F491953

General Info

Members Datasets Scaffolds Average Seq Length
1228 404 2456 275

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10220080|Ga0065712_102200801
Length 279
Sequence MGIRQFKPVTKGTRFRSVSDFTEITRTTPEKSLTEPLKKSGGRDNHGHIAMRRRGGGHKRKYRVIDFKRNRFDAPAVVKTIEYDPNRSARIALVQYEDGELRYILHPKGLAVGDTVVSGKGSDIRIGNTLPLREVPLGTNVHNVELVPGRGGQMARSAGVSLEVVAKEGEYVTVRMASTETRRLHGNCLATIGEVGNAEHELLSWGKAGKTRWKGRRPKVRGEVMNPVDHPHGGRTRGGRNVVSPWGKKEGVKTRNMKKPSQRLIVRGRKRGKATQSGF

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
223 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
260 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
264 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
321 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
340 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
341 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
342 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
363 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
364 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
365 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
366 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
367 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
368 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
369 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
370 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
371 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
372 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
373 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
374 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
375 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
376 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
382 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
383 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
384 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
403 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 1.87
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10220080 3300005290 Bacteria 1042
2 LJQas_1006187 3300000549 Bacteria 1498
3 Ga0055536_1006040 3300003781 Bacteria 5745
4 Ga0058863_10017357 3300004799 Bacteria 1804
5 Ga0058863_10086968 3300004799 Bacteria 3231
6 Ga0058863_10124246 3300004799 Bacteria 5910
7 Ga0058863_11781841 3300004799 Bacteria 2031
8 Ga0058861_11830918 3300004800 Bacteria 1045
9 Ga0058861_12045205 3300004800 Bacteria 1278
10 Ga0058861_12068682 3300004800 Bacteria 1401
11 Ga0058861_12070180 3300004800 Bacteria 2684
12 Ga0058862_12797539 3300004803 Bacteria 2338
13 Ga0058862_12888623 3300004803 Bacteria 3440
14 Ga0065165_1000131 3300005262 Bacteria 128880
15 Ga0065704_10014908 3300005289 Bacteria 2005
16 Ga0065712_10130506 3300005290 Bacteria 1555
17 Ga0065715_10135391 3300005293 Bacteria 1939
18 Ga0065707_10024835 3300005295 Bacteria 1918
19 Ga0070658_10030953 3300005327 Bacteria 4298
20 Ga0070658_10045112 3300005327 Bacteria 3563
21 Ga0070658_10120109 3300005327 Bacteria 2183
22 Ga0070658_10171352 3300005327 Bacteria 1823
23 Ga0070658_10506187 3300005327 Bacteria 1043
24 Ga0070676_10000896 3300005328 Bacteria 14732
25 Ga0070676_10010363 3300005328 Bacteria 5055
26 Ga0070676_10141630 3300005328 Bacteria 1531
27 Ga0070683_100003340 3300005329 Bacteria 12981
28 Ga0070683_100006197 3300005329 Bacteria 10030
29 Ga0070683_100046570 3300005329 Bacteria 4007
30 Ga0070683_100058071 3300005329 Bacteria 3595
31 Ga0070683_100071412 3300005329 Bacteria 3239
32 Ga0070683_100130283 3300005329 Bacteria 2380
33 Ga0070683_100163138 3300005329 Bacteria 2114
34 Ga0070683_100253323 3300005329 Bacteria 1674
35 Ga0070683_100417731 3300005329 Bacteria 1279
36 Ga0070690_100021133 3300005330 Bacteria 3971
37 Ga0070690_100054901 3300005330 Bacteria 2551
38 Ga0070690_100173738 3300005330 Bacteria 1484
39 Ga0070670_100016207 3300005331 Bacteria 6398
40 Ga0070670_100095610 3300005331 Bacteria 2555
41 Ga0070670_100240332 3300005331 Bacteria 1577
42 Ga0070677_10107002 3300005333 Bacteria 1242
43 Ga0068869_100003669 3300005334 Bacteria 9438
44 Ga0068869_100057193 3300005334 Bacteria 2846
45 Ga0068869_100148652 3300005334 Bacteria 1815
46 Ga0070666_10093653 3300005335 Bacteria 2065
47 Ga0070666_10154722 3300005335 Bacteria 1601
48 Ga0070680_100004063 3300005336 Bacteria 10956
49 Ga0070680_100005527 3300005336 Bacteria 9567
50 Ga0070680_100025720 3300005336 Bacteria 4705
51 Ga0070680_100037118 3300005336 Bacteria 3937
52 Ga0070680_100048050 3300005336 Bacteria 3477
53 Ga0070680_100062828 3300005336 Bacteria 3041
54 Ga0070680_100067284 3300005336 Bacteria 2938
55 Ga0070680_100094132 3300005336 Bacteria 2483
56 Ga0070680_100103171 3300005336 Bacteria 2369
57 Ga0070680_100106030 3300005336 Bacteria 2337
58 Ga0070680_100148940 3300005336 Bacteria 1964
59 Ga0070680_100163795 3300005336 Bacteria 1869
60 Ga0070680_100175503 3300005336 Bacteria 1804
61 Ga0070680_100179989 3300005336 Bacteria 1780
62 Ga0070680_100203783 3300005336 Bacteria 1668
63 Ga0070680_100309742 3300005336 Bacteria 1339
64 Ga0070682_100026044 3300005337 Bacteria 3496
65 Ga0070682_100029919 3300005337 Bacteria 3282
66 Ga0070682_100057682 3300005337 Bacteria 2447
67 Ga0070682_100060558 3300005337 Bacteria 2394
68 Ga0070682_100096638 3300005337 Bacteria 1942
69 Ga0070682_100235067 3300005337 Bacteria 1312
70 Ga0068868_100043273 3300005338 Bacteria 3517
71 Ga0068868_100141727 3300005338 Bacteria 1973
72 Ga0068868_100229320 3300005338 Bacteria 1557
73 Ga0068868_100334057 3300005338 Bacteria 1294
74 Ga0070660_100143024 3300005339 Bacteria 1920
75 Ga0070660_100293209 3300005339 Bacteria 1332
76 Ga0070660_100301949 3300005339 Bacteria 1313
77 Ga0070689_100012783 3300005340 Bacteria 6060
78 Ga0070689_100031628 3300005340 Bacteria 4023
79 Ga0070689_100040239 3300005340 Bacteria 3583
80 Ga0070689_100154947 3300005340 Bacteria 1849
81 Ga0070691_10042806 3300005341 Bacteria 2144
82 Ga0070691_10050992 3300005341 Bacteria 1975
83 Ga0070687_100026607 3300005343 Bacteria 2786
84 Ga0070661_100013855 3300005344 Bacteria 5665
85 Ga0070661_100028453 3300005344 Bacteria 4031
86 Ga0070661_100029610 3300005344 Bacteria 3952
87 Ga0070661_100029667 3300005344 Bacteria 3949
88 Ga0070661_100063709 3300005344 Bacteria 2708
89 Ga0070661_100216264 3300005344 Bacteria 1468
90 Ga0070661_100249809 3300005344 Bacteria 1368
91 Ga0070661_100253420 3300005344 Bacteria 1359
92 Ga0070692_10020992 3300005345 Bacteria 3174
93 Ga0070692_10030572 3300005345 Bacteria 2694
94 Ga0070692_10070694 3300005345 Bacteria 1859
95 Ga0070668_100000990 3300005347 Bacteria 19937
96 Ga0070668_100017369 3300005347 Bacteria 5389
97 Ga0070668_100044436 3300005347 Bacteria 3408
98 Ga0070668_100089192 3300005347 Bacteria 2429
99 Ga0070669_100002074 3300005353 Bacteria 14482
100 Ga0070669_100025980 3300005353 Bacteria 4211
101 Ga0070669_100066368 3300005353 Bacteria 2660
102 Ga0070675_100003059 3300005354 Bacteria 12632
103 Ga0070675_100006526 3300005354 Bacteria 8963
104 Ga0070675_100058013 3300005354 Bacteria 3192
105 Ga0070671_100072541 3300005355 Bacteria 2875
106 Ga0070671_100119817 3300005355 Bacteria 2214
107 Ga0070671_100159410 3300005355 Bacteria 1907
108 Ga0070674_100001338 3300005356 Bacteria 12995
109 Ga0070674_100075414 3300005356 Bacteria 2395
110 Ga0070674_100137876 3300005356 Bacteria 1827
111 Ga0070674_100444582 3300005356 Bacteria 1068
112 Ga0070673_100006677 3300005364 Bacteria 7523
113 Ga0070673_100024226 3300005364 Bacteria 4447
114 Ga0070673_100153788 3300005364 Bacteria 1950
115 Ga0070673_100187913 3300005364 Bacteria 1772
116 Ga0070673_100329863 3300005364 Bacteria 1350
117 Ga0070688_100028355 3300005365 Bacteria 3341
118 Ga0070688_100037041 3300005365 Bacteria 2970
119 Ga0070659_100002785 3300005366 Bacteria 12441
120 Ga0070659_100012581 3300005366 Bacteria 6275
121 Ga0070659_100108977 3300005366 Bacteria 2234
122 Ga0070659_100116694 3300005366 Bacteria 2158
123 Ga0070659_100185248 3300005366 Bacteria 1709
124 Ga0070667_100043630 3300005367 Bacteria 3764
125 Ga0070667_100093065 3300005367 Bacteria 2595
126 Ga0070667_100111431 3300005367 Bacteria 2373
127 Ga0070667_100128161 3300005367 Bacteria 2213
128 Ga0070667_100170052 3300005367 Bacteria 1924
129 Ga0070667_100228951 3300005367 Bacteria 1657
130 Ga0070703_10041333 3300005406 Bacteria 1437
131 Ga0070709_10006385 3300005434 Bacteria 6421
132 Ga0070714_100016130 3300005435 Bacteria 6025
133 Ga0070714_100018849 3300005435 Bacteria 5613
134 Ga0070714_100139880 3300005435 Bacteria 2171
135 Ga0070714_100200652 3300005435 Bacteria 1824
136 Ga0070713_100008004 3300005436 Bacteria 7470
137 Ga0070713_100035372 3300005436 Bacteria 4020
138 Ga0070713_100065550 3300005436 Bacteria 3051
139 Ga0070713_100286532 3300005436 Bacteria 1513
140 Ga0070710_10016585 3300005437 Bacteria 3752
141 Ga0070710_10064387 3300005437 Bacteria 2097
142 Ga0070701_10194692 3300005438 Bacteria 1195
143 Ga0070711_100025951 3300005439 Bacteria 3836
144 Ga0070711_100036243 3300005439 Bacteria 3304
145 Ga0070711_100079312 3300005439 Bacteria 2335
146 Ga0070705_100003623 3300005440 Bacteria 7560
147 Ga0070705_100325140 3300005440 Bacteria 1112
148 Ga0070700_100204357 3300005441 Bacteria 1389
149 Ga0070700_100443977 3300005441 Bacteria 986
150 Ga0070694_100111310 3300005444 Bacteria 1951
151 Ga0070708_100001661 3300005445 Bacteria 17067
152 Ga0070708_100018839 3300005445 Bacteria 5782
153 Ga0070708_100020893 3300005445 Bacteria 5528
154 Ga0070708_100338186 3300005445 Bacteria 1418
155 Ga0070663_100005346 3300005455 Bacteria 7621
156 Ga0070678_100006200 3300005456 Bacteria 6992
157 Ga0070678_100053888 3300005456 Bacteria 2927
158 Ga0070662_100006245 3300005457 Bacteria 7674
159 Ga0070662_100011148 3300005457 Bacteria 5922
160 Ga0070662_100047159 3300005457 Bacteria 3098
161 Ga0070662_100054587 3300005457 Bacteria 2896
162 Ga0070662_100059628 3300005457 Bacteria 2780
163 Ga0070662_100118516 3300005457 Bacteria 2026
164 Ga0070662_100251955 3300005457 Bacteria 1420
165 Ga0070681_10001182 3300005458 Bacteria 22569
166 Ga0070681_10030030 3300005458 Bacteria 5454
167 Ga0070681_10044619 3300005458 Bacteria 4438
168 Ga0070681_10053922 3300005458 Bacteria 4006
169 Ga0070681_10067823 3300005458 Bacteria 3535
170 Ga0070681_10078280 3300005458 Bacteria 3263
171 Ga0070681_10153736 3300005458 Bacteria 2226
172 Ga0070681_10160574 3300005458 Bacteria 2171
173 Ga0070681_10171280 3300005458 Bacteria 2093
174 Ga0070681_10200760 3300005458 Bacteria 1912
175 Ga0070681_10252646 3300005458 Bacteria 1675
176 Ga0070681_10402893 3300005458 Bacteria 1279
177 Ga0070681_10505405 3300005458 Bacteria 1122
178 Ga0070681_10515824 3300005458 Bacteria 1108
179 Ga0070681_10585687 3300005458 Bacteria 1030
180 Ga0070681_10662384 3300005458 Bacteria 959
181 Ga0070681_10716662 3300005458 Bacteria 916
182 Ga0068867_100006780 3300005459 Bacteria 8095
183 Ga0068867_100037348 3300005459 Bacteria 3530
184 Ga0068867_100079269 3300005459 Bacteria 2472
185 Ga0068867_100158633 3300005459 Bacteria 1782
186 Ga0070685_10086131 3300005466 Bacteria 1893
187 Ga0070706_100115208 3300005467 Bacteria 2503
188 Ga0070706_100188726 3300005467 Bacteria 1926
189 Ga0070707_100071326 3300005468 Bacteria 3347
190 Ga0070698_100001954 3300005471 Bacteria 22884
191 Ga0070698_100024253 3300005471 Bacteria 6330
192 Ga0070698_100052230 3300005471 Bacteria 4160
193 Ga0070698_100115071 3300005471 Bacteria 2654
194 Ga0070698_100189783 3300005471 Bacteria 1993
195 Ga0070699_100017326 3300005518 Bacteria 6186
196 Ga0070699_100243299 3300005518 Bacteria 1607
197 Ga0070699_100248507 3300005518 Bacteria 1589
198 Ga0070699_100303757 3300005518 Bacteria 1432
199 Ga0070679_100000601 3300005530 Bacteria 30635
200 Ga0070679_100001848 3300005530 Bacteria 19026
201 Ga0070679_100019482 3300005530 Bacteria 6597
202 Ga0070679_100023697 3300005530 Bacteria 6014
203 Ga0070679_100038523 3300005530 Bacteria 4753
204 Ga0070679_100052627 3300005530 Bacteria 4054
205 Ga0070679_100068775 3300005530 Bacteria 3532
206 Ga0070679_100091847 3300005530 Bacteria 3023
207 Ga0070679_100095030 3300005530 Bacteria 2968
208 Ga0070679_100113323 3300005530 Bacteria 2697
209 Ga0070679_100113336 3300005530 Bacteria 2697
210 Ga0070679_100165137 3300005530 Bacteria 2187
211 Ga0070679_100249770 3300005530 Bacteria 1730
212 Ga0070679_100257749 3300005530 Bacteria 1699
213 Ga0070684_100002577 3300005535 Bacteria 13386
214 Ga0070684_100005718 3300005535 Bacteria 9552
215 Ga0070684_100041533 3300005535 Bacteria 3965
216 Ga0070684_100066458 3300005535 Bacteria 3165
217 Ga0070684_100072750 3300005535 Bacteria 3027
218 Ga0070684_100092190 3300005535 Bacteria 2696
219 Ga0070684_100106633 3300005535 Bacteria 2509
220 Ga0070684_100152966 3300005535 Bacteria 2091
221 Ga0070684_100301363 3300005535 Bacteria 1471
222 Ga0070684_100302271 3300005535 Bacteria 1468
223 Ga0070684_100349691 3300005535 Bacteria 1359
224 Ga0070697_100190886 3300005536 Bacteria 1739
225 Ga0068853_100040762 3300005539 Bacteria 3963
226 Ga0068853_100096330 3300005539 Bacteria 2610
227 Ga0068853_100203663 3300005539 Bacteria 1801
228 Ga0068853_100205913 3300005539 Bacteria 1792
229 Ga0068853_100214746 3300005539 Bacteria 1754
230 Ga0070672_100003949 3300005543 Bacteria 9668
231 Ga0070672_100038933 3300005543 Bacteria 3637
232 Ga0070672_100061495 3300005543 Bacteria 2960
233 Ga0070672_100079274 3300005543 Bacteria 2628
234 Ga0070686_100059565 3300005544 Bacteria 2460
235 Ga0070686_100158982 3300005544 Bacteria 1590
236 Ga0070686_100171206 3300005544 Bacteria 1536
237 Ga0070686_100215576 3300005544 Bacteria 1384
238 Ga0070695_100006164 3300005545 Bacteria 7087
239 Ga0070695_100013525 3300005545 Bacteria 4906
240 Ga0070695_100401927 3300005545 Bacteria 1039
241 Ga0070696_100000402 3300005546 Bacteria 26803
242 Ga0070696_100004370 3300005546 Bacteria 9415
243 Ga0070696_100022063 3300005546 Bacteria 4323
244 Ga0070696_100111425 3300005546 Bacteria 1971
245 Ga0070693_100054124 3300005547 Bacteria 2306
246 Ga0070693_100075365 3300005547 Bacteria 1997
247 Ga0070665_100028793 3300005548 Bacteria 5593
248 Ga0070665_100124547 3300005548 Bacteria 2579
249 Ga0070665_100230766 3300005548 Bacteria 1851
250 Ga0070704_100212348 3300005549 Bacteria 1569
251 Ga0068855_100008032 3300005563 Bacteria 12749
252 Ga0068855_100063431 3300005563 Bacteria 4312
253 Ga0068855_100075666 3300005563 Bacteria 3909
254 Ga0068855_100132631 3300005563 Bacteria 2844
255 Ga0068855_100167043 3300005563 Bacteria 2493
256 Ga0068855_100257123 3300005563 Bacteria 1946
257 Ga0068855_100269245 3300005563 Bacteria 1895
258 Ga0068855_100466223 3300005563 Bacteria 1376
259 Ga0068855_100597234 3300005563 Bacteria 1191
260 Ga0068855_100622768 3300005563 Bacteria 1162
261 Ga0068855_100886266 3300005563 Bacteria 943
262 Ga0070664_100008033 3300005564 Bacteria 8527
263 Ga0070664_100113420 3300005564 Bacteria 2367
264 Ga0070664_100145371 3300005564 Bacteria 2090
265 Ga0070664_100229505 3300005564 Bacteria 1664
266 Ga0070664_100337824 3300005564 Bacteria 1367
267 Ga0068857_100009735 3300005577 Bacteria 8348
268 Ga0068857_100015888 3300005577 Bacteria 6589
269 Ga0068857_100024265 3300005577 Bacteria 5337
270 Ga0068857_100054772 3300005577 Bacteria 3540
271 Ga0068857_100067276 3300005577 Bacteria 3189
272 Ga0068857_100068315 3300005577 Bacteria 3163
273 Ga0068857_100292587 3300005577 Bacteria 1500
274 Ga0068854_100000444 3300005578 Bacteria 25595
275 Ga0068854_100008727 3300005578 Bacteria 6524
276 Ga0068854_100013720 3300005578 Bacteria 5325
277 Ga0068854_100051465 3300005578 Bacteria 2951
278 Ga0068854_100585640 3300005578 Bacteria 950
279 Ga0068854_100625852 3300005578 Bacteria 921
280 Ga0068856_100073182 3300005614 Bacteria 3393
281 Ga0068856_100088427 3300005614 Bacteria 3080
282 Ga0068856_100250348 3300005614 Bacteria 1787
283 Ga0068856_100262205 3300005614 Bacteria 1743
284 Ga0070702_100047710 3300005615 Bacteria 2434
285 Ga0068852_100009981 3300005616 Bacteria 7065
286 Ga0068852_100029062 3300005616 Bacteria 4535
287 Ga0068852_100068754 3300005616 Bacteria 3101
288 Ga0068852_100238569 3300005616 Bacteria 1736
289 Ga0068852_100379756 3300005616 Bacteria 1386
290 Ga0068852_100439541 3300005616 Bacteria 1289
291 Ga0068859_100017117 3300005617 Bacteria 7279
292 Ga0068859_100039441 3300005617 Bacteria 4737
293 Ga0068859_100044463 3300005617 Bacteria 4462
294 Ga0068859_100075086 3300005617 Bacteria 3420
295 Ga0068859_100287128 3300005617 Bacteria 1738
296 Ga0068864_100012293 3300005618 Bacteria 7076
297 Ga0068866_10000625 3300005718 Bacteria 16073
298 Ga0068861_100028185 3300005719 Bacteria 4097
299 Ga0068861_100159667 3300005719 Bacteria 1858
300 Ga0068861_100470097 3300005719 Bacteria 1130
301 Ga0068851_10035251 3300005834 Bacteria 2500
302 Ga0068851_10036179 3300005834 Bacteria 2471
303 Ga0068870_10011998 3300005840 Bacteria 4034
304 Ga0068870_10055691 3300005840 Bacteria 2108
305 Ga0068863_100023269 3300005841 Bacteria 5920
306 Ga0068863_100029946 3300005841 Bacteria 5199
307 Ga0068863_100119013 3300005841 Bacteria 2517
308 Ga0068863_100587566 3300005841 Bacteria 1101
309 Ga0068858_100083441 3300005842 Bacteria 2972
310 Ga0068858_100181183 3300005842 Bacteria 1989
311 Ga0068858_100327658 3300005842 Bacteria 1464
312 Ga0068860_100025031 3300005843 Bacteria 5761
313 Ga0068860_100057895 3300005843 Bacteria 3684
314 Ga0068860_100180185 3300005843 Bacteria 2042
315 Ga0068862_100003483 3300005844 Bacteria 13529
316 Ga0081539_10001506 3300005985 Bacteria 39339
317 Ga0081539_10023333 3300005985 Bacteria 4055
318 Ga0070717_10018982 3300006028 Bacteria 5383
319 Ga0070717_10122418 3300006028 Bacteria 2230
320 Ga0070716_100014957 3300006173 Bacteria 3982
321 Ga0070712_100039564 3300006175 Bacteria 3227
322 Ga0070712_100139555 3300006175 Bacteria 1848
323 Ga0070712_100229717 3300006175 Bacteria 1473
324 Ga0097621_100453116 3300006237 Bacteria 1156
325 Ga0068871_100103372 3300006358 Bacteria 2388
326 Ga0068871_100143085 3300006358 Bacteria 2035
327 Ga0075428_100044329 3300006844 Bacteria 4888
328 Ga0075428_100091987 3300006844 Bacteria 3307
329 Ga0075430_100040306 3300006846 Bacteria 3954
330 Ga0075430_100054598 3300006846 Bacteria 3361
331 Ga0075430_100057895 3300006846 Bacteria 3258
332 Ga0075430_100081302 3300006846 Bacteria 2714
333 Ga0075430_100100001 3300006846 Bacteria 2422
334 Ga0075431_100066106 3300006847 Bacteria 3732
335 Ga0075431_100085342 3300006847 Bacteria 3258
336 Ga0075431_100089199 3300006847 Bacteria 3183
337 Ga0075431_100130129 3300006847 Bacteria 2596
338 Ga0075431_100341131 3300006847 Bacteria 1508
339 Ga0075433_10008454 3300006852 Bacteria 8214
340 Ga0075433_10017586 3300006852 Bacteria 5928
341 Ga0075434_100293178 3300006871 Bacteria 1647
342 Ga0075429_100019213 3300006880 Bacteria 5920
343 Ga0075429_100055132 3300006880 Bacteria 3459
344 Ga0075429_100181478 3300006880 Bacteria 1844
345 Ga0068865_100047651 3300006881 Bacteria 2946
346 Ga0068865_100050694 3300006881 Bacteria 2869
347 Ga0068865_100438500 3300006881 Bacteria 1077
348 Ga0075436_100011027 3300006914 Bacteria 6202
349 Ga0075436_100149178 3300006914 Bacteria 1645
350 Ga0097620_100017115 3300006931 Bacteria 7279
351 Ga0097620_100039441 3300006931 Bacteria 4737
352 Ga0097620_100044456 3300006931 Bacteria 4462
353 Ga0097620_100075085 3300006931 Bacteria 3420
354 Ga0097620_100287131 3300006931 Bacteria 1738
355 Ga0075435_100151205 3300007076 Bacteria 1952
356 Ga0099795_10031621 3300007788 Bacteria 1824
357 Ga0105240_10053668 3300009093 Bacteria 5058
358 Ga0105240_10056546 3300009093 Bacteria 4909
359 Ga0105240_10101231 3300009093 Bacteria 3505
360 Ga0105240_10123211 3300009093 Bacteria 3119
361 Ga0105240_10171625 3300009093 Bacteria 2568
362 Ga0105240_10337410 3300009093 Bacteria 1713
363 Ga0105240_10741251 3300009093 Bacteria 1069
364 Ga0111539_10070760 3300009094 Bacteria 4118
365 Ga0111539_10080966 3300009094 Bacteria 3819
366 Ga0111539_10454897 3300009094 Bacteria 1491
367 Ga0105245_10078468 3300009098 Bacteria 3013
368 Ga0105245_10131671 3300009098 Bacteria 2346
369 Ga0105245_10155732 3300009098 Bacteria 2164
370 Ga0105245_10169504 3300009098 Bacteria 2078
371 Ga0105247_10193293 3300009101 Bacteria 1363
372 Ga0114129_10034794 3300009147 Bacteria 7117
373 Ga0114129_10074165 3300009147 Bacteria 4740
374 Ga0114129_10346555 3300009147 Bacteria 1969
375 Ga0105243_10140503 3300009148 Bacteria 2060
376 Ga0105241_10008410 3300009174 Bacteria 7592
377 Ga0105241_10089216 3300009174 Bacteria 2429
378 Ga0105241_10435464 3300009174 Bacteria 1157
379 Ga0105242_10007285 3300009176 Bacteria 8528
380 Ga0105242_10034725 3300009176 Bacteria 4043
381 Ga0105242_10149144 3300009176 Bacteria 2038
382 Ga0105248_10040839 3300009177 Bacteria 5200
383 Ga0105248_10050747 3300009177 Bacteria 4653
384 Ga0105248_10058180 3300009177 Bacteria 4340
385 Ga0105248_10122714 3300009177 Bacteria 2931
386 Ga0105248_10524641 3300009177 Bacteria 1335
387 Ga0105237_10178898 3300009545 Bacteria 2121
388 Ga0105237_10220165 3300009545 Bacteria 1898
389 Ga0105237_10474801 3300009545 Bacteria 1257
390 Ga0105238_10029825 3300009551 Bacteria 5555
391 Ga0105238_10075953 3300009551 Bacteria 3352
392 Ga0105238_10269246 3300009551 Bacteria 1684
393 Ga0105249_10000247 3300009553 Bacteria 59908
394 Ga0105249_10018979 3300009553 Bacteria 6131
395 Ga0105249_10173030 3300009553 Bacteria 2095
396 Ga0105249_10239032 3300009553 Bacteria 1795
397 Ga0099796_10021104 3300010159 Bacteria 2001
398 Ga0105239_10043771 3300010375 Bacteria 4909
399 Ga0105239_10121410 3300010375 Bacteria 2902
400 Ga0105239_10172198 3300010375 Bacteria 2421
401 Ga0105246_10031841 3300011119 Bacteria 3492
402 Ga0105246_10625625 3300011119 Bacteria 933
403 Ga0157373_10008827 3300013100 Bacteria 7467
404 Ga0157373_10024036 3300013100 Bacteria 4416
405 Ga0157373_10078858 3300013100 Bacteria 2322
406 Ga0157373_10134672 3300013100 Bacteria 1737
407 Ga0157373_10193303 3300013100 Bacteria 1434
408 Ga0157373_10257524 3300013100 Bacteria 1235
409 Ga0157371_10010154 3300013102 Bacteria 7356
410 Ga0157371_10011380 3300013102 Bacteria 6861
411 Ga0157371_10076830 3300013102 Bacteria 2365
412 Ga0157371_10099341 3300013102 Bacteria 2064
413 Ga0157370_10061565 3300013104 Bacteria 3561
414 Ga0157370_10375609 3300013104 Bacteria 1310
415 Ga0157370_10392922 3300013104 Bacteria 1277
416 Ga0157370_10448021 3300013104 Bacteria 1187
417 Ga0157370_10668109 3300013104 Bacteria 949
418 Ga0157369_10129033 3300013105 Bacteria 2680
419 Ga0157369_10217195 3300013105 Bacteria 2002
420 Ga0157369_10224152 3300013105 Bacteria 1967
421 Ga0157369_10234440 3300013105 Bacteria 1918
422 Ga0157369_10267556 3300013105 Bacteria 1782
423 Ga0157369_10277522 3300013105 Bacteria 1745
424 Ga0157369_10699947 3300013105 Bacteria 1043
425 Ga0157374_10019472 3300013296 Bacteria 6007
426 Ga0157374_10253601 3300013296 Bacteria 1732
427 Ga0157374_10326581 3300013296 Bacteria 1521
428 Ga0157374_10460651 3300013296 Bacteria 1273
429 Ga0157374_10826845 3300013296 Bacteria 943
430 Ga0157378_10107312 3300013297 Bacteria 2555
431 Ga0157378_10398123 3300013297 Bacteria 1356
432 Ga0163162_10000968 3300013306 Bacteria 26664
433 Ga0163162_10135225 3300013306 Bacteria 2576
434 Ga0163162_10674155 3300013306 Bacteria 1157
435 Ga0157372_10017897 3300013307 Bacteria 7614
436 Ga0157372_10019172 3300013307 Bacteria 7366
437 Ga0157372_10062629 3300013307 Bacteria 4168
438 Ga0157372_10141012 3300013307 Bacteria 2776
439 Ga0157372_10217816 3300013307 Bacteria 2213
440 Ga0157372_10219048 3300013307 Bacteria 2206
441 Ga0157372_10223667 3300013307 Bacteria 2182
442 Ga0157372_10228177 3300013307 Bacteria 2158
443 Ga0157372_10249173 3300013307 Bacteria 2061
444 Ga0157372_10370207 3300013307 Bacteria 1670
445 Ga0157372_10461114 3300013307 Bacteria 1481
446 Ga0157372_10934412 3300013307 Bacteria 1005
447 Ga0157372_11177403 3300013307 Bacteria 886
448 Ga0157375_10020665 3300013308 Bacteria 6019
449 Ga0157375_10116648 3300013308 Bacteria 2775
450 Ga0157380_10041125 3300014326 Bacteria 3606
451 Ga0157380_10117896 3300014326 Bacteria 2243
452 Ga0182008_10006718 3300014497 Bacteria 6404
453 Ga0157377_10001976 3300014745 Bacteria 8976
454 Ga0157377_10057641 3300014745 Bacteria 2210
455 Ga0157377_10064324 3300014745 Bacteria 2104
456 Ga0157379_10032210 3300014968 Bacteria 4673
457 Ga0157379_10412704 3300014968 Bacteria 1242
458 Ga0157376_10049138 3300014969 Bacteria 3493
459 Ga0157376_10074835 3300014969 Bacteria 2888
460 Ga0157376_10141281 3300014969 Bacteria 2160
461 Ga0157376_10155951 3300014969 Bacteria 2064
462 Ga0163161_10252959 3300017792 Bacteria 1374
463 Ga0197907_11051130 3300020069 Bacteria 1435
464 Ga0213876_10010709 3300021384 Bacteria 4913
465 Ga0213876_10031971 3300021384 Bacteria 2776
466 Ga0209676_1000332 3300025292 Bacteria 90798
467 Ga0207697_10011385 3300025315 Bacteria 3763
468 Ga0207697_10014185 3300025315 Bacteria 3312
469 Ga0207682_10011727 3300025893 Bacteria 3424
470 Ga0207682_10016764 3300025893 Bacteria 2859
471 Ga0207692_10015454 3300025898 Bacteria 3360
472 Ga0207692_10077555 3300025898 Bacteria 1768
473 Ga0207642_10000869 3300025899 Bacteria 9430
474 Ga0207710_10143982 3300025900 Bacteria 1152
475 Ga0207688_10027380 3300025901 Bacteria 3136
476 Ga0207688_10044712 3300025901 Bacteria 2468
477 Ga0207680_10024431 3300025903 Bacteria 3317
478 Ga0207680_10025729 3300025903 Bacteria 3250
479 Ga0207647_10012888 3300025904 Bacteria 5809
480 Ga0207647_10206493 3300025904 Bacteria 1135
481 Ga0207685_10159264 3300025905 Bacteria 1029
482 Ga0207699_10001230 3300025906 Bacteria 12159
483 Ga0207699_10126913 3300025906 Bacteria 1658
484 Ga0207645_10001246 3300025907 Bacteria 20949
485 Ga0207645_10002969 3300025907 Bacteria 13108
486 Ga0207645_10018114 3300025907 Bacteria 4642
487 Ga0207645_10185904 3300025907 Bacteria 1364
488 Ga0207645_10193849 3300025907 Bacteria 1336
489 Ga0207643_10003364 3300025908 Bacteria 8615
490 Ga0207643_10057418 3300025908 Bacteria 2215
491 Ga0207705_10027229 3300025909 Bacteria 4075
492 Ga0207705_10029211 3300025909 Bacteria 3930
493 Ga0207705_10031424 3300025909 Bacteria 3790
494 Ga0207705_10031835 3300025909 Bacteria 3767
495 Ga0207705_10043315 3300025909 Bacteria 3233
496 Ga0207705_10079711 3300025909 Bacteria 2385
497 Ga0207705_10122539 3300025909 Bacteria 1930
498 Ga0207705_10172522 3300025909 Bacteria 1629
499 Ga0207705_10276084 3300025909 Bacteria 1286
500 Ga0207684_10477754 3300025910 Bacteria 1069
501 Ga0207654_10005914 3300025911 Bacteria 6156
502 Ga0207654_10028743 3300025911 Bacteria 3034
503 Ga0207654_10099830 3300025911 Bacteria 1786
504 Ga0207654_10270197 3300025911 Bacteria 1147
505 Ga0207707_10000784 3300025912 Bacteria 31134
506 Ga0207707_10002248 3300025912 Bacteria 17457
507 Ga0207707_10003943 3300025912 Bacteria 13181
508 Ga0207707_10004141 3300025912 Bacteria 12844
509 Ga0207707_10010236 3300025912 Bacteria 8142
510 Ga0207707_10012860 3300025912 Bacteria 7283
511 Ga0207707_10020853 3300025912 Bacteria 5725
512 Ga0207707_10041250 3300025912 Bacteria 4031
513 Ga0207707_10074382 3300025912 Bacteria 2963
514 Ga0207707_10075446 3300025912 Bacteria 2942
515 Ga0207707_10097923 3300025912 Bacteria 2564
516 Ga0207707_10136471 3300025912 Bacteria 2145
517 Ga0207707_10212597 3300025912 Bacteria 1684
518 Ga0207707_10254088 3300025912 Bacteria 1526
519 Ga0207707_10275027 3300025912 Bacteria 1459
520 Ga0207707_10384637 3300025912 Bacteria 1206
521 Ga0207695_10002690 3300025913 Bacteria 25925
522 Ga0207695_10003067 3300025913 Bacteria 23953
523 Ga0207695_10004617 3300025913 Bacteria 18682
524 Ga0207695_10013424 3300025913 Bacteria 9771
525 Ga0207695_10066239 3300025913 Bacteria 3711
526 Ga0207695_10070341 3300025913 Bacteria 3578
527 Ga0207695_10226018 3300025913 Bacteria 1778
528 Ga0207695_10226195 3300025913 Bacteria 1777
529 Ga0207671_10264370 3300025914 Bacteria 1354
530 Ga0207693_10003338 3300025915 Bacteria 13734
531 Ga0207693_10084216 3300025915 Bacteria 2491
532 Ga0207693_10144717 3300025915 Bacteria 1869
533 Ga0207663_10012846 3300025916 Bacteria 4538
534 Ga0207663_10023350 3300025916 Bacteria 3547
535 Ga0207660_10001291 3300025917 Bacteria 16748
536 Ga0207660_10013204 3300025917 Bacteria 5410
537 Ga0207660_10032435 3300025917 Bacteria 3605
538 Ga0207660_10044376 3300025917 Bacteria 3128
539 Ga0207660_10054390 3300025917 Bacteria 2857
540 Ga0207660_10055934 3300025917 Bacteria 2822
541 Ga0207660_10057759 3300025917 Bacteria 2780
542 Ga0207660_10088243 3300025917 Bacteria 2293
543 Ga0207660_10103162 3300025917 Bacteria 2133
544 Ga0207660_10139720 3300025917 Bacteria 1851
545 Ga0207660_10200740 3300025917 Bacteria 1557
546 Ga0207660_10213249 3300025917 Bacteria 1513
547 Ga0207660_10249325 3300025917 Bacteria 1401
548 Ga0207660_10330852 3300025917 Bacteria 1218
549 Ga0207662_10006823 3300025918 Bacteria 6179
550 Ga0207662_10020855 3300025918 Bacteria 3741
551 Ga0207662_10037541 3300025918 Bacteria 2835
552 Ga0207662_10297302 3300025918 Bacteria 1072
553 Ga0207657_10001138 3300025919 Bacteria 28229
554 Ga0207657_10054086 3300025919 Bacteria 3473
555 Ga0207657_10100403 3300025919 Bacteria 2403
556 Ga0207657_10110156 3300025919 Bacteria 2275
557 Ga0207657_10202823 3300025919 Bacteria 1594
558 Ga0207657_10405023 3300025919 Bacteria 1073
559 Ga0207649_10002377 3300025920 Bacteria 10552
560 Ga0207649_10004410 3300025920 Bacteria 7637
561 Ga0207649_10007666 3300025920 Bacteria 5871
562 Ga0207649_10008227 3300025920 Bacteria 5682
563 Ga0207649_10013748 3300025920 Bacteria 4524
564 Ga0207649_10032190 3300025920 Bacteria 3124
565 Ga0207649_10156162 3300025920 Bacteria 1576
566 Ga0207649_10178625 3300025920 Bacteria 1484
567 Ga0207649_10310550 3300025920 Bacteria 1155
568 Ga0207652_10002905 3300025921 Bacteria 14334
569 Ga0207652_10004165 3300025921 Bacteria 11797
570 Ga0207652_10012004 3300025921 Bacteria 6992
571 Ga0207652_10015685 3300025921 Bacteria 6170
572 Ga0207652_10019965 3300025921 Bacteria 5517
573 Ga0207652_10038944 3300025921 Bacteria 4032
574 Ga0207652_10042922 3300025921 Bacteria 3850
575 Ga0207652_10067099 3300025921 Bacteria 3110
576 Ga0207652_10069714 3300025921 Bacteria 3053
577 Ga0207652_10093206 3300025921 Bacteria 2650
578 Ga0207652_10094537 3300025921 Bacteria 2632
579 Ga0207652_10180913 3300025921 Bacteria 1895
580 Ga0207652_10469355 3300025921 Bacteria 1134
581 Ga0207652_10522591 3300025921 Bacteria 1068
582 Ga0207652_10646286 3300025921 Bacteria 946
583 Ga0207652_10697419 3300025921 Bacteria 906
584 Ga0207646_10019243 3300025922 Bacteria 6348
585 Ga0207646_10035672 3300025922 Bacteria 4491
586 Ga0207646_10201520 3300025922 Bacteria 1798
587 Ga0207646_10280505 3300025922 Bacteria 1506
588 Ga0207681_10001456 3300025923 Bacteria 15236
589 Ga0207681_10023008 3300025923 Bacteria 3979
590 Ga0207681_10032436 3300025923 Bacteria 3419
591 Ga0207694_10026946 3300025924 Bacteria 4377
592 Ga0207694_10248765 3300025924 Bacteria 1454
593 Ga0207694_10327240 3300025924 Bacteria 1266
594 Ga0207650_10034430 3300025925 Bacteria 3673
595 Ga0207650_10086726 3300025925 Bacteria 2383
596 Ga0207650_10245208 3300025925 Bacteria 1449
597 Ga0207650_10503674 3300025925 Bacteria 1012
598 Ga0207659_10007653 3300025926 Bacteria 6665
599 Ga0207659_10017541 3300025926 Bacteria 4678
600 Ga0207659_10022346 3300025926 Bacteria 4211
601 Ga0207659_10051549 3300025926 Bacteria 2927
602 Ga0207659_10218655 3300025926 Bacteria 1530
603 Ga0207687_10075869 3300025927 Bacteria 2414
604 Ga0207687_10117584 3300025927 Bacteria 1983
605 Ga0207700_10021907 3300025928 Bacteria 4374
606 Ga0207700_10039951 3300025928 Bacteria 3420
607 Ga0207700_10744429 3300025928 Bacteria 876
608 Ga0207664_10009225 3300025929 Bacteria 6911
609 Ga0207664_10012437 3300025929 Bacteria 6084
610 Ga0207664_10030097 3300025929 Bacteria 4144
611 Ga0207664_10059661 3300025929 Bacteria 3039
612 Ga0207664_10150502 3300025929 Bacteria 1976
613 Ga0207644_10081250 3300025931 Bacteria 2395
614 Ga0207644_10157705 3300025931 Bacteria 1761
615 Ga0207644_10228772 3300025931 Bacteria 1477
616 Ga0207690_10039753 3300025932 Bacteria 3071
617 Ga0207690_10080789 3300025932 Bacteria 2270
618 Ga0207690_10631067 3300025932 Bacteria 877
619 Ga0207706_10000025 3300025933 Bacteria 150958
620 Ga0207706_10030641 3300025933 Bacteria 4797
621 Ga0207706_10044843 3300025933 Bacteria 3918
622 Ga0207706_10085090 3300025933 Bacteria 2780
623 Ga0207706_10150224 3300025933 Bacteria 2049
624 Ga0207706_10279971 3300025933 Bacteria 1455
625 Ga0207706_10320634 3300025933 Bacteria 1349
626 Ga0207686_10001115 3300025934 Bacteria 15582
627 Ga0207686_10022147 3300025934 Bacteria 3657
628 Ga0207686_10060773 3300025934 Bacteria 2393
629 Ga0207686_10085618 3300025934 Bacteria 2068
630 Ga0207709_10081832 3300025935 Bacteria 2083
631 Ga0207670_10005135 3300025936 Bacteria 7153
632 Ga0207670_10018648 3300025936 Bacteria 4224
633 Ga0207670_10107499 3300025936 Bacteria 2003
634 Ga0207669_10000638 3300025937 Bacteria 15128
635 Ga0207704_10004727 3300025938 Bacteria 6249
636 Ga0207704_10242662 3300025938 Bacteria 1347
637 Ga0207665_10024947 3300025939 Bacteria 3943
638 Ga0207665_10102606 3300025939 Bacteria 1999
639 Ga0207691_10003543 3300025940 Bacteria 15184
640 Ga0207691_10013350 3300025940 Bacteria 7866
641 Ga0207691_10032808 3300025940 Bacteria 4839
642 Ga0207691_10046795 3300025940 Bacteria 3973
643 Ga0207691_10102934 3300025940 Bacteria 2546
644 Ga0207691_10153386 3300025940 Bacteria 2025
645 Ga0207711_10002753 3300025941 Bacteria 15495
646 Ga0207711_10006251 3300025941 Bacteria 10048
647 Ga0207711_10469843 3300025941 Bacteria 1171
648 Ga0207711_10683652 3300025941 Bacteria 957
649 Ga0207711_10746633 3300025941 Bacteria 912
650 Ga0207689_10005455 3300025942 Bacteria 11380
651 Ga0207689_10019641 3300025942 Bacteria 5694
652 Ga0207689_10117716 3300025942 Bacteria 2185
653 Ga0207689_10488156 3300025942 Bacteria 1031
654 Ga0207661_10001853 3300025944 Bacteria 14467
655 Ga0207661_10001907 3300025944 Bacteria 14301
656 Ga0207661_10004866 3300025944 Bacteria 9413
657 Ga0207661_10007267 3300025944 Bacteria 7879
658 Ga0207661_10008533 3300025944 Bacteria 7322
659 Ga0207661_10034637 3300025944 Bacteria 3929
660 Ga0207661_10047859 3300025944 Bacteria 3396
661 Ga0207661_10167950 3300025944 Bacteria 1908
662 Ga0207661_10198084 3300025944 Bacteria 1764
663 Ga0207661_10217134 3300025944 Bacteria 1688
664 Ga0207661_10299851 3300025944 Bacteria 1440
665 Ga0207661_10463489 3300025944 Bacteria 1155
666 Ga0207679_10001341 3300025945 Bacteria 15577
667 Ga0207679_10006587 3300025945 Bacteria 7344
668 Ga0207679_10092083 3300025945 Bacteria 2348
669 Ga0207679_10192419 3300025945 Bacteria 1697
670 Ga0207679_10215775 3300025945 Bacteria 1612
671 Ga0207679_10218788 3300025945 Bacteria 1601
672 Ga0207667_10034763 3300025949 Bacteria 5409
673 Ga0207667_10056597 3300025949 Bacteria 4119
674 Ga0207667_10105114 3300025949 Bacteria 2913
675 Ga0207667_10126128 3300025949 Bacteria 2636
676 Ga0207667_10126755 3300025949 Bacteria 2630
677 Ga0207667_10233566 3300025949 Bacteria 1883
678 Ga0207667_10281980 3300025949 Bacteria 1698
679 Ga0207667_10300053 3300025949 Bacteria 1641
680 Ga0207667_10466524 3300025949 Bacteria 1282
681 Ga0207667_10537287 3300025949 Bacteria 1183
682 Ga0207651_10021908 3300025960 Bacteria 3893
683 Ga0207651_10036217 3300025960 Bacteria 3219
684 Ga0207651_10170424 3300025960 Bacteria 1716
685 Ga0207651_10173474 3300025960 Bacteria 1703
686 Ga0207651_10400513 3300025960 Bacteria 1167
687 Ga0207651_10570192 3300025960 Bacteria 986
688 Ga0207712_10000236 3300025961 Bacteria 54231
689 Ga0207712_10004705 3300025961 Bacteria 8621
690 Ga0207712_10013022 3300025961 Bacteria 5328
691 Ga0207712_10019662 3300025961 Bacteria 4414
692 Ga0207668_10002200 3300025972 Bacteria 11374
693 Ga0207668_10014204 3300025972 Bacteria 4926
694 Ga0207668_10045377 3300025972 Bacteria 2997
695 Ga0207668_10052171 3300025972 Bacteria 2828
696 Ga0207668_10388631 3300025972 Bacteria 1176
697 Ga0207640_10000324 3300025981 Bacteria 31977
698 Ga0207640_10001124 3300025981 Bacteria 14743
699 Ga0207640_10001854 3300025981 Bacteria 11325
700 Ga0207640_10015432 3300025981 Bacteria 4421
701 Ga0207640_10065476 3300025981 Bacteria 2425
702 Ga0207640_10287500 3300025981 Bacteria 1295
703 Ga0207640_10312773 3300025981 Bacteria 1247
704 Ga0207640_10609114 3300025981 Bacteria 925
705 Ga0207658_10078185 3300025986 Bacteria 2527
706 Ga0207658_10121737 3300025986 Bacteria 2082
707 Ga0207658_10390115 3300025986 Bacteria 1221
708 Ga0207677_10058774 3300026023 Bacteria 2649
709 Ga0207677_10092972 3300026023 Bacteria 2197
710 Ga0207703_10051872 3300026035 Bacteria 3327
711 Ga0207703_10052835 3300026035 Bacteria 3301
712 Ga0207703_10297709 3300026035 Bacteria 1470
713 Ga0207639_10031292 3300026041 Bacteria 3910
714 Ga0207639_10051893 3300026041 Bacteria 3122
715 Ga0207639_10220672 3300026041 Bacteria 1637
716 Ga0207639_10276977 3300026041 Bacteria 1474
717 Ga0207639_10580316 3300026041 Bacteria 1032
718 Ga0207639_10682003 3300026041 Bacteria 952
719 Ga0207678_10012023 3300026067 Bacteria 7601
720 Ga0207678_10071359 3300026067 Bacteria 2978
721 Ga0207678_10076305 3300026067 Bacteria 2871
722 Ga0207678_10086322 3300026067 Bacteria 2682
723 Ga0207678_10146850 3300026067 Bacteria 2013
724 Ga0207708_10012624 3300026075 Bacteria 6301
725 Ga0207708_10077845 3300026075 Bacteria 2545
726 Ga0207708_10112088 3300026075 Bacteria 2118
727 Ga0207702_10036288 3300026078 Bacteria 4123
728 Ga0207702_10556254 3300026078 Bacteria 1123
729 Ga0207641_10007192 3300026088 Bacteria 9281
730 Ga0207641_10115304 3300026088 Bacteria 2388
731 Ga0207641_10133751 3300026088 Bacteria 2230
732 Ga0207648_10000138 3300026089 Bacteria 72558
733 Ga0207648_10048391 3300026089 Bacteria 3722
734 Ga0207648_10097740 3300026089 Bacteria 2569
735 Ga0207648_10099910 3300026089 Bacteria 2541
736 Ga0207648_10203821 3300026089 Bacteria 1755
737 Ga0207676_10435635 3300026095 Bacteria 1232
738 Ga0207676_10894139 3300026095 Bacteria 871
739 Ga0207674_10019045 3300026116 Bacteria 7438
740 Ga0207674_10048059 3300026116 Bacteria 4370
741 Ga0207674_10048180 3300026116 Bacteria 4363
742 Ga0207674_10082972 3300026116 Bacteria 3205
743 Ga0207674_10086885 3300026116 Bacteria 3121
744 Ga0207674_10090084 3300026116 Bacteria 3059
745 Ga0207674_10101100 3300026116 Bacteria 2864
746 Ga0207674_10110465 3300026116 Bacteria 2725
747 Ga0207674_10168287 3300026116 Bacteria 2145
748 Ga0207674_10296702 3300026116 Bacteria 1565
749 Ga0207675_100001482 3300026118 Bacteria 23584
750 Ga0207675_100006697 3300026118 Bacteria 10892
751 Ga0207675_100117992 3300026118 Bacteria 2509
752 Ga0207675_100244793 3300026118 Bacteria 1734
753 Ga0207683_10006013 3300026121 Bacteria 10390
754 Ga0207683_10018004 3300026121 Bacteria 6025
755 Ga0207683_10028596 3300026121 Bacteria 4822
756 Ga0207683_10035142 3300026121 Bacteria 4359
757 Ga0207698_10019363 3300026142 Bacteria 4658
758 Ga0207698_10036093 3300026142 Bacteria 3624
759 Ga0207698_10038152 3300026142 Bacteria 3547
760 Ga0207698_10463610 3300026142 Bacteria 1226
761 Ga0207698_10561203 3300026142 Bacteria 1121
762 Ga0207698_10744398 3300026142 Bacteria 978
763 Ga0209969_1009191 3300027360 Bacteria 1406
764 Ga0209981_1002273 3300027378 Bacteria 2444
765 Ga0210000_1008961 3300027462 Bacteria 1470
766 Ga0209995_1006746 3300027471 Bacteria 1849
767 Ga0209968_1003096 3300027526 Bacteria 2493
768 Ga0209999_1000199 3300027543 Bacteria 8320
769 Ga0209999_1002599 3300027543 Bacteria 3194
770 Ga0209970_1008724 3300027614 Bacteria 1660
771 Ga0209966_1000982 3300027695 Bacteria 5325
772 Ga0209998_10003458 3300027717 Bacteria 3451
773 Ga0209974_10021093 3300027876 Bacteria 2158
774 Ga0207428_10118944 3300027907 Bacteria 2027
775 Ga0268266_10047291 3300028379 Bacteria 3686
776 Ga0268266_10484725 3300028379 Bacteria 1179
777 Ga0268265_10002653 3300028380 Bacteria 13279
778 Ga0268265_10060632 3300028380 Bacteria 2900
779 Ga0268264_10005398 3300028381 Bacteria 10824
780 Ga0268264_10012146 3300028381 Bacteria 7091
781 Ga0268264_10252891 3300028381 Bacteria 1638
782 Ga0265318_10091847 3300028577 Bacteria 1118
783 Ga0265332_10001239 3300031238 Bacteria 14770
784 Ga0265327_10004939 3300031251 Bacteria 11475
785 Ga0307513_10331498 3300031456 Bacteria 1276
786 Ga0307408_100002760 3300031548 Bacteria 12197
787 Ga0307408_100019763 3300031548 Bacteria 4537
788 Ga0307408_100052712 3300031548 Bacteria 2935
789 Ga0307408_100062503 3300031548 Bacteria 2721
790 Ga0307408_100066008 3300031548 Bacteria 2656
791 Ga0307408_100153960 3300031548 Bacteria 1818
792 Ga0307408_100223526 3300031548 Bacteria 1538
793 Ga0265314_10004621 3300031711 Bacteria 12682
794 Ga0265314_10017451 3300031711 Bacteria 5634
795 Ga0316576_10015012 3300031727 Bacteria 5185
796 Ga0316578_10041302 3300031728 Bacteria 2671
797 Ga0307405_10003326 3300031731 Bacteria 7362
798 Ga0307405_10004504 3300031731 Bacteria 6595
799 Ga0307405_10051278 3300031731 Bacteria 2559
800 Ga0307405_10061362 3300031731 Bacteria 2376
801 Ga0307405_10079157 3300031731 Bacteria 2141
802 Ga0307405_10081500 3300031731 Bacteria 2115
803 Ga0307405_10152371 3300031731 Bacteria 1627
804 Ga0307405_10228399 3300031731 Bacteria 1370
805 Ga0307405_10235083 3300031731 Bacteria 1353
806 Ga0307405_10315118 3300031731 Bacteria 1193
807 Ga0307405_10508407 3300031731 Bacteria 967
808 Ga0307413_10001842 3300031824 Bacteria 8343
809 Ga0307413_10002091 3300031824 Bacteria 7997
810 Ga0307413_10002387 3300031824 Bacteria 7627
811 Ga0307413_10037954 3300031824 Bacteria 2787
812 Ga0307413_10055726 3300031824 Bacteria 2407
813 Ga0307413_10079652 3300031824 Bacteria 2095
814 Ga0307413_10106244 3300031824 Bacteria 1868
815 Ga0307413_10111837 3300031824 Bacteria 1830
816 Ga0307413_10261069 3300031824 Bacteria 1291
817 Ga0307413_10388818 3300031824 Bacteria 1089
818 Ga0307410_10022252 3300031852 Bacteria 3914
819 Ga0307410_10054670 3300031852 Bacteria 2707
820 Ga0307410_10070477 3300031852 Bacteria 2422
821 Ga0307410_10105816 3300031852 Bacteria 2026
822 Ga0307410_10109480 3300031852 Bacteria 1996
823 Ga0307410_10369891 3300031852 Bacteria 1150
824 Ga0307406_10001264 3300031901 Bacteria 14150
825 Ga0307406_10020026 3300031901 Bacteria 3933
826 Ga0307406_10030981 3300031901 Bacteria 3253
827 Ga0307406_10033014 3300031901 Bacteria 3164
828 Ga0307406_10144685 3300031901 Bacteria 1688
829 Ga0307406_10208490 3300031901 Bacteria 1444
830 Ga0307407_10005111 3300031903 Bacteria 5655
831 Ga0307407_10021693 3300031903 Bacteria 3318
832 Ga0307407_10047832 3300031903 Bacteria 2430
833 Ga0307407_10216503 3300031903 Bacteria 1292
834 Ga0307412_10005885 3300031911 Bacteria 6908
835 Ga0307412_10007821 3300031911 Bacteria 6085
836 Ga0307412_10060199 3300031911 Bacteria 2548
837 Ga0307412_10075320 3300031911 Bacteria 2315
838 Ga0307412_10202806 3300031911 Bacteria 1507
839 Ga0307412_10407017 3300031911 Bacteria 1109
840 Ga0307409_100032235 3300031995 Bacteria 3796
841 Ga0307409_100079067 3300031995 Bacteria 2648
842 Ga0307409_100105590 3300031995 Bacteria 2348
843 Ga0307409_100119375 3300031995 Bacteria 2229
844 Ga0307409_100124031 3300031995 Bacteria 2193
845 Ga0307409_100206649 3300031995 Bacteria 1761
846 Ga0307409_100254111 3300031995 Bacteria 1608
847 Ga0307409_100331104 3300031995 Bacteria 1429
848 Ga0307409_100498924 3300031995 Bacteria 1185
849 Ga0307409_100623915 3300031995 Bacteria 1068
850 Ga0307416_100009003 3300032002 Bacteria 6494
851 Ga0307416_100016074 3300032002 Bacteria 5188
852 Ga0307416_100047021 3300032002 Bacteria 3411
853 Ga0307416_100092060 3300032002 Bacteria 2606
854 Ga0307416_100113896 3300032002 Bacteria 2391
855 Ga0307416_100116989 3300032002 Bacteria 2365
856 Ga0307416_100117798 3300032002 Bacteria 2358
857 Ga0307416_100118263 3300032002 Bacteria 2355
858 Ga0307416_100196081 3300032002 Bacteria 1910
859 Ga0307416_100209312 3300032002 Bacteria 1858
860 Ga0307416_100270316 3300032002 Bacteria 1668
861 Ga0307416_100314182 3300032002 Bacteria 1565
862 Ga0307416_100357375 3300032002 Bacteria 1481
863 Ga0307416_100364805 3300032002 Bacteria 1468
864 Ga0307416_100375061 3300032002 Bacteria 1450
865 Ga0307416_100832026 3300032002 Bacteria 1020
866 Ga0307414_10049512 3300032004 Bacteria 2906
867 Ga0307414_10086998 3300032004 Bacteria 2307
868 Ga0307414_10151426 3300032004 Bacteria 1830
869 Ga0307414_10341665 3300032004 Bacteria 1282
870 Ga0307411_10005072 3300032005 Bacteria 6412
871 Ga0307411_10072801 3300032005 Bacteria 2334
872 Ga0307411_10132943 3300032005 Bacteria 1821
873 Ga0307411_10158935 3300032005 Bacteria 1689
874 Ga0307411_10226050 3300032005 Bacteria 1455
875 Ga0307411_10298126 3300032005 Bacteria 1291
876 Ga0307415_100004310 3300032126 Bacteria 7364
877 Ga0307415_100004471 3300032126 Bacteria 7257
878 Ga0307415_100006886 3300032126 Bacteria 6172
879 Ga0307415_100023196 3300032126 Bacteria 3847
880 Ga0307415_100041357 3300032126 Bacteria 3060
881 Ga0307415_100077926 3300032126 Bacteria 2355
882 Ga0307415_100116777 3300032126 Bacteria 1991
883 Ga0307415_100127589 3300032126 Bacteria 1920
884 Ga0307415_100282987 3300032126 Bacteria 1365
885 Ga0307415_100315483 3300032126 Bacteria 1301
886 Ga0307415_100342471 3300032126 Bacteria 1255
887 Ga0373926_0074468 3300035083 Bacteria 1250
888 Ga0373929_0050970 3300035085 Bacteria 946
889 Ga0373934_0001304 3300035086 Bacteria 9089
890 Ga0373934_0104066 3300035086 Bacteria 1148
891 Ga0373944_0025955 3300035089 Bacteria 1728
892 Ga0373923_0000756 3300035111 Bacteria 8367
893 Ga0373953_0014696 3300035117 Bacteria 2822
894 Ga0373953_0097427 3300035117 Bacteria 1235
895 Ga0373954_0006856 3300035118 Bacteria 4972
896 Ga0373956_0001329 3300035119 Bacteria 10206
897 Ga0373956_0023371 3300035119 Bacteria 2653
898 Ga0373943_0057545 3300035170 Bacteria 1932
899 Ga0373943_0089557 3300035170 Bacteria 1591
900 Ga0373946_0054283 3300035171 Bacteria 1686
901 Ga0373946_0096626 3300035171 Bacteria 1317
902 Ga0373955_0000309 3300035172 Bacteria 20251
903 Ga0373955_0272419 3300035172 Bacteria 1017
904 Ga0373962_0069140 3300035242 Bacteria 1052
905 Ga0373924_0001445 3300035410 Bacteria 7710
906 Ga0373931_0017434 3300035691 Bacteria 3552
907 Ga0373935_0001142 3300035692 Bacteria 14517
908 Ga0373935_0058549 3300035692 Bacteria 2461
909 Ga0373927_0134380 3300035695 Bacteria 1616
910 Ga0373927_0160288 3300035695 Bacteria 1474
911 Ga0373927_0238483 3300035695 Bacteria 1195
912 Ga0373933_0000191 3300035724 Bacteria 40734
913 Ga0373933_0002765 3300035724 Bacteria 9786
914 Ga0373933_0266640 3300035724 Bacteria 1105
915 Ga0373947_0036655 3300035725 Bacteria 2908
916 Ga0373947_0236917 3300035725 Bacteria 1203
917 Ga0373937_0000625 3300036401 Bacteria 31052
918 Ga0373937_0063603 3300036401 Bacteria 3394
919 Ga0373937_0616041 3300036401 Bacteria 1030
920 Ga0373937_0662822 3300036401 Bacteria 989
921 Ga0373925_0005112 3300037068 Bacteria 9823
922 Ga0395899_0151372 3300037312 Bacteria 1644
923 Ga0395905_0025260 3300037471 Bacteria 5602
924 Ga0395901_0001770 3300038443 Bacteria 22280
925 Ga0436365_0023278 3300039437 Bacteria 1070
926 Ga0436365_0408308 3300039437 Bacteria 3423
927 Ga0451804_0380477 3300041463 Bacteria 713
928 Ga0439433_0015813 3300041999 Bacteria 1668
929 Ga0439448_0036131 3300042005 Bacteria 1584
930 Ga0439432_037604 3300042006 Bacteria 1544
931 Ga0450896_011384 3300042133 Bacteria 1252
932 Ga0439446_0009762 3300042156 Bacteria 2575
933 Ga0439446_0029363 3300042156 Bacteria 1587
934 Ga0451577_0000001 3300042876 Bacteria 2461803
935 Ga0451577_0003185 3300042876 Bacteria 18443
936 Ga0451577_0083322 3300042876 Bacteria 2852
937 Ga0451577_0141188 3300042876 Bacteria 2164
938 Ga0451577_0524250 3300042876 Bacteria 1076
939 Ga0453683_0033780 3300044673 Bacteria 3226
940 Ga0466966_0001530 3300044684 Bacteria 14826
941 Ga0466966_0006135 3300044684 Bacteria 7942
942 Ga0466961_0042804 3300044693 Bacteria 2902
943 Ga0466961_0160956 3300044693 Bacteria 1399
944 Ga0466961_0204760 3300044693 Bacteria 1219
945 Ga0466963_0055834 3300044694 Bacteria 2627
946 Ga0453684_0026762 3300044712 Bacteria 8311
947 Ga0453684_0062783 3300044712 Bacteria 4756
948 Ga0466971_0087484 3300044719 Bacteria 1425
949 Ga0466957_0076776 3300044842 Bacteria 2075
950 Ga0466957_0209596 3300044842 Bacteria 1283
951 Ga0466959_0016263 3300045049 Bacteria 5433
952 Ga0466959_0049416 3300045049 Bacteria 3090
953 Ga0451576_0153457 3300045051 Bacteria 2402
954 Ga0451576_0237355 3300045051 Bacteria 1904
955 Ga0451576_0510035 3300045051 Bacteria 1263
956 Ga0466958_0185693 3300045836 Bacteria 1320
957 Ga0466967_0065040 3300045976 Bacteria 3245
958 Ga0466967_0821743 3300045976 Bacteria 923
959 Ga0466967_1095808 3300045976 Bacteria 793
960 Ga0495592_0001172 3300046454 Bacteria 18177
961 Ga0495592_0009293 3300046454 Bacteria 7395
962 Ga0495603_0003416 3300046455 Bacteria 9453
963 Ga0495603_0043390 3300046455 Bacteria 2685
964 Ga0495603_0076014 3300046455 Bacteria 1971
965 Ga0495629_0009752 3300046459 Bacteria 7007
966 Ga0495629_0019579 3300046459 Bacteria 4834
967 Ga0495629_0042049 3300046459 Bacteria 3213
968 Ga0495629_0048696 3300046459 Bacteria 2971
969 Ga0495629_0073936 3300046459 Bacteria 2380
970 Ga0495629_0077215 3300046459 Bacteria 2325
971 Ga0495629_0128626 3300046459 Bacteria 1764
972 Ga0495629_0223629 3300046459 Bacteria 1298
973 Ga0495629_0266222 3300046459 Bacteria 1178
974 Ga0495651_0000116 3300046462 Bacteria 59001
975 Ga0495651_0011176 3300046462 Bacteria 6903
976 Ga0495651_0017188 3300046462 Bacteria 5605
977 Ga0495653_0000992 3300046463 Bacteria 21849
978 Ga0495653_0007356 3300046463 Bacteria 9019
979 Ga0495653_0026437 3300046463 Bacteria 4653
980 Ga0495580_0016230 3300046472 Bacteria 5595
981 Ga0495580_0047588 3300046472 Bacteria 3040
982 Ga0495580_0087356 3300046472 Bacteria 2172
983 Ga0495580_0113415 3300046472 Bacteria 1883
984 Ga0495582_0004886 3300046473 Bacteria 7509
985 Ga0495582_0010686 3300046473 Bacteria 5050
986 Ga0495582_0036644 3300046473 Bacteria 2698
987 Ga0495582_0050921 3300046473 Bacteria 2283
988 Ga0495582_0150032 3300046473 Bacteria 1323
989 Ga0495639_0004714 3300046475 Bacteria 5862
990 Ga0495639_0019583 3300046475 Bacteria 2955
991 Ga0495662_0035604 3300046476 Bacteria 2402
992 Ga0495664_0013790 3300046477 Bacteria 4582
993 Ga0495585_0144448 3300046492 Bacteria 1244
994 Ga0495594_0005611 3300046499 Bacteria 6449
995 Ga0495594_0007853 3300046499 Bacteria 5488
996 Ga0495594_0010292 3300046499 Bacteria 4849
997 Ga0495594_0012873 3300046499 Bacteria 4361
998 Ga0495594_0020695 3300046499 Bacteria 3506
999 Ga0495594_0140901 3300046499 Bacteria 1368
1000 Ga0495594_0199284 3300046499 Bacteria 1141
1001 Ga0495596_0010087 3300046500 Bacteria 4131
1002 Ga0495608_0001013 3300046511 Bacteria 19794
1003 Ga0495608_0033181 3300046511 Bacteria 3491
1004 Ga0495608_0073497 3300046511 Bacteria 2229
1005 Ga0495608_0103342 3300046511 Bacteria 1836
1006 Ga0495618_0218814 3300046514 Bacteria 1202
1007 Ga0495628_0000113 3300046516 Bacteria 65741
1008 Ga0495630_0019876 3300046517 Bacteria 4944
1009 Ga0495630_0048337 3300046517 Bacteria 3183
1010 Ga0495630_0050774 3300046517 Bacteria 3104
1011 Ga0495630_0094702 3300046517 Bacteria 2257
1012 Ga0495663_0020324 3300046525 Bacteria 1905
1013 Ga0495642_0274020 3300046528 Bacteria 739
1014 Ga0495652_0001031 3300046529 Bacteria 31830
1015 Ga0495652_0001095 3300046529 Bacteria 30639
1016 Ga0495652_0123654 3300046529 Bacteria 2059
1017 Ga0495652_0133218 3300046529 Bacteria 1964
1018 Ga0495665_0002814 3300046531 Bacteria 9385
1019 Ga0495665_0014539 3300046531 Bacteria 4244
1020 Ga0495665_0023640 3300046531 Bacteria 3301
1021 Ga0495665_0076291 3300046531 Bacteria 1764
1022 Ga0495586_0015359 3300046535 Bacteria 4074
1023 Ga0495586_0065516 3300046535 Bacteria 1980
1024 Ga0495586_0095659 3300046535 Bacteria 1644
1025 Ga0495587_0000143 3300046536 Bacteria 53480
1026 Ga0495645_0001110 3300046543 Bacteria 18204
1027 Ga0495645_0001766 3300046543 Bacteria 14712
1028 Ga0495645_0334115 3300046543 Bacteria 980
1029 Ga0495645_0461199 3300046543 Bacteria 800
1030 Ga0495622_0052951 3300046557 Bacteria 1883
1031 Ga0495633_0104185 3300046558 Bacteria 1316
1032 Ga0495667_0001636 3300046559 Bacteria 14836
1033 Ga0495667_0016331 3300046559 Bacteria 5016
1034 Ga0495667_0024990 3300046559 Bacteria 4026
1035 Ga0495667_0073783 3300046559 Bacteria 2222
1036 Ga0495635_0000158 3300046663 Bacteria 41599
1037 Ga0495635_0054906 3300046663 Bacteria 2744
1038 Ga0495659_0053455 3300046664 Bacteria 1476
1039 Ga0495659_0087973 3300046664 Bacteria 1189
1040 Ga0495659_0123527 3300046664 Bacteria 1021
1041 Ga0495659_0143222 3300046664 Bacteria 955
1042 Ga0495588_0030623 3300046674 Bacteria 2705
1043 Ga0495588_0297274 3300046674 Bacteria 850
1044 Ga0495657_0000476 3300046675 Bacteria 37717
1045 Ga0495657_0049025 3300046675 Bacteria 2847
1046 Ga0495657_0059269 3300046675 Bacteria 2539
1047 Ga0495657_0113082 3300046675 Bacteria 1718
1048 Ga0495599_0000553 3300046678 Bacteria 21358
1049 Ga0495599_0010652 3300046678 Bacteria 5627
1050 Ga0495599_0015785 3300046678 Bacteria 4688
1051 Ga0495599_0073902 3300046678 Bacteria 2128
1052 Ga0495623_0000017 3300046679 Bacteria 108556
1053 Ga0495623_0017452 3300046679 Bacteria 4637
1054 Ga0495623_0101934 3300046679 Bacteria 1748
1055 Ga0495623_0108146 3300046679 Bacteria 1688
1056 Ga0495646_0002016 3300046680 Bacteria 12293
1057 Ga0495646_0016342 3300046680 Bacteria 4709
1058 Ga0495646_0089993 3300046680 Bacteria 1774
1059 Ga0495658_0002526 3300046683 Bacteria 9205
1060 Ga0495658_0166410 3300046683 Bacteria 1362
1061 Ga0495658_0285154 3300046683 Bacteria 1043
1062 Ga0495658_0305619 3300046683 Bacteria 1006
1063 Ga0495669_0171122 3300046684 Bacteria 1033
1064 Ga0495613_0060691 3300046689 Bacteria 2769
1065 Ga0495613_0067704 3300046689 Bacteria 2606
1066 Ga0495613_0068168 3300046689 Bacteria 2595
1067 Ga0495613_0077081 3300046689 Bacteria 2425
1068 Ga0495670_0054140 3300046691 Bacteria 2010
1069 Ga0495600_0000063 3300046809 Bacteria 61349
1070 Ga0495600_0043058 3300046809 Bacteria 2943
1071 Ga0495600_0245756 3300046809 Bacteria 1139
1072 Ga0495581_0010867 3300047315 Bacteria 5264
1073 Ga0495581_0022768 3300047315 Bacteria 3628
1074 Ga0495604_0000017 3300047317 Bacteria 192029
1075 Ga0495604_0021369 3300047317 Bacteria 5167
1076 Ga0495604_0104964 3300047317 Bacteria 2069
1077 Ga0495636_0119308 3300047318 Bacteria 1166
1078 Ga0495674_0003779 3300047319 Bacteria 14722
1079 Ga0495674_0014556 3300047319 Bacteria 7360
1080 Ga0495674_0022976 3300047319 Bacteria 5745
1081 Ga0495672_0004623 3300047320 Bacteria 11171
1082 Ga0495676_0257331 3300047321 Bacteria 1189
1083 Ga0495680_0007844 3300047322 Bacteria 9746
1084 Ga0495680_0013035 3300047322 Bacteria 7271
1085 Ga0495680_0627083 3300047322 Bacteria 717
1086 Ga0495675_0079198 3300047444 Bacteria 2069
1087 Ga0495675_0129471 3300047444 Bacteria 1569
1088 Ga0495675_0170389 3300047444 Bacteria 1337
1089 Ga0495684_0000095 3300047471 Bacteria 62460
1090 Ga0495684_0023565 3300047471 Bacteria 4732
1091 Ga0495684_0026626 3300047471 Bacteria 4444
1092 Ga0495684_0071242 3300047471 Bacteria 2641
1093 Ga0495593_0020541 3300047673 Bacteria 3698
1094 Ga0495602_0001119 3300048088 Bacteria 26275
1095 Ga0495602_0013466 3300048088 Bacteria 8359
1096 Ga0496100_0109226 3300048903 Bacteria 1919
1097 Ga0496101_0056945 3300048904 Bacteria 2826
1098 Ga0496101_0125918 3300048904 Bacteria 1941
1099 Ga0496104_0103483 3300048907 Bacteria 2728
1100 Ga0496105_0059694 3300048908 Bacteria 3147
1101 Ga0496105_0071848 3300048908 Bacteria 2860
1102 Ga0496106_0003759 3300048909 Bacteria 11316
1103 Ga0496106_0064193 3300048909 Bacteria 2793
1104 Ga0496106_0157904 3300048909 Bacteria 1792
1105 Ga0496107_0134588 3300048910 Bacteria 1826
1106 Ga0496107_0387268 3300048910 Bacteria 1040
1107 Ga0496108_0430642 3300048911 Bacteria 1152
1108 Ga0496112_0002541 3300048915 Bacteria 14732
1109 Ga0496112_0043501 3300048915 Bacteria 4397
1110 Ga0496112_0104391 3300048915 Bacteria 2804
1111 Ga0496112_0248569 3300048915 Bacteria 1730
1112 Ga0496113_0016753 3300048916 Bacteria 5069
1113 Ga0496113_0156046 3300048916 Bacteria 1802
1114 Ga0496114_0136082 3300048917 Bacteria 2124
1115 Ga0496115_0052769 3300048918 Bacteria 3262
1116 Ga0496115_0082370 3300048918 Bacteria 2621
1117 Ga0496115_0376515 3300048918 Bacteria 1155
1118 Ga0501304_000552 3300049160 Bacteria 2011
1119 Ga0501291_018783 3300049514 Bacteria 1079
1120 Ga0501292_015075 3300049515 Bacteria 1205
1121 Ga0501299_013743 3300049522 Bacteria 1400
1122 Ga0501314_000038 3300049530 Bacteria 5733
1123 Ga0501031_0036052 3300049568 Bacteria 3226
1124 Ga0501031_0182846 3300049568 Bacteria 1369
1125 Ga0501031_0417637 3300049568 Bacteria 867
1126 Ga0501032_0082763 3300049569 Bacteria 2135
1127 Ga0501032_0184321 3300049569 Bacteria 1366
1128 Ga0501034_0220989 3300049571 Bacteria 1847
1129 Ga0501034_0470966 3300049571 Bacteria 1172
1130 Ga0501036_0131789 3300049572 Bacteria 2110
1131 Ga0501037_0036525 3300049573 Bacteria 3621
1132 Ga0501037_0252132 3300049573 Bacteria 1235
1133 Ga0501038_0011902 3300049574 Bacteria 7941
1134 Ga0501038_0029198 3300049574 Bacteria 4890
1135 Ga0501039_0103131 3300049575 Bacteria 2227
1136 Ga0501039_0165564 3300049575 Bacteria 1738
1137 Ga0501040_0040969 3300049576 Bacteria 3154
1138 Ga0501040_0080203 3300049576 Bacteria 2260
1139 Ga0501040_0176671 3300049576 Bacteria 1513
1140 Ga0501040_0383694 3300049576 Bacteria 1008
1141 Ga0501041_0023985 3300049577 Bacteria 3660
1142 Ga0501041_0227281 3300049577 Bacteria 1171
1143 Ga0501042_0119003 3300049578 Bacteria 1901
1144 Ga0501043_0014332 3300049579 Bacteria 6204
1145 Ga0501043_0047600 3300049579 Bacteria 3371
1146 Ga0501046_0028687 3300049580 Bacteria 4531
1147 Ga0501046_0112744 3300049580 Bacteria 2076
1148 Ga0501046_0186025 3300049580 Bacteria 1551
1149 Ga0501047_0019591 3300049581 Bacteria 6492
1150 Ga0501047_0029942 3300049581 Bacteria 5247
1151 Ga0501047_0291019 3300049581 Bacteria 1477
1152 Ga0501047_0405438 3300049581 Bacteria 1196
1153 Ga0501070_0042534 3300049586 Bacteria 3784
1154 Ga0501070_0069675 3300049586 Bacteria 2912
1155 Ga0501070_0097328 3300049586 Bacteria 2434
1156 Ga0501071_0238684 3300049587 Bacteria 1370
1157 Ga0501071_0421544 3300049587 Bacteria 1020
1158 Ga0501072_0010585 3300049588 Bacteria 7024
1159 Ga0501074_0246973 3300049590 Bacteria 1269
1160 Ga0501075_0078651 3300049591 Bacteria 2496
1161 Ga0501076_0069214 3300049592 Bacteria 2820
1162 Ga0501076_0244716 3300049592 Bacteria 1467
1163 Ga0501209_057742 3300049656 Bacteria 1075
1164 Ga0501217_010354 3300049661 Bacteria 2041
1165 Ga0501223_008477 3300049663 Bacteria 2097
1166 Ga0501224_001238 3300049664 Bacteria 3359
1167 Ga0501227_018036 3300049665 Bacteria 1598
1168 Ga0501228_005012 3300049666 Bacteria 1159
1169 Ga0501230_009571 3300049667 Bacteria 1494
1170 Ga0501233_004905 3300049668 Bacteria 2474
1171 Ga0501235_007524 3300049669 Bacteria 2370
1172 Ga0501249_012864 3300049679 Bacteria 1773
1173 Ga0501249_054659 3300049679 Bacteria 919
1174 Ga0501258_005248 3300049687 Bacteria 1251
1175 Ga0501221_041781 3300049704 Bacteria 1002
1176 Ga0501225_0004791 3300049705 Bacteria 4004
1177 Ga0501234_001400 3300049707 Bacteria 3791
1178 Ga0501245_012427 3300049708 Bacteria 1249
1179 Ga0501079_0019559 3300049741 Bacteria 5172
1180 Ga0501079_0035622 3300049741 Bacteria 3832
1181 Ga0501080_0443846 3300049742 Bacteria 1164
1182 Ga0501080_0570580 3300049742 Bacteria 1007
1183 Ga0501081_0148167 3300049743 Bacteria 1685
1184 Ga0501081_0314868 3300049743 Bacteria 1149
1185 Ga0501083_0309541 3300049744 Bacteria 1027
1186 Ga0501266_003064 3300049763 Bacteria 2080
1187 Ga0501268_008523 3300049765 Bacteria 1555
1188 Ga0501274_002181 3300049771 Bacteria 1526
1189 Ga0501283_008388 3300049779 Bacteria 1488
1190 Ga0501035_0052570 3300049822 Bacteria 3645
1191 Ga0501035_0204036 3300049822 Bacteria 1694
1192 Ga0501035_0288383 3300049822 Bacteria 1386
1193 Ga0501044_0007223 3300049823 Bacteria 12218
1194 Ga0501044_0064096 3300049823 Bacteria 3753
1195 Ga0501044_0152540 3300049823 Bacteria 2292
1196 Ga0501045_0032763 3300049824 Bacteria 3766
1197 Ga0501212_001652 3300049851 Bacteria 2552
1198 nmdc:mga0k408_122928_c1 3300050493 Bacteria 1538
1199 nmdc:mga05p37_151379_c1 3300050507 Bacteria 2837
1200 nmdc:mga05p37_57467_c1 3300050507 Bacteria 4792
1201 nmdc:mga09592_50694_c1 3300050508 Bacteria 3501
1202 nmdc:mga09592_74630_c1 3300050508 Bacteria 2882
1203 nmdc:mga0qj67_75775_c1 3300050509 Bacteria 2690
1204 nmdc:mga0qj67_77954_c1 3300050509 Bacteria 2652
1205 nmdc:mga0qj67_87554_c1 3300050509 Bacteria 2500
1206 nmdc:mga0qj67_90728_c1 3300050509 Bacteria 2455
1207 nmdc:mga06r32_259645_c1 3300050510 Bacteria 1725
1208 nmdc:mga06r32_303714_c1 3300050510 Bacteria 1582
1209 nmdc:mga06r32_310188_c1 3300050510 Bacteria 1563
1210 nmdc:mga06r32_6558_c1 3300050510 Bacteria 10457
1211 nmdc:mga08y16_1022_c1 3300050511 Bacteria 27431
1212 nmdc:mga08y16_281933_c1 3300050511 Bacteria 1714
1213 nmdc:mga08y16_46413_c1 3300050511 Bacteria 4548
1214 nmdc:mga08y16_597362_c1 3300050511 Bacteria 1113
1215 nmdc:mga0n895_21843_c1 3300050512 Bacteria 5991
1216 nmdc:mga0rr50_135710_c1 3300050513 Bacteria 1974
1217 nmdc:mga0a205_17997_c1 3300050515 Bacteria 6635
1218 nmdc:mga0a205_26534_c1 3300050515 Bacteria 5526
1219 nmdc:mga0a205_27367_c1 3300050515 Bacteria 5446
1220 Ga0495601_0102656 3300053077 Bacteria 1848
1221 Ga0495612_0004309 3300053078 Bacteria 5903
1222 Ga0495619_0002351 3300053085 Bacteria 12447
1223 Ga0495619_0062582 3300053085 Bacteria 2477
1224 Ga0501084_0221154 3300054114 Bacteria 1598
1225 Ga0501082_0071941 3300060353 Bacteria 2978
1226 Ga0501082_0086997 3300060353 Bacteria 2696
1227 Ga0466962_0078952 3300061719 Bacteria 1573
1228 Ga0530510_0055415 3300061734 Bacteria 2864
1229 Ga0065712_10220080
1230 LJQas_1006187
1231 Ga0055536_1006040
1232 Ga0058863_10017357
1233 Ga0058863_10086968
1234 Ga0058863_10124246
1235 Ga0058863_11781841
1236 Ga0058861_11830918
1237 Ga0058861_12045205
1238 Ga0058861_12068682
1239 Ga0058861_12070180
1240 Ga0058862_12797539
1241 Ga0058862_12888623
1242 Ga0065165_1000131
1243 Ga0065704_10014908
1244 Ga0065712_10130506
1245 Ga0065715_10135391
1246 Ga0065707_10024835
1247 Ga0070658_10030953
1248 Ga0070658_10045112
1249 Ga0070658_10120109
1250 Ga0070658_10171352
1251 Ga0070658_10506187
1252 Ga0070676_10000896
1253 Ga0070676_10010363
1254 Ga0070676_10141630
1255 Ga0070683_100003340
1256 Ga0070683_100006197
1257 Ga0070683_100046570
1258 Ga0070683_100058071
1259 Ga0070683_100071412
1260 Ga0070683_100130283
1261 Ga0070683_100163138
1262 Ga0070683_100253323
1263 Ga0070683_100417731
1264 Ga0070690_100021133
1265 Ga0070690_100054901
1266 Ga0070690_100173738
1267 Ga0070670_100016207
1268 Ga0070670_100095610
1269 Ga0070670_100240332
1270 Ga0070677_10107002
1271 Ga0068869_100003669
1272 Ga0068869_100057193
1273 Ga0068869_100148652
1274 Ga0070666_10093653
1275 Ga0070666_10154722
1276 Ga0070680_100004063
1277 Ga0070680_100005527
1278 Ga0070680_100025720
1279 Ga0070680_100037118
1280 Ga0070680_100048050
1281 Ga0070680_100062828
1282 Ga0070680_100067284
1283 Ga0070680_100094132
1284 Ga0070680_100103171
1285 Ga0070680_100106030
1286 Ga0070680_100148940
1287 Ga0070680_100163795
1288 Ga0070680_100175503
1289 Ga0070680_100179989
1290 Ga0070680_100203783
1291 Ga0070680_100309742
1292 Ga0070682_100026044
1293 Ga0070682_100029919
1294 Ga0070682_100057682
1295 Ga0070682_100060558
1296 Ga0070682_100096638
1297 Ga0070682_100235067
1298 Ga0068868_100043273
1299 Ga0068868_100141727
1300 Ga0068868_100229320
1301 Ga0068868_100334057
1302 Ga0070660_100143024
1303 Ga0070660_100293209
1304 Ga0070660_100301949
1305 Ga0070689_100012783
1306 Ga0070689_100031628
1307 Ga0070689_100040239
1308 Ga0070689_100154947
1309 Ga0070691_10042806
1310 Ga0070691_10050992
1311 Ga0070687_100026607
1312 Ga0070661_100013855
1313 Ga0070661_100028453
1314 Ga0070661_100029610
1315 Ga0070661_100029667
1316 Ga0070661_100063709
1317 Ga0070661_100216264
1318 Ga0070661_100249809
1319 Ga0070661_100253420
1320 Ga0070692_10020992
1321 Ga0070692_10030572
1322 Ga0070692_10070694
1323 Ga0070668_100000990
1324 Ga0070668_100017369
1325 Ga0070668_100044436
1326 Ga0070668_100089192
1327 Ga0070669_100002074
1328 Ga0070669_100025980
1329 Ga0070669_100066368
1330 Ga0070675_100003059
1331 Ga0070675_100006526
1332 Ga0070675_100058013
1333 Ga0070671_100072541
1334 Ga0070671_100119817
1335 Ga0070671_100159410
1336 Ga0070674_100001338
1337 Ga0070674_100075414
1338 Ga0070674_100137876
1339 Ga0070674_100444582
1340 Ga0070673_100006677
1341 Ga0070673_100024226
1342 Ga0070673_100153788
1343 Ga0070673_100187913
1344 Ga0070673_100329863
1345 Ga0070688_100028355
1346 Ga0070688_100037041
1347 Ga0070659_100002785
1348 Ga0070659_100012581
1349 Ga0070659_100108977
1350 Ga0070659_100116694
1351 Ga0070659_100185248
1352 Ga0070667_100043630
1353 Ga0070667_100093065
1354 Ga0070667_100111431
1355 Ga0070667_100128161
1356 Ga0070667_100170052
1357 Ga0070667_100228951
1358 Ga0070703_10041333
1359 Ga0070709_10006385
1360 Ga0070714_100016130
1361 Ga0070714_100018849
1362 Ga0070714_100139880
1363 Ga0070714_100200652
1364 Ga0070713_100008004
1365 Ga0070713_100035372
1366 Ga0070713_100065550
1367 Ga0070713_100286532
1368 Ga0070710_10016585
1369 Ga0070710_10064387
1370 Ga0070701_10194692
1371 Ga0070711_100025951
1372 Ga0070711_100036243
1373 Ga0070711_100079312
1374 Ga0070705_100003623
1375 Ga0070705_100325140
1376 Ga0070700_100204357
1377 Ga0070700_100443977
1378 Ga0070694_100111310
1379 Ga0070708_100001661
1380 Ga0070708_100018839
1381 Ga0070708_100020893
1382 Ga0070708_100338186
1383 Ga0070663_100005346
1384 Ga0070678_100006200
1385 Ga0070678_100053888
1386 Ga0070662_100006245
1387 Ga0070662_100011148
1388 Ga0070662_100047159
1389 Ga0070662_100054587
1390 Ga0070662_100059628
1391 Ga0070662_100118516
1392 Ga0070662_100251955
1393 Ga0070681_10001182
1394 Ga0070681_10030030
1395 Ga0070681_10044619
1396 Ga0070681_10053922
1397 Ga0070681_10067823
1398 Ga0070681_10078280
1399 Ga0070681_10153736
1400 Ga0070681_10160574
1401 Ga0070681_10171280
1402 Ga0070681_10200760
1403 Ga0070681_10252646
1404 Ga0070681_10402893
1405 Ga0070681_10505405
1406 Ga0070681_10515824
1407 Ga0070681_10585687
1408 Ga0070681_10662384
1409 Ga0070681_10716662
1410 Ga0068867_100006780
1411 Ga0068867_100037348
1412 Ga0068867_100079269
1413 Ga0068867_100158633
1414 Ga0070685_10086131
1415 Ga0070706_100115208
1416 Ga0070706_100188726
1417 Ga0070707_100071326
1418 Ga0070698_100001954
1419 Ga0070698_100024253
1420 Ga0070698_100052230
1421 Ga0070698_100115071
1422 Ga0070698_100189783
1423 Ga0070699_100017326
1424 Ga0070699_100243299
1425 Ga0070699_100248507
1426 Ga0070699_100303757
1427 Ga0070679_100000601
1428 Ga0070679_100001848
1429 Ga0070679_100019482
1430 Ga0070679_100023697
1431 Ga0070679_100038523
1432 Ga0070679_100052627
1433 Ga0070679_100068775
1434 Ga0070679_100091847
1435 Ga0070679_100095030
1436 Ga0070679_100113323
1437 Ga0070679_100113336
1438 Ga0070679_100165137
1439 Ga0070679_100249770
1440 Ga0070679_100257749
1441 Ga0070684_100002577
1442 Ga0070684_100005718
1443 Ga0070684_100041533
1444 Ga0070684_100066458
1445 Ga0070684_100072750
1446 Ga0070684_100092190
1447 Ga0070684_100106633
1448 Ga0070684_100152966
1449 Ga0070684_100301363
1450 Ga0070684_100302271
1451 Ga0070684_100349691
1452 Ga0070697_100190886
1453 Ga0068853_100040762
1454 Ga0068853_100096330
1455 Ga0068853_100203663
1456 Ga0068853_100205913
1457 Ga0068853_100214746
1458 Ga0070672_100003949
1459 Ga0070672_100038933
1460 Ga0070672_100061495
1461 Ga0070672_100079274
1462 Ga0070686_100059565
1463 Ga0070686_100158982
1464 Ga0070686_100171206
1465 Ga0070686_100215576
1466 Ga0070695_100006164
1467 Ga0070695_100013525
1468 Ga0070695_100401927
1469 Ga0070696_100000402
1470 Ga0070696_100004370
1471 Ga0070696_100022063
1472 Ga0070696_100111425
1473 Ga0070693_100054124
1474 Ga0070693_100075365
1475 Ga0070665_100028793
1476 Ga0070665_100124547
1477 Ga0070665_100230766
1478 Ga0070704_100212348
1479 Ga0068855_100008032
1480 Ga0068855_100063431
1481 Ga0068855_100075666
1482 Ga0068855_100132631
1483 Ga0068855_100167043
1484 Ga0068855_100257123
1485 Ga0068855_100269245
1486 Ga0068855_100466223
1487 Ga0068855_100597234
1488 Ga0068855_100622768
1489 Ga0068855_100886266
1490 Ga0070664_100008033
1491 Ga0070664_100113420
1492 Ga0070664_100145371
1493 Ga0070664_100229505
1494 Ga0070664_100337824
1495 Ga0068857_100009735
1496 Ga0068857_100015888
1497 Ga0068857_100024265
1498 Ga0068857_100054772
1499 Ga0068857_100067276
1500 Ga0068857_100068315
1501 Ga0068857_100292587
1502 Ga0068854_100000444
1503 Ga0068854_100008727
1504 Ga0068854_100013720
1505 Ga0068854_100051465
1506 Ga0068854_100585640
1507 Ga0068854_100625852
1508 Ga0068856_100073182
1509 Ga0068856_100088427
1510 Ga0068856_100250348
1511 Ga0068856_100262205
1512 Ga0070702_100047710
1513 Ga0068852_100009981
1514 Ga0068852_100029062
1515 Ga0068852_100068754
1516 Ga0068852_100238569
1517 Ga0068852_100379756
1518 Ga0068852_100439541
1519 Ga0068859_100017117
1520 Ga0068859_100039441
1521 Ga0068859_100044463
1522 Ga0068859_100075086
1523 Ga0068859_100287128
1524 Ga0068864_100012293
1525 Ga0068866_10000625
1526 Ga0068861_100028185
1527 Ga0068861_100159667
1528 Ga0068861_100470097
1529 Ga0068851_10035251
1530 Ga0068851_10036179
1531 Ga0068870_10011998
1532 Ga0068870_10055691
1533 Ga0068863_100023269
1534 Ga0068863_100029946
1535 Ga0068863_100119013
1536 Ga0068863_100587566
1537 Ga0068858_100083441
1538 Ga0068858_100181183
1539 Ga0068858_100327658
1540 Ga0068860_100025031
1541 Ga0068860_100057895
1542 Ga0068860_100180185
1543 Ga0068862_100003483
1544 Ga0081539_10001506
1545 Ga0081539_10023333
1546 Ga0070717_10018982
1547 Ga0070717_10122418
1548 Ga0070716_100014957
1549 Ga0070712_100039564
1550 Ga0070712_100139555
1551 Ga0070712_100229717
1552 Ga0097621_100453116
1553 Ga0068871_100103372
1554 Ga0068871_100143085
1555 Ga0075428_100044329
1556 Ga0075428_100091987
1557 Ga0075430_100040306
1558 Ga0075430_100054598
1559 Ga0075430_100057895
1560 Ga0075430_100081302
1561 Ga0075430_100100001
1562 Ga0075431_100066106
1563 Ga0075431_100085342
1564 Ga0075431_100089199
1565 Ga0075431_100130129
1566 Ga0075431_100341131
1567 Ga0075433_10008454
1568 Ga0075433_10017586
1569 Ga0075434_100293178
1570 Ga0075429_100019213
1571 Ga0075429_100055132
1572 Ga0075429_100181478
1573 Ga0068865_100047651
1574 Ga0068865_100050694
1575 Ga0068865_100438500
1576 Ga0075436_100011027
1577 Ga0075436_100149178
1578 Ga0097620_100017115
1579 Ga0097620_100039441
1580 Ga0097620_100044456
1581 Ga0097620_100075085
1582 Ga0097620_100287131
1583 Ga0075435_100151205
1584 Ga0099795_10031621
1585 Ga0105240_10053668
1586 Ga0105240_10056546
1587 Ga0105240_10101231
1588 Ga0105240_10123211
1589 Ga0105240_10171625
1590 Ga0105240_10337410
1591 Ga0105240_10741251
1592 Ga0111539_10070760
1593 Ga0111539_10080966
1594 Ga0111539_10454897
1595 Ga0105245_10078468
1596 Ga0105245_10131671
1597 Ga0105245_10155732
1598 Ga0105245_10169504
1599 Ga0105247_10193293
1600 Ga0114129_10034794
1601 Ga0114129_10074165
1602 Ga0114129_10346555
1603 Ga0105243_10140503
1604 Ga0105241_10008410
1605 Ga0105241_10089216
1606 Ga0105241_10435464
1607 Ga0105242_10007285
1608 Ga0105242_10034725
1609 Ga0105242_10149144
1610 Ga0105248_10040839
1611 Ga0105248_10050747
1612 Ga0105248_10058180
1613 Ga0105248_10122714
1614 Ga0105248_10524641
1615 Ga0105237_10178898
1616 Ga0105237_10220165
1617 Ga0105237_10474801
1618 Ga0105238_10029825
1619 Ga0105238_10075953
1620 Ga0105238_10269246
1621 Ga0105249_10000247
1622 Ga0105249_10018979
1623 Ga0105249_10173030
1624 Ga0105249_10239032
1625 Ga0099796_10021104
1626 Ga0105239_10043771
1627 Ga0105239_10121410
1628 Ga0105239_10172198
1629 Ga0105246_10031841
1630 Ga0105246_10625625
1631 Ga0157373_10008827
1632 Ga0157373_10024036
1633 Ga0157373_10078858
1634 Ga0157373_10134672
1635 Ga0157373_10193303
1636 Ga0157373_10257524
1637 Ga0157371_10010154
1638 Ga0157371_10011380
1639 Ga0157371_10076830
1640 Ga0157371_10099341
1641 Ga0157370_10061565
1642 Ga0157370_10375609
1643 Ga0157370_10392922
1644 Ga0157370_10448021
1645 Ga0157370_10668109
1646 Ga0157369_10129033
1647 Ga0157369_10217195
1648 Ga0157369_10224152
1649 Ga0157369_10234440
1650 Ga0157369_10267556
1651 Ga0157369_10277522
1652 Ga0157369_10699947
1653 Ga0157374_10019472
1654 Ga0157374_10253601
1655 Ga0157374_10326581
1656 Ga0157374_10460651
1657 Ga0157374_10826845
1658 Ga0157378_10107312
1659 Ga0157378_10398123
1660 Ga0163162_10000968
1661 Ga0163162_10135225
1662 Ga0163162_10674155
1663 Ga0157372_10017897
1664 Ga0157372_10019172
1665 Ga0157372_10062629
1666 Ga0157372_10141012
1667 Ga0157372_10217816
1668 Ga0157372_10219048
1669 Ga0157372_10223667
1670 Ga0157372_10228177
1671 Ga0157372_10249173
1672 Ga0157372_10370207
1673 Ga0157372_10461114
1674 Ga0157372_10934412
1675 Ga0157372_11177403
1676 Ga0157375_10020665
1677 Ga0157375_10116648
1678 Ga0157380_10041125
1679 Ga0157380_10117896
1680 Ga0182008_10006718
1681 Ga0157377_10001976
1682 Ga0157377_10057641
1683 Ga0157377_10064324
1684 Ga0157379_10032210
1685 Ga0157379_10412704
1686 Ga0157376_10049138
1687 Ga0157376_10074835
1688 Ga0157376_10141281
1689 Ga0157376_10155951
1690 Ga0163161_10252959
1691 Ga0197907_11051130
1692 Ga0213876_10010709
1693 Ga0213876_10031971
1694 Ga0209676_1000332
1695 Ga0207697_10011385
1696 Ga0207697_10014185
1697 Ga0207682_10011727
1698 Ga0207682_10016764
1699 Ga0207692_10015454
1700 Ga0207692_10077555
1701 Ga0207642_10000869
1702 Ga0207710_10143982
1703 Ga0207688_10027380
1704 Ga0207688_10044712
1705 Ga0207680_10024431
1706 Ga0207680_10025729
1707 Ga0207647_10012888
1708 Ga0207647_10206493
1709 Ga0207685_10159264
1710 Ga0207699_10001230
1711 Ga0207699_10126913
1712 Ga0207645_10001246
1713 Ga0207645_10002969
1714 Ga0207645_10018114
1715 Ga0207645_10185904
1716 Ga0207645_10193849
1717 Ga0207643_10003364
1718 Ga0207643_10057418
1719 Ga0207705_10027229
1720 Ga0207705_10029211
1721 Ga0207705_10031424
1722 Ga0207705_10031835
1723 Ga0207705_10043315
1724 Ga0207705_10079711
1725 Ga0207705_10122539
1726 Ga0207705_10172522
1727 Ga0207705_10276084
1728 Ga0207684_10477754
1729 Ga0207654_10005914
1730 Ga0207654_10028743
1731 Ga0207654_10099830
1732 Ga0207654_10270197
1733 Ga0207707_10000784
1734 Ga0207707_10002248
1735 Ga0207707_10003943
1736 Ga0207707_10004141
1737 Ga0207707_10010236
1738 Ga0207707_10012860
1739 Ga0207707_10020853
1740 Ga0207707_10041250
1741 Ga0207707_10074382
1742 Ga0207707_10075446
1743 Ga0207707_10097923
1744 Ga0207707_10136471
1745 Ga0207707_10212597
1746 Ga0207707_10254088
1747 Ga0207707_10275027
1748 Ga0207707_10384637
1749 Ga0207695_10002690
1750 Ga0207695_10003067
1751 Ga0207695_10004617
1752 Ga0207695_10013424
1753 Ga0207695_10066239
1754 Ga0207695_10070341
1755 Ga0207695_10226018
1756 Ga0207695_10226195
1757 Ga0207671_10264370
1758 Ga0207693_10003338
1759 Ga0207693_10084216
1760 Ga0207693_10144717
1761 Ga0207663_10012846
1762 Ga0207663_10023350
1763 Ga0207660_10001291
1764 Ga0207660_10013204
1765 Ga0207660_10032435
1766 Ga0207660_10044376
1767 Ga0207660_10054390
1768 Ga0207660_10055934
1769 Ga0207660_10057759
1770 Ga0207660_10088243
1771 Ga0207660_10103162
1772 Ga0207660_10139720
1773 Ga0207660_10200740
1774 Ga0207660_10213249
1775 Ga0207660_10249325
1776 Ga0207660_10330852
1777 Ga0207662_10006823
1778 Ga0207662_10020855
1779 Ga0207662_10037541
1780 Ga0207662_10297302
1781 Ga0207657_10001138
1782 Ga0207657_10054086
1783 Ga0207657_10100403
1784 Ga0207657_10110156
1785 Ga0207657_10202823
1786 Ga0207657_10405023
1787 Ga0207649_10002377
1788 Ga0207649_10004410
1789 Ga0207649_10007666
1790 Ga0207649_10008227
1791 Ga0207649_10013748
1792 Ga0207649_10032190
1793 Ga0207649_10156162
1794 Ga0207649_10178625
1795 Ga0207649_10310550
1796 Ga0207652_10002905
1797 Ga0207652_10004165
1798 Ga0207652_10012004
1799 Ga0207652_10015685
1800 Ga0207652_10019965
1801 Ga0207652_10038944
1802 Ga0207652_10042922
1803 Ga0207652_10067099
1804 Ga0207652_10069714
1805 Ga0207652_10093206
1806 Ga0207652_10094537
1807 Ga0207652_10180913
1808 Ga0207652_10469355
1809 Ga0207652_10522591
1810 Ga0207652_10646286
1811 Ga0207652_10697419
1812 Ga0207646_10019243
1813 Ga0207646_10035672
1814 Ga0207646_10201520
1815 Ga0207646_10280505
1816 Ga0207681_10001456
1817 Ga0207681_10023008
1818 Ga0207681_10032436
1819 Ga0207694_10026946
1820 Ga0207694_10248765
1821 Ga0207694_10327240
1822 Ga0207650_10034430
1823 Ga0207650_10086726
1824 Ga0207650_10245208
1825 Ga0207650_10503674
1826 Ga0207659_10007653
1827 Ga0207659_10017541
1828 Ga0207659_10022346
1829 Ga0207659_10051549
1830 Ga0207659_10218655
1831 Ga0207687_10075869
1832 Ga0207687_10117584
1833 Ga0207700_10021907
1834 Ga0207700_10039951
1835 Ga0207700_10744429
1836 Ga0207664_10009225
1837 Ga0207664_10012437
1838 Ga0207664_10030097
1839 Ga0207664_10059661
1840 Ga0207664_10150502
1841 Ga0207644_10081250
1842 Ga0207644_10157705
1843 Ga0207644_10228772
1844 Ga0207690_10039753
1845 Ga0207690_10080789
1846 Ga0207690_10631067
1847 Ga0207706_10000025
1848 Ga0207706_10030641
1849 Ga0207706_10044843
1850 Ga0207706_10085090
1851 Ga0207706_10150224
1852 Ga0207706_10279971
1853 Ga0207706_10320634
1854 Ga0207686_10001115
1855 Ga0207686_10022147
1856 Ga0207686_10060773
1857 Ga0207686_10085618
1858 Ga0207709_10081832
1859 Ga0207670_10005135
1860 Ga0207670_10018648
1861 Ga0207670_10107499
1862 Ga0207669_10000638
1863 Ga0207704_10004727
1864 Ga0207704_10242662
1865 Ga0207665_10024947
1866 Ga0207665_10102606
1867 Ga0207691_10003543
1868 Ga0207691_10013350
1869 Ga0207691_10032808
1870 Ga0207691_10046795
1871 Ga0207691_10102934
1872 Ga0207691_10153386
1873 Ga0207711_10002753
1874 Ga0207711_10006251
1875 Ga0207711_10469843
1876 Ga0207711_10683652
1877 Ga0207711_10746633
1878 Ga0207689_10005455
1879 Ga0207689_10019641
1880 Ga0207689_10117716
1881 Ga0207689_10488156
1882 Ga0207661_10001853
1883 Ga0207661_10001907
1884 Ga0207661_10004866
1885 Ga0207661_10007267
1886 Ga0207661_10008533
1887 Ga0207661_10034637
1888 Ga0207661_10047859
1889 Ga0207661_10167950
1890 Ga0207661_10198084
1891 Ga0207661_10217134
1892 Ga0207661_10299851
1893 Ga0207661_10463489
1894 Ga0207679_10001341
1895 Ga0207679_10006587
1896 Ga0207679_10092083
1897 Ga0207679_10192419
1898 Ga0207679_10215775
1899 Ga0207679_10218788
1900 Ga0207667_10034763
1901 Ga0207667_10056597
1902 Ga0207667_10105114
1903 Ga0207667_10126128
1904 Ga0207667_10126755
1905 Ga0207667_10233566
1906 Ga0207667_10281980
1907 Ga0207667_10300053
1908 Ga0207667_10466524
1909 Ga0207667_10537287
1910 Ga0207651_10021908
1911 Ga0207651_10036217
1912 Ga0207651_10170424
1913 Ga0207651_10173474
1914 Ga0207651_10400513
1915 Ga0207651_10570192
1916 Ga0207712_10000236
1917 Ga0207712_10004705
1918 Ga0207712_10013022
1919 Ga0207712_10019662
1920 Ga0207668_10002200
1921 Ga0207668_10014204
1922 Ga0207668_10045377
1923 Ga0207668_10052171
1924 Ga0207668_10388631
1925 Ga0207640_10000324
1926 Ga0207640_10001124
1927 Ga0207640_10001854
1928 Ga0207640_10015432
1929 Ga0207640_10065476
1930 Ga0207640_10287500
1931 Ga0207640_10312773
1932 Ga0207640_10609114
1933 Ga0207658_10078185
1934 Ga0207658_10121737
1935 Ga0207658_10390115
1936 Ga0207677_10058774
1937 Ga0207677_10092972
1938 Ga0207703_10051872
1939 Ga0207703_10052835
1940 Ga0207703_10297709
1941 Ga0207639_10031292
1942 Ga0207639_10051893
1943 Ga0207639_10220672
1944 Ga0207639_10276977
1945 Ga0207639_10580316
1946 Ga0207639_10682003
1947 Ga0207678_10012023
1948 Ga0207678_10071359
1949 Ga0207678_10076305
1950 Ga0207678_10086322
1951 Ga0207678_10146850
1952 Ga0207708_10012624
1953 Ga0207708_10077845
1954 Ga0207708_10112088
1955 Ga0207702_10036288
1956 Ga0207702_10556254
1957 Ga0207641_10007192
1958 Ga0207641_10115304
1959 Ga0207641_10133751
1960 Ga0207648_10000138
1961 Ga0207648_10048391
1962 Ga0207648_10097740
1963 Ga0207648_10099910
1964 Ga0207648_10203821
1965 Ga0207676_10435635
1966 Ga0207676_10894139
1967 Ga0207674_10019045
1968 Ga0207674_10048059
1969 Ga0207674_10048180
1970 Ga0207674_10082972
1971 Ga0207674_10086885
1972 Ga0207674_10090084
1973 Ga0207674_10101100
1974 Ga0207674_10110465
1975 Ga0207674_10168287
1976 Ga0207674_10296702
1977 Ga0207675_100001482
1978 Ga0207675_100006697
1979 Ga0207675_100117992
1980 Ga0207675_100244793
1981 Ga0207683_10006013
1982 Ga0207683_10018004
1983 Ga0207683_10028596
1984 Ga0207683_10035142
1985 Ga0207698_10019363
1986 Ga0207698_10036093
1987 Ga0207698_10038152
1988 Ga0207698_10463610
1989 Ga0207698_10561203
1990 Ga0207698_10744398
1991 Ga0209969_1009191
1992 Ga0209981_1002273
1993 Ga0210000_1008961
1994 Ga0209995_1006746
1995 Ga0209968_1003096
1996 Ga0209999_1000199
1997 Ga0209999_1002599
1998 Ga0209970_1008724
1999 Ga0209966_1000982
2000 Ga0209998_10003458
2001 Ga0209974_10021093
2002 Ga0207428_10118944
2003 Ga0268266_10047291
2004 Ga0268266_10484725
2005 Ga0268265_10002653
2006 Ga0268265_10060632
2007 Ga0268264_10005398
2008 Ga0268264_10012146
2009 Ga0268264_10252891
2010 Ga0265318_10091847
2011 Ga0265332_10001239
2012 Ga0265327_10004939
2013 Ga0307513_10331498
2014 Ga0307408_100002760
2015 Ga0307408_100019763
2016 Ga0307408_100052712
2017 Ga0307408_100062503
2018 Ga0307408_100066008
2019 Ga0307408_100153960
2020 Ga0307408_100223526
2021 Ga0265314_10004621
2022 Ga0265314_10017451
2023 Ga0316576_10015012
2024 Ga0316578_10041302
2025 Ga0307405_10003326
2026 Ga0307405_10004504
2027 Ga0307405_10051278
2028 Ga0307405_10061362
2029 Ga0307405_10079157
2030 Ga0307405_10081500
2031 Ga0307405_10152371
2032 Ga0307405_10228399
2033 Ga0307405_10235083
2034 Ga0307405_10315118
2035 Ga0307405_10508407
2036 Ga0307413_10001842
2037 Ga0307413_10002091
2038 Ga0307413_10002387
2039 Ga0307413_10037954
2040 Ga0307413_10055726
2041 Ga0307413_10079652
2042 Ga0307413_10106244
2043 Ga0307413_10111837
2044 Ga0307413_10261069
2045 Ga0307413_10388818
2046 Ga0307410_10022252
2047 Ga0307410_10054670
2048 Ga0307410_10070477
2049 Ga0307410_10105816
2050 Ga0307410_10109480
2051 Ga0307410_10369891
2052 Ga0307406_10001264
2053 Ga0307406_10020026
2054 Ga0307406_10030981
2055 Ga0307406_10033014
2056 Ga0307406_10144685
2057 Ga0307406_10208490
2058 Ga0307407_10005111
2059 Ga0307407_10021693
2060 Ga0307407_10047832
2061 Ga0307407_10216503
2062 Ga0307412_10005885
2063 Ga0307412_10007821
2064 Ga0307412_10060199
2065 Ga0307412_10075320
2066 Ga0307412_10202806
2067 Ga0307412_10407017
2068 Ga0307409_100032235
2069 Ga0307409_100079067
2070 Ga0307409_100105590
2071 Ga0307409_100119375
2072 Ga0307409_100124031
2073 Ga0307409_100206649
2074 Ga0307409_100254111
2075 Ga0307409_100331104
2076 Ga0307409_100498924
2077 Ga0307409_100623915
2078 Ga0307416_100009003
2079 Ga0307416_100016074
2080 Ga0307416_100047021
2081 Ga0307416_100092060
2082 Ga0307416_100113896
2083 Ga0307416_100116989
2084 Ga0307416_100117798
2085 Ga0307416_100118263
2086 Ga0307416_100196081
2087 Ga0307416_100209312
2088 Ga0307416_100270316
2089 Ga0307416_100314182
2090 Ga0307416_100357375
2091 Ga0307416_100364805
2092 Ga0307416_100375061
2093 Ga0307416_100832026
2094 Ga0307414_10049512
2095 Ga0307414_10086998
2096 Ga0307414_10151426
2097 Ga0307414_10341665
2098 Ga0307411_10005072
2099 Ga0307411_10072801
2100 Ga0307411_10132943
2101 Ga0307411_10158935
2102 Ga0307411_10226050
2103 Ga0307411_10298126
2104 Ga0307415_100004310
2105 Ga0307415_100004471
2106 Ga0307415_100006886
2107 Ga0307415_100023196
2108 Ga0307415_100041357
2109 Ga0307415_100077926
2110 Ga0307415_100116777
2111 Ga0307415_100127589
2112 Ga0307415_100282987
2113 Ga0307415_100315483
2114 Ga0307415_100342471
2115 Ga0373926_0074468
2116 Ga0373929_0050970
2117 Ga0373934_0001304
2118 Ga0373934_0104066
2119 Ga0373944_0025955
2120 Ga0373923_0000756
2121 Ga0373953_0014696
2122 Ga0373953_0097427
2123 Ga0373954_0006856
2124 Ga0373956_0001329
2125 Ga0373956_0023371
2126 Ga0373943_0057545
2127 Ga0373943_0089557
2128 Ga0373946_0054283
2129 Ga0373946_0096626
2130 Ga0373955_0000309
2131 Ga0373955_0272419
2132 Ga0373962_0069140
2133 Ga0373924_0001445
2134 Ga0373931_0017434
2135 Ga0373935_0001142
2136 Ga0373935_0058549
2137 Ga0373927_0134380
2138 Ga0373927_0160288
2139 Ga0373927_0238483
2140 Ga0373933_0000191
2141 Ga0373933_0002765
2142 Ga0373933_0266640
2143 Ga0373947_0036655
2144 Ga0373947_0236917
2145 Ga0373937_0000625
2146 Ga0373937_0063603
2147 Ga0373937_0616041
2148 Ga0373937_0662822
2149 Ga0373925_0005112
2150 Ga0395899_0151372
2151 Ga0395905_0025260
2152 Ga0395901_0001770
2153 Ga0436365_0023278
2154 Ga0436365_0408308
2155 Ga0451804_0380477
2156 Ga0439433_0015813
2157 Ga0439448_0036131
2158 Ga0439432_037604
2159 Ga0450896_011384
2160 Ga0439446_0009762
2161 Ga0439446_0029363
2162 Ga0451577_0000001
2163 Ga0451577_0003185
2164 Ga0451577_0083322
2165 Ga0451577_0141188
2166 Ga0451577_0524250
2167 Ga0453683_0033780
2168 Ga0466966_0001530
2169 Ga0466966_0006135
2170 Ga0466961_0042804
2171 Ga0466961_0160956
2172 Ga0466961_0204760
2173 Ga0466963_0055834
2174 Ga0453684_0026762
2175 Ga0453684_0062783
2176 Ga0466971_0087484
2177 Ga0466957_0076776
2178 Ga0466957_0209596
2179 Ga0466959_0016263
2180 Ga0466959_0049416
2181 Ga0451576_0153457
2182 Ga0451576_0237355
2183 Ga0451576_0510035
2184 Ga0466958_0185693
2185 Ga0466967_0065040
2186 Ga0466967_0821743
2187 Ga0466967_1095808
2188 Ga0495592_0001172
2189 Ga0495592_0009293
2190 Ga0495603_0003416
2191 Ga0495603_0043390
2192 Ga0495603_0076014
2193 Ga0495629_0009752
2194 Ga0495629_0019579
2195 Ga0495629_0042049
2196 Ga0495629_0048696
2197 Ga0495629_0073936
2198 Ga0495629_0077215
2199 Ga0495629_0128626
2200 Ga0495629_0223629
2201 Ga0495629_0266222
2202 Ga0495651_0000116
2203 Ga0495651_0011176
2204 Ga0495651_0017188
2205 Ga0495653_0000992
2206 Ga0495653_0007356
2207 Ga0495653_0026437
2208 Ga0495580_0016230
2209 Ga0495580_0047588
2210 Ga0495580_0087356
2211 Ga0495580_0113415
2212 Ga0495582_0004886
2213 Ga0495582_0010686
2214 Ga0495582_0036644
2215 Ga0495582_0050921
2216 Ga0495582_0150032
2217 Ga0495639_0004714
2218 Ga0495639_0019583
2219 Ga0495662_0035604
2220 Ga0495664_0013790
2221 Ga0495585_0144448
2222 Ga0495594_0005611
2223 Ga0495594_0007853
2224 Ga0495594_0010292
2225 Ga0495594_0012873
2226 Ga0495594_0020695
2227 Ga0495594_0140901
2228 Ga0495594_0199284
2229 Ga0495596_0010087
2230 Ga0495608_0001013
2231 Ga0495608_0033181
2232 Ga0495608_0073497
2233 Ga0495608_0103342
2234 Ga0495618_0218814
2235 Ga0495628_0000113
2236 Ga0495630_0019876
2237 Ga0495630_0048337
2238 Ga0495630_0050774
2239 Ga0495630_0094702
2240 Ga0495663_0020324
2241 Ga0495642_0274020
2242 Ga0495652_0001031
2243 Ga0495652_0001095
2244 Ga0495652_0123654
2245 Ga0495652_0133218
2246 Ga0495665_0002814
2247 Ga0495665_0014539
2248 Ga0495665_0023640
2249 Ga0495665_0076291
2250 Ga0495586_0015359
2251 Ga0495586_0065516
2252 Ga0495586_0095659
2253 Ga0495587_0000143
2254 Ga0495645_0001110
2255 Ga0495645_0001766
2256 Ga0495645_0334115
2257 Ga0495645_0461199
2258 Ga0495622_0052951
2259 Ga0495633_0104185
2260 Ga0495667_0001636
2261 Ga0495667_0016331
2262 Ga0495667_0024990
2263 Ga0495667_0073783
2264 Ga0495635_0000158
2265 Ga0495635_0054906
2266 Ga0495659_0053455
2267 Ga0495659_0087973
2268 Ga0495659_0123527
2269 Ga0495659_0143222
2270 Ga0495588_0030623
2271 Ga0495588_0297274
2272 Ga0495657_0000476
2273 Ga0495657_0049025
2274 Ga0495657_0059269
2275 Ga0495657_0113082
2276 Ga0495599_0000553
2277 Ga0495599_0010652
2278 Ga0495599_0015785
2279 Ga0495599_0073902
2280 Ga0495623_0000017
2281 Ga0495623_0017452
2282 Ga0495623_0101934
2283 Ga0495623_0108146
2284 Ga0495646_0002016
2285 Ga0495646_0016342
2286 Ga0495646_0089993
2287 Ga0495658_0002526
2288 Ga0495658_0166410
2289 Ga0495658_0285154
2290 Ga0495658_0305619
2291 Ga0495669_0171122
2292 Ga0495613_0060691
2293 Ga0495613_0067704
2294 Ga0495613_0068168
2295 Ga0495613_0077081
2296 Ga0495670_0054140
2297 Ga0495600_0000063
2298 Ga0495600_0043058
2299 Ga0495600_0245756
2300 Ga0495581_0010867
2301 Ga0495581_0022768
2302 Ga0495604_0000017
2303 Ga0495604_0021369
2304 Ga0495604_0104964
2305 Ga0495636_0119308
2306 Ga0495674_0003779
2307 Ga0495674_0014556
2308 Ga0495674_0022976
2309 Ga0495672_0004623
2310 Ga0495676_0257331
2311 Ga0495680_0007844
2312 Ga0495680_0013035
2313 Ga0495680_0627083
2314 Ga0495675_0079198
2315 Ga0495675_0129471
2316 Ga0495675_0170389
2317 Ga0495684_0000095
2318 Ga0495684_0023565
2319 Ga0495684_0026626
2320 Ga0495684_0071242
2321 Ga0495593_0020541
2322 Ga0495602_0001119
2323 Ga0495602_0013466
2324 Ga0496100_0109226
2325 Ga0496101_0056945
2326 Ga0496101_0125918
2327 Ga0496104_0103483
2328 Ga0496105_0059694
2329 Ga0496105_0071848
2330 Ga0496106_0003759
2331 Ga0496106_0064193
2332 Ga0496106_0157904
2333 Ga0496107_0134588
2334 Ga0496107_0387268
2335 Ga0496108_0430642
2336 Ga0496112_0002541
2337 Ga0496112_0043501
2338 Ga0496112_0104391
2339 Ga0496112_0248569
2340 Ga0496113_0016753
2341 Ga0496113_0156046
2342 Ga0496114_0136082
2343 Ga0496115_0052769
2344 Ga0496115_0082370
2345 Ga0496115_0376515
2346 Ga0501304_000552
2347 Ga0501291_018783
2348 Ga0501292_015075
2349 Ga0501299_013743
2350 Ga0501314_000038
2351 Ga0501031_0036052
2352 Ga0501031_0182846
2353 Ga0501031_0417637
2354 Ga0501032_0082763
2355 Ga0501032_0184321
2356 Ga0501034_0220989
2357 Ga0501034_0470966
2358 Ga0501036_0131789
2359 Ga0501037_0036525
2360 Ga0501037_0252132
2361 Ga0501038_0011902
2362 Ga0501038_0029198
2363 Ga0501039_0103131
2364 Ga0501039_0165564
2365 Ga0501040_0040969
2366 Ga0501040_0080203
2367 Ga0501040_0176671
2368 Ga0501040_0383694
2369 Ga0501041_0023985
2370 Ga0501041_0227281
2371 Ga0501042_0119003
2372 Ga0501043_0014332
2373 Ga0501043_0047600
2374 Ga0501046_0028687
2375 Ga0501046_0112744
2376 Ga0501046_0186025
2377 Ga0501047_0019591
2378 Ga0501047_0029942
2379 Ga0501047_0291019
2380 Ga0501047_0405438
2381 Ga0501070_0042534
2382 Ga0501070_0069675
2383 Ga0501070_0097328
2384 Ga0501071_0238684
2385 Ga0501071_0421544
2386 Ga0501072_0010585
2387 Ga0501074_0246973
2388 Ga0501075_0078651
2389 Ga0501076_0069214
2390 Ga0501076_0244716
2391 Ga0501209_057742
2392 Ga0501217_010354
2393 Ga0501223_008477
2394 Ga0501224_001238
2395 Ga0501227_018036
2396 Ga0501228_005012
2397 Ga0501230_009571
2398 Ga0501233_004905
2399 Ga0501235_007524
2400 Ga0501249_012864
2401 Ga0501249_054659
2402 Ga0501258_005248
2403 Ga0501221_041781
2404 Ga0501225_0004791
2405 Ga0501234_001400
2406 Ga0501245_012427
2407 Ga0501079_0019559
2408 Ga0501079_0035622
2409 Ga0501080_0443846
2410 Ga0501080_0570580
2411 Ga0501081_0148167
2412 Ga0501081_0314868
2413 Ga0501083_0309541
2414 Ga0501266_003064
2415 Ga0501268_008523
2416 Ga0501274_002181
2417 Ga0501283_008388
2418 Ga0501035_0052570
2419 Ga0501035_0204036
2420 Ga0501035_0288383
2421 Ga0501044_0007223
2422 Ga0501044_0064096
2423 Ga0501044_0152540
2424 Ga0501045_0032763
2425 Ga0501212_001652
2426 nmdc:mga0k408_122928_c1
2427 nmdc:mga05p37_151379_c1
2428 nmdc:mga05p37_57467_c1
2429 nmdc:mga09592_50694_c1
2430 nmdc:mga09592_74630_c1
2431 nmdc:mga0qj67_75775_c1
2432 nmdc:mga0qj67_77954_c1
2433 nmdc:mga0qj67_87554_c1
2434 nmdc:mga0qj67_90728_c1
2435 nmdc:mga06r32_259645_c1
2436 nmdc:mga06r32_303714_c1
2437 nmdc:mga06r32_310188_c1
2438 nmdc:mga06r32_6558_c1
2439 nmdc:mga08y16_1022_c1
2440 nmdc:mga08y16_281933_c1
2441 nmdc:mga08y16_46413_c1
2442 nmdc:mga08y16_597362_c1
2443 nmdc:mga0n895_21843_c1
2444 nmdc:mga0rr50_135710_c1
2445 nmdc:mga0a205_17997_c1
2446 nmdc:mga0a205_26534_c1
2447 nmdc:mga0a205_27367_c1
2448 Ga0495601_0102656
2449 Ga0495612_0004309
2450 Ga0495619_0002351
2451 Ga0495619_0062582
2452 Ga0501084_0221154
2453 Ga0501082_0071941
2454 Ga0501082_0086997
2455 Ga0466962_0078952
2456 Ga0530510_0055415

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00181

Ribosomal_L2

Ribosomal Proteins L2, RNA binding domain

42

118

0.99

PF03947

Ribosomal_L2_C

Ribosomal Proteins L2, C-terminal domain

125

247

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.977 62 195
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.9629 62 195
8c91-assembly1.cif.gz_C cryo-em captures early ribosome assembly in action 0.9249 23 200
8c91-assembly1.cif.gz_C cryo-em captures early ribosome assembly in action 0.9025 23 200
3iy9-assembly1.cif.gz_B leishmania tarentolae mitochondrial large ribosomal subunit model 0.8842 81 209
ID Description Score Start End Superfamily
af_Q6R9C6_19_86_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9954 131 196 2.30.30.30
af_E7F8R3_156_236_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9926 125 195 2.30.30.30
af_P92812_354_429_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9857 125 195 2.30.30.30
af_A4HTH9_204_277_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9839 125 194 2.30.30.30
af_Q5A7P6_207_283_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9836 124 195 2.30.30.30
ID Description Score Start End GO Terms
AF-R4I6R4-F1-model_v4 Ribosomal protein L2 0.9911 74 197 GO:0003723
GO:0003735
GO:0005762
GO:0009507
GO:0016740
GO:0032543
AF-A0A0F2I9X1-F1-model_v4 50S ribosomal protein L2 0.9903 62 187 GO:0002181
GO:0003723
GO:0003735
GO:0015934
GO:0016740
AF-D8KXK9-F1-model_v4 Ribosomal protein L2 0.9851 74 196 GO:0003723
GO:0003735
GO:0005762
GO:0009507
GO:0032543
AF-A0A0F2I9X1-F1-model_v4 50S ribosomal protein L2 0.9675 62 187 GO:0002181
GO:0003723
GO:0003735
GO:0015934
GO:0016740
AF-D8KXK9-F1-model_v4 Ribosomal protein L2 0.9619 74 196 GO:0003723
GO:0003735
GO:0005762
GO:0009507
GO:0032543

Map