdc:mga00v17_20073_c1 | 3300050491 | Bacteria | 3824 |
| 899 | nmdc:mga00v17_21986_c1 | 3300050491 | Bacteria | 3676 |
| 900 | nmdc:mga00v17_39489_c1 | 3300050491 | Bacteria | 2827 |
| 901 | nmdc:mga00v17_54704_c1 | 3300050491 | Bacteria | 2435 |
| 902 | nmdc:mga00v17_71107_c1 | 3300050491 | Bacteria | 2156 |
| 903 | nmdc:mga0k408_173388_c1 | 3300050493 | Bacteria | 1286 |
| 904 | nmdc:mga0k408_8907_c1 | 3300050493 | Bacteria | 5400 |
| 905 | nmdc:mga06z11_138917_c1 | 3300050494 | Bacteria | 1372 |
| 906 | nmdc:mga06z11_1539_c1 | 3300050494 | Bacteria | 8561 |
| 907 | nmdc:mga06z11_15566_c1 | 3300050494 | Bacteria | 3398 |
| 908 | nmdc:mga06z11_26257_c1 | 3300050494 | Bacteria | 2770 |
| 909 | nmdc:mga06z11_27713_c1 | 3300050494 | Bacteria | 2710 |
| 910 | nmdc:mga06z11_3403_c1 | 3300050494 | Bacteria | 6146 |
| 911 | nmdc:mga06z11_9669_c1 | 3300050494 | Bacteria | 4073 |
| 912 | nmdc:mga06z11_99692_c1 | 3300050494 | Bacteria | 1592 |
| 913 | nmdc:mga04h51_43205_c1 | 3300050495 | Bacteria | 1482 |
| 914 | nmdc:mga04h51_46672_c1 | 3300050495 | Bacteria | 1437 |
| 915 | nmdc:mga04h51_54831_c1 | 3300050495 | Bacteria | 1349 |
| 916 | nmdc:mga07m45_104020_c1 | 3300050496 | Bacteria | 1632 |
| 917 | nmdc:mga07m45_19907_c1 | 3300050496 | Bacteria | 3641 |
| 918 | nmdc:mga07m45_50561_c1 | 3300050496 | Bacteria | 2342 |
| 919 | nmdc:mga07m45_92466_c1 | 3300050496 | Bacteria | 1734 |
| 920 | nmdc:mga05p37_88061_c1 | 3300050507 | Bacteria | 3827 |
| 921 | nmdc:mga09592_238708_c1 | 3300050508 | Bacteria | 1575 |
| 922 | nmdc:mga06r32_14185_c1 | 3300050510 | Bacteria | 7228 |
| 923 | nmdc:mga06r32_158105_c1 | 3300050510 | Bacteria | 2248 |
| 924 | nmdc:mga08y16_101861_c1 | 3300050511 | Bacteria | 2989 |
| 925 | nmdc:mga08y16_136369_c1 | 3300050511 | Bacteria | 2551 |
| 926 | nmdc:mga08y16_335756_c1 | 3300050511 | Bacteria | 1554 |
| 927 | nmdc:mga08y16_90800_c1 | 3300050511 | Bacteria | 3184 |
| 928 | nmdc:mga0n895_169243_c1 | 3300050512 | Bacteria | 2217 |
| 929 | nmdc:mga0rr50_53185_c1 | 3300050513 | Bacteria | 3012 |
| 930 | nmdc:mga0a205_121136_c1 | 3300050515 | Bacteria | 2515 |
| 931 | nmdc:mga0sz30_892_c1 | 3300050516 | Bacteria | 10764 |
| 932 | Ga0495601_0051532 | 3300053077 | Bacteria | 2598 |
| 933 | Ga0495601_0058890 | 3300053077 | Bacteria | 2435 |
| 934 | Ga0495612_0004090 | 3300053078 | Bacteria | 6044 |
| 935 | Ga0495612_0059233 | 3300053078 | Bacteria | 1583 |
| 936 | Ga0495595_0000314 | 3300053084 | Bacteria | 18872 |
| 937 | Ga0495619_0001159 | 3300053085 | Bacteria | 17308 |
| 938 | Ga0495619_0010035 | 3300053085 | Bacteria | 5960 |
| 939 | Ga0495619_0012831 | 3300053085 | Bacteria | 5277 |
| 940 | Ga0495619_0045760 | 3300053085 | Bacteria | 2875 |
| 941 | Ga0500643_001368 | 3300053087 | Bacteria | 14139 |
| 942 | Ga0500643_004397 | 3300053087 | Bacteria | 6392 |
| 943 | Ga0500651_0001603 | 3300053093 | Bacteria | 11492 |
| 944 | Ga0500651_0029129 | 3300053093 | Bacteria | 3470 |
| 945 | Ga0500651_0042209 | 3300053093 | Bacteria | 2874 |
| 946 | Ga0500651_0052622 | 3300053093 | Bacteria | 2553 |
| 947 | Ga0500566_0000112 | 3300053094 | Bacteria | 41687 |
| 948 | Ga0500566_0000977 | 3300053094 | Bacteria | 16463 |
| 949 | Ga0500566_0001893 | 3300053094 | Bacteria | 12317 |
| 950 | Ga0500566_0019034 | 3300053094 | Bacteria | 4032 |
| 951 | Ga0500566_0050249 | 3300053094 | Bacteria | 2388 |
| 952 | Ga0500640_001798 | 3300053095 | Bacteria | 6749 |
| 953 | Ga0500641_0019500 | 3300053096 | Bacteria | 2565 |
| 954 | Ga0500641_0021052 | 3300053096 | Bacteria | 2480 |
| 955 | Ga0500641_0076775 | 3300053096 | Bacteria | 1413 |
| 956 | Ga0500650_0012794 | 3300053098 | Bacteria | 3500 |
| 957 | Ga0500555_006850 | 3300053103 | Bacteria | 3240 |
| 958 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 959 | Ga0500556_0003137 | 3300053104 | Bacteria | 4928 |
| 960 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 961 | Ga0500562_019507 | 3300053108 | Bacteria | 1754 |
| 962 | Ga0500569_012395 | 3300053109 | Bacteria | 2061 |
| 963 | Ga0500569_014417 | 3300053109 | Bacteria | 1956 |
| 964 | Ga0500572_001579 | 3300053111 | Bacteria | 6051 |
| 965 | Ga0500592_002202 | 3300053116 | Bacteria | 3147 |
| 966 | Ga0500593_002237 | 3300053117 | Bacteria | 7064 |
| 967 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 968 | Ga0500595_000906 | 3300053119 | Bacteria | 16896 |
| 969 | Ga0500595_005109 | 3300053119 | Bacteria | 5759 |
| 970 | Ga0500595_012231 | 3300053119 | Bacteria | 3327 |
| 971 | Ga0500595_013615 | 3300053119 | Bacteria | 3112 |
| 972 | Ga0500607_048600 | 3300053121 | Bacteria | 2267 |
| 973 | Ga0500607_066703 | 3300053121 | Bacteria | 1866 |
| 974 | Ga0500614_005002 | 3300053123 | Bacteria | 2785 |
| 975 | Ga0500642_0000026 | 3300053130 | Bacteria | 127731 |
| 976 | Ga0500642_0000051 | 3300053130 | Bacteria | 77123 |
| 977 | Ga0500642_0003882 | 3300053130 | Bacteria | 4597 |
| 978 | Ga0500652_002679 | 3300053131 | Bacteria | 5378 |
| 979 | Ga0500559_0000502 | 3300053136 | Bacteria | 27452 |
| 980 | Ga0500559_0042677 | 3300053136 | Bacteria | 1979 |
| 981 | Ga0500559_0053929 | 3300053136 | Bacteria | 1780 |
| 982 | Ga0500568_0000519 | 3300053139 | Bacteria | 28419 |
| 983 | Ga0500568_0010252 | 3300053139 | Bacteria | 4399 |
| 984 | Ga0500577_0007028 | 3300053142 | Bacteria | 3137 |
| 985 | Ga0500586_003947 | 3300053145 | Bacteria | 3569 |
| 986 | Ga0500603_000746 | 3300053150 | Bacteria | 7921 |
| 987 | Ga0500604_0000440 | 3300053151 | Bacteria | 11390 |
| 988 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 989 | Ga0500616_0000547 | 3300053153 | Bacteria | 46727 |
| 990 | Ga0500616_0094226 | 3300053153 | Bacteria | 1476 |
| 991 | Ga0500622_0000106 | 3300053156 | Bacteria | 85750 |
| 992 | Ga0500622_0004681 | 3300053156 | Bacteria | 8463 |
| 993 | Ga0500622_0029022 | 3300053156 | Bacteria | 2911 |
| 994 | Ga0500630_003177 | 3300053159 | Bacteria | 7941 |
| 995 | Ga0500639_000061 | 3300053163 | Bacteria | 49500 |
| 996 | Ga0500636_0007886 | 3300053177 | Bacteria | 6158 |
| 997 | Ga0500637_0000098 | 3300053178 | Bacteria | 31362 |
| 998 | Ga0500625_008055 | 3300053729 | Bacteria | 4625 |
| 999 | Ga0500609_001453 | 3300053731 | Bacteria | 3468 |
| 1000 | Ga0500609_003779 | 3300053731 | Bacteria | 2112 |
| 1001 | Ga0500596_001455 | 3300053735 | Bacteria | 4795 |
| 1002 | Ga0500601_000504 | 3300053737 | Bacteria | 6010 |
| 1003 | Ga0501084_0002419 | 3300054114 | Bacteria | 15019 |
| 1004 | Ga0501084_0042743 | 3300054114 | Bacteria | 3791 |
| 1005 | Ga0501082_0000457 | 3300060353 | Bacteria | 36134 |
| 1006 | Ga0530510_0125277 | 3300061734 | Bacteria | 1888 |
| 1007 | Ga0530510_0242905 | 3300061734 | Bacteria | 1341 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049742 | Ga0501080_0350293 | Ga0501080_0350293_245_1291 | 332 |
| 2 | iso_pu_bacteria | 8016539877 | 8016546972 | 355 |
| 3 | 3300013307 | Ga0157372_10524700 | Ga0157372_105247002 | 365 |
| 4 | 3300034818 | Ga0373950_0017092 | Ga0373950_0017092_16_1119 | 365 |
| 5 | 3300046660 | Ga0495625_0106401 | Ga0495625_0106401_10_1113 | 365 |
| 6 | 3300046694 | Ga0495649_0105837 | Ga0495649_0105837_372_1475 | 365 |
| 7 | 3300048089 | Ga0495614_0081336 | Ga0495614_0081336_14_1117 | 365 |
| 8 | 3300048929 | Ga0496126_0148587 | Ga0496126_0148587_20_1123 | 365 |
| 9 | 3300050490 | nmdc:mga03n38_11303_c1 | nmdc:mga03n38_11303_c1_2125_3228 | 365 |
| 10 | 3300050491 | nmdc:mga00v17_39489_c1 | nmdc:mga00v17_39489_c1_700_1803 | 365 |
| 11 | 3300050494 | nmdc:mga06z11_3403_c1 | nmdc:mga06z11_3403_c1_4921_6024 | 365 |
| 12 | 3300050495 | nmdc:mga04h51_54831_c1 | nmdc:mga04h51_54831_c1_23_1126 | 365 |
| 13 | 3300050496 | nmdc:mga07m45_50561_c1 | nmdc:mga07m45_50561_c1_66_1169 | 365 |
| 14 | 3300053109 | Ga0500569_014417 | Ga0500569_014417_839_1942 | 365 |
| 15 | 3300035695 | Ga0373927_0157191 | Ga0373927_0157191_204_1367 | 367 |
| 16 | 3300046681 | Ga0495647_0010678 | Ga0495647_0010678_1748_2911 | 367 |
| 17 | 3300014968 | Ga0157379_10023235 | Ga0157379_100232354 | 371 |
| 18 | 3300005347 | Ga0070668_100027692 | Ga0070668_1000276923 | 372 |
| 19 | 3300005435 | Ga0070714_100075963 | Ga0070714_1000759631 | 372 |
| 20 | 3300006048 | Ga0075363_100007935 | Ga0075363_1000079354 | 372 |
| 21 | 3300009553 | Ga0105249_10288149 | Ga0105249_102881492 | 372 |
| 22 | 3300009553 | Ga0105249_10406987 | Ga0105249_104069872 | 372 |
| 23 | 3300013104 | Ga0157370_10089633 | Ga0157370_100896332 | 372 |
| 24 | 3300013306 | Ga0163162_10071836 | Ga0163162_100718363 | 372 |
| 25 | 3300014325 | Ga0163163_10005260 | Ga0163163_100052602 | 372 |
| 26 | 3300014326 | Ga0157380_10058124 | Ga0157380_100581242 | 372 |
| 27 | 3300017792 | Ga0163161_10063621 | Ga0163161_100636212 | 372 |
| 28 | 3300025914 | Ga0207671_10048241 | Ga0207671_100482412 | 372 |
| 29 | 3300025929 | Ga0207664_10128139 | Ga0207664_101281392 | 372 |
| 30 | 3300028380 | Ga0268265_10033549 | Ga0268265_100335493 | 372 |
| 31 | 3300028666 | Ga0265336_10001051 | Ga0265336_100010513 | 372 |
| 32 | 3300028800 | Ga0265338_10010144 | Ga0265338_1001014410 | 372 |
| 33 | 3300031240 | Ga0265320_10001942 | Ga0265320_100019422 | 372 |
| 34 | 3300031241 | Ga0265325_10044396 | Ga0265325_100443962 | 372 |
| 35 | 3300031251 | Ga0265327_10002606 | Ga0265327_100026065 | 372 |
| 36 | 3300034816 | Ga0373930_0013432 | Ga0373930_0013432_98_1216 | 372 |
| 37 | 3300034817 | Ga0373948_0011963 | Ga0373948_0011963_33_1151 | 372 |
| 38 | 3300035085 | Ga0373929_0028456 | Ga0373929_0028456_21_1139 | 372 |
| 39 | 3300035090 | Ga0373949_0008964 | Ga0373949_0008964_455_1573 | 372 |
| 40 | 3300035117 | Ga0373953_0026586 | Ga0373953_0026586_441_1565 | 372 |
| 41 | 3300035118 | Ga0373954_0014777 | Ga0373954_0014777_1999_3123 | 372 |
| 42 | 3300035119 | Ga0373956_0019312 | Ga0373956_0019312_582_1706 | 372 |
| 43 | 3300035172 | Ga0373955_0008741 | Ga0373955_0008741_2824_3948 | 372 |
| 44 | 3300035241 | Ga0373961_0005467 | Ga0373961_0005467_595_1713 | 372 |
| 45 | 3300035241 | Ga0373961_0021351 | Ga0373961_0021351_443_1561 | 372 |
| 46 | 3300035724 | Ga0373933_0043148 | Ga0373933_0043148_221_1345 | 372 |
| 47 | 3300035725 | Ga0373947_0174368 | Ga0373947_0174368_251_1375 | 372 |
| 48 | 3300036401 | Ga0373937_0262907 | Ga0373937_0262907_99_1223 | 372 |
| 49 | 3300037068 | Ga0373925_0131653 | Ga0373925_0131653_655_1779 | 372 |
| 50 | 3300037471 | Ga0395905_0465460 | Ga0395905_0465460_22_1146 | 372 |
| 51 | 3300038443 | Ga0395901_0059645 | Ga0395901_0059645_2230_3354 | 372 |
| 52 | 3300042876 | Ga0451577_0166812 | Ga0451577_0166812_186_1304 | 372 |
| 53 | 3300046461 | Ga0495641_0024336 | Ga0495641_0024336_1248_2372 | 372 |
| 54 | 3300046462 | Ga0495651_0135609 | Ga0495651_0135609_601_1725 | 372 |
| 55 | 3300046463 | Ga0495653_0018166 | Ga0495653_0018166_3694_4818 | 372 |
| 56 | 3300046472 | Ga0495580_0093205 | Ga0495580_0093205_874_1998 | 372 |
| 57 | 3300046472 | Ga0495580_0102210 | Ga0495580_0102210_12_1136 | 372 |
| 58 | 3300046475 | Ga0495639_0019480 | Ga0495639_0019480_1054_2178 | 372 |
| 59 | 3300046476 | Ga0495662_0071470 | Ga0495662_0071470_224_1348 | 372 |
| 60 | 3300046477 | Ga0495664_0100608 | Ga0495664_0100608_24_1148 | 372 |
| 61 | 3300046499 | Ga0495594_0046653 | Ga0495594_0046653_944_2068 | 372 |
| 62 | 3300046511 | Ga0495608_0037100 | Ga0495608_0037100_1023_2147 | 372 |
| 63 | 3300046514 | Ga0495618_0024388 | Ga0495618_0024388_1822_2946 | 372 |
| 64 | 3300046516 | Ga0495628_0027342 | Ga0495628_0027342_1023_2147 | 372 |
| 65 | 3300046517 | Ga0495630_0117521 | Ga0495630_0117521_488_1612 | 372 |
| 66 | 3300046529 | Ga0495652_0082876 | Ga0495652_0082876_13_1137 | 372 |
| 67 | 3300046533 | Ga0495640_0013123 | Ga0495640_0013123_4561_5685 | 372 |
| 68 | 3300046533 | Ga0495640_0085945 | Ga0495640_0085945_358_1482 | 372 |
| 69 | 3300046536 | Ga0495587_0004996 | Ga0495587_0004996_6538_7662 | 372 |
| 70 | 3300046557 | Ga0495622_0081871 | Ga0495622_0081871_76_1200 | 372 |
| 71 | 3300046559 | Ga0495667_0007840 | Ga0495667_0007840_5341_6465 | 372 |
| 72 | 3300046642 | Ga0495634_0114515 | Ga0495634_0114515_217_1341 | 372 |
| 73 | 3300046663 | Ga0495635_0082903 | Ga0495635_0082903_859_1983 | 372 |
| 74 | 3300046674 | Ga0495588_0073067 | Ga0495588_0073067_535_1659 | 372 |
| 75 | 3300046675 | Ga0495657_0001362 | Ga0495657_0001362_19828_20952 | 372 |
| 76 | 3300046678 | Ga0495599_0031531 | Ga0495599_0031531_1231_2355 | 372 |
| 77 | 3300046679 | Ga0495623_0001444 | Ga0495623_0001444_14393_15517 | 372 |
| 78 | 3300046680 | Ga0495646_0004949 | Ga0495646_0004949_6645_7769 | 372 |
| 79 | 3300046683 | Ga0495658_0097814 | Ga0495658_0097814_430_1554 | 372 |
| 80 | 3300046690 | Ga0495624_0112777 | Ga0495624_0112777_361_1485 | 372 |
| 81 | 3300047315 | Ga0495581_0040728 | Ga0495581_0040728_858_1982 | 372 |
| 82 | 3300047317 | Ga0495604_0001234 | Ga0495604_0001234_17056_18180 | 372 |
| 83 | 3300047319 | Ga0495674_0027892 | Ga0495674_0027892_2521_3645 | 372 |
| 84 | 3300047319 | Ga0495674_0052039 | Ga0495674_0052039_1001_2125 | 372 |
| 85 | 3300047322 | Ga0495680_0012183 | Ga0495680_0012183_1423_2547 | 372 |
| 86 | 3300047444 | Ga0495675_0000579 | Ga0495675_0000579_468_1592 | 372 |
| 87 | 3300047471 | Ga0495684_0198589 | Ga0495684_0198589_23_1147 | 372 |
| 88 | 3300047673 | Ga0495593_0081635 | Ga0495593_0081635_186_1310 | 372 |
| 89 | 3300048088 | Ga0495602_0073830 | Ga0495602_0073830_1133_2257 | 372 |
| 90 | 3300048904 | Ga0496101_0024277 | Ga0496101_0024277_2715_3839 | 372 |
| 91 | 3300048905 | Ga0496102_0026902 | Ga0496102_0026902_2272_3396 | 372 |
| 92 | 3300048905 | Ga0496102_0183178 | Ga0496102_0183178_250_1374 | 372 |
| 93 | 3300048908 | Ga0496105_0026924 | Ga0496105_0026924_2546_3670 | 372 |
| 94 | 3300048909 | Ga0496106_0027070 | Ga0496106_0027070_184_1308 | 372 |
| 95 | 3300048909 | Ga0496106_0228735 | Ga0496106_0228735_311_1435 | 372 |
| 96 | 3300048910 | Ga0496107_0048041 | Ga0496107_0048041_187_1311 | 372 |
| 97 | 3300048911 | Ga0496108_0023518 | Ga0496108_0023518_365_1489 | 372 |
| 98 | 3300048911 | Ga0496108_0066473 | Ga0496108_0066473_1780_2904 | 372 |
| 99 | 3300048911 | Ga0496108_0136458 | Ga0496108_0136458_348_1466 | 372 |
| 100 | 3300048912 | Ga0496109_0005410 | Ga0496109_0005410_5831_6949 | 372 |
| 101 | 3300048912 | Ga0496109_0012331 | Ga0496109_0012331_4309_5433 | 372 |
| 102 | 3300048912 | Ga0496109_0020991 | Ga0496109_0020991_1217_2341 | 372 |
| 103 | 3300048913 | Ga0496110_0029267 | Ga0496110_0029267_3196_4314 | 372 |
| 104 | 3300048914 | Ga0496111_0042641 | Ga0496111_0042641_1518_2642 | 372 |
| 105 | 3300048914 | Ga0496111_0254972 | Ga0496111_0254972_49_1167 | 372 |
| 106 | 3300048915 | Ga0496112_0018318 | Ga0496112_0018318_1310_2428 | 372 |
| 107 | 3300048916 | Ga0496113_0015669 | Ga0496113_0015669_1587_2705 | 372 |
| 108 | 3300048917 | Ga0496114_0198310 | Ga0496114_0198310_367_1491 | 372 |
| 109 | 3300048918 | Ga0496115_0012493 | Ga0496115_0012493_4867_5991 | 372 |
| 110 | 3300048918 | Ga0496115_0025238 | Ga0496115_0025238_1763_2887 | 372 |
| 111 | 3300048929 | Ga0496126_0001799 | Ga0496126_0001799_2019_3146 | 372 |
| 112 | 3300049587 | Ga0501071_0056067 | Ga0501071_0056067_269_1387 | 372 |
| 113 | 3300050494 | nmdc:mga06z11_15566_c1 | nmdc:mga06z11_15566_c1_467_1591 | 372 |
| 114 | 3300050511 | nmdc:mga08y16_136369_c1 | nmdc:mga08y16_136369_c1_276_1394 | 372 |
| 115 | 3300050511 | nmdc:mga08y16_335756_c1 | nmdc:mga08y16_335756_c1_304_1422 | 372 |
| 116 | 3300053077 | Ga0495601_0051532 | Ga0495601_0051532_1444_2568 | 372 |
| 117 | 3300053078 | Ga0495612_0004090 | Ga0495612_0004090_3062_4186 | 372 |
| 118 | 3300053084 | Ga0495595_0000314 | Ga0495595_0000314_11278_12402 | 372 |
| 119 | 3300053085 | Ga0495619_0010035 | Ga0495619_0010035_188_1312 | 372 |
| 120 | 3300053085 | Ga0495619_0012831 | Ga0495619_0012831_406_1530 | 372 |
| 121 | 3300053139 | Ga0500568_0010252 | Ga0500568_0010252_3250_4374 | 372 |
| 122 | 3300053153 | Ga0500616_0000547 | Ga0500616_0000547_8675_9799 | 372 |
| 123 | 3300061734 | Ga0530510_0242905 | Ga0530510_0242905_55_1173 | 372 |
| 124 | 3300005435 | Ga0070714_100009461 | Ga0070714_1000094612 | 374 |
| 125 | 3300006028 | Ga0070717_10075971 | Ga0070717_100759713 | 374 |
| 126 | iso_pu_bacteria | 2874123672 | 2874128766 | 375 |
| 127 | 3300050512 | nmdc:mga0n895_169243_c1 | nmdc:mga0n895_169243_c1_774_1910 | 376 |
| 128 | 3300050515 | nmdc:mga0a205_121136_c1 | nmdc:mga0a205_121136_c1_1279_2415 | 376 |
| 129 | iso_pu_bacteria | 2507262055 | 2507507564 | 377 |
| 130 | iso_pu_bacteria | 2508501009 | 2508541683 | 377 |
| 131 | iso_pu_bacteria | 2508501042 | 2508692779 | 377 |
| 132 | iso_pu_bacteria | 2508501114 | 2509074862 | 377 |
| 133 | iso_pu_bacteria | 2508501128 | 2509152962 | 377 |
| 134 | iso_pu_bacteria | 2511231028 | 2511394859 | 377 |
| 135 | iso_pu_bacteria | 2513237092 | 2513621759 | 377 |
| 136 | iso_pu_bacteria | 2513237094 | 2513636799 | 377 |
| 137 | iso_pu_bacteria | 2513237095 | 2513651259 | 377 |
| 138 | iso_pu_bacteria | 2513237096 | 2513654186 | 377 |
| 139 | iso_pu_bacteria | 2513237098 | 2513674865 | 377 |
| 140 | iso_pu_bacteria | 2513237101 | 2513697128 | 377 |
| 141 | iso_pu_bacteria | 2513237102 | 2513704464 | 377 |
| 142 | iso_pu_bacteria | 2513237104 | 2513720775 | 377 |
| 143 | iso_pu_bacteria | 2513237137 | 2513856941 | 377 |
| 144 | iso_pu_bacteria | 2513237139 | 2513878743 | 377 |
| 145 | iso_pu_bacteria | 2513237141 | 2513894163 | 377 |
| 146 | iso_pu_bacteria | 2513237145 | 2513918526 | 377 |
| 147 | iso_pu_bacteria | 2513237161 | 2514009330 | 377 |
| 148 | iso_pu_bacteria | 2515154112 | 2515626173 | 377 |
| 149 | iso_pu_bacteria | 2517093001 | 2517104266 | 377 |
| 150 | iso_pu_bacteria | 2517572143 | 2517891238 | 377 |
| 151 | iso_pu_bacteria | 2522572158 | 2523106010 | 377 |
| 152 | iso_pu_bacteria | 2524023205 | 2524436179 | 377 |
| 153 | iso_pu_bacteria | 2524023210 | 2524468243 | 377 |
| 154 | iso_pu_bacteria | 2524023228 | 2524533567 | 377 |
| 155 | iso_pu_bacteria | 2528768022 | 2528848878 | 377 |
| 156 | iso_pu_bacteria | 2585428058 | 2587732231 | 377 |
| 157 | iso_pu_bacteria | 2585428062 | 2587758485 | 377 |
| 158 | iso_pu_bacteria | 2588253510 | 2588292200 | 377 |
| 159 | iso_pu_bacteria | 2602042107 | 2603861395 | 377 |
| 160 | iso_pu_bacteria | 2617270735 | 2617346900 | 377 |
| 161 | iso_pu_bacteria | 2617270741 | 2617372830 | 377 |
| 162 | iso_pu_bacteria | 2643221545 | 2643748306 | 377 |
| 163 | iso_pu_bacteria | 2643221592 | 2643971837 | 377 |
| 164 | iso_pu_bacteria | 2643221625 | 2644139326 | 377 |
| 165 | iso_pu_bacteria | 2643221648 | 2644274936 | 377 |
| 166 | iso_pu_bacteria | 2643221691 | 2644508159 | 377 |
| 167 | iso_pu_bacteria | 2667528175 | 2671123768 | 377 |
| 168 | iso_pu_bacteria | 2721755755 | 2723843598 | 377 |
| 169 | iso_pu_bacteria | 2728368998 | 2728749936 | 377 |
| 170 | iso_pu_bacteria | 2744054633 | 2745080865 | 377 |
| 171 | iso_pu_bacteria | 2775506901 | 2776262744 | 377 |
| 172 | iso_pu_bacteria | 2791355196 | 2793060973 | 377 |
| 173 | iso_pu_bacteria | 2791355197 | 2793066593 | 377 |
| 174 | iso_pu_bacteria | 2791355199 | 2793083884 | 377 |
| 175 | iso_pu_bacteria | 2802429603 | 2805921392 | 377 |
| 176 | iso_pu_bacteria | 2816332527 | 2818236662 | 377 |
| 177 | iso_pu_bacteria | 2824600985 | 2824602882 | 377 |
| 178 | iso_pu_bacteria | 2824609381 | 2824611895 | 377 |
| 179 | iso_pu_bacteria | 2824617872 | 2824621468 | 377 |
| 180 | iso_pu_bacteria | 2824626560 | 2824630580 | 377 |
| 181 | iso_pu_bacteria | 2824635225 | 2824643023 | 377 |
| 182 | iso_pu_bacteria | 2824644064 | 2824651241 | 377 |
| 183 | iso_pu_bacteria | 2824653114 | 2824659657 | 377 |
| 184 | iso_pu_bacteria | 2824661429 | 2824664509 | 377 |
| 185 | iso_pu_bacteria | 2824671348 | 2824672204 | 377 |
| 186 | iso_pu_bacteria | 2824679649 | 2824685510 | 377 |
| 187 | iso_pu_bacteria | 2824687955 | 2824688913 | 377 |
| 188 | iso_pu_bacteria | 2824696289 | 2824703557 | 377 |
| 189 | iso_pu_bacteria | 2824704595 | 2824712692 | 377 |
| 190 | iso_pu_bacteria | 2824714736 | 2824721276 | 377 |
| 191 | iso_pu_bacteria | 2824723954 | 2824729844 | 377 |
| 192 | iso_pu_bacteria | 2824732956 | 2824733912 | 377 |
| 193 | iso_pu_bacteria | 2824746037 | 2824748345 | 377 |
| 194 | iso_pu_bacteria | 2824753945 | 2824756089 | 377 |
| 195 | iso_pu_bacteria | 2824763712 | 2824766436 | 377 |
| 196 | iso_pu_bacteria | 2824773399 | 2824776563 | 377 |
| 197 | iso_pu_bacteria | 2835312727 | 2835318616 | 377 |
| 198 | iso_pu_bacteria | 2838122688 | 2838129321 | 377 |
| 199 | iso_pu_bacteria | 2841941048 | 2841948023 | 377 |
| 200 | iso_pu_bacteria | 2841949485 | 2841953579 | 377 |
| 201 | iso_pu_bacteria | 2841957949 | 2841962814 | 377 |
| 202 | iso_pu_bacteria | 2841966195 | 2841973016 | 377 |
| 203 | iso_pu_bacteria | 2841974524 | 2841978306 | 377 |
| 204 | iso_pu_bacteria | 2841983080 | 2841990526 | 377 |
| 205 | iso_pu_bacteria | 2842038055 | 2842040747 | 377 |
| 206 | iso_pu_bacteria | 2842045827 | 2842046307 | 377 |
| 207 | iso_pu_bacteria | 2844315083 | 2844320127 | 377 |
| 208 | iso_pu_bacteria | 2847930680 | 2847937422 | 377 |
| 209 | iso_pu_bacteria | 2847939898 | 2847947846 | 377 |
| 210 | iso_pu_bacteria | 2849076700 | 2849078299 | 377 |
| 211 | iso_pu_bacteria | 2857509624 | 2857512675 | 377 |
| 212 | iso_pu_bacteria | 2857524615 | 2857530168 | 377 |
| 213 | iso_pu_bacteria | 2874590934 | 2874598679 | 377 |
| 214 | iso_pu_bacteria | 2874604998 | 2874607193 | 377 |
| 215 | iso_pu_bacteria | 2874612657 | 2874614465 | 377 |
| 216 | iso_pu_bacteria | 2874620515 | 2874628178 | 377 |
| 217 | iso_pu_bacteria | 2874628541 | 2874630219 | 377 |
| 218 | iso_pu_bacteria | 2874645413 | 2874652134 | 377 |
| 219 | iso_pu_bacteria | 2876761206 | 2876768189 | 377 |
| 220 | iso_pu_bacteria | 2876771140 | 2876778718 | 377 |
| 221 | iso_pu_bacteria | 2876808645 | 2876818305 | 377 |
| 222 | iso_pu_bacteria | 2876818435 | 2876823522 | 377 |
| 223 | iso_pu_bacteria | 2879074833 | 2879082511 | 377 |
| 224 | iso_pu_bacteria | 2879083081 | 2879086722 | 377 |
| 225 | iso_pu_bacteria | 2879099564 | 2879107812 | 377 |
| 226 | iso_pu_bacteria | 2879110137 | 2879114083 | 377 |
| 227 | iso_pu_bacteria | 2879127579 | 2879131709 | 377 |
| 228 | iso_pu_bacteria | 2879142872 | 2879150045 | 377 |
| 229 | iso_pu_bacteria | 2881364244 | 2881371359 | 377 |
| 230 | iso_pu_bacteria | 2881665667 | 2881672213 | 377 |
| 231 | iso_pu_bacteria | 2885366525 | 2885370067 | 377 |
| 232 | iso_pu_bacteria | 2885374607 | 2885383133 | 377 |
| 233 | iso_pu_bacteria | 2885383462 | 2885386073 | 377 |
| 234 | iso_pu_bacteria | 2885409591 | 2885415631 | 377 |
| 235 | iso_pu_bacteria | 2888378607 | 2888385564 | 377 |
| 236 | iso_pu_bacteria | 2888388044 | 2888392685 | 377 |
| 237 | iso_pu_bacteria | 2888419890 | 2888425693 | 377 |
| 238 | iso_pu_bacteria | 2889033259 | 2889037916 | 377 |
| 239 | iso_pu_bacteria | 2889415604 | 2889416342 | 377 |
| 240 | iso_pu_bacteria | 2893066018 | 2893066060 | 377 |
| 241 | iso_pu_bacteria | 2894232714 | 2894241251 | 377 |
| 242 | iso_pu_bacteria | 2903727486 | 2903734621 | 377 |
| 243 | iso_pu_bacteria | 2903748898 | 2903754667 | 377 |
| 244 | iso_pu_bacteria | 2903768456 | 2903774865 | 377 |
| 245 | iso_pu_bacteria | 2904666416 | 2904674204 | 377 |
| 246 | iso_pu_bacteria | 2904690495 | 2904694140 | 377 |
| 247 | iso_pu_bacteria | 2904699407 | 2904701144 | 377 |
| 248 | iso_pu_bacteria | 2904711408 | 2904711866 | 377 |
| 249 | iso_pu_bacteria | 2906602504 | 2906609952 | 377 |
| 250 | iso_pu_bacteria | 2906610324 | 2906616422 | 377 |
| 251 | iso_pu_bacteria | 2906626472 | 2906627707 | 377 |
| 252 | iso_pu_bacteria | 2906635258 | 2906638123 | 377 |
| 253 | iso_pu_bacteria | 2906643746 | 2906649626 | 377 |
| 254 | iso_pu_bacteria | 2906660503 | 2906662918 | 377 |
| 255 | iso_pu_bacteria | 2908739725 | 2908741567 | 377 |
| 256 | iso_pu_bacteria | 2908756301 | 2908758986 | 377 |
| 257 | iso_pu_bacteria | 2908775508 | 2908781277 | 377 |
| 258 | iso_pu_bacteria | 2919073203 | 2919079560 | 377 |
| 259 | iso_pu_bacteria | 2922361189 | 2922361853 | 377 |
| 260 | iso_pu_bacteria | 2922368715 | 2922372302 | 377 |
| 261 | iso_pu_bacteria | 2922386360 | 2922386913 | 377 |
| 262 | iso_pu_bacteria | 2922393267 | 2922396970 | 377 |
| 263 | iso_pu_bacteria | 2922425934 | 2922431573 | 377 |
| 264 | iso_pu_bacteria | 2929615660 | 2929621132 | 377 |
| 265 | iso_pu_bacteria | 2929624759 | 2929626037 | 377 |
| 266 | iso_pu_bacteria | 2932784394 | 2932785083 | 377 |
| 267 | iso_pu_bacteria | 2932794094 | 2932795045 | 377 |
| 268 | iso_pu_bacteria | 2932801729 | 2932805573 | 377 |
| 269 | iso_pu_bacteria | 2932809354 | 2932810111 | 377 |
| 270 | iso_pu_bacteria | 2932818245 | 2932821684 | 377 |
| 271 | iso_pu_bacteria | 2932828146 | 2932828920 | 377 |
| 272 | iso_pu_bacteria | 2933577622 | 2933582999 | 377 |
| 273 | iso_pu_bacteria | 2935608549 | 2935609929 | 377 |
| 274 | iso_pu_bacteria | 2935616580 | 2935619661 | 377 |
| 275 | iso_pu_bacteria | 2935630451 | 2935636126 | 377 |
| 276 | iso_pu_bacteria | 2935638405 | 2935638641 | 377 |
| 277 | iso_pu_bacteria | 2935648319 | 2935652040 | 377 |
| 278 | iso_pu_bacteria | 2935656913 | 2935659987 | 377 |
| 279 | iso_pu_bacteria | 2935665750 | 2935666507 | 377 |
| 280 | iso_pu_bacteria | 2935675223 | 2935676450 | 377 |
| 281 | iso_pu_bacteria | 2935684952 | 2935691034 | 377 |
| 282 | iso_pu_bacteria | 2935694250 | 2935694532 | 377 |
| 283 | iso_pu_bacteria | 2935703347 | 2935703647 | 377 |
| 284 | iso_pu_bacteria | 2935713505 | 2935718415 | 377 |
| 285 | iso_pu_bacteria | 2935722832 | 2935727605 | 377 |
| 286 | iso_pu_bacteria | 2935732158 | 2935736308 | 377 |
| 287 | iso_pu_bacteria | 2935741537 | 2935745688 | 377 |
| 288 | iso_pu_bacteria | 2935750917 | 2935756069 | 377 |
| 289 | iso_pu_bacteria | 2935760218 | 2935760671 | 377 |
| 290 | iso_pu_bacteria | 2935769743 | 2935776087 | 377 |
| 291 | iso_pu_bacteria | 2935777560 | 2935785157 | 377 |
| 292 | iso_pu_bacteria | 2935785616 | 2935791900 | 377 |
| 293 | iso_pu_bacteria | 2935793552 | 2935800290 | 377 |
| 294 | iso_pu_bacteria | 2935801545 | 2935801785 | 377 |
| 295 | iso_pu_bacteria | 2935810662 | 2935814800 | 377 |
| 296 | iso_pu_bacteria | 2935819856 | 2935823089 | 377 |
| 297 | iso_pu_bacteria | 2935827899 | 2935828135 | 377 |
| 298 | iso_pu_bacteria | 2935837841 | 2935842340 | 377 |
| 299 | iso_pu_bacteria | 2935847175 | 2935848671 | 377 |
| 300 | iso_pu_bacteria | 2935855204 | 2935858024 | 377 |
| 301 | iso_pu_bacteria | 2935864058 | 2935867928 | 377 |
| 302 | iso_pu_bacteria | 2935873716 | 2935874048 | 377 |
| 303 | iso_pu_bacteria | 2935883170 | 2935885774 | 377 |
| 304 | iso_pu_bacteria | 2935908558 | 2935909524 | 377 |
| 305 | iso_pu_bacteria | 2935916978 | 2935917248 | 377 |
| 306 | iso_pu_bacteria | 2935926038 | 2935927005 | 377 |
| 307 | iso_pu_bacteria | 2935934488 | 2935937151 | 377 |
| 308 | iso_pu_bacteria | 2935942939 | 2935944546 | 377 |
| 309 | iso_pu_bacteria | 2935951376 | 2935952983 | 377 |
| 310 | iso_pu_bacteria | 2935959822 | 2935962824 | 377 |
| 311 | iso_pu_bacteria | 2935967501 | 2935969823 | 377 |
| 312 | iso_pu_bacteria | 2935975950 | 2935976420 | 377 |
| 313 | iso_pu_bacteria | 2935984226 | 2935987132 | 377 |
| 314 | iso_pu_bacteria | 2935992306 | 2935993027 | 377 |
| 315 | iso_pu_bacteria | 2936002035 | 2936002939 | 377 |
| 316 | iso_pu_bacteria | 2936011229 | 2936014403 | 377 |
| 317 | iso_pu_bacteria | 2936019824 | 2936023757 | 377 |
| 318 | iso_pu_bacteria | 2936028420 | 2936031400 | 377 |
| 319 | iso_pu_bacteria | 2936037263 | 2936040557 | 377 |
| 320 | iso_pu_bacteria | 2936046547 | 2936049509 | 377 |
| 321 | iso_pu_bacteria | 2936055302 | 2936061275 | 377 |
| 322 | iso_pu_bacteria | 2940556831 | 2940561956 | 377 |
| 323 | iso_pu_bacteria | 2941507105 | 2941512757 | 377 |
| 324 | iso_pu_bacteria | 2941515067 | 2941520676 | 377 |
| 325 | iso_pu_bacteria | 2941523033 | 2941528690 | 377 |
| 326 | iso_pu_bacteria | 2941531003 | 2941531309 | 377 |
| 327 | iso_pu_bacteria | 2941538514 | 2941542389 | 377 |
| 328 | iso_pu_bacteria | 3005474847 | 3005481366 | 377 |
| 329 | iso_pu_bacteria | 3005483717 | 3005485505 | 377 |
| 330 | iso_pu_bacteria | 3005506211 | 3005508338 | 377 |
| 331 | iso_pu_bacteria | 3005587118 | 3005588161 | 377 |
| 332 | iso_pu_bacteria | 3005594810 | 3005600426 | 377 |
| 333 | iso_pu_bacteria | 3005710791 | 3005715907 | 377 |
| 334 | iso_pu_bacteria | 3005718088 | 3005723262 | 377 |
| 335 | iso_pu_bacteria | 8006926726 | 8006933204 | 377 |
| 336 | iso_pu_bacteria | 8006933436 | 8006939342 | 377 |
| 337 | iso_pu_bacteria | 8006964411 | 8006968853 | 377 |
| 338 | iso_pu_bacteria | 8006973647 | 8006978999 | 377 |
| 339 | iso_pu_bacteria | 8006984368 | 8006984532 | 377 |
| 340 | iso_pu_bacteria | 8006994254 | 8006997159 | 377 |
| 341 | iso_pu_bacteria | 8016511872 | 8016520543 | 377 |
| 342 | iso_pu_bacteria | 8016522445 | 8016528584 | 377 |
| 343 | iso_pu_bacteria | 8016530956 | 8016533754 | 377 |
| 344 | iso_pu_bacteria | 8016566248 | 8016572087 | 377 |
| 345 | iso_pu_bacteria | 8016575299 | 8016576286 | 377 |
| 346 | iso_pu_bacteria | 8016583857 | 8016594471 | 377 |
| 347 | iso_pu_bacteria | 8016595262 | 8016601250 | 377 |
| 348 | iso_pu_bacteria | 8016603502 | 8016609185 | 377 |
| 349 | iso_pu_bacteria | 8016622563 | 8016625509 | 377 |
| 350 | iso_pu_bacteria | 8016630954 | 8016639065 | 377 |
| 351 | iso_pu_bacteria | 8017057580 | 8017065032 | 377 |
| 352 | iso_pu_bacteria | 8019530166 | 8019533529 | 377 |
| 353 | iso_pu_bacteria | 8019538911 | 8019546148 | 377 |
| 354 | iso_pu_bacteria | 8019547302 | 8019552561 | 377 |
| 355 | iso_pu_bacteria | 8019555841 | 8019565213 | 377 |
| 356 | iso_pu_bacteria | 8019565922 | 8019575312 | 377 |
| 357 | iso_pu_bacteria | 8019597564 | 8019599096 | 377 |
| 358 | iso_pu_bacteria | 8019608314 | 8019609264 | 377 |
| 359 | iso_pu_bacteria | 8019629233 | 8019633195 | 377 |
| 360 | iso_pu_bacteria | 8019638758 | 8019646704 | 377 |
| 361 | iso_pu_bacteria | 8019659431 | 8019661067 | 377 |
| 362 | iso_pu_bacteria | 8019668869 | 8019675850 | 377 |
| 363 | iso_pu_bacteria | 8019678201 | 8019680243 | 377 |
| 364 | iso_pu_bacteria | 8019678201 | 8019685604 | 377 |
| 365 | iso_pu_bacteria | 8019687851 | 8019691175 | 377 |
| 366 | iso_pu_bacteria | 8055742211 | 8055745006 | 377 |
| 367 | iso_pu_bacteria | 8056673599 | 8056677509 | 377 |
| 368 | iso_pu_bacteria | 8056681323 | 8056684818 | 377 |
| 369 | iso_pu_bacteria | 8056689827 | 8056690695 | 377 |
| 370 | iso_pu_bacteria | 8056967851 | 8056974959 | 377 |
| 371 | 3300014325 | Ga0163163_10003896 | Ga0163163_100038966 | 378 |
| 372 | 3300037068 | Ga0373925_0035982 | Ga0373925_0035982_333_1475 | 378 |
| 373 | 3300048903 | Ga0496100_0138796 | Ga0496100_0138796_515_1657 | 378 |
| 374 | 3300048908 | Ga0496105_0004690 | Ga0496105_0004690_6864_8006 | 378 |
| 375 | 3300048913 | Ga0496110_0043984 | Ga0496110_0043984_1819_2961 | 378 |
| 376 | 3300048918 | Ga0496115_0002089 | Ga0496115_0002089_7552_8694 | 378 |
| 377 | 3300003215 | JGI25153J46596_10001771 | JGI25153J46596_100017712 | 379 |
| 378 | 3300003215 | JGI25153J46596_10005376 | JGI25153J46596_100053764 | 379 |
| 379 | 3300005328 | Ga0070676_10104133 | Ga0070676_101041331 | 379 |
| 380 | 3300005340 | Ga0070689_100008156 | Ga0070689_1000081565 | 379 |
| 381 | 3300005353 | Ga0070669_100046473 | Ga0070669_1000464733 | 379 |
| 382 | 3300005456 | Ga0070678_100049636 | Ga0070678_1000496364 | 379 |
| 383 | 3300005457 | Ga0070662_100269786 | Ga0070662_1002697862 | 379 |
| 384 | 3300006042 | Ga0075368_10059682 | Ga0075368_100596821 | 379 |
| 385 | 3300006195 | Ga0075366_10147024 | Ga0075366_101470242 | 379 |
| 386 | 3300006353 | Ga0075370_10056711 | Ga0075370_100567112 | 379 |
| 387 | 3300006881 | Ga0068865_100077175 | Ga0068865_1000771752 | 379 |
| 388 | 3300014325 | Ga0163163_10012351 | Ga0163163_100123515 | 379 |
| 389 | 3300014497 | Ga0182008_10097894 | Ga0182008_100978942 | 379 |
| 390 | 3300021377 | Ga0213874_10001651 | Ga0213874_100016515 | 379 |
| 391 | 3300025297 | Ga0209758_1000302 | Ga0209758_100030246 | 379 |
| 392 | 3300025907 | Ga0207645_10108318 | Ga0207645_101083182 | 379 |
| 393 | 3300025936 | Ga0207670_10005208 | Ga0207670_100052085 | 379 |
| 394 | 3300025937 | Ga0207669_10046404 | Ga0207669_100464042 | 379 |
| 395 | 3300025941 | Ga0207711_10146522 | Ga0207711_101465222 | 379 |
| 396 | 3300025960 | Ga0207651_10306848 | Ga0207651_103068481 | 379 |
| 397 | 3300025961 | Ga0207712_10146744 | Ga0207712_101467441 | 379 |
| 398 | 3300026121 | Ga0207683_10135537 | Ga0207683_101355372 | 379 |
| 399 | 3300027866 | Ga0209813_10036052 | Ga0209813_100360522 | 379 |
| 400 | 3300028381 | Ga0268264_10145744 | Ga0268264_101457441 | 379 |
| 401 | 3300031241 | Ga0265325_10000031 | Ga0265325_1000003148 | 379 |
| 402 | 3300035114 | Ga0373939_0007131 | Ga0373939_0007131_659_1801 | 379 |
| 403 | 3300035695 | Ga0373927_0170245 | Ga0373927_0170245_176_1318 | 379 |
| 404 | 3300037068 | Ga0373925_0123348 | Ga0373925_0123348_454_1596 | 379 |
| 405 | 3300041408 | Ga0439453_0005883 | Ga0439453_0005883_92_1237 | 379 |
| 406 | 3300044694 | Ga0466963_0026149 | Ga0466963_0026149_689_1834 | 379 |
| 407 | 3300044842 | Ga0466957_0006157 | Ga0466957_0006157_642_1787 | 379 |
| 408 | 3300045836 | Ga0466958_0026812 | Ga0466958_0026812_1485_2630 | 379 |
| 409 | 3300048904 | Ga0496101_0081094 | Ga0496101_0081094_184_1326 | 379 |
| 410 | 3300048910 | Ga0496107_0108444 | Ga0496107_0108444_434_1576 | 379 |
| 411 | 3300048913 | Ga0496110_0338654 | Ga0496110_0338654_79_1221 | 379 |
| 412 | 3300048915 | Ga0496112_0093681 | Ga0496112_0093681_607_1749 | 379 |
| 413 | 3300048915 | Ga0496112_0271698 | Ga0496112_0271698_446_1588 | 379 |
| 414 | 3300048918 | Ga0496115_0110379 | Ga0496115_0110379_104_1246 | 379 |
| 415 | 3300048918 | Ga0496115_0139608 | Ga0496115_0139608_734_1882 | 379 |
| 416 | 3300049571 | Ga0501034_0095199 | Ga0501034_0095199_760_1908 | 379 |
| 417 | 3300049742 | Ga0501080_0114361 | Ga0501080_0114361_1249_2397 | 379 |
| 418 | 3300050489 | nmdc:mga03683_37826_c1 | nmdc:mga03683_37826_c1_807_1949 | 379 |
| 419 | 3300050489 | nmdc:mga03683_52171_c1 | nmdc:mga03683_52171_c1_251_1393 | 379 |
| 420 | 3300050490 | nmdc:mga03n38_58325_c1 | nmdc:mga03n38_58325_c1_533_1675 | 379 |
| 421 | 3300050491 | nmdc:mga00v17_21986_c1 | nmdc:mga00v17_21986_c1_496_1638 | 379 |
| 422 | 3300050493 | nmdc:mga0k408_173388_c1 | nmdc:mga0k408_173388_c1_70_1212 | 379 |
| 423 | 3300050494 | nmdc:mga06z11_138917_c1 | nmdc:mga06z11_138917_c1_89_1231 | 379 |
| 424 | 3300050494 | nmdc:mga06z11_26257_c1 | nmdc:mga06z11_26257_c1_459_1685 | 379 |
| 425 | 3300050495 | nmdc:mga04h51_43205_c1 | nmdc:mga04h51_43205_c1_322_1464 | 379 |
| 426 | 3300050496 | nmdc:mga07m45_92466_c1 | nmdc:mga07m45_92466_c1_310_1452 | 379 |
| 427 | 3300050511 | nmdc:mga08y16_101861_c1 | nmdc:mga08y16_101861_c1_1617_2759 | 379 |
| 428 | 3300053096 | Ga0500641_0021052 | Ga0500641_0021052_963_2105 | 379 |
| 429 | 3300053119 | Ga0500595_013615 | Ga0500595_013615_1162_2304 | 379 |
| 430 | 3300005436 | Ga0070713_100154932 | Ga0070713_1001549322 | 380 |
| 431 | 3300007265 | Ga0099794_10017117 | Ga0099794_100171174 | 380 |
| 432 | 3300025916 | Ga0207663_10023124 | Ga0207663_100231242 | 380 |
| 433 | 3300025928 | Ga0207700_10269725 | Ga0207700_102697251 | 380 |
| 434 | 3300035086 | Ga0373934_0029448 | Ga0373934_0029448_458_1606 | 380 |
| 435 | 3300035118 | Ga0373954_0000003 | Ga0373954_0000003_39872_41020 | 380 |
| 436 | 3300035119 | Ga0373956_0034057 | Ga0373956_0034057_664_1812 | 380 |
| 437 | 3300035695 | Ga0373927_0020827 | Ga0373927_0020827_2472_3626 | 380 |
| 438 | 3300035724 | Ga0373933_0011065 | Ga0373933_0011065_1753_2901 | 380 |
| 439 | 3300036401 | Ga0373937_0000131 | Ga0373937_0000131_58707_59855 | 380 |
| 440 | 3300037068 | Ga0373925_0173635 | Ga0373925_0173635_297_1451 | 380 |
| 441 | 3300046679 | Ga0495623_0079339 | Ga0495623_0079339_763_1911 | 380 |
| 442 | 3300000043 | ARcpr5yngRDRAFT_c002823 | ARcpr5yngRDRAFT_0028232 | 381 |
| 443 | 3300000044 | ARSoilOldRDRAFT_c003037 | ARSoilOldRDRAFT_0030372 | 381 |
| 444 | 3300001989 | JGI24739J22299_10031571 | JGI24739J22299_100315712 | 381 |
| 445 | 3300001990 | JGI24737J22298_10039955 | JGI24737J22298_100399552 | 381 |
| 446 | 3300002075 | JGI24738J21930_10017994 | JGI24738J21930_100179942 | 381 |
| 447 | 3300003203 | JGI25406J46586_10000050 | JGI25406J46586_1000005036 | 381 |
| 448 | 3300003215 | JGI25153J46596_10000297 | JGI25153J46596_100002974 | 381 |
| 449 | 3300003215 | JGI25153J46596_10002178 | JGI25153J46596_100021788 | 381 |
| 450 | 3300003215 | JGI25153J46596_10003525 | JGI25153J46596_100035252 | 381 |
| 451 | 3300003215 | JGI25153J46596_10007400 | JGI25153J46596_100074005 | 381 |
| 452 | 3300003762 | Ga0055542_1005691 | Ga0055542_10056913 | 381 |
| 453 | 3300003794 | Ga0055531_10012935 | Ga0055531_100129352 | 381 |
| 454 | 3300004625 | Ga0055543_1004359 | Ga0055543_10043592 | 381 |
| 455 | 3300005262 | Ga0065165_1001109 | Ga0065165_100110925 | 381 |
| 456 | 3300005262 | Ga0065165_1012799 | Ga0065165_10127992 | 381 |
| 457 | 3300005289 | Ga0065704_10111240 | Ga0065704_101112402 | 381 |
| 458 | 3300005290 | Ga0065712_10021991 | Ga0065712_100219911 | 381 |
| 459 | 3300005290 | Ga0065712_10080594 | Ga0065712_100805943 | 381 |
| 460 | 3300005328 | Ga0070676_10119955 | Ga0070676_101199552 | 381 |
| 461 | 3300005329 | Ga0070683_100005122 | Ga0070683_1000051223 | 381 |
| 462 | 3300005329 | Ga0070683_100088145 | Ga0070683_1000881453 | 381 |
| 463 | 3300005331 | Ga0070670_100069412 | Ga0070670_1000694122 | 381 |
| 464 | 3300005335 | Ga0070666_10041549 | Ga0070666_100415493 | 381 |
| 465 | 3300005336 | Ga0070680_100011806 | Ga0070680_1000118062 | 381 |
| 466 | 3300005336 | Ga0070680_100074827 | Ga0070680_1000748272 | 381 |
| 467 | 3300005336 | Ga0070680_100094123 | Ga0070680_1000941232 | 381 |
| 468 | 3300005337 | Ga0070682_100232921 | Ga0070682_1002329212 | 381 |
| 469 | 3300005338 | Ga0068868_100001939 | Ga0068868_1000019393 | 381 |
| 470 | 3300005338 | Ga0068868_100037581 | Ga0068868_1000375812 | 381 |
| 471 | 3300005339 | Ga0070660_100029848 | Ga0070660_1000298483 | 381 |
| 472 | 3300005339 | Ga0070660_100103884 | Ga0070660_1001038841 | 381 |
| 473 | 3300005339 | Ga0070660_100132353 | Ga0070660_1001323532 | 381 |
| 474 | 3300005339 | Ga0070660_100296921 | Ga0070660_1002969211 | 381 |
| 475 | 3300005344 | Ga0070661_100038404 | Ga0070661_1000384042 | 381 |
| 476 | 3300005344 | Ga0070661_100064072 | Ga0070661_1000640722 | 381 |
| 477 | 3300005347 | Ga0070668_100071610 | Ga0070668_1000716102 | 381 |
| 478 | 3300005347 | Ga0070668_100088233 | Ga0070668_1000882332 | 381 |
| 479 | 3300005353 | Ga0070669_100152048 | Ga0070669_1001520482 | 381 |
| 480 | 3300005354 | Ga0070675_100164085 | Ga0070675_1001640852 | 381 |
| 481 | 3300005354 | Ga0070675_100269619 | Ga0070675_1002696191 | 381 |
| 482 | 3300005355 | Ga0070671_100011229 | Ga0070671_1000112295 | 381 |
| 483 | 3300005355 | Ga0070671_100015820 | Ga0070671_1000158205 | 381 |
| 484 | 3300005355 | Ga0070671_100139747 | Ga0070671_1001397472 | 381 |
| 485 | 3300005356 | Ga0070674_100052883 | Ga0070674_1000528832 | 381 |
| 486 | 3300005364 | Ga0070673_100001119 | Ga0070673_1000011193 | 381 |
| 487 | 3300005365 | Ga0070688_100034556 | Ga0070688_1000345561 | 381 |
| 488 | 3300005367 | Ga0070667_100000427 | Ga0070667_10000042725 | 381 |
| 489 | 3300005367 | Ga0070667_100058914 | Ga0070667_1000589142 | 381 |
| 490 | 3300005367 | Ga0070667_100240126 | Ga0070667_1002401262 | 381 |
| 491 | 3300005434 | Ga0070709_10001579 | Ga0070709_1000157910 | 381 |
| 492 | 3300005434 | Ga0070709_10018524 | Ga0070709_100185244 | 381 |
| 493 | 3300005435 | Ga0070714_100033299 | Ga0070714_1000332993 | 381 |
| 494 | 3300005435 | Ga0070714_100041521 | Ga0070714_1000415212 | 381 |
| 495 | 3300005436 | Ga0070713_100050284 | Ga0070713_1000502842 | 381 |
| 496 | 3300005436 | Ga0070713_100084103 | Ga0070713_1000841032 | 381 |
| 497 | 3300005436 | Ga0070713_100157884 | Ga0070713_1001578841 | 381 |
| 498 | 3300005437 | Ga0070710_10008336 | Ga0070710_100083363 | 381 |
| 499 | 3300005439 | Ga0070711_100003453 | Ga0070711_10000345310 | 381 |
| 500 | 3300005439 | Ga0070711_100010332 | Ga0070711_1000103322 | 381 |
| 501 | 3300005439 | Ga0070711_100013079 | Ga0070711_1000130795 | 381 |
| 502 | 3300005439 | Ga0070711_100027252 | Ga0070711_1000272523 | 381 |
| 503 | 3300005439 | Ga0070711_100028382 | Ga0070711_1000283822 | 381 |
| 504 | 3300005441 | Ga0070700_100113454 | Ga0070700_1001134542 | 381 |
| 505 | 3300005444 | Ga0070694_100088723 | Ga0070694_1000887232 | 381 |
| 506 | 3300005455 | Ga0070663_100009428 | Ga0070663_1000094281 | 381 |
| 507 | 3300005455 | Ga0070663_100028430 | Ga0070663_1000284303 | 381 |
| 508 | 3300005455 | Ga0070663_100096844 | Ga0070663_1000968442 | 381 |
| 509 | 3300005456 | Ga0070678_100000866 | Ga0070678_10000086610 | 381 |
| 510 | 3300005456 | Ga0070678_100030749 | Ga0070678_1000307494 | 381 |
| 511 | 3300005458 | Ga0070681_10063853 | Ga0070681_100638533 | 381 |
| 512 | 3300005459 | Ga0068867_100027893 | Ga0068867_1000278933 | 381 |
| 513 | 3300005467 | Ga0070706_100075117 | Ga0070706_1000751172 | 381 |
| 514 | 3300005471 | Ga0070698_100142127 | Ga0070698_1001421272 | 381 |
| 515 | 3300005530 | Ga0070679_100089458 | Ga0070679_1000894582 | 381 |
| 516 | 3300005530 | Ga0070679_100143686 | Ga0070679_1001436862 | 381 |
| 517 | 3300005535 | Ga0070684_100027728 | Ga0070684_1000277285 | 381 |
| 518 | 3300005535 | Ga0070684_100058149 | Ga0070684_1000581493 | 381 |
| 519 | 3300005535 | Ga0070684_100170508 | Ga0070684_1001705081 | 381 |
| 520 | 3300005536 | Ga0070697_100012253 | Ga0070697_1000122535 | 381 |
| 521 | 3300005543 | Ga0070672_100085986 | Ga0070672_1000859862 | 381 |
| 522 | 3300005543 | Ga0070672_100115772 | Ga0070672_1001157722 | 381 |
| 523 | 3300005547 | Ga0070693_100088214 | Ga0070693_1000882142 | 381 |
| 524 | 3300005548 | Ga0070665_100103293 | Ga0070665_1001032932 | 381 |
| 525 | 3300005548 | Ga0070665_100123255 | Ga0070665_1001232552 | 381 |
| 526 | 3300005548 | Ga0070665_100381401 | Ga0070665_1003814011 | 381 |
| 527 | 3300005549 | Ga0070704_100172906 | Ga0070704_1001729062 | 381 |
| 528 | 3300005563 | Ga0068855_100044511 | Ga0068855_1000445113 | 381 |
| 529 | 3300005563 | Ga0068855_100129697 | Ga0068855_1001296973 | 381 |
| 530 | 3300005564 | Ga0070664_100004769 | Ga0070664_1000047696 | 381 |
| 531 | 3300005577 | Ga0068857_100006913 | Ga0068857_1000069132 | 381 |
| 532 | 3300005614 | Ga0068856_100001803 | Ga0068856_10000180318 | 381 |
| 533 | 3300005614 | Ga0068856_100017040 | Ga0068856_1000170404 | 381 |
| 534 | 3300005614 | Ga0068856_100200377 | Ga0068856_1002003772 | 381 |
| 535 | 3300005616 | Ga0068852_100064623 | Ga0068852_1000646232 | 381 |
| 536 | 3300005616 | Ga0068852_100075034 | Ga0068852_1000750342 | 381 |
| 537 | 3300005616 | Ga0068852_100120886 | Ga0068852_1001208862 | 381 |
| 538 | 3300005616 | Ga0068852_100370232 | Ga0068852_1003702322 | 381 |
| 539 | 3300005617 | Ga0068859_100090741 | Ga0068859_1000907412 | 381 |
| 540 | 3300005618 | Ga0068864_100001940 | Ga0068864_10000194013 | 381 |
| 541 | 3300005618 | Ga0068864_100087884 | Ga0068864_1000878842 | 381 |
| 542 | 3300005618 | Ga0068864_100214469 | Ga0068864_1002144692 | 381 |
| 543 | 3300005718 | Ga0068866_10024437 | Ga0068866_100244372 | 381 |
| 544 | 3300005718 | Ga0068866_10117751 | Ga0068866_101177512 | 381 |
| 545 | 3300005719 | Ga0068861_100048457 | Ga0068861_1000484573 | 381 |
| 546 | 3300005719 | Ga0068861_100081446 | Ga0068861_1000814463 | 381 |
| 547 | 3300005841 | Ga0068863_100005859 | Ga0068863_1000058592 | 381 |
| 548 | 3300005841 | Ga0068863_100219662 | Ga0068863_1002196622 | 381 |
| 549 | 3300005842 | Ga0068858_100064249 | Ga0068858_1000642492 | 381 |
| 550 | 3300005842 | Ga0068858_100132331 | Ga0068858_1001323312 | 381 |
| 551 | 3300005842 | Ga0068858_100263622 | Ga0068858_1002636221 | 381 |
| 552 | 3300005843 | Ga0068860_100000399 | Ga0068860_1000003997 | 381 |
| 553 | 3300005843 | Ga0068860_100144833 | Ga0068860_1001448332 | 381 |
| 554 | 3300005937 | Ga0081455_10000237 | Ga0081455_1000023765 | 381 |
| 555 | 3300005937 | Ga0081455_10095265 | Ga0081455_100952653 | 381 |
| 556 | 3300005981 | Ga0081538_10018641 | Ga0081538_100186414 | 381 |
| 557 | 3300005983 | Ga0081540_1002658 | Ga0081540_10026588 | 381 |
| 558 | 3300005983 | Ga0081540_1012722 | Ga0081540_10127225 | 381 |
| 559 | 3300005983 | Ga0081540_1014792 | Ga0081540_10147922 | 381 |
| 560 | 3300005983 | Ga0081540_1019041 | Ga0081540_10190413 | 381 |
| 561 | 3300005985 | Ga0081539_10000325 | Ga0081539_1000032525 | 381 |
| 562 | 3300005985 | Ga0081539_10000542 | Ga0081539_1000054214 | 381 |
| 563 | 3300005985 | Ga0081539_10017927 | Ga0081539_100179274 | 381 |
| 564 | 3300005985 | Ga0081539_10041063 | Ga0081539_100410632 | 381 |
| 565 | 3300005985 | Ga0081539_10103757 | Ga0081539_101037571 | 381 |
| 566 | 3300006028 | Ga0070717_10004627 | Ga0070717_100046272 | 381 |
| 567 | 3300006028 | Ga0070717_10021548 | Ga0070717_100215483 | 381 |
| 568 | 3300006038 | Ga0075365_10000416 | Ga0075365_100004163 | 381 |
| 569 | 3300006038 | Ga0075365_10066033 | Ga0075365_100660332 | 381 |
| 570 | 3300006038 | Ga0075365_10070334 | Ga0075365_100703342 | 381 |
| 571 | 3300006042 | Ga0075368_10012500 | Ga0075368_100125003 | 381 |
| 572 | 3300006048 | Ga0075363_100001174 | Ga0075363_1000011742 | 381 |
| 573 | 3300006048 | Ga0075363_100014889 | Ga0075363_1000148893 | 381 |
| 574 | 3300006051 | Ga0075364_10002830 | Ga0075364_100028302 | 381 |
| 575 | 3300006051 | Ga0075364_10036378 | Ga0075364_100363783 | 381 |
| 576 | 3300006051 | Ga0075364_10108105 | Ga0075364_101081052 | 381 |
| 577 | 3300006163 | Ga0070715_10037104 | Ga0070715_100371042 | 381 |
| 578 | 3300006163 | Ga0070715_10095856 | Ga0070715_100958562 | 381 |
| 579 | 3300006173 | Ga0070716_100036597 | Ga0070716_1000365972 | 381 |
| 580 | 3300006175 | Ga0070712_100008334 | Ga0070712_1000083347 | 381 |
| 581 | 3300006175 | Ga0070712_100116412 | Ga0070712_1001164122 | 381 |
| 582 | 3300006178 | Ga0075367_10013317 | Ga0075367_100133172 | 381 |
| 583 | 3300006178 | Ga0075367_10027064 | Ga0075367_100270642 | 381 |
| 584 | 3300006178 | Ga0075367_10040805 | Ga0075367_100408053 | 381 |
| 585 | 3300006186 | Ga0075369_10014301 | Ga0075369_100143012 | 381 |
| 586 | 3300006195 | Ga0075366_10009516 | Ga0075366_100095164 | 381 |
| 587 | 3300006195 | Ga0075366_10022789 | Ga0075366_100227893 | 381 |
| 588 | 3300006237 | Ga0097621_100044777 | Ga0097621_1000447773 | 381 |
| 589 | 3300006237 | Ga0097621_100141994 | Ga0097621_1001419942 | 381 |
| 590 | 3300006237 | Ga0097621_100146252 | Ga0097621_1001462522 | 381 |
| 591 | 3300006353 | Ga0075370_10005713 | Ga0075370_100057132 | 381 |
| 592 | 3300006353 | Ga0075370_10011478 | Ga0075370_100114783 | 381 |
| 593 | 3300006353 | Ga0075370_10097937 | Ga0075370_100979371 | 381 |
| 594 | 3300006358 | Ga0068871_100139545 | Ga0068871_1001395451 | 381 |
| 595 | 3300006844 | Ga0075428_100128240 | Ga0075428_1001282402 | 381 |
| 596 | 3300006847 | Ga0075431_100001980 | Ga0075431_10000198015 | 381 |
| 597 | 3300006847 | Ga0075431_100254358 | Ga0075431_1002543582 | 381 |
| 598 | 3300006871 | Ga0075434_100077954 | Ga0075434_1000779543 | 381 |
| 599 | 3300006881 | Ga0068865_100060979 | Ga0068865_1000609792 | 381 |
| 600 | 3300006881 | Ga0068865_100229200 | Ga0068865_1002292002 | 381 |
| 601 | 3300006931 | Ga0097620_100090743 | Ga0097620_1000907432 | 381 |
| 602 | 3300006942 | Ga0099824_1019369 | Ga0099824_10193692 | 381 |
| 603 | 3300006942 | Ga0099824_1037786 | Ga0099824_10377862 | 381 |
| 604 | 3300006943 | Ga0099822_1001244 | Ga0099822_100124413 | 381 |
| 605 | 3300007788 | Ga0099795_10006714 | Ga0099795_100067143 | 381 |
| 606 | 3300009093 | Ga0105240_10184409 | Ga0105240_101844092 | 381 |
| 607 | 3300009094 | Ga0111539_10033837 | Ga0111539_100338372 | 381 |
| 608 | 3300009094 | Ga0111539_10162670 | Ga0111539_101626702 | 381 |
| 609 | 3300009098 | Ga0105245_10050469 | Ga0105245_100504692 | 381 |
| 610 | 3300009098 | Ga0105245_10065537 | Ga0105245_100655372 | 381 |
| 611 | 3300009147 | Ga0114129_10069616 | Ga0114129_100696164 | 381 |
| 612 | 3300009148 | Ga0105243_10072375 | Ga0105243_100723752 | 381 |
| 613 | 3300009148 | Ga0105243_10111021 | Ga0105243_101110211 | 381 |
| 614 | 3300009174 | Ga0105241_10111029 | Ga0105241_101110292 | 381 |
| 615 | 3300009177 | Ga0105248_10135644 | Ga0105248_101356442 | 381 |
| 616 | 3300009545 | Ga0105237_10013607 | Ga0105237_100136074 | 381 |
| 617 | 3300009551 | Ga0105238_10041453 | Ga0105238_100414532 | 381 |
| 618 | 3300009551 | Ga0105238_10110140 | Ga0105238_101101402 | 381 |
| 619 | 3300009553 | Ga0105249_10025941 | Ga0105249_100259416 | 381 |
| 620 | 3300010375 | Ga0105239_10034550 | Ga0105239_100345502 | 381 |
| 621 | 3300010375 | Ga0105239_10087399 | Ga0105239_100873992 | 381 |
| 622 | 3300010375 | Ga0105239_10218278 | Ga0105239_102182782 | 381 |
| 623 | 3300011119 | Ga0105246_10134531 | Ga0105246_101345312 | 381 |
| 624 | 3300013100 | Ga0157373_10012937 | Ga0157373_100129374 | 381 |
| 625 | 3300013104 | Ga0157370_10087286 | Ga0157370_100872862 | 381 |
| 626 | 3300013105 | Ga0157369_10011073 | Ga0157369_100110736 | 381 |
| 627 | 3300013105 | Ga0157369_10052856 | Ga0157369_100528565 | 381 |
| 628 | 3300013105 | Ga0157369_10172790 | Ga0157369_101727902 | 381 |
| 629 | 3300013296 | Ga0157374_10090805 | Ga0157374_100908051 | 381 |
| 630 | 3300013306 | Ga0163162_10042571 | Ga0163162_100425713 | 381 |
| 631 | 3300013306 | Ga0163162_10122854 | Ga0163162_101228543 | 381 |
| 632 | 3300013306 | Ga0163162_10217062 | Ga0163162_102170622 | 381 |
| 633 | 3300013307 | Ga0157372_10145358 | Ga0157372_101453582 | 381 |
| 634 | 3300013308 | Ga0157375_10122327 | Ga0157375_101223272 | 381 |
| 635 | 3300014325 | Ga0163163_10005988 | Ga0163163_1000598810 | 381 |
| 636 | 3300014326 | Ga0157380_10115131 | Ga0157380_101151312 | 381 |
| 637 | 3300014968 | Ga0157379_10032090 | Ga0157379_100320903 | 381 |
| 638 | 3300014969 | Ga0157376_10231582 | Ga0157376_102315822 | 381 |
| 639 | 3300017792 | Ga0163161_10066401 | Ga0163161_100664012 | 381 |
| 640 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001657 | 381 |
| 641 | 3300021320 | Ga0214544_1026847 | Ga0214544_10268472 | 381 |
| 642 | 3300021320 | Ga0214544_1027275 | Ga0214544_10272752 | 381 |
| 643 | 3300021321 | Ga0214542_1000037 | Ga0214542_100003742 | 381 |
| 644 | 3300021321 | Ga0214542_1037377 | Ga0214542_10373771 | 381 |
| 645 | 3300021321 | Ga0214542_1037673 | Ga0214542_10376731 | 381 |
| 646 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003103 | 381 |
| 647 | 3300021324 | Ga0214545_1019261 | Ga0214545_10192611 | 381 |
| 648 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002662 | 381 |
| 649 | 3300021327 | Ga0214543_1026652 | Ga0214543_10266521 | 381 |
| 650 | 3300021327 | Ga0214543_1039585 | Ga0214543_10395851 | 381 |
| 651 | 3300021377 | Ga0213874_10041435 | Ga0213874_100414351 | 381 |
| 652 | 3300021384 | Ga0213876_10002729 | Ga0213876_1000272910 | 381 |
| 653 | 3300021384 | Ga0213876_10027514 | Ga0213876_100275142 | 381 |
| 654 | 3300021384 | Ga0213876_10097258 | Ga0213876_100972582 | 381 |
| 655 | 3300025230 | Ga0209563_104444 | Ga0209563_1044442 | 381 |
| 656 | 3300025253 | Ga0209677_100598 | Ga0209677_10059816 | 381 |
| 657 | 3300025253 | Ga0209677_107557 | Ga0209677_1075571 | 381 |
| 658 | 3300025254 | Ga0209148_1000462 | Ga0209148_100046234 | 381 |
| 659 | 3300025254 | Ga0209148_1004101 | Ga0209148_10041012 | 381 |
| 660 | 3300025261 | Ga0209233_1000654 | Ga0209233_100065410 | 381 |
| 661 | 3300025261 | Ga0209233_1007735 | Ga0209233_10077353 | 381 |
| 662 | 3300025261 | Ga0209233_1008472 | Ga0209233_10084722 | 381 |
| 663 | 3300025261 | Ga0209233_1014172 | Ga0209233_10141722 | 381 |
| 664 | 3300025272 | Ga0209455_1000926 | Ga0209455_100092611 | 381 |
| 665 | 3300025272 | Ga0209455_1000954 | Ga0209455_100095411 | 381 |
| 666 | 3300025295 | Ga0209564_1000468 | Ga0209564_100046818 | 381 |
| 667 | 3300025295 | Ga0209564_1008067 | Ga0209564_10080674 | 381 |
| 668 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011424 | 381 |
| 669 | 3300025297 | Ga0209758_1000133 | Ga0209758_1000133157 | 381 |
| 670 | 3300025297 | Ga0209758_1000845 | Ga0209758_100084511 | 381 |
| 671 | 3300025297 | Ga0209758_1001760 | Ga0209758_100176019 | 381 |
| 672 | 3300025297 | Ga0209758_1002308 | Ga0209758_10023088 | 381 |
| 673 | 3300025297 | Ga0209758_1008957 | Ga0209758_10089573 | 381 |
| 674 | 3300025297 | Ga0209758_1010383 | Ga0209758_10103833 | 381 |
| 675 | 3300025297 | Ga0209758_1052251 | Ga0209758_10522511 | 381 |
| 676 | 3300025299 | Ga0209256_1003911 | Ga0209256_10039119 | 381 |
| 677 | 3300025302 | Ga0207426_1000270 | Ga0207426_100027077 | 381 |
| 678 | 3300025302 | Ga0207426_1000292 | Ga0207426_100029272 | 381 |
| 679 | 3300025302 | Ga0207426_1002666 | Ga0207426_10026663 | 381 |
| 680 | 3300025304 | Ga0209257_1001242 | Ga0209257_100124212 | 381 |
| 681 | 3300025315 | Ga0207697_10021016 | Ga0207697_100210162 | 381 |
| 682 | 3300025321 | Ga0207656_10010329 | Ga0207656_100103292 | 381 |
| 683 | 3300025885 | Ga0207653_10001814 | Ga0207653_100018145 | 381 |
| 684 | 3300025898 | Ga0207692_10008873 | Ga0207692_100088733 | 381 |
| 685 | 3300025898 | Ga0207692_10013471 | Ga0207692_100134713 | 381 |
| 686 | 3300025898 | Ga0207692_10032938 | Ga0207692_100329382 | 381 |
| 687 | 3300025898 | Ga0207692_10168069 | Ga0207692_101680691 | 381 |
| 688 | 3300025899 | Ga0207642_10022066 | Ga0207642_100220661 | 381 |
| 689 | 3300025899 | Ga0207642_10042821 | Ga0207642_100428212 | 381 |
| 690 | 3300025904 | Ga0207647_10007857 | Ga0207647_100078577 | 381 |
| 691 | 3300025905 | Ga0207685_10000806 | Ga0207685_100008063 | 381 |
| 692 | 3300025906 | Ga0207699_10000503 | Ga0207699_100005034 | 381 |
| 693 | 3300025906 | Ga0207699_10015653 | Ga0207699_100156532 | 381 |
| 694 | 3300025906 | Ga0207699_10062610 | Ga0207699_100626101 | 381 |
| 695 | 3300025907 | Ga0207645_10079415 | Ga0207645_100794152 | 381 |
| 696 | 3300025911 | Ga0207654_10071689 | Ga0207654_100716891 | 381 |
| 697 | 3300025911 | Ga0207654_10144311 | Ga0207654_101443112 | 381 |
| 698 | 3300025912 | Ga0207707_10001896 | Ga0207707_100018965 | 381 |
| 699 | 3300025912 | Ga0207707_10007520 | Ga0207707_100075209 | 381 |
| 700 | 3300025912 | Ga0207707_10019033 | Ga0207707_100190334 | 381 |
| 701 | 3300025912 | Ga0207707_10031890 | Ga0207707_100318902 | 381 |
| 702 | 3300025912 | Ga0207707_10057854 | Ga0207707_100578543 | 381 |
| 703 | 3300025912 | Ga0207707_10060997 | Ga0207707_100609973 | 381 |
| 704 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008905 | 381 |
| 705 | 3300025913 | Ga0207695_10010954 | Ga0207695_100109545 | 381 |
| 706 | 3300025913 | Ga0207695_10030077 | Ga0207695_100300775 | 381 |
| 707 | 3300025913 | Ga0207695_10230368 | Ga0207695_102303681 | 381 |
| 708 | 3300025913 | Ga0207695_10236614 | Ga0207695_102366142 | 381 |
| 709 | 3300025914 | Ga0207671_10004345 | Ga0207671_100043455 | 381 |
| 710 | 3300025914 | Ga0207671_10161986 | Ga0207671_101619862 | 381 |
| 711 | 3300025915 | Ga0207693_10000085 | Ga0207693_1000008544 | 381 |
| 712 | 3300025915 | Ga0207693_10016551 | Ga0207693_100165512 | 381 |
| 713 | 3300025916 | Ga0207663_10000739 | Ga0207663_100007394 | 381 |
| 714 | 3300025916 | Ga0207663_10056741 | Ga0207663_100567413 | 381 |
| 715 | 3300025917 | Ga0207660_10018620 | Ga0207660_100186202 | 381 |
| 716 | 3300025917 | Ga0207660_10070860 | Ga0207660_100708602 | 381 |
| 717 | 3300025917 | Ga0207660_10096304 | Ga0207660_100963042 | 381 |
| 718 | 3300025919 | Ga0207657_10000245 | Ga0207657_100002454 | 381 |
| 719 | 3300025919 | Ga0207657_10061790 | Ga0207657_100617903 | 381 |
| 720 | 3300025919 | Ga0207657_10065902 | Ga0207657_100659022 | 381 |
| 721 | 3300025919 | Ga0207657_10109884 | Ga0207657_101098842 | 381 |
| 722 | 3300025919 | Ga0207657_10159485 | Ga0207657_101594851 | 381 |
| 723 | 3300025919 | Ga0207657_10210291 | Ga0207657_102102911 | 381 |
| 724 | 3300025920 | Ga0207649_10051062 | Ga0207649_100510622 | 381 |
| 725 | 3300025920 | Ga0207649_10229296 | Ga0207649_102292961 | 381 |
| 726 | 3300025921 | Ga0207652_10022732 | Ga0207652_100227324 | 381 |
| 727 | 3300025921 | Ga0207652_10048089 | Ga0207652_100480892 | 381 |
| 728 | 3300025921 | Ga0207652_10202865 | Ga0207652_102028652 | 381 |
| 729 | 3300025923 | Ga0207681_10076838 | Ga0207681_100768382 | 381 |
| 730 | 3300025924 | Ga0207694_10025256 | Ga0207694_100252563 | 381 |
| 731 | 3300025925 | Ga0207650_10049602 | Ga0207650_100496022 | 381 |
| 732 | 3300025926 | Ga0207659_10206837 | Ga0207659_102068371 | 381 |
| 733 | 3300025927 | Ga0207687_10205179 | Ga0207687_102051792 | 381 |
| 734 | 3300025928 | Ga0207700_10014467 | Ga0207700_100144672 | 381 |
| 735 | 3300025928 | Ga0207700_10118838 | Ga0207700_101188382 | 381 |
| 736 | 3300025929 | Ga0207664_10004463 | Ga0207664_100044634 | 381 |
| 737 | 3300025929 | Ga0207664_10010699 | Ga0207664_100106992 | 381 |
| 738 | 3300025931 | Ga0207644_10015614 | Ga0207644_100156143 | 381 |
| 739 | 3300025931 | Ga0207644_10048488 | Ga0207644_100484882 | 381 |
| 740 | 3300025932 | Ga0207690_10170538 | Ga0207690_101705382 | 381 |
| 741 | 3300025932 | Ga0207690_10229913 | Ga0207690_102299132 | 381 |
| 742 | 3300025933 | Ga0207706_10013176 | Ga0207706_100131766 | 381 |
| 743 | 3300025933 | Ga0207706_10018926 | Ga0207706_100189265 | 381 |
| 744 | 3300025934 | Ga0207686_10049526 | Ga0207686_100495262 | 381 |
| 745 | 3300025935 | Ga0207709_10094774 | Ga0207709_100947742 | 381 |
| 746 | 3300025936 | Ga0207670_10032123 | Ga0207670_100321232 | 381 |
| 747 | 3300025937 | Ga0207669_10015366 | Ga0207669_100153662 | 381 |
| 748 | 3300025938 | Ga0207704_10046849 | Ga0207704_100468492 | 381 |
| 749 | 3300025939 | Ga0207665_10000229 | Ga0207665_1000022927 | 381 |
| 750 | 3300025939 | Ga0207665_10011145 | Ga0207665_100111454 | 381 |
| 751 | 3300025939 | Ga0207665_10035278 | Ga0207665_100352782 | 381 |
| 752 | 3300025940 | Ga0207691_10008150 | Ga0207691_100081509 | 381 |
| 753 | 3300025940 | Ga0207691_10150637 | Ga0207691_101506372 | 381 |
| 754 | 3300025941 | Ga0207711_10002271 | Ga0207711_1000227110 | 381 |
| 755 | 3300025941 | Ga0207711_10030359 | Ga0207711_100303592 | 381 |
| 756 | 3300025942 | Ga0207689_10109021 | Ga0207689_101090212 | 381 |
| 757 | 3300025944 | Ga0207661_10000917 | Ga0207661_100009179 | 381 |
| 758 | 3300025944 | Ga0207661_10018018 | Ga0207661_100180183 | 381 |
| 759 | 3300025944 | Ga0207661_10221537 | Ga0207661_102215372 | 381 |
| 760 | 3300025949 | Ga0207667_10037702 | Ga0207667_100377023 | 381 |
| 761 | 3300025949 | Ga0207667_10200099 | Ga0207667_102000992 | 381 |
| 762 | 3300025960 | Ga0207651_10048453 | Ga0207651_100484532 | 381 |
| 763 | 3300025961 | Ga0207712_10016182 | Ga0207712_100161822 | 381 |
| 764 | 3300025961 | Ga0207712_10099233 | Ga0207712_100992332 | 381 |
| 765 | 3300025972 | Ga0207668_10008285 | Ga0207668_100082854 | 381 |
| 766 | 3300025972 | Ga0207668_10014124 | Ga0207668_100141243 | 381 |
| 767 | 3300025972 | Ga0207668_10116133 | Ga0207668_101161332 | 381 |
| 768 | 3300025986 | Ga0207658_10001754 | Ga0207658_1000175415 | 381 |
| 769 | 3300025986 | Ga0207658_10026085 | Ga0207658_100260852 | 381 |
| 770 | 3300025986 | Ga0207658_10162191 | Ga0207658_101621912 | 381 |
| 771 | 3300026023 | Ga0207677_10025562 | Ga0207677_100255623 | 381 |
| 772 | 3300026041 | Ga0207639_10002832 | Ga0207639_100028326 | 381 |
| 773 | 3300026067 | Ga0207678_10000788 | Ga0207678_100007883 | 381 |
| 774 | 3300026067 | Ga0207678_10024231 | Ga0207678_100242313 | 381 |
| 775 | 3300026067 | Ga0207678_10069922 | Ga0207678_100699222 | 381 |
| 776 | 3300026067 | Ga0207678_10094459 | Ga0207678_100944592 | 381 |
| 777 | 3300026067 | Ga0207678_10095328 | Ga0207678_100953282 | 381 |
| 778 | 3300026067 | Ga0207678_10123308 | Ga0207678_101233082 | 381 |
| 779 | 3300026078 | Ga0207702_10001708 | Ga0207702_1000170818 | 381 |
| 780 | 3300026078 | Ga0207702_10130329 | Ga0207702_101303292 | 381 |
| 781 | 3300026088 | Ga0207641_10283667 | Ga0207641_102836672 | 381 |
| 782 | 3300026089 | Ga0207648_10072089 | Ga0207648_100720893 | 381 |
| 783 | 3300026089 | Ga0207648_10160704 | Ga0207648_101607041 | 381 |
| 784 | 3300026095 | Ga0207676_10006093 | Ga0207676_100060933 | 381 |
| 785 | 3300026095 | Ga0207676_10070618 | Ga0207676_100706182 | 381 |
| 786 | 3300026116 | Ga0207674_10000253 | Ga0207674_1000025340 | 381 |
| 787 | 3300026116 | Ga0207674_10006543 | Ga0207674_100065433 | 381 |
| 788 | 3300026116 | Ga0207674_10222202 | Ga0207674_102222022 | 381 |
| 789 | 3300026118 | Ga0207675_100311200 | Ga0207675_1003112001 | 381 |
| 790 | 3300026121 | Ga0207683_10001491 | Ga0207683_100014918 | 381 |
| 791 | 3300026121 | Ga0207683_10014022 | Ga0207683_100140223 | 381 |
| 792 | 3300026121 | Ga0207683_10019680 | Ga0207683_100196803 | 381 |
| 793 | 3300026142 | Ga0207698_10135209 | Ga0207698_101352092 | 381 |
| 794 | 3300026142 | Ga0207698_10169769 | Ga0207698_101697692 | 381 |
| 795 | 3300026142 | Ga0207698_10175830 | Ga0207698_101758301 | 381 |
| 796 | 3300027296 | Ga0209389_1000001 | Ga0209389_100000132 | 381 |
| 797 | 3300027296 | Ga0209389_1000014 | Ga0209389_100001465 | 381 |
| 798 | 3300027357 | Ga0209589_1000011 | Ga0209589_1000011120 | 381 |
| 799 | 3300027357 | Ga0209589_1000020 | Ga0209589_100002065 | 381 |
| 800 | 3300027361 | Ga0209489_100012 | Ga0209489_100012120 | 381 |
| 801 | 3300027361 | Ga0209489_100060 | Ga0209489_10006024 | 381 |
| 802 | 3300027361 | Ga0209489_101114 | Ga0209489_10111429 | 381 |
| 803 | 3300027363 | Ga0209700_100007 | Ga0209700_100007372 | 381 |
| 804 | 3300027363 | Ga0209700_100019 | Ga0209700_100019120 | 381 |
| 805 | 3300027543 | Ga0209999_1018986 | Ga0209999_10189861 | 381 |
| 806 | 3300027695 | Ga0209966_1002395 | Ga0209966_10023953 | 381 |
| 807 | 3300027907 | Ga0207428_10143682 | Ga0207428_101436822 | 381 |
| 808 | 3300028379 | Ga0268266_10001272 | Ga0268266_1000127211 | 381 |
| 809 | 3300028379 | Ga0268266_10045429 | Ga0268266_100454292 | 381 |
| 810 | 3300028379 | Ga0268266_10113881 | Ga0268266_101138812 | 381 |
| 811 | 3300028380 | Ga0268265_10071486 | Ga0268265_100714862 | 381 |
| 812 | 3300028380 | Ga0268265_10365416 | Ga0268265_103654162 | 381 |
| 813 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030352 | 381 |
| 814 | 3300028381 | Ga0268264_10499558 | Ga0268264_104995581 | 381 |
| 815 | 3300028573 | Ga0265334_10059873 | Ga0265334_100598732 | 381 |
| 816 | 3300028786 | Ga0307517_10001377 | Ga0307517_1000137730 | 381 |
| 817 | 3300028794 | Ga0307515_10000417 | Ga0307515_1000041729 | 381 |
| 818 | 3300028794 | Ga0307515_10000477 | Ga0307515_1000047751 | 381 |
| 819 | 3300028794 | Ga0307515_10071901 | Ga0307515_100719014 | 381 |
| 820 | 3300028794 | Ga0307515_10093229 | Ga0307515_100932293 | 381 |
| 821 | 3300028800 | Ga0265338_10004642 | Ga0265338_1000464210 | 381 |
| 822 | 3300031235 | Ga0265330_10040262 | Ga0265330_100402622 | 381 |
| 823 | 3300031247 | Ga0265340_10062699 | Ga0265340_100626991 | 381 |
| 824 | 3300031249 | Ga0265339_10037898 | Ga0265339_100378983 | 381 |
| 825 | 3300031251 | Ga0265327_10013461 | Ga0265327_100134612 | 381 |
| 826 | 3300031344 | Ga0265316_10121496 | Ga0265316_101214962 | 381 |
| 827 | 3300031456 | Ga0307513_10022829 | Ga0307513_100228294 | 381 |
| 828 | 3300031456 | Ga0307513_10046501 | Ga0307513_100465012 | 381 |
| 829 | 3300031507 | Ga0307509_10156515 | Ga0307509_101565152 | 381 |
| 830 | 3300031507 | Ga0307509_10171185 | Ga0307509_101711852 | 381 |
| 831 | 3300031548 | Ga0307408_100047872 | Ga0307408_1000478722 | 381 |
| 832 | 3300031595 | Ga0265313_10013689 | Ga0265313_100136891 | 381 |
| 833 | 3300031616 | Ga0307508_10000015 | Ga0307508_10000015119 | 381 |
| 834 | 3300031711 | Ga0265314_10002234 | Ga0265314_1000223416 | 381 |
| 835 | 3300031711 | Ga0265314_10002758 | Ga0265314_100027585 | 381 |
| 836 | 3300031711 | Ga0265314_10013252 | Ga0265314_100132524 | 381 |
| 837 | 3300031712 | Ga0265342_10024663 | Ga0265342_100246633 | 381 |
| 838 | 3300031730 | Ga0307516_10002523 | Ga0307516_1000252321 | 381 |
| 839 | 3300031730 | Ga0307516_10004543 | Ga0307516_100045438 | 381 |
| 840 | 3300031730 | Ga0307516_10010277 | Ga0307516_1001027713 | 381 |
| 841 | 3300031824 | Ga0307413_10042181 | Ga0307413_100421812 | 381 |
| 842 | 3300031852 | Ga0307410_10070931 | Ga0307410_100709312 | 381 |
| 843 | 3300031852 | Ga0307410_10106018 | Ga0307410_101060182 | 381 |
| 844 | 3300031901 | Ga0307406_10045617 | Ga0307406_100456172 | 381 |
| 845 | 3300031903 | Ga0307407_10049465 | Ga0307407_100494652 | 381 |
| 846 | 3300031911 | Ga0307412_10061387 | Ga0307412_100613872 | 381 |
| 847 | 3300032002 | Ga0307416_100070997 | Ga0307416_1000709972 | 381 |
| 848 | 3300032005 | Ga0307411_10057952 | Ga0307411_100579521 | 381 |
| 849 | 3300032133 | Ga0316583_10005887 | Ga0316583_100058874 | 381 |
| 850 | 3300033179 | Ga0307507_10034988 | Ga0307507_100349882 | 381 |
| 851 | 3300033180 | Ga0307510_10007552 | Ga0307510_1000755210 | 381 |
| 852 | 3300033180 | Ga0307510_10010054 | Ga0307510_100100547 | 381 |
| 853 | 3300033180 | Ga0307510_10148735 | Ga0307510_101487352 | 381 |
| 854 | 3300033442 | Ga0315911_1000002 | Ga0315911_100000234 | 381 |
| 855 | 3300035117 | Ga0373953_0003240 | Ga0373953_0003240_1215_2366 | 381 |
| 856 | 3300035118 | Ga0373954_0002051 | Ga0373954_0002051_1320_2471 | 381 |
| 857 | 3300035118 | Ga0373954_0110339 | Ga0373954_0110339_153_1304 | 381 |
| 858 | 3300035171 | Ga0373946_0009678 | Ga0373946_0009678_566_1837 | 381 |
| 859 | 3300035410 | Ga0373924_0011463 | Ga0373924_0011463_1216_2367 | 381 |
| 860 | 3300035692 | Ga0373935_0002404 | Ga0373935_0002404_7557_8708 | 381 |
| 861 | 3300035692 | Ga0373935_0047935 | Ga0373935_0047935_1483_2634 | 381 |
| 862 | 3300035692 | Ga0373935_0125490 | Ga0373935_0125490_388_1539 | 381 |
| 863 | 3300035695 | Ga0373927_0000783 | Ga0373927_0000783_11603_12754 | 381 |
| 864 | 3300035695 | Ga0373927_0004757 | Ga0373927_0004757_1454_2605 | 381 |
| 865 | 3300035695 | Ga0373927_0050912 | Ga0373927_0050912_726_1877 | 381 |
| 866 | 3300035724 | Ga0373933_0019929 | Ga0373933_0019929_232_1383 | 381 |
| 867 | 3300035724 | Ga0373933_0085873 | Ga0373933_0085873_271_1422 | 381 |
| 868 | 3300035724 | Ga0373933_0110932 | Ga0373933_0110932_27_1178 | 381 |
| 869 | 3300035725 | Ga0373947_0002483 | Ga0373947_0002483_812_1963 | 381 |
| 870 | 3300035725 | Ga0373947_0005531 | Ga0373947_0005531_2192_3343 | 381 |
| 871 | 3300035725 | Ga0373947_0049392 | Ga0373947_0049392_1118_2482 | 381 |
| 872 | 3300036401 | Ga0373937_0116679 | Ga0373937_0116679_252_1403 | 381 |
| 873 | 3300036459 | Ga0372808_010978 | Ga0372808_010978_71_1222 | 381 |
| 874 | 3300037068 | Ga0373925_0033388 | Ga0373925_0033388_1168_2319 | 381 |
| 875 | 3300037068 | Ga0373925_0062989 | Ga0373925_0062989_267_1418 | 381 |
| 876 | 3300037312 | Ga0395899_0003168 | Ga0395899_0003168_6410_7561 | 381 |
| 877 | 3300037312 | Ga0395899_0119155 | Ga0395899_0119155_471_1622 | 381 |
| 878 | 3300037418 | Ga0395900_0001070 | Ga0395900_0001070_15828_16979 | 381 |
| 879 | 3300037418 | Ga0395900_0005737 | Ga0395900_0005737_1877_3028 | 381 |
| 880 | 3300037418 | Ga0395900_0074549 | Ga0395900_0074549_2288_3439 | 381 |
| 881 | 3300037418 | Ga0395900_0170764 | Ga0395900_0170764_153_1304 | 381 |
| 882 | 3300037466 | Ga0395898_0003538 | Ga0395898_0003538_4358_5509 | 381 |
| 883 | 3300037466 | Ga0395898_0009135 | Ga0395898_0009135_79_1230 | 381 |
| 884 | 3300037466 | Ga0395898_0030821 | Ga0395898_0030821_3387_4538 | 381 |
| 885 | 3300037466 | Ga0395898_0030823 | Ga0395898_0030823_3286_4437 | 381 |
| 886 | 3300037466 | Ga0395898_0066901 | Ga0395898_0066901_2013_3164 | 381 |
| 887 | 3300037466 | Ga0395898_0170035 | Ga0395898_0170035_305_1456 | 381 |
| 888 | 3300037466 | Ga0395898_0367021 | Ga0395898_0367021_186_1337 | 381 |
| 889 | 3300037471 | Ga0395905_0009454 | Ga0395905_0009454_2449_3600 | 381 |
| 890 | 3300037471 | Ga0395905_0154216 | Ga0395905_0154216_69_1220 | 381 |
| 891 | 3300037471 | Ga0395905_0167690 | Ga0395905_0167690_390_1541 | 381 |
| 892 | 3300037853 | Ga0436364_1166954 | Ga0436364_1166954_3801_4952 | 381 |
| 893 | 3300037853 | Ga0436364_1341441 | Ga0436364_1341441_1386_2543 | 381 |
| 894 | 3300038443 | Ga0395901_0037136 | Ga0395901_0037136_1438_2589 | 381 |
| 895 | 3300038443 | Ga0395901_0046711 | Ga0395901_0046711_2072_3223 | 381 |
| 896 | 3300038443 | Ga0395901_0122876 | Ga0395901_0122876_40_1191 | 381 |
| 897 | 3300038443 | Ga0395901_0182148 | Ga0395901_0182148_624_1775 | 381 |
| 898 | 3300038443 | Ga0395901_0239195 | Ga0395901_0239195_666_1817 | 381 |
| 899 | 3300038443 | Ga0395901_0392404 | Ga0395901_0392404_165_1316 | 381 |
| 900 | 3300039437 | Ga0436365_0052183 | Ga0436365_0052183_11491_12636 | 381 |
| 901 | 3300039437 | Ga0436365_0828830 | Ga0436365_0828830_256_1401 | 381 |
| 902 | 3300039437 | Ga0436365_0873719 | Ga0436365_0873719_2409_3557 | 381 |
| 903 | 3300039437 | Ga0436365_1136356 | Ga0436365_1136356_4882_6033 | 381 |
| 904 | 3300039450 | Ga0436363_1246162 | Ga0436363_1246162_978_2129 | 381 |
| 905 | 3300042156 | Ga0439446_0034412 | Ga0439446_0034412_284_1438 | 381 |
| 906 | 3300042157 | Ga0439458_0005150 | Ga0439458_0005150_805_1956 | 381 |
| 907 | 3300044658 | Ga0466972_0000113 | Ga0466972_0000113_1267_2418 | 381 |
| 908 | 3300044658 | Ga0466972_0008577 | Ga0466972_0008577_2847_3998 | 381 |
| 909 | 3300044684 | Ga0466966_0000094 | Ga0466966_0000094_29393_30544 | 381 |
| 910 | 3300044693 | Ga0466961_0000118 | Ga0466961_0000118_12824_13975 | 381 |
| 911 | 3300044694 | Ga0466963_0028581 | Ga0466963_0028581_2071_3222 | 381 |
| 912 | 3300044694 | Ga0466963_0053875 | Ga0466963_0053875_1299_2477 | 381 |
| 913 | 3300044765 | Ga0466970_0031842 | Ga0466970_0031842_197_1348 | 381 |
| 914 | 3300044901 | Ga0466960_0120251 | Ga0466960_0120251_128_1279 | 381 |
| 915 | 3300045049 | Ga0466959_0065076 | Ga0466959_0065076_788_1939 | 381 |
| 916 | 3300045049 | Ga0466959_0113703 | Ga0466959_0113703_746_1897 | 381 |
| 917 | 3300045836 | Ga0466958_0006856 | Ga0466958_0006856_2062_3222 | 381 |
| 918 | 3300045976 | Ga0466967_0263578 | Ga0466967_0263578_358_1509 | 381 |
| 919 | 3300046452 | Ga0495617_011415 | Ga0495617_011415_319_1470 | 381 |
| 920 | 3300046453 | Ga0495627_034423 | Ga0495627_034423_208_1359 | 381 |
| 921 | 3300046454 | Ga0495592_0025176 | Ga0495592_0025176_1003_2154 | 381 |
| 922 | 3300046454 | Ga0495592_0037086 | Ga0495592_0037086_25_1176 | 381 |
| 923 | 3300046454 | Ga0495592_0045952 | Ga0495592_0045952_54_1205 | 381 |
| 924 | 3300046454 | Ga0495592_0046108 | Ga0495592_0046108_101_1252 | 381 |
| 925 | 3300046455 | Ga0495603_0001681 | Ga0495603_0001681_3698_4849 | 381 |
| 926 | 3300046455 | Ga0495603_0002554 | Ga0495603_0002554_8804_9955 | 381 |
| 927 | 3300046455 | Ga0495603_0131829 | Ga0495603_0131829_77_1441 | 381 |
| 928 | 3300046459 | Ga0495629_0000077 | Ga0495629_0000077_79388_80539 | 381 |
| 929 | 3300046459 | Ga0495629_0000165 | Ga0495629_0000165_52408_53559 | 381 |
| 930 | 3300046459 | Ga0495629_0033399 | Ga0495629_0033399_334_1485 | 381 |
| 931 | 3300046460 | Ga0495638_0018892 | Ga0495638_0018892_1632_2783 | 381 |
| 932 | 3300046460 | Ga0495638_0045820 | Ga0495638_0045820_327_1478 | 381 |
| 933 | 3300046460 | Ga0495638_0050514 | Ga0495638_0050514_432_1583 | 381 |
| 934 | 3300046461 | Ga0495641_0000929 | Ga0495641_0000929_4033_5184 | 381 |
| 935 | 3300046462 | Ga0495651_0009827 | Ga0495651_0009827_3906_5057 | 381 |
| 936 | 3300046462 | Ga0495651_0045132 | Ga0495651_0045132_2231_3382 | 381 |
| 937 | 3300046462 | Ga0495651_0106556 | Ga0495651_0106556_464_1615 | 381 |
| 938 | 3300046463 | Ga0495653_0002848 | Ga0495653_0002848_7231_8382 | 381 |
| 939 | 3300046472 | Ga0495580_0000913 | Ga0495580_0000913_198_1349 | 381 |
| 940 | 3300046473 | Ga0495582_0000016 | Ga0495582_0000016_93879_95030 | 381 |
| 941 | 3300046473 | Ga0495582_0018865 | Ga0495582_0018865_2355_3719 | 381 |
| 942 | 3300046473 | Ga0495582_0020941 | Ga0495582_0020941_2001_3152 | 381 |
| 943 | 3300046475 | Ga0495639_0000014 | Ga0495639_0000014_13037_14188 | 381 |
| 944 | 3300046476 | Ga0495662_0000086 | Ga0495662_0000086_10239_11390 | 381 |
| 945 | 3300046476 | Ga0495662_0032757 | Ga0495662_0032757_268_1419 | 381 |
| 946 | 3300046477 | Ga0495664_0008014 | Ga0495664_0008014_1052_2203 | 381 |
| 947 | 3300046477 | Ga0495664_0180595 | Ga0495664_0180595_30_1181 | 381 |
| 948 | 3300046492 | Ga0495585_0021846 | Ga0495585_0021846_1847_2998 | 381 |
| 949 | 3300046499 | Ga0495594_0000420 | Ga0495594_0000420_13760_14911 | 381 |
| 950 | 3300046501 | Ga0495607_0140319 | Ga0495607_0140319_53_1204 | 381 |
| 951 | 3300046507 | Ga0495606_0000196 | Ga0495606_0000196_57310_58461 | 381 |
| 952 | 3300046507 | Ga0495606_0030531 | Ga0495606_0030531_1084_2235 | 381 |
| 953 | 3300046507 | Ga0495606_0033015 | Ga0495606_0033015_646_1797 | 381 |
| 954 | 3300046512 | Ga0495610_0031313 | Ga0495610_0031313_1056_2207 | 381 |
| 955 | 3300046512 | Ga0495610_0042674 | Ga0495610_0042674_262_1413 | 381 |
| 956 | 3300046513 | Ga0495616_0048545 | Ga0495616_0048545_915_2066 | 381 |
| 957 | 3300046513 | Ga0495616_0052358 | Ga0495616_0052358_619_1770 | 381 |
| 958 | 3300046513 | Ga0495616_0083181 | Ga0495616_0083181_318_1469 | 381 |
| 959 | 3300046516 | Ga0495628_0048184 | Ga0495628_0048184_2099_3250 | 381 |
| 960 | 3300046516 | Ga0495628_0079685 | Ga0495628_0079685_1196_2347 | 381 |
| 961 | 3300046517 | Ga0495630_0003176 | Ga0495630_0003176_5812_6963 | 381 |
| 962 | 3300046517 | Ga0495630_0034979 | Ga0495630_0034979_511_1662 | 381 |
| 963 | 3300046518 | Ga0495631_0017160 | Ga0495631_0017160_1823_2974 | 381 |
| 964 | 3300046519 | Ga0495632_0034239 | Ga0495632_0034239_1062_2213 | 381 |
| 965 | 3300046522 | Ga0495643_0040171 | Ga0495643_0040171_534_1685 | 381 |
| 966 | 3300046524 | Ga0495648_0011613 | Ga0495648_0011613_3340_4491 | 381 |
| 967 | 3300046524 | Ga0495648_0030140 | Ga0495648_0030140_809_1960 | 381 |
| 968 | 3300046529 | Ga0495652_0004103 | Ga0495652_0004103_11731_12882 | 381 |
| 969 | 3300046529 | Ga0495652_0028184 | Ga0495652_0028184_2447_3598 | 381 |
| 970 | 3300046529 | Ga0495652_0032661 | Ga0495652_0032661_1697_2848 | 381 |
| 971 | 3300046529 | Ga0495652_0070350 | Ga0495652_0070350_838_1989 | 381 |
| 972 | 3300046530 | Ga0495654_0008669 | Ga0495654_0008669_3158_4309 | 381 |
| 973 | 3300046531 | Ga0495665_0000665 | Ga0495665_0000665_1802_2953 | 381 |
| 974 | 3300046533 | Ga0495640_0007412 | Ga0495640_0007412_6622_7773 | 381 |
| 975 | 3300046533 | Ga0495640_0008807 | Ga0495640_0008807_981_2132 | 381 |
| 976 | 3300046533 | Ga0495640_0047285 | Ga0495640_0047285_19_1170 | 381 |
| 977 | 3300046533 | Ga0495640_0130271 | Ga0495640_0130271_18_1169 | 381 |
| 978 | 3300046543 | Ga0495645_0018393 | Ga0495645_0018393_3036_4187 | 381 |
| 979 | 3300046543 | Ga0495645_0100232 | Ga0495645_0100232_419_1570 | 381 |
| 980 | 3300046557 | Ga0495622_0005435 | Ga0495622_0005435_2404_3555 | 381 |
| 981 | 3300046557 | Ga0495622_0048603 | Ga0495622_0048603_44_1195 | 381 |
| 982 | 3300046557 | Ga0495622_0048651 | Ga0495622_0048651_703_1854 | 381 |
| 983 | 3300046557 | Ga0495622_0056184 | Ga0495622_0056184_207_1358 | 381 |
| 984 | 3300046559 | Ga0495667_0039628 | Ga0495667_0039628_1576_2727 | 381 |
| 985 | 3300046559 | Ga0495667_0064174 | Ga0495667_0064174_477_1628 | 381 |
| 986 | 3300046615 | Ga0495656_0002336 | Ga0495656_0002336_2750_3901 | 381 |
| 987 | 3300046615 | Ga0495656_0025305 | Ga0495656_0025305_1179_2330 | 381 |
| 988 | 3300046616 | Ga0495668_0041374 | Ga0495668_0041374_298_1449 | 381 |
| 989 | 3300046616 | Ga0495668_0078731 | Ga0495668_0078731_435_1586 | 381 |
| 990 | 3300046642 | Ga0495634_0000859 | Ga0495634_0000859_24104_25255 | 381 |
| 991 | 3300046660 | Ga0495625_0219120 | Ga0495625_0219120_50_1201 | 381 |
| 992 | 3300046663 | Ga0495635_0000160 | Ga0495635_0000160_2460_3611 | 381 |
| 993 | 3300046663 | Ga0495635_0010832 | Ga0495635_0010832_2781_3932 | 381 |
| 994 | 3300046663 | Ga0495635_0090783 | Ga0495635_0090783_448_1599 | 381 |
| 995 | 3300046665 | Ga0495661_0055948 | Ga0495661_0055948_1155_2306 | 381 |
| 996 | 3300046675 | Ga0495657_0005563 | Ga0495657_0005563_7351_8502 | 381 |
| 997 | 3300046675 | Ga0495657_0030874 | Ga0495657_0030874_666_1817 | 381 |
| 998 | 3300046678 | Ga0495599_0002061 | Ga0495599_0002061_10342_11493 | 381 |
| 999 | 3300046679 | Ga0495623_0014196 | Ga0495623_0014196_1889_3040 | 381 |
| 1000 | 3300046680 | Ga0495646_0040336 | Ga0495646_0040336_939_2090 | 381 |
| 1001 | 3300046680 | Ga0495646_0046774 | Ga0495646_0046774_514_1665 | 381 |
| 1002 | 3300046683 | Ga0495658_0001756 | Ga0495658_0001756_8038_9189 | 381 |
| 1003 | 3300046684 | Ga0495669_0001159 | Ga0495669_0001159_9549_10700 | 381 |
| 1004 | 3300046690 | Ga0495624_0000138 | Ga0495624_0000138_18237_19388 | 381 |
| 1005 | 3300046690 | Ga0495624_0015049 | Ga0495624_0015049_4063_5214 | 381 |
| 1006 | 3300046690 | Ga0495624_0124961 | Ga0495624_0124961_19_1170 | 381 |
| 1007 | 3300046690 | Ga0495624_0135809 | Ga0495624_0135809_220_1371 | 381 |
| 1008 | 3300046691 | Ga0495670_0081736 | Ga0495670_0081736_93_1244 | 381 |
| 1009 | 3300046692 | Ga0495671_0070797 | Ga0495671_0070797_526_1677 | 381 |
| 1010 | 3300046809 | Ga0495600_0003305 | Ga0495600_0003305_2597_3748 | 381 |
| 1011 | 3300046809 | Ga0495600_0005469 | Ga0495600_0005469_2349_3500 | 381 |
| 1012 | 3300046809 | Ga0495600_0005851 | Ga0495600_0005851_4165_5316 | 381 |
| 1013 | 3300047315 | Ga0495581_0000001 | Ga0495581_0000001_61384_62535 | 381 |
| 1014 | 3300047317 | Ga0495604_0005301 | Ga0495604_0005301_120_1271 | 381 |
| 1015 | 3300047317 | Ga0495604_0006543 | Ga0495604_0006543_6600_7751 | 381 |
| 1016 | 3300047317 | Ga0495604_0039854 | Ga0495604_0039854_1139_2290 | 381 |
| 1017 | 3300047317 | Ga0495604_0071998 | Ga0495604_0071998_702_1853 | 381 |
| 1018 | 3300047319 | Ga0495674_0002545 | Ga0495674_0002545_15_1166 | 381 |
| 1019 | 3300047319 | Ga0495674_0008583 | Ga0495674_0008583_4473_5624 | 381 |
| 1020 | 3300047319 | Ga0495674_0020945 | Ga0495674_0020945_3051_4202 | 381 |
| 1021 | 3300047319 | Ga0495674_0119699 | Ga0495674_0119699_100_1464 | 381 |
| 1022 | 3300047320 | Ga0495672_0073357 | Ga0495672_0073357_413_1564 | 381 |
| 1023 | 3300047320 | Ga0495672_0104025 | Ga0495672_0104025_349_1500 | 381 |
| 1024 | 3300047321 | Ga0495676_0032214 | Ga0495676_0032214_2323_3474 | 381 |
| 1025 | 3300047322 | Ga0495680_0003866 | Ga0495680_0003866_12849_14000 | 381 |
| 1026 | 3300047323 | Ga0495683_0050327 | Ga0495683_0050327_577_1728 | 381 |
| 1027 | 3300047443 | Ga0495687_055047 | Ga0495687_055047_191_1342 | 381 |
| 1028 | 3300047444 | Ga0495675_0002075 | Ga0495675_0002075_1814_2965 | 381 |
| 1029 | 3300047444 | Ga0495675_0002727 | Ga0495675_0002727_1139_2290 | 381 |
| 1030 | 3300047444 | Ga0495675_0161884 | Ga0495675_0161884_90_1241 | 381 |
| 1031 | 3300047445 | Ga0495677_0024754 | Ga0495677_0024754_261_1412 | 381 |
| 1032 | 3300047469 | Ga0495673_0021201 | Ga0495673_0021201_1224_2375 | 381 |
| 1033 | 3300047469 | Ga0495673_0036636 | Ga0495673_0036636_675_1826 | 381 |
| 1034 | 3300047471 | Ga0495684_0001407 | Ga0495684_0001407_14267_15418 | 381 |
| 1035 | 3300047471 | Ga0495684_0015407 | Ga0495684_0015407_1924_3075 | 381 |
| 1036 | 3300047471 | Ga0495684_0095266 | Ga0495684_0095266_860_2011 | 381 |
| 1037 | 3300047472 | Ga0495686_0093016 | Ga0495686_0093016_366_1517 | 381 |
| 1038 | 3300047673 | Ga0495593_0021689 | Ga0495593_0021689_1786_2937 | 381 |
| 1039 | 3300047673 | Ga0495593_0044214 | Ga0495593_0044214_868_2019 | 381 |
| 1040 | 3300048088 | Ga0495602_0115391 | Ga0495602_0115391_224_1375 | 381 |
| 1041 | 3300048088 | Ga0495602_0135074 | Ga0495602_0135074_604_1755 | 381 |
| 1042 | 3300048905 | Ga0496102_0004364 | Ga0496102_0004364_3576_4727 | 381 |
| 1043 | 3300048905 | Ga0496102_0126693 | Ga0496102_0126693_825_1976 | 381 |
| 1044 | 3300048906 | Ga0496103_0030153 | Ga0496103_0030153_438_1589 | 381 |
| 1045 | 3300048907 | Ga0496104_0023586 | Ga0496104_0023586_2694_3845 | 381 |
| 1046 | 3300048907 | Ga0496104_0291444 | Ga0496104_0291444_13_1164 | 381 |
| 1047 | 3300048908 | Ga0496105_0021651 | Ga0496105_0021651_3340_4491 | 381 |
| 1048 | 3300048909 | Ga0496106_0005916 | Ga0496106_0005916_6404_7555 | 381 |
| 1049 | 3300048909 | Ga0496106_0346451 | Ga0496106_0346451_15_1166 | 381 |
| 1050 | 3300048910 | Ga0496107_0114635 | Ga0496107_0114635_159_1310 | 381 |
| 1051 | 3300048912 | Ga0496109_0104237 | Ga0496109_0104237_208_1359 | 381 |
| 1052 | 3300048912 | Ga0496109_0221039 | Ga0496109_0221039_131_1282 | 381 |
| 1053 | 3300048913 | Ga0496110_0031172 | Ga0496110_0031172_2377_3528 | 381 |
| 1054 | 3300048913 | Ga0496110_0087682 | Ga0496110_0087682_1253_2404 | 381 |
| 1055 | 3300048913 | Ga0496110_0089255 | Ga0496110_0089255_118_1269 | 381 |
| 1056 | 3300048913 | Ga0496110_0327100 | Ga0496110_0327100_192_1343 | 381 |
| 1057 | 3300048914 | Ga0496111_0028518 | Ga0496111_0028518_2445_3596 | 381 |
| 1058 | 3300048914 | Ga0496111_0040389 | Ga0496111_0040389_907_2058 | 381 |
| 1059 | 3300048914 | Ga0496111_0132461 | Ga0496111_0132461_220_1371 | 381 |
| 1060 | 3300048914 | Ga0496111_0196314 | Ga0496111_0196314_69_1220 | 381 |
| 1061 | 3300048915 | Ga0496112_0000044 | Ga0496112_0000044_21213_22364 | 381 |
| 1062 | 3300048915 | Ga0496112_0000342 | Ga0496112_0000342_8454_9605 | 381 |
| 1063 | 3300048915 | Ga0496112_0014805 | Ga0496112_0014805_4691_5842 | 381 |
| 1064 | 3300048915 | Ga0496112_0021871 | Ga0496112_0021871_4253_5404 | 381 |
| 1065 | 3300048915 | Ga0496112_0255827 | Ga0496112_0255827_153_1304 | 381 |
| 1066 | 3300048915 | Ga0496112_0323815 | Ga0496112_0323815_320_1471 | 381 |
| 1067 | 3300048916 | Ga0496113_0005475 | Ga0496113_0005475_1225_2376 | 381 |
| 1068 | 3300048916 | Ga0496113_0029593 | Ga0496113_0029593_2489_3640 | 381 |
| 1069 | 3300048916 | Ga0496113_0085949 | Ga0496113_0085949_229_1380 | 381 |
| 1070 | 3300048917 | Ga0496114_0017464 | Ga0496114_0017464_744_1895 | 381 |
| 1071 | 3300048917 | Ga0496114_0051070 | Ga0496114_0051070_1936_3087 | 381 |
| 1072 | 3300048917 | Ga0496114_0144403 | Ga0496114_0144403_439_1602 | 381 |
| 1073 | 3300048918 | Ga0496115_0000619 | Ga0496115_0000619_19936_21147 | 381 |
| 1074 | 3300048918 | Ga0496115_0089498 | Ga0496115_0089498_721_1872 | 381 |
| 1075 | 3300048920 | Ga0496117_0010855 | Ga0496117_0010855_510_1661 | 381 |
| 1076 | 3300048920 | Ga0496117_0022245 | Ga0496117_0022245_1127_2278 | 381 |
| 1077 | 3300048920 | Ga0496117_0061701 | Ga0496117_0061701_1403_2554 | 381 |
| 1078 | 3300048921 | Ga0496118_0006532 | Ga0496118_0006532_8131_9282 | 381 |
| 1079 | 3300048921 | Ga0496118_0020316 | Ga0496118_0020316_3542_4693 | 381 |
| 1080 | 3300048922 | Ga0496119_0019407 | Ga0496119_0019407_2839_3990 | 381 |
| 1081 | 3300048922 | Ga0496119_0073072 | Ga0496119_0073072_438_1589 | 381 |
| 1082 | 3300048922 | Ga0496119_0083148 | Ga0496119_0083148_504_1655 | 381 |
| 1083 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_125918_127069 | 381 |
| 1084 | 3300048924 | Ga0496121_0001183 | Ga0496121_0001183_1763_2914 | 381 |
| 1085 | 3300048924 | Ga0496121_0001244 | Ga0496121_0001244_6152_7303 | 381 |
| 1086 | 3300048924 | Ga0496121_0003563 | Ga0496121_0003563_13791_14942 | 381 |
| 1087 | 3300048924 | Ga0496121_0012601 | Ga0496121_0012601_4170_5321 | 381 |
| 1088 | 3300048924 | Ga0496121_0023065 | Ga0496121_0023065_1999_3150 | 381 |
| 1089 | 3300048924 | Ga0496121_0026867 | Ga0496121_0026867_2121_3272 | 381 |
| 1090 | 3300048924 | Ga0496121_0057954 | Ga0496121_0057954_1646_2893 | 381 |
| 1091 | 3300048924 | Ga0496121_0063495 | Ga0496121_0063495_1255_2406 | 381 |
| 1092 | 3300048924 | Ga0496121_0073802 | Ga0496121_0073802_620_1771 | 381 |
| 1093 | 3300048924 | Ga0496121_0106593 | Ga0496121_0106593_454_1605 | 381 |
| 1094 | 3300048924 | Ga0496121_0147697 | Ga0496121_0147697_117_1268 | 381 |
| 1095 | 3300048925 | Ga0496122_0029843 | Ga0496122_0029843_1864_3015 | 381 |
| 1096 | 3300048925 | Ga0496122_0115546 | Ga0496122_0115546_119_1270 | 381 |
| 1097 | 3300048926 | Ga0496123_0037136 | Ga0496123_0037136_1653_2804 | 381 |
| 1098 | 3300048927 | Ga0496124_0000624 | Ga0496124_0000624_30738_31889 | 381 |
| 1099 | 3300048928 | Ga0496125_0000504 | Ga0496125_0000504_23519_24670 | 381 |
| 1100 | 3300048928 | Ga0496125_0000712 | Ga0496125_0000712_40457_41608 | 381 |
| 1101 | 3300048928 | Ga0496125_0009811 | Ga0496125_0009811_5946_7097 | 381 |
| 1102 | 3300048928 | Ga0496125_0051838 | Ga0496125_0051838_346_1497 | 381 |
| 1103 | 3300048929 | Ga0496126_0007021 | Ga0496126_0007021_5772_6923 | 381 |
| 1104 | 3300048929 | Ga0496126_0008123 | Ga0496126_0008123_8256_9407 | 381 |
| 1105 | 3300048929 | Ga0496126_0008842 | Ga0496126_0008842_1505_2656 | 381 |
| 1106 | 3300048929 | Ga0496126_0010850 | Ga0496126_0010850_3288_4439 | 381 |
| 1107 | 3300048929 | Ga0496126_0011784 | Ga0496126_0011784_6005_7156 | 381 |
| 1108 | 3300048929 | Ga0496126_0020974 | Ga0496126_0020974_4672_5823 | 381 |
| 1109 | 3300048929 | Ga0496126_0031915 | Ga0496126_0031915_492_1643 | 381 |
| 1110 | 3300048929 | Ga0496126_0049331 | Ga0496126_0049331_1075_2226 | 381 |
| 1111 | 3300048929 | Ga0496126_0134140 | Ga0496126_0134140_86_1237 | 381 |
| 1112 | 3300048929 | Ga0496126_0145793 | Ga0496126_0145793_488_1639 | 381 |
| 1113 | 3300049568 | Ga0501031_0000657 | Ga0501031_0000657_9592_10764 | 381 |
| 1114 | 3300049568 | Ga0501031_0006130 | Ga0501031_0006130_3910_5061 | 381 |
| 1115 | 3300049569 | Ga0501032_0000198 | Ga0501032_0000198_14730_15881 | 381 |
| 1116 | 3300049569 | Ga0501032_0001779 | Ga0501032_0001779_15114_16265 | 381 |
| 1117 | 3300049570 | Ga0501033_0000091 | Ga0501033_0000091_46585_47736 | 381 |
| 1118 | 3300049570 | Ga0501033_0001037 | Ga0501033_0001037_8533_9684 | 381 |
| 1119 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_104866_106017 | 381 |
| 1120 | 3300049571 | Ga0501034_0007438 | Ga0501034_0007438_2739_3890 | 381 |
| 1121 | 3300049571 | Ga0501034_0008754 | Ga0501034_0008754_7157_8308 | 381 |
| 1122 | 3300049572 | Ga0501036_0000134 | Ga0501036_0000134_37794_38945 | 381 |
| 1123 | 3300049572 | Ga0501036_0000347 | Ga0501036_0000347_5436_6587 | 381 |
| 1124 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_7455_8606 | 381 |
| 1125 | 3300049573 | Ga0501037_0004145 | Ga0501037_0004145_1900_3051 | 381 |
| 1126 | 3300049574 | Ga0501038_0000929 | Ga0501038_0000929_16038_17189 | 381 |
| 1127 | 3300049574 | Ga0501038_0002497 | Ga0501038_0002497_1256_2407 | 381 |
| 1128 | 3300049575 | Ga0501039_0000550 | Ga0501039_0000550_23130_24281 | 381 |
| 1129 | 3300049575 | Ga0501039_0005656 | Ga0501039_0005656_2172_3323 | 381 |
| 1130 | 3300049578 | Ga0501042_0028182 | Ga0501042_0028182_787_1938 | 381 |
| 1131 | 3300049579 | Ga0501043_0000233 | Ga0501043_0000233_43743_44894 | 381 |
| 1132 | 3300049579 | Ga0501043_0021633 | Ga0501043_0021633_2739_3890 | 381 |
| 1133 | 3300049580 | Ga0501046_0000995 | Ga0501046_0000995_18212_19363 | 381 |
| 1134 | 3300049580 | Ga0501046_0058683 | Ga0501046_0058683_278_1429 | 381 |
| 1135 | 3300049580 | Ga0501046_0088815 | Ga0501046_0088815_1121_2272 | 381 |
| 1136 | 3300049581 | Ga0501047_0004251 | Ga0501047_0004251_6895_8046 | 381 |
| 1137 | 3300049581 | Ga0501047_0045211 | Ga0501047_0045211_1840_2991 | 381 |
| 1138 | 3300049582 | Ga0501048_0000218 | Ga0501048_0000218_5125_6276 | 381 |
| 1139 | 3300049582 | Ga0501048_0178806 | Ga0501048_0178806_200_1351 | 381 |
| 1140 | 3300049583 | Ga0501067_0000973 | Ga0501067_0000973_12060_13211 | 381 |
| 1141 | 3300049583 | Ga0501067_0029581 | Ga0501067_0029581_231_1382 | 381 |
| 1142 | 3300049584 | Ga0501068_0000785 | Ga0501068_0000785_4160_5311 | 381 |
| 1143 | 3300049584 | Ga0501068_0165689 | Ga0501068_0165689_67_1218 | 381 |
| 1144 | 3300049585 | Ga0501069_0015183 | Ga0501069_0015183_304_1455 | 381 |
| 1145 | 3300049585 | Ga0501069_0019027 | Ga0501069_0019027_2181_3332 | 381 |
| 1146 | 3300049586 | Ga0501070_0002981 | Ga0501070_0002981_5958_7109 | 381 |
| 1147 | 3300049586 | Ga0501070_0026807 | Ga0501070_0026807_1731_2882 | 381 |
| 1148 | 3300049586 | Ga0501070_0174986 | Ga0501070_0174986_598_1749 | 381 |
| 1149 | 3300049588 | Ga0501072_0007128 | Ga0501072_0007128_1756_2907 | 381 |
| 1150 | 3300049588 | Ga0501072_0050543 | Ga0501072_0050543_1167_2318 | 381 |
| 1151 | 3300049588 | Ga0501072_0101782 | Ga0501072_0101782_91_1242 | 381 |
| 1152 | 3300049588 | Ga0501072_0113554 | Ga0501072_0113554_850_2001 | 381 |
| 1153 | 3300049589 | Ga0501073_0000118 | Ga0501073_0000118_44300_45451 | 381 |
| 1154 | 3300049590 | Ga0501074_0000724 | Ga0501074_0000724_2187_3338 | 381 |
| 1155 | 3300049592 | Ga0501076_0046016 | Ga0501076_0046016_178_1329 | 381 |
| 1156 | 3300049741 | Ga0501079_0000590 | Ga0501079_0000590_22681_23832 | 381 |
| 1157 | 3300049742 | Ga0501080_0000124 | Ga0501080_0000124_38403_39554 | 381 |
| 1158 | 3300049742 | Ga0501080_0023280 | Ga0501080_0023280_1269_2420 | 381 |
| 1159 | 3300049744 | Ga0501083_0000184 | Ga0501083_0000184_30379_31530 | 381 |
| 1160 | 3300049759 | Ga0501262_004277 | Ga0501262_004277_110_1273 | 381 |
| 1161 | 3300049762 | Ga0501265_001763 | Ga0501265_001763_329_1492 | 381 |
| 1162 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_94606_95757 | 381 |
| 1163 | 3300049822 | Ga0501035_0008174 | Ga0501035_0008174_1315_2466 | 381 |
| 1164 | 3300049823 | Ga0501044_0001974 | Ga0501044_0001974_17145_18296 | 381 |
| 1165 | 3300049823 | Ga0501044_0005964 | Ga0501044_0005964_8049_9200 | 381 |
| 1166 | 3300049824 | Ga0501045_0009338 | Ga0501045_0009338_3754_4905 | 381 |
| 1167 | 3300050489 | nmdc:mga03683_103077_c1 | nmdc:mga03683_103077_c1_52_1203 | 381 |
| 1168 | 3300050490 | nmdc:mga03n38_421_c1 | nmdc:mga03n38_421_c1_8265_9416 | 381 |
| 1169 | 3300050491 | nmdc:mga00v17_20073_c1 | nmdc:mga00v17_20073_c1_1960_3135 | 381 |
| 1170 | 3300050491 | nmdc:mga00v17_54704_c1 | nmdc:mga00v17_54704_c1_698_1849 | 381 |
| 1171 | 3300050491 | nmdc:mga00v17_71107_c1 | nmdc:mga00v17_71107_c1_172_1323 | 381 |
| 1172 | 3300050493 | nmdc:mga0k408_8907_c1 | nmdc:mga0k408_8907_c1_272_1423 | 381 |
| 1173 | 3300050494 | nmdc:mga06z11_1539_c1 | nmdc:mga06z11_1539_c1_215_1366 | 381 |
| 1174 | 3300050494 | nmdc:mga06z11_27713_c1 | nmdc:mga06z11_27713_c1_1528_2679 | 381 |
| 1175 | 3300050494 | nmdc:mga06z11_9669_c1 | nmdc:mga06z11_9669_c1_780_1931 | 381 |
| 1176 | 3300050494 | nmdc:mga06z11_99692_c1 | nmdc:mga06z11_99692_c1_169_1320 | 381 |
| 1177 | 3300050495 | nmdc:mga04h51_46672_c1 | nmdc:mga04h51_46672_c1_245_1396 | 381 |
| 1178 | 3300050496 | nmdc:mga07m45_104020_c1 | nmdc:mga07m45_104020_c1_328_1479 | 381 |
| 1179 | 3300050496 | nmdc:mga07m45_19907_c1 | nmdc:mga07m45_19907_c1_1711_2862 | 381 |
| 1180 | 3300050507 | nmdc:mga05p37_88061_c1 | nmdc:mga05p37_88061_c1_1569_2720 | 381 |
| 1181 | 3300050508 | nmdc:mga09592_238708_c1 | nmdc:mga09592_238708_c1_345_1496 | 381 |
| 1182 | 3300050510 | nmdc:mga06r32_14185_c1 | nmdc:mga06r32_14185_c1_3435_4586 | 381 |
| 1183 | 3300050510 | nmdc:mga06r32_158105_c1 | nmdc:mga06r32_158105_c1_254_1405 | 381 |
| 1184 | 3300050511 | nmdc:mga08y16_90800_c1 | nmdc:mga08y16_90800_c1_62_1213 | 381 |
| 1185 | 3300050513 | nmdc:mga0rr50_53185_c1 | nmdc:mga0rr50_53185_c1_203_1354 | 381 |
| 1186 | 3300050516 | nmdc:mga0sz30_892_c1 | nmdc:mga0sz30_892_c1_3633_4784 | 381 |
| 1187 | 3300053077 | Ga0495601_0058890 | Ga0495601_0058890_180_1331 | 381 |
| 1188 | 3300053078 | Ga0495612_0059233 | Ga0495612_0059233_27_1178 | 381 |
| 1189 | 3300053085 | Ga0495619_0001159 | Ga0495619_0001159_10385_11536 | 381 |
| 1190 | 3300053085 | Ga0495619_0045760 | Ga0495619_0045760_63_1214 | 381 |
| 1191 | 3300053087 | Ga0500643_001368 | Ga0500643_001368_8221_9372 | 381 |
| 1192 | 3300053087 | Ga0500643_004397 | Ga0500643_004397_1460_2611 | 381 |
| 1193 | 3300053093 | Ga0500651_0001603 | Ga0500651_0001603_8775_9926 | 381 |
| 1194 | 3300053093 | Ga0500651_0029129 | Ga0500651_0029129_140_1291 | 381 |
| 1195 | 3300053093 | Ga0500651_0042209 | Ga0500651_0042209_358_1509 | 381 |
| 1196 | 3300053093 | Ga0500651_0052622 | Ga0500651_0052622_801_1952 | 381 |
| 1197 | 3300053094 | Ga0500566_0000112 | Ga0500566_0000112_20708_21859 | 381 |
| 1198 | 3300053094 | Ga0500566_0000977 | Ga0500566_0000977_5656_6807 | 381 |
| 1199 | 3300053094 | Ga0500566_0001893 | Ga0500566_0001893_5216_6367 | 381 |
| 1200 | 3300053094 | Ga0500566_0019034 | Ga0500566_0019034_1017_2168 | 381 |
| 1201 | 3300053094 | Ga0500566_0050249 | Ga0500566_0050249_251_1402 | 381 |
| 1202 | 3300053095 | Ga0500640_001798 | Ga0500640_001798_3450_4601 | 381 |
| 1203 | 3300053096 | Ga0500641_0019500 | Ga0500641_0019500_602_1753 | 381 |
| 1204 | 3300053096 | Ga0500641_0076775 | Ga0500641_0076775_232_1383 | 381 |
| 1205 | 3300053098 | Ga0500650_0012794 | Ga0500650_0012794_1923_3074 | 381 |
| 1206 | 3300053103 | Ga0500555_006850 | Ga0500555_006850_683_1834 | 381 |
| 1207 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_83542_84693 | 381 |
| 1208 | 3300053104 | Ga0500556_0003137 | Ga0500556_0003137_2376_3527 | 381 |
| 1209 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_142070_143221 | 381 |
| 1210 | 3300053108 | Ga0500562_019507 | Ga0500562_019507_356_1507 | 381 |
| 1211 | 3300053109 | Ga0500569_012395 | Ga0500569_012395_116_1267 | 381 |
| 1212 | 3300053111 | Ga0500572_001579 | Ga0500572_001579_1416_2567 | 381 |
| 1213 | 3300053116 | Ga0500592_002202 | Ga0500592_002202_283_1434 | 381 |
| 1214 | 3300053117 | Ga0500593_002237 | Ga0500593_002237_1921_3072 | 381 |
| 1215 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_497953_499104 | 381 |
| 1216 | 3300053119 | Ga0500595_000906 | Ga0500595_000906_5890_7041 | 381 |
| 1217 | 3300053119 | Ga0500595_005109 | Ga0500595_005109_2977_4128 | 381 |
| 1218 | 3300053119 | Ga0500595_012231 | Ga0500595_012231_240_1391 | 381 |
| 1219 | 3300053121 | Ga0500607_048600 | Ga0500607_048600_733_1884 | 381 |
| 1220 | 3300053121 | Ga0500607_066703 | Ga0500607_066703_580_1731 | 381 |
| 1221 | 3300053123 | Ga0500614_005002 | Ga0500614_005002_510_1661 | 381 |
| 1222 | 3300053130 | Ga0500642_0000026 | Ga0500642_0000026_90651_91802 | 381 |
| 1223 | 3300053130 | Ga0500642_0000051 | Ga0500642_0000051_69102_70253 | 381 |
| 1224 | 3300053130 | Ga0500642_0003882 | Ga0500642_0003882_2750_3901 | 381 |
| 1225 | 3300053131 | Ga0500652_002679 | Ga0500652_002679_1282_2433 | 381 |
| 1226 | 3300053136 | Ga0500559_0000502 | Ga0500559_0000502_15624_16775 | 381 |
| 1227 | 3300053136 | Ga0500559_0042677 | Ga0500559_0042677_230_1381 | 381 |
| 1228 | 3300053136 | Ga0500559_0053929 | Ga0500559_0053929_36_1187 | 381 |
| 1229 | 3300053139 | Ga0500568_0000519 | Ga0500568_0000519_6427_7578 | 381 |
| 1230 | 3300053142 | Ga0500577_0007028 | Ga0500577_0007028_158_1309 | 381 |
| 1231 | 3300053145 | Ga0500586_003947 | Ga0500586_003947_488_1639 | 381 |
| 1232 | 3300053150 | Ga0500603_000746 | Ga0500603_000746_1949_3100 | 381 |
| 1233 | 3300053151 | Ga0500604_0000440 | Ga0500604_0000440_6568_7719 | 381 |
| 1234 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_67933_69084 | 381 |
| 1235 | 3300053153 | Ga0500616_0094226 | Ga0500616_0094226_20_1171 | 381 |
| 1236 | 3300053156 | Ga0500622_0000106 | Ga0500622_0000106_35031_36182 | 381 |
| 1237 | 3300053156 | Ga0500622_0004681 | Ga0500622_0004681_4086_5237 | 381 |
| 1238 | 3300053156 | Ga0500622_0029022 | Ga0500622_0029022_983_2134 | 381 |
| 1239 | 3300053159 | Ga0500630_003177 | Ga0500630_003177_5240_6391 | 381 |
| 1240 | 3300053163 | Ga0500639_000061 | Ga0500639_000061_5951_7102 | 381 |
| 1241 | 3300053177 | Ga0500636_0007886 | Ga0500636_0007886_1088_2239 | 381 |
| 1242 | 3300053178 | Ga0500637_0000098 | Ga0500637_0000098_19603_20754 | 381 |
| 1243 | 3300053729 | Ga0500625_008055 | Ga0500625_008055_2118_3269 | 381 |
| 1244 | 3300053731 | Ga0500609_001453 | Ga0500609_001453_1026_2177 | 381 |
| 1245 | 3300053731 | Ga0500609_003779 | Ga0500609_003779_148_1299 | 381 |
| 1246 | 3300053735 | Ga0500596_001455 | Ga0500596_001455_2455_3606 | 381 |
| 1247 | 3300053737 | Ga0500601_000504 | Ga0500601_000504_3377_4528 | 381 |
| 1248 | 3300054114 | Ga0501084_0002419 | Ga0501084_0002419_1256_2407 | 381 |
| 1249 | 3300054114 | Ga0501084_0042743 | Ga0501084_0042743_2488_3639 | 381 |
| 1250 | 3300060353 | Ga0501082_0000457 | Ga0501082_0000457_23033_24184 | 381 |
| 1251 | 3300061734 | Ga0530510_0125277 | Ga0530510_0125277_322_1473 | 381 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oqb-assembly1.cif.gz_H | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.982 | 3 | 381 |
| 3oqb-assembly1.cif.gz_A | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9807 | 3 | 381 |
| 3oqb-assembly1.cif.gz_C | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9799 | 3 | 381 |
| 3oqb-assembly1.cif.gz_H | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9769 | 3 | 381 |
| 3oqb-assembly1.cif.gz_G | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9764 | 3 | 381 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oqbF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9837 | 3 | 139 | 3.40.50.720 |
| 3oqbH02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9684 | 142 | 381 | 3.30.360.10 |
| 3oqbF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9622 | 3 | 139 | 3.40.50.720 |
| 3oqbH02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9603 | 142 | 381 | 3.30.360.10 |
| 3uuwB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8764 | 4 | 139 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535CEX2-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9827 | 61 | 381 |
GO:0000166
GO:0016491 |
| AF-A0A535CEX2-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9619 | 61 | 381 |
GO:0000166
GO:0016491 |
| AF-A0A6D0LXU9-F1-model_v4 | deleted | 0.9025 | 71 | 287 |
|
| AF-U3TMX4-F1-model_v4 | Oxidoreductase domain-containing protein | 0.901 | 49 | 158 |
GO:0000166
|
| AF-A0A836BGI8-F1-model_v4 | Oxidoreductase domain-containing protein | 0.9007 | 74 | 379 |
GO:0000166
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar