F491953
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1228 | 404 | 2456 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10220080|Ga0065712_102200801 |
| Length | 279 |
| Sequence | MGIRQFKPVTKGTRFRSVSDFTEITRTTPEKSLTEPLKKSGGRDNHGHIAMRRRGGGHKRKYRVIDFKRNRFDAPAVVKTIEYDPNRSARIALVQYEDGELRYILHPKGLAVGDTVVSGKGSDIRIGNTLPLREVPLGTNVHNVELVPGRGGQMARSAGVSLEVVAKEGEYVTVRMASTETRRLHGNCLATIGEVGNAEHELLSWGKAGKTRWKGRRPKVRGEVMNPVDHPHGGRTRGGRNVVSPWGKKEGVKTRNMKKPSQRLIVRGRKRGKATQSGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 223 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 263 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 264 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 340 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 342 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 363 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 364 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 368 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 369 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 372 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 373 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 374 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 376 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 382 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 384 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 404 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 1.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 1.87 |
| Rhizosphere | 97.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10220080 | 3300005290 | Bacteria | 1042 |
| 2 | LJQas_1006187 | 3300000549 | Bacteria | 1498 |
| 3 | Ga0055536_1006040 | 3300003781 | Bacteria | 5745 |
| 4 | Ga0058863_10017357 | 3300004799 | Bacteria | 1804 |
| 5 | Ga0058863_10086968 | 3300004799 | Bacteria | 3231 |
| 6 | Ga0058863_10124246 | 3300004799 | Bacteria | 5910 |
| 7 | Ga0058863_11781841 | 3300004799 | Bacteria | 2031 |
| 8 | Ga0058861_11830918 | 3300004800 | Bacteria | 1045 |
| 9 | Ga0058861_12045205 | 3300004800 | Bacteria | 1278 |
| 10 | Ga0058861_12068682 | 3300004800 | Bacteria | 1401 |
| 11 | Ga0058861_12070180 | 3300004800 | Bacteria | 2684 |
| 12 | Ga0058862_12797539 | 3300004803 | Bacteria | 2338 |
| 13 | Ga0058862_12888623 | 3300004803 | Bacteria | 3440 |
| 14 | Ga0065165_1000131 | 3300005262 | Bacteria | 128880 |
| 15 | Ga0065704_10014908 | 3300005289 | Bacteria | 2005 |
| 16 | Ga0065712_10130506 | 3300005290 | Bacteria | 1555 |
| 17 | Ga0065715_10135391 | 3300005293 | Bacteria | 1939 |
| 18 | Ga0065707_10024835 | 3300005295 | Bacteria | 1918 |
| 19 | Ga0070658_10030953 | 3300005327 | Bacteria | 4298 |
| 20 | Ga0070658_10045112 | 3300005327 | Bacteria | 3563 |
| 21 | Ga0070658_10120109 | 3300005327 | Bacteria | 2183 |
| 22 | Ga0070658_10171352 | 3300005327 | Bacteria | 1823 |
| 23 | Ga0070658_10506187 | 3300005327 | Bacteria | 1043 |
| 24 | Ga0070676_10000896 | 3300005328 | Bacteria | 14732 |
| 25 | Ga0070676_10010363 | 3300005328 | Bacteria | 5055 |
| 26 | Ga0070676_10141630 | 3300005328 | Bacteria | 1531 |
| 27 | Ga0070683_100003340 | 3300005329 | Bacteria | 12981 |
| 28 | Ga0070683_100006197 | 3300005329 | Bacteria | 10030 |
| 29 | Ga0070683_100046570 | 3300005329 | Bacteria | 4007 |
| 30 | Ga0070683_100058071 | 3300005329 | Bacteria | 3595 |
| 31 | Ga0070683_100071412 | 3300005329 | Bacteria | 3239 |
| 32 | Ga0070683_100130283 | 3300005329 | Bacteria | 2380 |
| 33 | Ga0070683_100163138 | 3300005329 | Bacteria | 2114 |
| 34 | Ga0070683_100253323 | 3300005329 | Bacteria | 1674 |
| 35 | Ga0070683_100417731 | 3300005329 | Bacteria | 1279 |
| 36 | Ga0070690_100021133 | 3300005330 | Bacteria | 3971 |
| 37 | Ga0070690_100054901 | 3300005330 | Bacteria | 2551 |
| 38 | Ga0070690_100173738 | 3300005330 | Bacteria | 1484 |
| 39 | Ga0070670_100016207 | 3300005331 | Bacteria | 6398 |
| 40 | Ga0070670_100095610 | 3300005331 | Bacteria | 2555 |
| 41 | Ga0070670_100240332 | 3300005331 | Bacteria | 1577 |
| 42 | Ga0070677_10107002 | 3300005333 | Bacteria | 1242 |
| 43 | Ga0068869_100003669 | 3300005334 | Bacteria | 9438 |
| 44 | Ga0068869_100057193 | 3300005334 | Bacteria | 2846 |
| 45 | Ga0068869_100148652 | 3300005334 | Bacteria | 1815 |
| 46 | Ga0070666_10093653 | 3300005335 | Bacteria | 2065 |
| 47 | Ga0070666_10154722 | 3300005335 | Bacteria | 1601 |
| 48 | Ga0070680_100004063 | 3300005336 | Bacteria | 10956 |
| 49 | Ga0070680_100005527 | 3300005336 | Bacteria | 9567 |
| 50 | Ga0070680_100025720 | 3300005336 | Bacteria | 4705 |
| 51 | Ga0070680_100037118 | 3300005336 | Bacteria | 3937 |
| 52 | Ga0070680_100048050 | 3300005336 | Bacteria | 3477 |
| 53 | Ga0070680_100062828 | 3300005336 | Bacteria | 3041 |
| 54 | Ga0070680_100067284 | 3300005336 | Bacteria | 2938 |
| 55 | Ga0070680_100094132 | 3300005336 | Bacteria | 2483 |
| 56 | Ga0070680_100103171 | 3300005336 | Bacteria | 2369 |
| 57 | Ga0070680_100106030 | 3300005336 | Bacteria | 2337 |
| 58 | Ga0070680_100148940 | 3300005336 | Bacteria | 1964 |
| 59 | Ga0070680_100163795 | 3300005336 | Bacteria | 1869 |
| 60 | Ga0070680_100175503 | 3300005336 | Bacteria | 1804 |
| 61 | Ga0070680_100179989 | 3300005336 | Bacteria | 1780 |
| 62 | Ga0070680_100203783 | 3300005336 | Bacteria | 1668 |
| 63 | Ga0070680_100309742 | 3300005336 | Bacteria | 1339 |
| 64 | Ga0070682_100026044 | 3300005337 | Bacteria | 3496 |
| 65 | Ga0070682_100029919 | 3300005337 | Bacteria | 3282 |
| 66 | Ga0070682_100057682 | 3300005337 | Bacteria | 2447 |
| 67 | Ga0070682_100060558 | 3300005337 | Bacteria | 2394 |
| 68 | Ga0070682_100096638 | 3300005337 | Bacteria | 1942 |
| 69 | Ga0070682_100235067 | 3300005337 | Bacteria | 1312 |
| 70 | Ga0068868_100043273 | 3300005338 | Bacteria | 3517 |
| 71 | Ga0068868_100141727 | 3300005338 | Bacteria | 1973 |
| 72 | Ga0068868_100229320 | 3300005338 | Bacteria | 1557 |
| 73 | Ga0068868_100334057 | 3300005338 | Bacteria | 1294 |
| 74 | Ga0070660_100143024 | 3300005339 | Bacteria | 1920 |
| 75 | Ga0070660_100293209 | 3300005339 | Bacteria | 1332 |
| 76 | Ga0070660_100301949 | 3300005339 | Bacteria | 1313 |
| 77 | Ga0070689_100012783 | 3300005340 | Bacteria | 6060 |
| 78 | Ga0070689_100031628 | 3300005340 | Bacteria | 4023 |
| 79 | Ga0070689_100040239 | 3300005340 | Bacteria | 3583 |
| 80 | Ga0070689_100154947 | 3300005340 | Bacteria | 1849 |
| 81 | Ga0070691_10042806 | 3300005341 | Bacteria | 2144 |
| 82 | Ga0070691_10050992 | 3300005341 | Bacteria | 1975 |
| 83 | Ga0070687_100026607 | 3300005343 | Bacteria | 2786 |
| 84 | Ga0070661_100013855 | 3300005344 | Bacteria | 5665 |
| 85 | Ga0070661_100028453 | 3300005344 | Bacteria | 4031 |
| 86 | Ga0070661_100029610 | 3300005344 | Bacteria | 3952 |
| 87 | Ga0070661_100029667 | 3300005344 | Bacteria | 3949 |
| 88 | Ga0070661_100063709 | 3300005344 | Bacteria | 2708 |
| 89 | Ga0070661_100216264 | 3300005344 | Bacteria | 1468 |
| 90 | Ga0070661_100249809 | 3300005344 | Bacteria | 1368 |
| 91 | Ga0070661_100253420 | 3300005344 | Bacteria | 1359 |
| 92 | Ga0070692_10020992 | 3300005345 | Bacteria | 3174 |
| 93 | Ga0070692_10030572 | 3300005345 | Bacteria | 2694 |
| 94 | Ga0070692_10070694 | 3300005345 | Bacteria | 1859 |
| 95 | Ga0070668_100000990 | 3300005347 | Bacteria | 19937 |
| 96 | Ga0070668_100017369 | 3300005347 | Bacteria | 5389 |
| 97 | Ga0070668_100044436 | 3300005347 | Bacteria | 3408 |
| 98 | Ga0070668_100089192 | 3300005347 | Bacteria | 2429 |
| 99 | Ga0070669_100002074 | 3300005353 | Bacteria | 14482 |
| 100 | Ga0070669_100025980 | 3300005353 | Bacteria | 4211 |
| 101 | Ga0070669_100066368 | 3300005353 | Bacteria | 2660 |
| 102 | Ga0070675_100003059 | 3300005354 | Bacteria | 12632 |
| 103 | Ga0070675_100006526 | 3300005354 | Bacteria | 8963 |
| 104 | Ga0070675_100058013 | 3300005354 | Bacteria | 3192 |
| 105 | Ga0070671_100072541 | 3300005355 | Bacteria | 2875 |
| 106 | Ga0070671_100119817 | 3300005355 | Bacteria | 2214 |
| 107 | Ga0070671_100159410 | 3300005355 | Bacteria | 1907 |
| 108 | Ga0070674_100001338 | 3300005356 | Bacteria | 12995 |
| 109 | Ga0070674_100075414 | 3300005356 | Bacteria | 2395 |
| 110 | Ga0070674_100137876 | 3300005356 | Bacteria | 1827 |
| 111 | Ga0070674_100444582 | 3300005356 | Bacteria | 1068 |
| 112 | Ga0070673_100006677 | 3300005364 | Bacteria | 7523 |
| 113 | Ga0070673_100024226 | 3300005364 | Bacteria | 4447 |
| 114 | Ga0070673_100153788 | 3300005364 | Bacteria | 1950 |
| 115 | Ga0070673_100187913 | 3300005364 | Bacteria | 1772 |
| 116 | Ga0070673_100329863 | 3300005364 | Bacteria | 1350 |
| 117 | Ga0070688_100028355 | 3300005365 | Bacteria | 3341 |
| 118 | Ga0070688_100037041 | 3300005365 | Bacteria | 2970 |
| 119 | Ga0070659_100002785 | 3300005366 | Bacteria | 12441 |
| 120 | Ga0070659_100012581 | 3300005366 | Bacteria | 6275 |
| 121 | Ga0070659_100108977 | 3300005366 | Bacteria | 2234 |
| 122 | Ga0070659_100116694 | 3300005366 | Bacteria | 2158 |
| 123 | Ga0070659_100185248 | 3300005366 | Bacteria | 1709 |
| 124 | Ga0070667_100043630 | 3300005367 | Bacteria | 3764 |
| 125 | Ga0070667_100093065 | 3300005367 | Bacteria | 2595 |
| 126 | Ga0070667_100111431 | 3300005367 | Bacteria | 2373 |
| 127 | Ga0070667_100128161 | 3300005367 | Bacteria | 2213 |
| 128 | Ga0070667_100170052 | 3300005367 | Bacteria | 1924 |
| 129 | Ga0070667_100228951 | 3300005367 | Bacteria | 1657 |
| 130 | Ga0070703_10041333 | 3300005406 | Bacteria | 1437 |
| 131 | Ga0070709_10006385 | 3300005434 | Bacteria | 6421 |
| 132 | Ga0070714_100016130 | 3300005435 | Bacteria | 6025 |
| 133 | Ga0070714_100018849 | 3300005435 | Bacteria | 5613 |
| 134 | Ga0070714_100139880 | 3300005435 | Bacteria | 2171 |
| 135 | Ga0070714_100200652 | 3300005435 | Bacteria | 1824 |
| 136 | Ga0070713_100008004 | 3300005436 | Bacteria | 7470 |
| 137 | Ga0070713_100035372 | 3300005436 | Bacteria | 4020 |
| 138 | Ga0070713_100065550 | 3300005436 | Bacteria | 3051 |
| 139 | Ga0070713_100286532 | 3300005436 | Bacteria | 1513 |
| 140 | Ga0070710_10016585 | 3300005437 | Bacteria | 3752 |
| 141 | Ga0070710_10064387 | 3300005437 | Bacteria | 2097 |
| 142 | Ga0070701_10194692 | 3300005438 | Bacteria | 1195 |
| 143 | Ga0070711_100025951 | 3300005439 | Bacteria | 3836 |
| 144 | Ga0070711_100036243 | 3300005439 | Bacteria | 3304 |
| 145 | Ga0070711_100079312 | 3300005439 | Bacteria | 2335 |
| 146 | Ga0070705_100003623 | 3300005440 | Bacteria | 7560 |
| 147 | Ga0070705_100325140 | 3300005440 | Bacteria | 1112 |
| 148 | Ga0070700_100204357 | 3300005441 | Bacteria | 1389 |
| 149 | Ga0070700_100443977 | 3300005441 | Bacteria | 986 |
| 150 | Ga0070694_100111310 | 3300005444 | Bacteria | 1951 |
| 151 | Ga0070708_100001661 | 3300005445 | Bacteria | 17067 |
| 152 | Ga0070708_100018839 | 3300005445 | Bacteria | 5782 |
| 153 | Ga0070708_100020893 | 3300005445 | Bacteria | 5528 |
| 154 | Ga0070708_100338186 | 3300005445 | Bacteria | 1418 |
| 155 | Ga0070663_100005346 | 3300005455 | Bacteria | 7621 |
| 156 | Ga0070678_100006200 | 3300005456 | Bacteria | 6992 |
| 157 | Ga0070678_100053888 | 3300005456 | Bacteria | 2927 |
| 158 | Ga0070662_100006245 | 3300005457 | Bacteria | 7674 |
| 159 | Ga0070662_100011148 | 3300005457 | Bacteria | 5922 |
| 160 | Ga0070662_100047159 | 3300005457 | Bacteria | 3098 |
| 161 | Ga0070662_100054587 | 3300005457 | Bacteria | 2896 |
| 162 | Ga0070662_100059628 | 3300005457 | Bacteria | 2780 |
| 163 | Ga0070662_100118516 | 3300005457 | Bacteria | 2026 |
| 164 | Ga0070662_100251955 | 3300005457 | Bacteria | 1420 |
| 165 | Ga0070681_10001182 | 3300005458 | Bacteria | 22569 |
| 166 | Ga0070681_10030030 | 3300005458 | Bacteria | 5454 |
| 167 | Ga0070681_10044619 | 3300005458 | Bacteria | 4438 |
| 168 | Ga0070681_10053922 | 3300005458 | Bacteria | 4006 |
| 169 | Ga0070681_10067823 | 3300005458 | Bacteria | 3535 |
| 170 | Ga0070681_10078280 | 3300005458 | Bacteria | 3263 |
| 171 | Ga0070681_10153736 | 3300005458 | Bacteria | 2226 |
| 172 | Ga0070681_10160574 | 3300005458 | Bacteria | 2171 |
| 173 | Ga0070681_10171280 | 3300005458 | Bacteria | 2093 |
| 174 | Ga0070681_10200760 | 3300005458 | Bacteria | 1912 |
| 175 | Ga0070681_10252646 | 3300005458 | Bacteria | 1675 |
| 176 | Ga0070681_10402893 | 3300005458 | Bacteria | 1279 |
| 177 | Ga0070681_10505405 | 3300005458 | Bacteria | 1122 |
| 178 | Ga0070681_10515824 | 3300005458 | Bacteria | 1108 |
| 179 | Ga0070681_10585687 | 3300005458 | Bacteria | 1030 |
| 180 | Ga0070681_10662384 | 3300005458 | Bacteria | 959 |
| 181 | Ga0070681_10716662 | 3300005458 | Bacteria | 916 |
| 182 | Ga0068867_100006780 | 3300005459 | Bacteria | 8095 |
| 183 | Ga0068867_100037348 | 3300005459 | Bacteria | 3530 |
| 184 | Ga0068867_100079269 | 3300005459 | Bacteria | 2472 |
| 185 | Ga0068867_100158633 | 3300005459 | Bacteria | 1782 |
| 186 | Ga0070685_10086131 | 3300005466 | Bacteria | 1893 |
| 187 | Ga0070706_100115208 | 3300005467 | Bacteria | 2503 |
| 188 | Ga0070706_100188726 | 3300005467 | Bacteria | 1926 |
| 189 | Ga0070707_100071326 | 3300005468 | Bacteria | 3347 |
| 190 | Ga0070698_100001954 | 3300005471 | Bacteria | 22884 |
| 191 | Ga0070698_100024253 | 3300005471 | Bacteria | 6330 |
| 192 | Ga0070698_100052230 | 3300005471 | Bacteria | 4160 |
| 193 | Ga0070698_100115071 | 3300005471 | Bacteria | 2654 |
| 194 | Ga0070698_100189783 | 3300005471 | Bacteria | 1993 |
| 195 | Ga0070699_100017326 | 3300005518 | Bacteria | 6186 |
| 196 | Ga0070699_100243299 | 3300005518 | Bacteria | 1607 |
| 197 | Ga0070699_100248507 | 3300005518 | Bacteria | 1589 |
| 198 | Ga0070699_100303757 | 3300005518 | Bacteria | 1432 |
| 199 | Ga0070679_100000601 | 3300005530 | Bacteria | 30635 |
| 200 | Ga0070679_100001848 | 3300005530 | Bacteria | 19026 |
| 201 | Ga0070679_100019482 | 3300005530 | Bacteria | 6597 |
| 202 | Ga0070679_100023697 | 3300005530 | Bacteria | 6014 |
| 203 | Ga0070679_100038523 | 3300005530 | Bacteria | 4753 |
| 204 | Ga0070679_100052627 | 3300005530 | Bacteria | 4054 |
| 205 | Ga0070679_100068775 | 3300005530 | Bacteria | 3532 |
| 206 | Ga0070679_100091847 | 3300005530 | Bacteria | 3023 |
| 207 | Ga0070679_100095030 | 3300005530 | Bacteria | 2968 |
| 208 | Ga0070679_100113323 | 3300005530 | Bacteria | 2697 |
| 209 | Ga0070679_100113336 | 3300005530 | Bacteria | 2697 |
| 210 | Ga0070679_100165137 | 3300005530 | Bacteria | 2187 |
| 211 | Ga0070679_100249770 | 3300005530 | Bacteria | 1730 |
| 212 | Ga0070679_100257749 | 3300005530 | Bacteria | 1699 |
| 213 | Ga0070684_100002577 | 3300005535 | Bacteria | 13386 |
| 214 | Ga0070684_100005718 | 3300005535 | Bacteria | 9552 |
| 215 | Ga0070684_100041533 | 3300005535 | Bacteria | 3965 |
| 216 | Ga0070684_100066458 | 3300005535 | Bacteria | 3165 |
| 217 | Ga0070684_100072750 | 3300005535 | Bacteria | 3027 |
| 218 | Ga0070684_100092190 | 3300005535 | Bacteria | 2696 |
| 219 | Ga0070684_100106633 | 3300005535 | Bacteria | 2509 |
| 220 | Ga0070684_100152966 | 3300005535 | Bacteria | 2091 |
| 221 | Ga0070684_100301363 | 3300005535 | Bacteria | 1471 |
| 222 | Ga0070684_100302271 | 3300005535 | Bacteria | 1468 |
| 223 | Ga0070684_100349691 | 3300005535 | Bacteria | 1359 |
| 224 | Ga0070697_100190886 | 3300005536 | Bacteria | 1739 |
| 225 | Ga0068853_100040762 | 3300005539 | Bacteria | 3963 |
| 226 | Ga0068853_100096330 | 3300005539 | Bacteria | 2610 |
| 227 | Ga0068853_100203663 | 3300005539 | Bacteria | 1801 |
| 228 | Ga0068853_100205913 | 3300005539 | Bacteria | 1792 |
| 229 | Ga0068853_100214746 | 3300005539 | Bacteria | 1754 |
| 230 | Ga0070672_100003949 | 3300005543 | Bacteria | 9668 |
| 231 | Ga0070672_100038933 | 3300005543 | Bacteria | 3637 |
| 232 | Ga0070672_100061495 | 3300005543 | Bacteria | 2960 |
| 233 | Ga0070672_100079274 | 3300005543 | Bacteria | 2628 |
| 234 | Ga0070686_100059565 | 3300005544 | Bacteria | 2460 |
| 235 | Ga0070686_100158982 | 3300005544 | Bacteria | 1590 |
| 236 | Ga0070686_100171206 | 3300005544 | Bacteria | 1536 |
| 237 | Ga0070686_100215576 | 3300005544 | Bacteria | 1384 |
| 238 | Ga0070695_100006164 | 3300005545 | Bacteria | 7087 |
| 239 | Ga0070695_100013525 | 3300005545 | Bacteria | 4906 |
| 240 | Ga0070695_100401927 | 3300005545 | Bacteria | 1039 |
| 241 | Ga0070696_100000402 | 3300005546 | Bacteria | 26803 |
| 242 | Ga0070696_100004370 | 3300005546 | Bacteria | 9415 |
| 243 | Ga0070696_100022063 | 3300005546 | Bacteria | 4323 |
| 244 | Ga0070696_100111425 | 3300005546 | Bacteria | 1971 |
| 245 | Ga0070693_100054124 | 3300005547 | Bacteria | 2306 |
| 246 | Ga0070693_100075365 | 3300005547 | Bacteria | 1997 |
| 247 | Ga0070665_100028793 | 3300005548 | Bacteria | 5593 |
| 248 | Ga0070665_100124547 | 3300005548 | Bacteria | 2579 |
| 249 | Ga0070665_100230766 | 3300005548 | Bacteria | 1851 |
| 250 | Ga0070704_100212348 | 3300005549 | Bacteria | 1569 |
| 251 | Ga0068855_100008032 | 3300005563 | Bacteria | 12749 |
| 252 | Ga0068855_100063431 | 3300005563 | Bacteria | 4312 |
| 253 | Ga0068855_100075666 | 3300005563 | Bacteria | 3909 |
| 254 | Ga0068855_100132631 | 3300005563 | Bacteria | 2844 |
| 255 | Ga0068855_100167043 | 3300005563 | Bacteria | 2493 |
| 256 | Ga0068855_100257123 | 3300005563 | Bacteria | 1946 |
| 257 | Ga0068855_100269245 | 3300005563 | Bacteria | 1895 |
| 258 | Ga0068855_100466223 | 3300005563 | Bacteria | 1376 |
| 259 | Ga0068855_100597234 | 3300005563 | Bacteria | 1191 |
| 260 | Ga0068855_100622768 | 3300005563 | Bacteria | 1162 |
| 261 | Ga0068855_100886266 | 3300005563 | Bacteria | 943 |
| 262 | Ga0070664_100008033 | 3300005564 | Bacteria | 8527 |
| 263 | Ga0070664_100113420 | 3300005564 | Bacteria | 2367 |
| 264 | Ga0070664_100145371 | 3300005564 | Bacteria | 2090 |
| 265 | Ga0070664_100229505 | 3300005564 | Bacteria | 1664 |
| 266 | Ga0070664_100337824 | 3300005564 | Bacteria | 1367 |
| 267 | Ga0068857_100009735 | 3300005577 | Bacteria | 8348 |
| 268 | Ga0068857_100015888 | 3300005577 | Bacteria | 6589 |
| 269 | Ga0068857_100024265 | 3300005577 | Bacteria | 5337 |
| 270 | Ga0068857_100054772 | 3300005577 | Bacteria | 3540 |
| 271 | Ga0068857_100067276 | 3300005577 | Bacteria | 3189 |
| 272 | Ga0068857_100068315 | 3300005577 | Bacteria | 3163 |
| 273 | Ga0068857_100292587 | 3300005577 | Bacteria | 1500 |
| 274 | Ga0068854_100000444 | 3300005578 | Bacteria | 25595 |
| 275 | Ga0068854_100008727 | 3300005578 | Bacteria | 6524 |
| 276 | Ga0068854_100013720 | 3300005578 | Bacteria | 5325 |
| 277 | Ga0068854_100051465 | 3300005578 | Bacteria | 2951 |
| 278 | Ga0068854_100585640 | 3300005578 | Bacteria | 950 |
| 279 | Ga0068854_100625852 | 3300005578 | Bacteria | 921 |
| 280 | Ga0068856_100073182 | 3300005614 | Bacteria | 3393 |
| 281 | Ga0068856_100088427 | 3300005614 | Bacteria | 3080 |
| 282 | Ga0068856_100250348 | 3300005614 | Bacteria | 1787 |
| 283 | Ga0068856_100262205 | 3300005614 | Bacteria | 1743 |
| 284 | Ga0070702_100047710 | 3300005615 | Bacteria | 2434 |
| 285 | Ga0068852_100009981 | 3300005616 | Bacteria | 7065 |
| 286 | Ga0068852_100029062 | 3300005616 | Bacteria | 4535 |
| 287 | Ga0068852_100068754 | 3300005616 | Bacteria | 3101 |
| 288 | Ga0068852_100238569 | 3300005616 | Bacteria | 1736 |
| 289 | Ga0068852_100379756 | 3300005616 | Bacteria | 1386 |
| 290 | Ga0068852_100439541 | 3300005616 | Bacteria | 1289 |
| 291 | Ga0068859_100017117 | 3300005617 | Bacteria | 7279 |
| 292 | Ga0068859_100039441 | 3300005617 | Bacteria | 4737 |
| 293 | Ga0068859_100044463 | 3300005617 | Bacteria | 4462 |
| 294 | Ga0068859_100075086 | 3300005617 | Bacteria | 3420 |
| 295 | Ga0068859_100287128 | 3300005617 | Bacteria | 1738 |
| 296 | Ga0068864_100012293 | 3300005618 | Bacteria | 7076 |
| 297 | Ga0068866_10000625 | 3300005718 | Bacteria | 16073 |
| 298 | Ga0068861_100028185 | 3300005719 | Bacteria | 4097 |
| 299 | Ga0068861_100159667 | 3300005719 | Bacteria | 1858 |
| 300 | Ga0068861_100470097 | 3300005719 | Bacteria | 1130 |
| 301 | Ga0068851_10035251 | 3300005834 | Bacteria | 2500 |
| 302 | Ga0068851_10036179 | 3300005834 | Bacteria | 2471 |
| 303 | Ga0068870_10011998 | 3300005840 | Bacteria | 4034 |
| 304 | Ga0068870_10055691 | 3300005840 | Bacteria | 2108 |
| 305 | Ga0068863_100023269 | 3300005841 | Bacteria | 5920 |
| 306 | Ga0068863_100029946 | 3300005841 | Bacteria | 5199 |
| 307 | Ga0068863_100119013 | 3300005841 | Bacteria | 2517 |
| 308 | Ga0068863_100587566 | 3300005841 | Bacteria | 1101 |
| 309 | Ga0068858_100083441 | 3300005842 | Bacteria | 2972 |
| 310 | Ga0068858_100181183 | 3300005842 | Bacteria | 1989 |
| 311 | Ga0068858_100327658 | 3300005842 | Bacteria | 1464 |
| 312 | Ga0068860_100025031 | 3300005843 | Bacteria | 5761 |
| 313 | Ga0068860_100057895 | 3300005843 | Bacteria | 3684 |
| 314 | Ga0068860_100180185 | 3300005843 | Bacteria | 2042 |
| 315 | Ga0068862_100003483 | 3300005844 | Bacteria | 13529 |
| 316 | Ga0081539_10001506 | 3300005985 | Bacteria | 39339 |
| 317 | Ga0081539_10023333 | 3300005985 | Bacteria | 4055 |
| 318 | Ga0070717_10018982 | 3300006028 | Bacteria | 5383 |
| 319 | Ga0070717_10122418 | 3300006028 | Bacteria | 2230 |
| 320 | Ga0070716_100014957 | 3300006173 | Bacteria | 3982 |
| 321 | Ga0070712_100039564 | 3300006175 | Bacteria | 3227 |
| 322 | Ga0070712_100139555 | 3300006175 | Bacteria | 1848 |
| 323 | Ga0070712_100229717 | 3300006175 | Bacteria | 1473 |
| 324 | Ga0097621_100453116 | 3300006237 | Bacteria | 1156 |
| 325 | Ga0068871_100103372 | 3300006358 | Bacteria | 2388 |
| 326 | Ga0068871_100143085 | 3300006358 | Bacteria | 2035 |
| 327 | Ga0075428_100044329 | 3300006844 | Bacteria | 4888 |
| 328 | Ga0075428_100091987 | 3300006844 | Bacteria | 3307 |
| 329 | Ga0075430_100040306 | 3300006846 | Bacteria | 3954 |
| 330 | Ga0075430_100054598 | 3300006846 | Bacteria | 3361 |
| 331 | Ga0075430_100057895 | 3300006846 | Bacteria | 3258 |
| 332 | Ga0075430_100081302 | 3300006846 | Bacteria | 2714 |
| 333 | Ga0075430_100100001 | 3300006846 | Bacteria | 2422 |
| 334 | Ga0075431_100066106 | 3300006847 | Bacteria | 3732 |
| 335 | Ga0075431_100085342 | 3300006847 | Bacteria | 3258 |
| 336 | Ga0075431_100089199 | 3300006847 | Bacteria | 3183 |
| 337 | Ga0075431_100130129 | 3300006847 | Bacteria | 2596 |
| 338 | Ga0075431_100341131 | 3300006847 | Bacteria | 1508 |
| 339 | Ga0075433_10008454 | 3300006852 | Bacteria | 8214 |
| 340 | Ga0075433_10017586 | 3300006852 | Bacteria | 5928 |
| 341 | Ga0075434_100293178 | 3300006871 | Bacteria | 1647 |
| 342 | Ga0075429_100019213 | 3300006880 | Bacteria | 5920 |
| 343 | Ga0075429_100055132 | 3300006880 | Bacteria | 3459 |
| 344 | Ga0075429_100181478 | 3300006880 | Bacteria | 1844 |
| 345 | Ga0068865_100047651 | 3300006881 | Bacteria | 2946 |
| 346 | Ga0068865_100050694 | 3300006881 | Bacteria | 2869 |
| 347 | Ga0068865_100438500 | 3300006881 | Bacteria | 1077 |
| 348 | Ga0075436_100011027 | 3300006914 | Bacteria | 6202 |
| 349 | Ga0075436_100149178 | 3300006914 | Bacteria | 1645 |
| 350 | Ga0097620_100017115 | 3300006931 | Bacteria | 7279 |
| 351 | Ga0097620_100039441 | 3300006931 | Bacteria | 4737 |
| 352 | Ga0097620_100044456 | 3300006931 | Bacteria | 4462 |
| 353 | Ga0097620_100075085 | 3300006931 | Bacteria | 3420 |
| 354 | Ga0097620_100287131 | 3300006931 | Bacteria | 1738 |
| 355 | Ga0075435_100151205 | 3300007076 | Bacteria | 1952 |
| 356 | Ga0099795_10031621 | 3300007788 | Bacteria | 1824 |
| 357 | Ga0105240_10053668 | 3300009093 | Bacteria | 5058 |
| 358 | Ga0105240_10056546 | 3300009093 | Bacteria | 4909 |
| 359 | Ga0105240_10101231 | 3300009093 | Bacteria | 3505 |
| 360 | Ga0105240_10123211 | 3300009093 | Bacteria | 3119 |
| 361 | Ga0105240_10171625 | 3300009093 | Bacteria | 2568 |
| 362 | Ga0105240_10337410 | 3300009093 | Bacteria | 1713 |
| 363 | Ga0105240_10741251 | 3300009093 | Bacteria | 1069 |
| 364 | Ga0111539_10070760 | 3300009094 | Bacteria | 4118 |
| 365 | Ga0111539_10080966 | 3300009094 | Bacteria | 3819 |
| 366 | Ga0111539_10454897 | 3300009094 | Bacteria | 1491 |
| 367 | Ga0105245_10078468 | 3300009098 | Bacteria | 3013 |
| 368 | Ga0105245_10131671 | 3300009098 | Bacteria | 2346 |
| 369 | Ga0105245_10155732 | 3300009098 | Bacteria | 2164 |
| 370 | Ga0105245_10169504 | 3300009098 | Bacteria | 2078 |
| 371 | Ga0105247_10193293 | 3300009101 | Bacteria | 1363 |
| 372 | Ga0114129_10034794 | 3300009147 | Bacteria | 7117 |
| 373 | Ga0114129_10074165 | 3300009147 | Bacteria | 4740 |
| 374 | Ga0114129_10346555 | 3300009147 | Bacteria | 1969 |
| 375 | Ga0105243_10140503 | 3300009148 | Bacteria | 2060 |
| 376 | Ga0105241_10008410 | 3300009174 | Bacteria | 7592 |
| 377 | Ga0105241_10089216 | 3300009174 | Bacteria | 2429 |
| 378 | Ga0105241_10435464 | 3300009174 | Bacteria | 1157 |
| 379 | Ga0105242_10007285 | 3300009176 | Bacteria | 8528 |
| 380 | Ga0105242_10034725 | 3300009176 | Bacteria | 4043 |
| 381 | Ga0105242_10149144 | 3300009176 | Bacteria | 2038 |
| 382 | Ga0105248_10040839 | 3300009177 | Bacteria | 5200 |
| 383 | Ga0105248_10050747 | 3300009177 | Bacteria | 4653 |
| 384 | Ga0105248_10058180 | 3300009177 | Bacteria | 4340 |
| 385 | Ga0105248_10122714 | 3300009177 | Bacteria | 2931 |
| 386 | Ga0105248_10524641 | 3300009177 | Bacteria | 1335 |
| 387 | Ga0105237_10178898 | 3300009545 | Bacteria | 2121 |
| 388 | Ga0105237_10220165 | 3300009545 | Bacteria | 1898 |
| 389 | Ga0105237_10474801 | 3300009545 | Bacteria | 1257 |
| 390 | Ga0105238_10029825 | 3300009551 | Bacteria | 5555 |
| 391 | Ga0105238_10075953 | 3300009551 | Bacteria | 3352 |
| 392 | Ga0105238_10269246 | 3300009551 | Bacteria | 1684 |
| 393 | Ga0105249_10000247 | 3300009553 | Bacteria | 59908 |
| 394 | Ga0105249_10018979 | 3300009553 | Bacteria | 6131 |
| 395 | Ga0105249_10173030 | 3300009553 | Bacteria | 2095 |
| 396 | Ga0105249_10239032 | 3300009553 | Bacteria | 1795 |
| 397 | Ga0099796_10021104 | 3300010159 | Bacteria | 2001 |
| 398 | Ga0105239_10043771 | 3300010375 | Bacteria | 4909 |
| 399 | Ga0105239_10121410 | 3300010375 | Bacteria | 2902 |
| 400 | Ga0105239_10172198 | 3300010375 | Bacteria | 2421 |
| 401 | Ga0105246_10031841 | 3300011119 | Bacteria | 3492 |
| 402 | Ga0105246_10625625 | 3300011119 | Bacteria | 933 |
| 403 | Ga0157373_10008827 | 3300013100 | Bacteria | 7467 |
| 404 | Ga0157373_10024036 | 3300013100 | Bacteria | 4416 |
| 405 | Ga0157373_10078858 | 3300013100 | Bacteria | 2322 |
| 406 | Ga0157373_10134672 | 3300013100 | Bacteria | 1737 |
| 407 | Ga0157373_10193303 | 3300013100 | Bacteria | 1434 |
| 408 | Ga0157373_10257524 | 3300013100 | Bacteria | 1235 |
| 409 | Ga0157371_10010154 | 3300013102 | Bacteria | 7356 |
| 410 | Ga0157371_10011380 | 3300013102 | Bacteria | 6861 |
| 411 | Ga0157371_10076830 | 3300013102 | Bacteria | 2365 |
| 412 | Ga0157371_10099341 | 3300013102 | Bacteria | 2064 |
| 413 | Ga0157370_10061565 | 3300013104 | Bacteria | 3561 |
| 414 | Ga0157370_10375609 | 3300013104 | Bacteria | 1310 |
| 415 | Ga0157370_10392922 | 3300013104 | Bacteria | 1277 |
| 416 | Ga0157370_10448021 | 3300013104 | Bacteria | 1187 |
| 417 | Ga0157370_10668109 | 3300013104 | Bacteria | 949 |
| 418 | Ga0157369_10129033 | 3300013105 | Bacteria | 2680 |
| 419 | Ga0157369_10217195 | 3300013105 | Bacteria | 2002 |
| 420 | Ga0157369_10224152 | 3300013105 | Bacteria | 1967 |
| 421 | Ga0157369_10234440 | 3300013105 | Bacteria | 1918 |
| 422 | Ga0157369_10267556 | 3300013105 | Bacteria | 1782 |
| 423 | Ga0157369_10277522 | 3300013105 | Bacteria | 1745 |
| 424 | Ga0157369_10699947 | 3300013105 | Bacteria | 1043 |
| 425 | Ga0157374_10019472 | 3300013296 | Bacteria | 6007 |
| 426 | Ga0157374_10253601 | 3300013296 | Bacteria | 1732 |
| 427 | Ga0157374_10326581 | 3300013296 | Bacteria | 1521 |
| 428 | Ga0157374_10460651 | 3300013296 | Bacteria | 1273 |
| 429 | Ga0157374_10826845 | 3300013296 | Bacteria | 943 |
| 430 | Ga0157378_10107312 | 3300013297 | Bacteria | 2555 |
| 431 | Ga0157378_10398123 | 3300013297 | Bacteria | 1356 |
| 432 | Ga0163162_10000968 | 3300013306 | Bacteria | 26664 |
| 433 | Ga0163162_10135225 | 3300013306 | Bacteria | 2576 |
| 434 | Ga0163162_10674155 | 3300013306 | Bacteria | 1157 |
| 435 | Ga0157372_10017897 | 3300013307 | Bacteria | 7614 |
| 436 | Ga0157372_10019172 | 3300013307 | Bacteria | 7366 |
| 437 | Ga0157372_10062629 | 3300013307 | Bacteria | 4168 |
| 438 | Ga0157372_10141012 | 3300013307 | Bacteria | 2776 |
| 439 | Ga0157372_10217816 | 3300013307 | Bacteria | 2213 |
| 440 | Ga0157372_10219048 | 3300013307 | Bacteria | 2206 |
| 441 | Ga0157372_10223667 | 3300013307 | Bacteria | 2182 |
| 442 | Ga0157372_10228177 | 3300013307 | Bacteria | 2158 |
| 443 | Ga0157372_10249173 | 3300013307 | Bacteria | 2061 |
| 444 | Ga0157372_10370207 | 3300013307 | Bacteria | 1670 |
| 445 | Ga0157372_10461114 | 3300013307 | Bacteria | 1481 |
| 446 | Ga0157372_10934412 | 3300013307 | Bacteria | 1005 |
| 447 | Ga0157372_11177403 | 3300013307 | Bacteria | 886 |
| 448 | Ga0157375_10020665 | 3300013308 | Bacteria | 6019 |
| 449 | Ga0157375_10116648 | 3300013308 | Bacteria | 2775 |
| 450 | Ga0157380_10041125 | 3300014326 | Bacteria | 3606 |
| 451 | Ga0157380_10117896 | 3300014326 | Bacteria | 2243 |
| 452 | Ga0182008_10006718 | 3300014497 | Bacteria | 6404 |
| 453 | Ga0157377_10001976 | 3300014745 | Bacteria | 8976 |
| 454 | Ga0157377_10057641 | 3300014745 | Bacteria | 2210 |
| 455 | Ga0157377_10064324 | 3300014745 | Bacteria | 2104 |
| 456 | Ga0157379_10032210 | 3300014968 | Bacteria | 4673 |
| 457 | Ga0157379_10412704 | 3300014968 | Bacteria | 1242 |
| 458 | Ga0157376_10049138 | 3300014969 | Bacteria | 3493 |
| 459 | Ga0157376_10074835 | 3300014969 | Bacteria | 2888 |
| 460 | Ga0157376_10141281 | 3300014969 | Bacteria | 2160 |
| 461 | Ga0157376_10155951 | 3300014969 | Bacteria | 2064 |
| 462 | Ga0163161_10252959 | 3300017792 | Bacteria | 1374 |
| 463 | Ga0197907_11051130 | 3300020069 | Bacteria | 1435 |
| 464 | Ga0213876_10010709 | 3300021384 | Bacteria | 4913 |
| 465 | Ga0213876_10031971 | 3300021384 | Bacteria | 2776 |
| 466 | Ga0209676_1000332 | 3300025292 | Bacteria | 90798 |
| 467 | Ga0207697_10011385 | 3300025315 | Bacteria | 3763 |
| 468 | Ga0207697_10014185 | 3300025315 | Bacteria | 3312 |
| 469 | Ga0207682_10011727 | 3300025893 | Bacteria | 3424 |
| 470 | Ga0207682_10016764 | 3300025893 | Bacteria | 2859 |
| 471 | Ga0207692_10015454 | 3300025898 | Bacteria | 3360 |
| 472 | Ga0207692_10077555 | 3300025898 | Bacteria | 1768 |
| 473 | Ga0207642_10000869 | 3300025899 | Bacteria | 9430 |
| 474 | Ga0207710_10143982 | 3300025900 | Bacteria | 1152 |
| 475 | Ga0207688_10027380 | 3300025901 | Bacteria | 3136 |
| 476 | Ga0207688_10044712 | 3300025901 | Bacteria | 2468 |
| 477 | Ga0207680_10024431 | 3300025903 | Bacteria | 3317 |
| 478 | Ga0207680_10025729 | 3300025903 | Bacteria | 3250 |
| 479 | Ga0207647_10012888 | 3300025904 | Bacteria | 5809 |
| 480 | Ga0207647_10206493 | 3300025904 | Bacteria | 1135 |
| 481 | Ga0207685_10159264 | 3300025905 | Bacteria | 1029 |
| 482 | Ga0207699_10001230 | 3300025906 | Bacteria | 12159 |
| 483 | Ga0207699_10126913 | 3300025906 | Bacteria | 1658 |
| 484 | Ga0207645_10001246 | 3300025907 | Bacteria | 20949 |
| 485 | Ga0207645_10002969 | 3300025907 | Bacteria | 13108 |
| 486 | Ga0207645_10018114 | 3300025907 | Bacteria | 4642 |
| 487 | Ga0207645_10185904 | 3300025907 | Bacteria | 1364 |
| 488 | Ga0207645_10193849 | 3300025907 | Bacteria | 1336 |
| 489 | Ga0207643_10003364 | 3300025908 | Bacteria | 8615 |
| 490 | Ga0207643_10057418 | 3300025908 | Bacteria | 2215 |
| 491 | Ga0207705_10027229 | 3300025909 | Bacteria | 4075 |
| 492 | Ga0207705_10029211 | 3300025909 | Bacteria | 3930 |
| 493 | Ga0207705_10031424 | 3300025909 | Bacteria | 3790 |
| 494 | Ga0207705_10031835 | 3300025909 | Bacteria | 3767 |
| 495 | Ga0207705_10043315 | 3300025909 | Bacteria | 3233 |
| 496 | Ga0207705_10079711 | 3300025909 | Bacteria | 2385 |
| 497 | Ga0207705_10122539 | 3300025909 | Bacteria | 1930 |
| 498 | Ga0207705_10172522 | 3300025909 | Bacteria | 1629 |
| 499 | Ga0207705_10276084 | 3300025909 | Bacteria | 1286 |
| 500 | Ga0207684_10477754 | 3300025910 | Bacteria | 1069 |
| 501 | Ga0207654_10005914 | 3300025911 | Bacteria | 6156 |
| 502 | Ga0207654_10028743 | 3300025911 | Bacteria | 3034 |
| 503 | Ga0207654_10099830 | 3300025911 | Bacteria | 1786 |
| 504 | Ga0207654_10270197 | 3300025911 | Bacteria | 1147 |
| 505 | Ga0207707_10000784 | 3300025912 | Bacteria | 31134 |
| 506 | Ga0207707_10002248 | 3300025912 | Bacteria | 17457 |
| 507 | Ga0207707_10003943 | 3300025912 | Bacteria | 13181 |
| 508 | Ga0207707_10004141 | 3300025912 | Bacteria | 12844 |
| 509 | Ga0207707_10010236 | 3300025912 | Bacteria | 8142 |
| 510 | Ga0207707_10012860 | 3300025912 | Bacteria | 7283 |
| 511 | Ga0207707_10020853 | 3300025912 | Bacteria | 5725 |
| 512 | Ga0207707_10041250 | 3300025912 | Bacteria | 4031 |
| 513 | Ga0207707_10074382 | 3300025912 | Bacteria | 2963 |
| 514 | Ga0207707_10075446 | 3300025912 | Bacteria | 2942 |
| 515 | Ga0207707_10097923 | 3300025912 | Bacteria | 2564 |
| 516 | Ga0207707_10136471 | 3300025912 | Bacteria | 2145 |
| 517 | Ga0207707_10212597 | 3300025912 | Bacteria | 1684 |
| 518 | Ga0207707_10254088 | 3300025912 | Bacteria | 1526 |
| 519 | Ga0207707_10275027 | 3300025912 | Bacteria | 1459 |
| 520 | Ga0207707_10384637 | 3300025912 | Bacteria | 1206 |
| 521 | Ga0207695_10002690 | 3300025913 | Bacteria | 25925 |
| 522 | Ga0207695_10003067 | 3300025913 | Bacteria | 23953 |
| 523 | Ga0207695_10004617 | 3300025913 | Bacteria | 18682 |
| 524 | Ga0207695_10013424 | 3300025913 | Bacteria | 9771 |
| 525 | Ga0207695_10066239 | 3300025913 | Bacteria | 3711 |
| 526 | Ga0207695_10070341 | 3300025913 | Bacteria | 3578 |
| 527 | Ga0207695_10226018 | 3300025913 | Bacteria | 1778 |
| 528 | Ga0207695_10226195 | 3300025913 | Bacteria | 1777 |
| 529 | Ga0207671_10264370 | 3300025914 | Bacteria | 1354 |
| 530 | Ga0207693_10003338 | 3300025915 | Bacteria | 13734 |
| 531 | Ga0207693_10084216 | 3300025915 | Bacteria | 2491 |
| 532 | Ga0207693_10144717 | 3300025915 | Bacteria | 1869 |
| 533 | Ga0207663_10012846 | 3300025916 | Bacteria | 4538 |
| 534 | Ga0207663_10023350 | 3300025916 | Bacteria | 3547 |
| 535 | Ga0207660_10001291 | 3300025917 | Bacteria | 16748 |
| 536 | Ga0207660_10013204 | 3300025917 | Bacteria | 5410 |
| 537 | Ga0207660_10032435 | 3300025917 | Bacteria | 3605 |
| 538 | Ga0207660_10044376 | 3300025917 | Bacteria | 3128 |
| 539 | Ga0207660_10054390 | 3300025917 | Bacteria | 2857 |
| 540 | Ga0207660_10055934 | 3300025917 | Bacteria | 2822 |
| 541 | Ga0207660_10057759 | 3300025917 | Bacteria | 2780 |
| 542 | Ga0207660_10088243 | 3300025917 | Bacteria | 2293 |
| 543 | Ga0207660_10103162 | 3300025917 | Bacteria | 2133 |
| 544 | Ga0207660_10139720 | 3300025917 | Bacteria | 1851 |
| 545 | Ga0207660_10200740 | 3300025917 | Bacteria | 1557 |
| 546 | Ga0207660_10213249 | 3300025917 | Bacteria | 1513 |
| 547 | Ga0207660_10249325 | 3300025917 | Bacteria | 1401 |
| 548 | Ga0207660_10330852 | 3300025917 | Bacteria | 1218 |
| 549 | Ga0207662_10006823 | 3300025918 | Bacteria | 6179 |
| 550 | Ga0207662_10020855 | 3300025918 | Bacteria | 3741 |
| 551 | Ga0207662_10037541 | 3300025918 | Bacteria | 2835 |
| 552 | Ga0207662_10297302 | 3300025918 | Bacteria | 1072 |
| 553 | Ga0207657_10001138 | 3300025919 | Bacteria | 28229 |
| 554 | Ga0207657_10054086 | 3300025919 | Bacteria | 3473 |
| 555 | Ga0207657_10100403 | 3300025919 | Bacteria | 2403 |
| 556 | Ga0207657_10110156 | 3300025919 | Bacteria | 2275 |
| 557 | Ga0207657_10202823 | 3300025919 | Bacteria | 1594 |
| 558 | Ga0207657_10405023 | 3300025919 | Bacteria | 1073 |
| 559 | Ga0207649_10002377 | 3300025920 | Bacteria | 10552 |
| 560 | Ga0207649_10004410 | 3300025920 | Bacteria | 7637 |
| 561 | Ga0207649_10007666 | 3300025920 | Bacteria | 5871 |
| 562 | Ga0207649_10008227 | 3300025920 | Bacteria | 5682 |
| 563 | Ga0207649_10013748 | 3300025920 | Bacteria | 4524 |
| 564 | Ga0207649_10032190 | 3300025920 | Bacteria | 3124 |
| 565 | Ga0207649_10156162 | 3300025920 | Bacteria | 1576 |
| 566 | Ga0207649_10178625 | 3300025920 | Bacteria | 1484 |
| 567 | Ga0207649_10310550 | 3300025920 | Bacteria | 1155 |
| 568 | Ga0207652_10002905 | 3300025921 | Bacteria | 14334 |
| 569 | Ga0207652_10004165 | 3300025921 | Bacteria | 11797 |
| 570 | Ga0207652_10012004 | 3300025921 | Bacteria | 6992 |
| 571 | Ga0207652_10015685 | 3300025921 | Bacteria | 6170 |
| 572 | Ga0207652_10019965 | 3300025921 | Bacteria | 5517 |
| 573 | Ga0207652_10038944 | 3300025921 | Bacteria | 4032 |
| 574 | Ga0207652_10042922 | 3300025921 | Bacteria | 3850 |
| 575 | Ga0207652_10067099 | 3300025921 | Bacteria | 3110 |
| 576 | Ga0207652_10069714 | 3300025921 | Bacteria | 3053 |
| 577 | Ga0207652_10093206 | 3300025921 | Bacteria | 2650 |
| 578 | Ga0207652_10094537 | 3300025921 | Bacteria | 2632 |
| 579 | Ga0207652_10180913 | 3300025921 | Bacteria | 1895 |
| 580 | Ga0207652_10469355 | 3300025921 | Bacteria | 1134 |
| 581 | Ga0207652_10522591 | 3300025921 | Bacteria | 1068 |
| 582 | Ga0207652_10646286 | 3300025921 | Bacteria | 946 |
| 583 | Ga0207652_10697419 | 3300025921 | Bacteria | 906 |
| 584 | Ga0207646_10019243 | 3300025922 | Bacteria | 6348 |
| 585 | Ga0207646_10035672 | 3300025922 | Bacteria | 4491 |
| 586 | Ga0207646_10201520 | 3300025922 | Bacteria | 1798 |
| 587 | Ga0207646_10280505 | 3300025922 | Bacteria | 1506 |
| 588 | Ga0207681_10001456 | 3300025923 | Bacteria | 15236 |
| 589 | Ga0207681_10023008 | 3300025923 | Bacteria | 3979 |
| 590 | Ga0207681_10032436 | 3300025923 | Bacteria | 3419 |
| 591 | Ga0207694_10026946 | 3300025924 | Bacteria | 4377 |
| 592 | Ga0207694_10248765 | 3300025924 | Bacteria | 1454 |
| 593 | Ga0207694_10327240 | 3300025924 | Bacteria | 1266 |
| 594 | Ga0207650_10034430 | 3300025925 | Bacteria | 3673 |
| 595 | Ga0207650_10086726 | 3300025925 | Bacteria | 2383 |
| 596 | Ga0207650_10245208 | 3300025925 | Bacteria | 1449 |
| 597 | Ga0207650_10503674 | 3300025925 | Bacteria | 1012 |
| 598 | Ga0207659_10007653 | 3300025926 | Bacteria | 6665 |
| 599 | Ga0207659_10017541 | 3300025926 | Bacteria | 4678 |
| 600 | Ga0207659_10022346 | 3300025926 | Bacteria | 4211 |
| 601 | Ga0207659_10051549 | 3300025926 | Bacteria | 2927 |
| 602 | Ga0207659_10218655 | 3300025926 | Bacteria | 1530 |
| 603 | Ga0207687_10075869 | 3300025927 | Bacteria | 2414 |
| 604 | Ga0207687_10117584 | 3300025927 | Bacteria | 1983 |
| 605 | Ga0207700_10021907 | 3300025928 | Bacteria | 4374 |
| 606 | Ga0207700_10039951 | 3300025928 | Bacteria | 3420 |
| 607 | Ga0207700_10744429 | 3300025928 | Bacteria | 876 |
| 608 | Ga0207664_10009225 | 3300025929 | Bacteria | 6911 |
| 609 | Ga0207664_10012437 | 3300025929 | Bacteria | 6084 |
| 610 | Ga0207664_10030097 | 3300025929 | Bacteria | 4144 |
| 611 | Ga0207664_10059661 | 3300025929 | Bacteria | 3039 |
| 612 | Ga0207664_10150502 | 3300025929 | Bacteria | 1976 |
| 613 | Ga0207644_10081250 | 3300025931 | Bacteria | 2395 |
| 614 | Ga0207644_10157705 | 3300025931 | Bacteria | 1761 |
| 615 | Ga0207644_10228772 | 3300025931 | Bacteria | 1477 |
| 616 | Ga0207690_10039753 | 3300025932 | Bacteria | 3071 |
| 617 | Ga0207690_10080789 | 3300025932 | Bacteria | 2270 |
| 618 | Ga0207690_10631067 | 3300025932 | Bacteria | 877 |
| 619 | Ga0207706_10000025 | 3300025933 | Bacteria | 150958 |
| 620 | Ga0207706_10030641 | 3300025933 | Bacteria | 4797 |
| 621 | Ga0207706_10044843 | 3300025933 | Bacteria | 3918 |
| 622 | Ga0207706_10085090 | 3300025933 | Bacteria | 2780 |
| 623 | Ga0207706_10150224 | 3300025933 | Bacteria | 2049 |
| 624 | Ga0207706_10279971 | 3300025933 | Bacteria | 1455 |
| 625 | Ga0207706_10320634 | 3300025933 | Bacteria | 1349 |
| 626 | Ga0207686_10001115 | 3300025934 | Bacteria | 15582 |
| 627 | Ga0207686_10022147 | 3300025934 | Bacteria | 3657 |
| 628 | Ga0207686_10060773 | 3300025934 | Bacteria | 2393 |
| 629 | Ga0207686_10085618 | 3300025934 | Bacteria | 2068 |
| 630 | Ga0207709_10081832 | 3300025935 | Bacteria | 2083 |
| 631 | Ga0207670_10005135 | 3300025936 | Bacteria | 7153 |
| 632 | Ga0207670_10018648 | 3300025936 | Bacteria | 4224 |
| 633 | Ga0207670_10107499 | 3300025936 | Bacteria | 2003 |
| 634 | Ga0207669_10000638 | 3300025937 | Bacteria | 15128 |
| 635 | Ga0207704_10004727 | 3300025938 | Bacteria | 6249 |
| 636 | Ga0207704_10242662 | 3300025938 | Bacteria | 1347 |
| 637 | Ga0207665_10024947 | 3300025939 | Bacteria | 3943 |
| 638 | Ga0207665_10102606 | 3300025939 | Bacteria | 1999 |
| 639 | Ga0207691_10003543 | 3300025940 | Bacteria | 15184 |
| 640 | Ga0207691_10013350 | 3300025940 | Bacteria | 7866 |
| 641 | Ga0207691_10032808 | 3300025940 | Bacteria | 4839 |
| 642 | Ga0207691_10046795 | 3300025940 | Bacteria | 3973 |
| 643 | Ga0207691_10102934 | 3300025940 | Bacteria | 2546 |
| 644 | Ga0207691_10153386 | 3300025940 | Bacteria | 2025 |
| 645 | Ga0207711_10002753 | 3300025941 | Bacteria | 15495 |
| 646 | Ga0207711_10006251 | 3300025941 | Bacteria | 10048 |
| 647 | Ga0207711_10469843 | 3300025941 | Bacteria | 1171 |
| 648 | Ga0207711_10683652 | 3300025941 | Bacteria | 957 |
| 649 | Ga0207711_10746633 | 3300025941 | Bacteria | 912 |
| 650 | Ga0207689_10005455 | 3300025942 | Bacteria | 11380 |
| 651 | Ga0207689_10019641 | 3300025942 | Bacteria | 5694 |
| 652 | Ga0207689_10117716 | 3300025942 | Bacteria | 2185 |
| 653 | Ga0207689_10488156 | 3300025942 | Bacteria | 1031 |
| 654 | Ga0207661_10001853 | 3300025944 | Bacteria | 14467 |
| 655 | Ga0207661_10001907 | 3300025944 | Bacteria | 14301 |
| 656 | Ga0207661_10004866 | 3300025944 | Bacteria | 9413 |
| 657 | Ga0207661_10007267 | 3300025944 | Bacteria | 7879 |
| 658 | Ga0207661_10008533 | 3300025944 | Bacteria | 7322 |
| 659 | Ga0207661_10034637 | 3300025944 | Bacteria | 3929 |
| 660 | Ga0207661_10047859 | 3300025944 | Bacteria | 3396 |
| 661 | Ga0207661_10167950 | 3300025944 | Bacteria | 1908 |
| 662 | Ga0207661_10198084 | 3300025944 | Bacteria | 1764 |
| 663 | Ga0207661_10217134 | 3300025944 | Bacteria | 1688 |
| 664 | Ga0207661_10299851 | 3300025944 | Bacteria | 1440 |
| 665 | Ga0207661_10463489 | 3300025944 | Bacteria | 1155 |
| 666 | Ga0207679_10001341 | 3300025945 | Bacteria | 15577 |
| 667 | Ga0207679_10006587 | 3300025945 | Bacteria | 7344 |
| 668 | Ga0207679_10092083 | 3300025945 | Bacteria | 2348 |
| 669 | Ga0207679_10192419 | 3300025945 | Bacteria | 1697 |
| 670 | Ga0207679_10215775 | 3300025945 | Bacteria | 1612 |
| 671 | Ga0207679_10218788 | 3300025945 | Bacteria | 1601 |
| 672 | Ga0207667_10034763 | 3300025949 | Bacteria | 5409 |
| 673 | Ga0207667_10056597 | 3300025949 | Bacteria | 4119 |
| 674 | Ga0207667_10105114 | 3300025949 | Bacteria | 2913 |
| 675 | Ga0207667_10126128 | 3300025949 | Bacteria | 2636 |
| 676 | Ga0207667_10126755 | 3300025949 | Bacteria | 2630 |
| 677 | Ga0207667_10233566 | 3300025949 | Bacteria | 1883 |
| 678 | Ga0207667_10281980 | 3300025949 | Bacteria | 1698 |
| 679 | Ga0207667_10300053 | 3300025949 | Bacteria | 1641 |
| 680 | Ga0207667_10466524 | 3300025949 | Bacteria | 1282 |
| 681 | Ga0207667_10537287 | 3300025949 | Bacteria | 1183 |
| 682 | Ga0207651_10021908 | 3300025960 | Bacteria | 3893 |
| 683 | Ga0207651_10036217 | 3300025960 | Bacteria | 3219 |
| 684 | Ga0207651_10170424 | 3300025960 | Bacteria | 1716 |
| 685 | Ga0207651_10173474 | 3300025960 | Bacteria | 1703 |
| 686 | Ga0207651_10400513 | 3300025960 | Bacteria | 1167 |
| 687 | Ga0207651_10570192 | 3300025960 | Bacteria | 986 |
| 688 | Ga0207712_10000236 | 3300025961 | Bacteria | 54231 |
| 689 | Ga0207712_10004705 | 3300025961 | Bacteria | 8621 |
| 690 | Ga0207712_10013022 | 3300025961 | Bacteria | 5328 |
| 691 | Ga0207712_10019662 | 3300025961 | Bacteria | 4414 |
| 692 | Ga0207668_10002200 | 3300025972 | Bacteria | 11374 |
| 693 | Ga0207668_10014204 | 3300025972 | Bacteria | 4926 |
| 694 | Ga0207668_10045377 | 3300025972 | Bacteria | 2997 |
| 695 | Ga0207668_10052171 | 3300025972 | Bacteria | 2828 |
| 696 | Ga0207668_10388631 | 3300025972 | Bacteria | 1176 |
| 697 | Ga0207640_10000324 | 3300025981 | Bacteria | 31977 |
| 698 | Ga0207640_10001124 | 3300025981 | Bacteria | 14743 |
| 699 | Ga0207640_10001854 | 3300025981 | Bacteria | 11325 |
| 700 | Ga0207640_10015432 | 3300025981 | Bacteria | 4421 |
| 701 | Ga0207640_10065476 | 3300025981 | Bacteria | 2425 |
| 702 | Ga0207640_10287500 | 3300025981 | Bacteria | 1295 |
| 703 | Ga0207640_10312773 | 3300025981 | Bacteria | 1247 |
| 704 | Ga0207640_10609114 | 3300025981 | Bacteria | 925 |
| 705 | Ga0207658_10078185 | 3300025986 | Bacteria | 2527 |
| 706 | Ga0207658_10121737 | 3300025986 | Bacteria | 2082 |
| 707 | Ga0207658_10390115 | 3300025986 | Bacteria | 1221 |
| 708 | Ga0207677_10058774 | 3300026023 | Bacteria | 2649 |
| 709 | Ga0207677_10092972 | 3300026023 | Bacteria | 2197 |
| 710 | Ga0207703_10051872 | 3300026035 | Bacteria | 3327 |
| 711 | Ga0207703_10052835 | 3300026035 | Bacteria | 3301 |
| 712 | Ga0207703_10297709 | 3300026035 | Bacteria | 1470 |
| 713 | Ga0207639_10031292 | 3300026041 | Bacteria | 3910 |
| 714 | Ga0207639_10051893 | 3300026041 | Bacteria | 3122 |
| 715 | Ga0207639_10220672 | 3300026041 | Bacteria | 1637 |
| 716 | Ga0207639_10276977 | 3300026041 | Bacteria | 1474 |
| 717 | Ga0207639_10580316 | 3300026041 | Bacteria | 1032 |
| 718 | Ga0207639_10682003 | 3300026041 | Bacteria | 952 |
| 719 | Ga0207678_10012023 | 3300026067 | Bacteria | 7601 |
| 720 | Ga0207678_10071359 | 3300026067 | Bacteria | 2978 |
| 721 | Ga0207678_10076305 | 3300026067 | Bacteria | 2871 |
| 722 | Ga0207678_10086322 | 3300026067 | Bacteria | 2682 |
| 723 | Ga0207678_10146850 | 3300026067 | Bacteria | 2013 |
| 724 | Ga0207708_10012624 | 3300026075 | Bacteria | 6301 |
| 725 | Ga0207708_10077845 | 3300026075 | Bacteria | 2545 |
| 726 | Ga0207708_10112088 | 3300026075 | Bacteria | 2118 |
| 727 | Ga0207702_10036288 | 3300026078 | Bacteria | 4123 |
| 728 | Ga0207702_10556254 | 3300026078 | Bacteria | 1123 |
| 729 | Ga0207641_10007192 | 3300026088 | Bacteria | 9281 |
| 730 | Ga0207641_10115304 | 3300026088 | Bacteria | 2388 |
| 731 | Ga0207641_10133751 | 3300026088 | Bacteria | 2230 |
| 732 | Ga0207648_10000138 | 3300026089 | Bacteria | 72558 |
| 733 | Ga0207648_10048391 | 3300026089 | Bacteria | 3722 |
| 734 | Ga0207648_10097740 | 3300026089 | Bacteria | 2569 |
| 735 | Ga0207648_10099910 | 3300026089 | Bacteria | 2541 |
| 736 | Ga0207648_10203821 | 3300026089 | Bacteria | 1755 |
| 737 | Ga0207676_10435635 | 3300026095 | Bacteria | 1232 |
| 738 | Ga0207676_10894139 | 3300026095 | Bacteria | 871 |
| 739 | Ga0207674_10019045 | 3300026116 | Bacteria | 7438 |
| 740 | Ga0207674_10048059 | 3300026116 | Bacteria | 4370 |
| 741 | Ga0207674_10048180 | 3300026116 | Bacteria | 4363 |
| 742 | Ga0207674_10082972 | 3300026116 | Bacteria | 3205 |
| 743 | Ga0207674_10086885 | 3300026116 | Bacteria | 3121 |
| 744 | Ga0207674_10090084 | 3300026116 | Bacteria | 3059 |
| 745 | Ga0207674_10101100 | 3300026116 | Bacteria | 2864 |
| 746 | Ga0207674_10110465 | 3300026116 | Bacteria | 2725 |
| 747 | Ga0207674_10168287 | 3300026116 | Bacteria | 2145 |
| 748 | Ga0207674_10296702 | 3300026116 | Bacteria | 1565 |
| 749 | Ga0207675_100001482 | 3300026118 | Bacteria | 23584 |
| 750 | Ga0207675_100006697 | 3300026118 | Bacteria | 10892 |
| 751 | Ga0207675_100117992 | 3300026118 | Bacteria | 2509 |
| 752 | Ga0207675_100244793 | 3300026118 | Bacteria | 1734 |
| 753 | Ga0207683_10006013 | 3300026121 | Bacteria | 10390 |
| 754 | Ga0207683_10018004 | 3300026121 | Bacteria | 6025 |
| 755 | Ga0207683_10028596 | 3300026121 | Bacteria | 4822 |
| 756 | Ga0207683_10035142 | 3300026121 | Bacteria | 4359 |
| 757 | Ga0207698_10019363 | 3300026142 | Bacteria | 4658 |
| 758 | Ga0207698_10036093 | 3300026142 | Bacteria | 3624 |
| 759 | Ga0207698_10038152 | 3300026142 | Bacteria | 3547 |
| 760 | Ga0207698_10463610 | 3300026142 | Bacteria | 1226 |
| 761 | Ga0207698_10561203 | 3300026142 | Bacteria | 1121 |
| 762 | Ga0207698_10744398 | 3300026142 | Bacteria | 978 |
| 763 | Ga0209969_1009191 | 3300027360 | Bacteria | 1406 |
| 764 | Ga0209981_1002273 | 3300027378 | Bacteria | 2444 |
| 765 | Ga0210000_1008961 | 3300027462 | Bacteria | 1470 |
| 766 | Ga0209995_1006746 | 3300027471 | Bacteria | 1849 |
| 767 | Ga0209968_1003096 | 3300027526 | Bacteria | 2493 |
| 768 | Ga0209999_1000199 | 3300027543 | Bacteria | 8320 |
| 769 | Ga0209999_1002599 | 3300027543 | Bacteria | 3194 |
| 770 | Ga0209970_1008724 | 3300027614 | Bacteria | 1660 |
| 771 | Ga0209966_1000982 | 3300027695 | Bacteria | 5325 |
| 772 | Ga0209998_10003458 | 3300027717 | Bacteria | 3451 |
| 773 | Ga0209974_10021093 | 3300027876 | Bacteria | 2158 |
| 774 | Ga0207428_10118944 | 3300027907 | Bacteria | 2027 |
| 775 | Ga0268266_10047291 | 3300028379 | Bacteria | 3686 |
| 776 | Ga0268266_10484725 | 3300028379 | Bacteria | 1179 |
| 777 | Ga0268265_10002653 | 3300028380 | Bacteria | 13279 |
| 778 | Ga0268265_10060632 | 3300028380 | Bacteria | 2900 |
| 779 | Ga0268264_10005398 | 3300028381 | Bacteria | 10824 |
| 780 | Ga0268264_10012146 | 3300028381 | Bacteria | 7091 |
| 781 | Ga0268264_10252891 | 3300028381 | Bacteria | 1638 |
| 782 | Ga0265318_10091847 | 3300028577 | Bacteria | 1118 |
| 783 | Ga0265332_10001239 | 3300031238 | Bacteria | 14770 |
| 784 | Ga0265327_10004939 | 3300031251 | Bacteria | 11475 |
| 785 | Ga0307513_10331498 | 3300031456 | Bacteria | 1276 |
| 786 | Ga0307408_100002760 | 3300031548 | Bacteria | 12197 |
| 787 | Ga0307408_100019763 | 3300031548 | Bacteria | 4537 |
| 788 | Ga0307408_100052712 | 3300031548 | Bacteria | 2935 |
| 789 | Ga0307408_100062503 | 3300031548 | Bacteria | 2721 |
| 790 | Ga0307408_100066008 | 3300031548 | Bacteria | 2656 |
| 791 | Ga0307408_100153960 | 3300031548 | Bacteria | 1818 |
| 792 | Ga0307408_100223526 | 3300031548 | Bacteria | 1538 |
| 793 | Ga0265314_10004621 | 3300031711 | Bacteria | 12682 |
| 794 | Ga0265314_10017451 | 3300031711 | Bacteria | 5634 |
| 795 | Ga0316576_10015012 | 3300031727 | Bacteria | 5185 |
| 796 | Ga0316578_10041302 | 3300031728 | Bacteria | 2671 |
| 797 | Ga0307405_10003326 | 3300031731 | Bacteria | 7362 |
| 798 | Ga0307405_10004504 | 3300031731 | Bacteria | 6595 |
| 799 | Ga0307405_10051278 | 3300031731 | Bacteria | 2559 |
| 800 | Ga0307405_10061362 | 3300031731 | Bacteria | 2376 |
| 801 | Ga0307405_10079157 | 3300031731 | Bacteria | 2141 |
| 802 | Ga0307405_10081500 | 3300031731 | Bacteria | 2115 |
| 803 | Ga0307405_10152371 | 3300031731 | Bacteria | 1627 |
| 804 | Ga0307405_10228399 | 3300031731 | Bacteria | 1370 |
| 805 | Ga0307405_10235083 | 3300031731 | Bacteria | 1353 |
| 806 | Ga0307405_10315118 | 3300031731 | Bacteria | 1193 |
| 807 | Ga0307405_10508407 | 3300031731 | Bacteria | 967 |
| 808 | Ga0307413_10001842 | 3300031824 | Bacteria | 8343 |
| 809 | Ga0307413_10002091 | 3300031824 | Bacteria | 7997 |
| 810 | Ga0307413_10002387 | 3300031824 | Bacteria | 7627 |
| 811 | Ga0307413_10037954 | 3300031824 | Bacteria | 2787 |
| 812 | Ga0307413_10055726 | 3300031824 | Bacteria | 2407 |
| 813 | Ga0307413_10079652 | 3300031824 | Bacteria | 2095 |
| 814 | Ga0307413_10106244 | 3300031824 | Bacteria | 1868 |
| 815 | Ga0307413_10111837 | 3300031824 | Bacteria | 1830 |
| 816 | Ga0307413_10261069 | 3300031824 | Bacteria | 1291 |
| 817 | Ga0307413_10388818 | 3300031824 | Bacteria | 1089 |
| 818 | Ga0307410_10022252 | 3300031852 | Bacteria | 3914 |
| 819 | Ga0307410_10054670 | 3300031852 | Bacteria | 2707 |
| 820 | Ga0307410_10070477 | 3300031852 | Bacteria | 2422 |
| 821 | Ga0307410_10105816 | 3300031852 | Bacteria | 2026 |
| 822 | Ga0307410_10109480 | 3300031852 | Bacteria | 1996 |
| 823 | Ga0307410_10369891 | 3300031852 | Bacteria | 1150 |
| 824 | Ga0307406_10001264 | 3300031901 | Bacteria | 14150 |
| 825 | Ga0307406_10020026 | 3300031901 | Bacteria | 3933 |
| 826 | Ga0307406_10030981 | 3300031901 | Bacteria | 3253 |
| 827 | Ga0307406_10033014 | 3300031901 | Bacteria | 3164 |
| 828 | Ga0307406_10144685 | 3300031901 | Bacteria | 1688 |
| 829 | Ga0307406_10208490 | 3300031901 | Bacteria | 1444 |
| 830 | Ga0307407_10005111 | 3300031903 | Bacteria | 5655 |
| 831 | Ga0307407_10021693 | 3300031903 | Bacteria | 3318 |
| 832 | Ga0307407_10047832 | 3300031903 | Bacteria | 2430 |
| 833 | Ga0307407_10216503 | 3300031903 | Bacteria | 1292 |
| 834 | Ga0307412_10005885 | 3300031911 | Bacteria | 6908 |
| 835 | Ga0307412_10007821 | 3300031911 | Bacteria | 6085 |
| 836 | Ga0307412_10060199 | 3300031911 | Bacteria | 2548 |
| 837 | Ga0307412_10075320 | 3300031911 | Bacteria | 2315 |
| 838 | Ga0307412_10202806 | 3300031911 | Bacteria | 1507 |
| 839 | Ga0307412_10407017 | 3300031911 | Bacteria | 1109 |
| 840 | Ga0307409_100032235 | 3300031995 | Bacteria | 3796 |
| 841 | Ga0307409_100079067 | 3300031995 | Bacteria | 2648 |
| 842 | Ga0307409_100105590 | 3300031995 | Bacteria | 2348 |
| 843 | Ga0307409_100119375 | 3300031995 | Bacteria | 2229 |
| 844 | Ga0307409_100124031 | 3300031995 | Bacteria | 2193 |
| 845 | Ga0307409_100206649 | 3300031995 | Bacteria | 1761 |
| 846 | Ga0307409_100254111 | 3300031995 | Bacteria | 1608 |
| 847 | Ga0307409_100331104 | 3300031995 | Bacteria | 1429 |
| 848 | Ga0307409_100498924 | 3300031995 | Bacteria | 1185 |
| 849 | Ga0307409_100623915 | 3300031995 | Bacteria | 1068 |
| 850 | Ga0307416_100009003 | 3300032002 | Bacteria | 6494 |
| 851 | Ga0307416_100016074 | 3300032002 | Bacteria | 5188 |
| 852 | Ga0307416_100047021 | 3300032002 | Bacteria | 3411 |
| 853 | Ga0307416_100092060 | 3300032002 | Bacteria | 2606 |
| 854 | Ga0307416_100113896 | 3300032002 | Bacteria | 2391 |
| 855 | Ga0307416_100116989 | 3300032002 | Bacteria | 2365 |
| 856 | Ga0307416_100117798 | 3300032002 | Bacteria | 2358 |
| 857 | Ga0307416_100118263 | 3300032002 | Bacteria | 2355 |
| 858 | Ga0307416_100196081 | 3300032002 | Bacteria | 1910 |
| 859 | Ga0307416_100209312 | 3300032002 | Bacteria | 1858 |
| 860 | Ga0307416_100270316 | 3300032002 | Bacteria | 1668 |
| 861 | Ga0307416_100314182 | 3300032002 | Bacteria | 1565 |
| 862 | Ga0307416_100357375 | 3300032002 | Bacteria | 1481 |
| 863 | Ga0307416_100364805 | 3300032002 | Bacteria | 1468 |
| 864 | Ga0307416_100375061 | 3300032002 | Bacteria | 1450 |
| 865 | Ga0307416_100832026 | 3300032002 | Bacteria | 1020 |
| 866 | Ga0307414_10049512 | 3300032004 | Bacteria | 2906 |
| 867 | Ga0307414_10086998 | 3300032004 | Bacteria | 2307 |
| 868 | Ga0307414_10151426 | 3300032004 | Bacteria | 1830 |
| 869 | Ga0307414_10341665 | 3300032004 | Bacteria | 1282 |
| 870 | Ga0307411_10005072 | 3300032005 | Bacteria | 6412 |
| 871 | Ga0307411_10072801 | 3300032005 | Bacteria | 2334 |
| 872 | Ga0307411_10132943 | 3300032005 | Bacteria | 1821 |
| 873 | Ga0307411_10158935 | 3300032005 | Bacteria | 1689 |
| 874 | Ga0307411_10226050 | 3300032005 | Bacteria | 1455 |
| 875 | Ga0307411_10298126 | 3300032005 | Bacteria | 1291 |
| 876 | Ga0307415_100004310 | 3300032126 | Bacteria | 7364 |
| 877 | Ga0307415_100004471 | 3300032126 | Bacteria | 7257 |
| 878 | Ga0307415_100006886 | 3300032126 | Bacteria | 6172 |
| 879 | Ga0307415_100023196 | 3300032126 | Bacteria | 3847 |
| 880 | Ga0307415_100041357 | 3300032126 | Bacteria | 3060 |
| 881 | Ga0307415_100077926 | 3300032126 | Bacteria | 2355 |
| 882 | Ga0307415_100116777 | 3300032126 | Bacteria | 1991 |
| 883 | Ga0307415_100127589 | 3300032126 | Bacteria | 1920 |
| 884 | Ga0307415_100282987 | 3300032126 | Bacteria | 1365 |
| 885 | Ga0307415_100315483 | 3300032126 | Bacteria | 1301 |
| 886 | Ga0307415_100342471 | 3300032126 | Bacteria | 1255 |
| 887 | Ga0373926_0074468 | 3300035083 | Bacteria | 1250 |
| 888 | Ga0373929_0050970 | 3300035085 | Bacteria | 946 |
| 889 | Ga0373934_0001304 | 3300035086 | Bacteria | 9089 |
| 890 | Ga0373934_0104066 | 3300035086 | Bacteria | 1148 |
| 891 | Ga0373944_0025955 | 3300035089 | Bacteria | 1728 |
| 892 | Ga0373923_0000756 | 3300035111 | Bacteria | 8367 |
| 893 | Ga0373953_0014696 | 3300035117 | Bacteria | 2822 |
| 894 | Ga0373953_0097427 | 3300035117 | Bacteria | 1235 |
| 895 | Ga0373954_0006856 | 3300035118 | Bacteria | 4972 |
| 896 | Ga0373956_0001329 | 3300035119 | Bacteria | 10206 |
| 897 | Ga0373956_0023371 | 3300035119 | Bacteria | 2653 |
| 898 | Ga0373943_0057545 | 3300035170 | Bacteria | 1932 |
| 899 | Ga0373943_0089557 | 3300035170 | Bacteria | 1591 |
| 900 | Ga0373946_0054283 | 3300035171 | Bacteria | 1686 |
| 901 | Ga0373946_0096626 | 3300035171 | Bacteria | 1317 |
| 902 | Ga0373955_0000309 | 3300035172 | Bacteria | 20251 |
| 903 | Ga0373955_0272419 | 3300035172 | Bacteria | 1017 |
| 904 | Ga0373962_0069140 | 3300035242 | Bacteria | 1052 |
| 905 | Ga0373924_0001445 | 3300035410 | Bacteria | 7710 |
| 906 | Ga0373931_0017434 | 3300035691 | Bacteria | 3552 |
| 907 | Ga0373935_0001142 | 3300035692 | Bacteria | 14517 |
| 908 | Ga0373935_0058549 | 3300035692 | Bacteria | 2461 |
| 909 | Ga0373927_0134380 | 3300035695 | Bacteria | 1616 |
| 910 | Ga0373927_0160288 | 3300035695 | Bacteria | 1474 |
| 911 | Ga0373927_0238483 | 3300035695 | Bacteria | 1195 |
| 912 | Ga0373933_0000191 | 3300035724 | Bacteria | 40734 |
| 913 | Ga0373933_0002765 | 3300035724 | Bacteria | 9786 |
| 914 | Ga0373933_0266640 | 3300035724 | Bacteria | 1105 |
| 915 | Ga0373947_0036655 | 3300035725 | Bacteria | 2908 |
| 916 | Ga0373947_0236917 | 3300035725 | Bacteria | 1203 |
| 917 | Ga0373937_0000625 | 3300036401 | Bacteria | 31052 |
| 918 | Ga0373937_0063603 | 3300036401 | Bacteria | 3394 |
| 919 | Ga0373937_0616041 | 3300036401 | Bacteria | 1030 |
| 920 | Ga0373937_0662822 | 3300036401 | Bacteria | 989 |
| 921 | Ga0373925_0005112 | 3300037068 | Bacteria | 9823 |
| 922 | Ga0395899_0151372 | 3300037312 | Bacteria | 1644 |
| 923 | Ga0395905_0025260 | 3300037471 | Bacteria | 5602 |
| 924 | Ga0395901_0001770 | 3300038443 | Bacteria | 22280 |
| 925 | Ga0436365_0023278 | 3300039437 | Bacteria | 1070 |
| 926 | Ga0436365_0408308 | 3300039437 | Bacteria | 3423 |
| 927 | Ga0451804_0380477 | 3300041463 | Bacteria | 713 |
| 928 | Ga0439433_0015813 | 3300041999 | Bacteria | 1668 |
| 929 | Ga0439448_0036131 | 3300042005 | Bacteria | 1584 |
| 930 | Ga0439432_037604 | 3300042006 | Bacteria | 1544 |
| 931 | Ga0450896_011384 | 3300042133 | Bacteria | 1252 |
| 932 | Ga0439446_0009762 | 3300042156 | Bacteria | 2575 |
| 933 | Ga0439446_0029363 | 3300042156 | Bacteria | 1587 |
| 934 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 935 | Ga0451577_0003185 | 3300042876 | Bacteria | 18443 |
| 936 | Ga0451577_0083322 | 3300042876 | Bacteria | 2852 |
| 937 | Ga0451577_0141188 | 3300042876 | Bacteria | 2164 |
| 938 | Ga0451577_0524250 | 3300042876 | Bacteria | 1076 |
| 939 | Ga0453683_0033780 | 3300044673 | Bacteria | 3226 |
| 940 | Ga0466966_0001530 | 3300044684 | Bacteria | 14826 |
| 941 | Ga0466966_0006135 | 3300044684 | Bacteria | 7942 |
| 942 | Ga0466961_0042804 | 3300044693 | Bacteria | 2902 |
| 943 | Ga0466961_0160956 | 3300044693 | Bacteria | 1399 |
| 944 | Ga0466961_0204760 | 3300044693 | Bacteria | 1219 |
| 945 | Ga0466963_0055834 | 3300044694 | Bacteria | 2627 |
| 946 | Ga0453684_0026762 | 3300044712 | Bacteria | 8311 |
| 947 | Ga0453684_0062783 | 3300044712 | Bacteria | 4756 |
| 948 | Ga0466971_0087484 | 3300044719 | Bacteria | 1425 |
| 949 | Ga0466957_0076776 | 3300044842 | Bacteria | 2075 |
| 950 | Ga0466957_0209596 | 3300044842 | Bacteria | 1283 |
| 951 | Ga0466959_0016263 | 3300045049 | Bacteria | 5433 |
| 952 | Ga0466959_0049416 | 3300045049 | Bacteria | 3090 |
| 953 | Ga0451576_0153457 | 3300045051 | Bacteria | 2402 |
| 954 | Ga0451576_0237355 | 3300045051 | Bacteria | 1904 |
| 955 | Ga0451576_0510035 | 3300045051 | Bacteria | 1263 |
| 956 | Ga0466958_0185693 | 3300045836 | Bacteria | 1320 |
| 957 | Ga0466967_0065040 | 3300045976 | Bacteria | 3245 |
| 958 | Ga0466967_0821743 | 3300045976 | Bacteria | 923 |
| 959 | Ga0466967_1095808 | 3300045976 | Bacteria | 793 |
| 960 | Ga0495592_0001172 | 3300046454 | Bacteria | 18177 |
| 961 | Ga0495592_0009293 | 3300046454 | Bacteria | 7395 |
| 962 | Ga0495603_0003416 | 3300046455 | Bacteria | 9453 |
| 963 | Ga0495603_0043390 | 3300046455 | Bacteria | 2685 |
| 964 | Ga0495603_0076014 | 3300046455 | Bacteria | 1971 |
| 965 | Ga0495629_0009752 | 3300046459 | Bacteria | 7007 |
| 966 | Ga0495629_0019579 | 3300046459 | Bacteria | 4834 |
| 967 | Ga0495629_0042049 | 3300046459 | Bacteria | 3213 |
| 968 | Ga0495629_0048696 | 3300046459 | Bacteria | 2971 |
| 969 | Ga0495629_0073936 | 3300046459 | Bacteria | 2380 |
| 970 | Ga0495629_0077215 | 3300046459 | Bacteria | 2325 |
| 971 | Ga0495629_0128626 | 3300046459 | Bacteria | 1764 |
| 972 | Ga0495629_0223629 | 3300046459 | Bacteria | 1298 |
| 973 | Ga0495629_0266222 | 3300046459 | Bacteria | 1178 |
| 974 | Ga0495651_0000116 | 3300046462 | Bacteria | 59001 |
| 975 | Ga0495651_0011176 | 3300046462 | Bacteria | 6903 |
| 976 | Ga0495651_0017188 | 3300046462 | Bacteria | 5605 |
| 977 | Ga0495653_0000992 | 3300046463 | Bacteria | 21849 |
| 978 | Ga0495653_0007356 | 3300046463 | Bacteria | 9019 |
| 979 | Ga0495653_0026437 | 3300046463 | Bacteria | 4653 |
| 980 | Ga0495580_0016230 | 3300046472 | Bacteria | 5595 |
| 981 | Ga0495580_0047588 | 3300046472 | Bacteria | 3040 |
| 982 | Ga0495580_0087356 | 3300046472 | Bacteria | 2172 |
| 983 | Ga0495580_0113415 | 3300046472 | Bacteria | 1883 |
| 984 | Ga0495582_0004886 | 3300046473 | Bacteria | 7509 |
| 985 | Ga0495582_0010686 | 3300046473 | Bacteria | 5050 |
| 986 | Ga0495582_0036644 | 3300046473 | Bacteria | 2698 |
| 987 | Ga0495582_0050921 | 3300046473 | Bacteria | 2283 |
| 988 | Ga0495582_0150032 | 3300046473 | Bacteria | 1323 |
| 989 | Ga0495639_0004714 | 3300046475 | Bacteria | 5862 |
| 990 | Ga0495639_0019583 | 3300046475 | Bacteria | 2955 |
| 991 | Ga0495662_0035604 | 3300046476 | Bacteria | 2402 |
| 992 | Ga0495664_0013790 | 3300046477 | Bacteria | 4582 |
| 993 | Ga0495585_0144448 | 3300046492 | Bacteria | 1244 |
| 994 | Ga0495594_0005611 | 3300046499 | Bacteria | 6449 |
| 995 | Ga0495594_0007853 | 3300046499 | Bacteria | 5488 |
| 996 | Ga0495594_0010292 | 3300046499 | Bacteria | 4849 |
| 997 | Ga0495594_0012873 | 3300046499 | Bacteria | 4361 |
| 998 | Ga0495594_0020695 | 3300046499 | Bacteria | 3506 |
| 999 | Ga0495594_0140901 | 3300046499 | Bacteria | 1368 |
| 1000 | Ga0495594_0199284 | 3300046499 | Bacteria | 1141 |
| 1001 | Ga0495596_0010087 | 3300046500 | Bacteria | 4131 |
| 1002 | Ga0495608_0001013 | 3300046511 | Bacteria | 19794 |
| 1003 | Ga0495608_0033181 | 3300046511 | Bacteria | 3491 |
| 1004 | Ga0495608_0073497 | 3300046511 | Bacteria | 2229 |
| 1005 | Ga0495608_0103342 | 3300046511 | Bacteria | 1836 |
| 1006 | Ga0495618_0218814 | 3300046514 | Bacteria | 1202 |
| 1007 | Ga0495628_0000113 | 3300046516 | Bacteria | 65741 |
| 1008 | Ga0495630_0019876 | 3300046517 | Bacteria | 4944 |
| 1009 | Ga0495630_0048337 | 3300046517 | Bacteria | 3183 |
| 1010 | Ga0495630_0050774 | 3300046517 | Bacteria | 3104 |
| 1011 | Ga0495630_0094702 | 3300046517 | Bacteria | 2257 |
| 1012 | Ga0495663_0020324 | 3300046525 | Bacteria | 1905 |
| 1013 | Ga0495642_0274020 | 3300046528 | Bacteria | 739 |
| 1014 | Ga0495652_0001031 | 3300046529 | Bacteria | 31830 |
| 1015 | Ga0495652_0001095 | 3300046529 | Bacteria | 30639 |
| 1016 | Ga0495652_0123654 | 3300046529 | Bacteria | 2059 |
| 1017 | Ga0495652_0133218 | 3300046529 | Bacteria | 1964 |
| 1018 | Ga0495665_0002814 | 3300046531 | Bacteria | 9385 |
| 1019 | Ga0495665_0014539 | 3300046531 | Bacteria | 4244 |
| 1020 | Ga0495665_0023640 | 3300046531 | Bacteria | 3301 |
| 1021 | Ga0495665_0076291 | 3300046531 | Bacteria | 1764 |
| 1022 | Ga0495586_0015359 | 3300046535 | Bacteria | 4074 |
| 1023 | Ga0495586_0065516 | 3300046535 | Bacteria | 1980 |
| 1024 | Ga0495586_0095659 | 3300046535 | Bacteria | 1644 |
| 1025 | Ga0495587_0000143 | 3300046536 | Bacteria | 53480 |
| 1026 | Ga0495645_0001110 | 3300046543 | Bacteria | 18204 |
| 1027 | Ga0495645_0001766 | 3300046543 | Bacteria | 14712 |
| 1028 | Ga0495645_0334115 | 3300046543 | Bacteria | 980 |
| 1029 | Ga0495645_0461199 | 3300046543 | Bacteria | 800 |
| 1030 | Ga0495622_0052951 | 3300046557 | Bacteria | 1883 |
| 1031 | Ga0495633_0104185 | 3300046558 | Bacteria | 1316 |
| 1032 | Ga0495667_0001636 | 3300046559 | Bacteria | 14836 |
| 1033 | Ga0495667_0016331 | 3300046559 | Bacteria | 5016 |
| 1034 | Ga0495667_0024990 | 3300046559 | Bacteria | 4026 |
| 1035 | Ga0495667_0073783 | 3300046559 | Bacteria | 2222 |
| 1036 | Ga0495635_0000158 | 3300046663 | Bacteria | 41599 |
| 1037 | Ga0495635_0054906 | 3300046663 | Bacteria | 2744 |
| 1038 | Ga0495659_0053455 | 3300046664 | Bacteria | 1476 |
| 1039 | Ga0495659_0087973 | 3300046664 | Bacteria | 1189 |
| 1040 | Ga0495659_0123527 | 3300046664 | Bacteria | 1021 |
| 1041 | Ga0495659_0143222 | 3300046664 | Bacteria | 955 |
| 1042 | Ga0495588_0030623 | 3300046674 | Bacteria | 2705 |
| 1043 | Ga0495588_0297274 | 3300046674 | Bacteria | 850 |
| 1044 | Ga0495657_0000476 | 3300046675 | Bacteria | 37717 |
| 1045 | Ga0495657_0049025 | 3300046675 | Bacteria | 2847 |
| 1046 | Ga0495657_0059269 | 3300046675 | Bacteria | 2539 |
| 1047 | Ga0495657_0113082 | 3300046675 | Bacteria | 1718 |
| 1048 | Ga0495599_0000553 | 3300046678 | Bacteria | 21358 |
| 1049 | Ga0495599_0010652 | 3300046678 | Bacteria | 5627 |
| 1050 | Ga0495599_0015785 | 3300046678 | Bacteria | 4688 |
| 1051 | Ga0495599_0073902 | 3300046678 | Bacteria | 2128 |
| 1052 | Ga0495623_0000017 | 3300046679 | Bacteria | 108556 |
| 1053 | Ga0495623_0017452 | 3300046679 | Bacteria | 4637 |
| 1054 | Ga0495623_0101934 | 3300046679 | Bacteria | 1748 |
| 1055 | Ga0495623_0108146 | 3300046679 | Bacteria | 1688 |
| 1056 | Ga0495646_0002016 | 3300046680 | Bacteria | 12293 |
| 1057 | Ga0495646_0016342 | 3300046680 | Bacteria | 4709 |
| 1058 | Ga0495646_0089993 | 3300046680 | Bacteria | 1774 |
| 1059 | Ga0495658_0002526 | 3300046683 | Bacteria | 9205 |
| 1060 | Ga0495658_0166410 | 3300046683 | Bacteria | 1362 |
| 1061 | Ga0495658_0285154 | 3300046683 | Bacteria | 1043 |
| 1062 | Ga0495658_0305619 | 3300046683 | Bacteria | 1006 |
| 1063 | Ga0495669_0171122 | 3300046684 | Bacteria | 1033 |
| 1064 | Ga0495613_0060691 | 3300046689 | Bacteria | 2769 |
| 1065 | Ga0495613_0067704 | 3300046689 | Bacteria | 2606 |
| 1066 | Ga0495613_0068168 | 3300046689 | Bacteria | 2595 |
| 1067 | Ga0495613_0077081 | 3300046689 | Bacteria | 2425 |
| 1068 | Ga0495670_0054140 | 3300046691 | Bacteria | 2010 |
| 1069 | Ga0495600_0000063 | 3300046809 | Bacteria | 61349 |
| 1070 | Ga0495600_0043058 | 3300046809 | Bacteria | 2943 |
| 1071 | Ga0495600_0245756 | 3300046809 | Bacteria | 1139 |
| 1072 | Ga0495581_0010867 | 3300047315 | Bacteria | 5264 |
| 1073 | Ga0495581_0022768 | 3300047315 | Bacteria | 3628 |
| 1074 | Ga0495604_0000017 | 3300047317 | Bacteria | 192029 |
| 1075 | Ga0495604_0021369 | 3300047317 | Bacteria | 5167 |
| 1076 | Ga0495604_0104964 | 3300047317 | Bacteria | 2069 |
| 1077 | Ga0495636_0119308 | 3300047318 | Bacteria | 1166 |
| 1078 | Ga0495674_0003779 | 3300047319 | Bacteria | 14722 |
| 1079 | Ga0495674_0014556 | 3300047319 | Bacteria | 7360 |
| 1080 | Ga0495674_0022976 | 3300047319 | Bacteria | 5745 |
| 1081 | Ga0495672_0004623 | 3300047320 | Bacteria | 11171 |
| 1082 | Ga0495676_0257331 | 3300047321 | Bacteria | 1189 |
| 1083 | Ga0495680_0007844 | 3300047322 | Bacteria | 9746 |
| 1084 | Ga0495680_0013035 | 3300047322 | Bacteria | 7271 |
| 1085 | Ga0495680_0627083 | 3300047322 | Bacteria | 717 |
| 1086 | Ga0495675_0079198 | 3300047444 | Bacteria | 2069 |
| 1087 | Ga0495675_0129471 | 3300047444 | Bacteria | 1569 |
| 1088 | Ga0495675_0170389 | 3300047444 | Bacteria | 1337 |
| 1089 | Ga0495684_0000095 | 3300047471 | Bacteria | 62460 |
| 1090 | Ga0495684_0023565 | 3300047471 | Bacteria | 4732 |
| 1091 | Ga0495684_0026626 | 3300047471 | Bacteria | 4444 |
| 1092 | Ga0495684_0071242 | 3300047471 | Bacteria | 2641 |
| 1093 | Ga0495593_0020541 | 3300047673 | Bacteria | 3698 |
| 1094 | Ga0495602_0001119 | 3300048088 | Bacteria | 26275 |
| 1095 | Ga0495602_0013466 | 3300048088 | Bacteria | 8359 |
| 1096 | Ga0496100_0109226 | 3300048903 | Bacteria | 1919 |
| 1097 | Ga0496101_0056945 | 3300048904 | Bacteria | 2826 |
| 1098 | Ga0496101_0125918 | 3300048904 | Bacteria | 1941 |
| 1099 | Ga0496104_0103483 | 3300048907 | Bacteria | 2728 |
| 1100 | Ga0496105_0059694 | 3300048908 | Bacteria | 3147 |
| 1101 | Ga0496105_0071848 | 3300048908 | Bacteria | 2860 |
| 1102 | Ga0496106_0003759 | 3300048909 | Bacteria | 11316 |
| 1103 | Ga0496106_0064193 | 3300048909 | Bacteria | 2793 |
| 1104 | Ga0496106_0157904 | 3300048909 | Bacteria | 1792 |
| 1105 | Ga0496107_0134588 | 3300048910 | Bacteria | 1826 |
| 1106 | Ga0496107_0387268 | 3300048910 | Bacteria | 1040 |
| 1107 | Ga0496108_0430642 | 3300048911 | Bacteria | 1152 |
| 1108 | Ga0496112_0002541 | 3300048915 | Bacteria | 14732 |
| 1109 | Ga0496112_0043501 | 3300048915 | Bacteria | 4397 |
| 1110 | Ga0496112_0104391 | 3300048915 | Bacteria | 2804 |
| 1111 | Ga0496112_0248569 | 3300048915 | Bacteria | 1730 |
| 1112 | Ga0496113_0016753 | 3300048916 | Bacteria | 5069 |
| 1113 | Ga0496113_0156046 | 3300048916 | Bacteria | 1802 |
| 1114 | Ga0496114_0136082 | 3300048917 | Bacteria | 2124 |
| 1115 | Ga0496115_0052769 | 3300048918 | Bacteria | 3262 |
| 1116 | Ga0496115_0082370 | 3300048918 | Bacteria | 2621 |
| 1117 | Ga0496115_0376515 | 3300048918 | Bacteria | 1155 |
| 1118 | Ga0501304_000552 | 3300049160 | Bacteria | 2011 |
| 1119 | Ga0501291_018783 | 3300049514 | Bacteria | 1079 |
| 1120 | Ga0501292_015075 | 3300049515 | Bacteria | 1205 |
| 1121 | Ga0501299_013743 | 3300049522 | Bacteria | 1400 |
| 1122 | Ga0501314_000038 | 3300049530 | Bacteria | 5733 |
| 1123 | Ga0501031_0036052 | 3300049568 | Bacteria | 3226 |
| 1124 | Ga0501031_0182846 | 3300049568 | Bacteria | 1369 |
| 1125 | Ga0501031_0417637 | 3300049568 | Bacteria | 867 |
| 1126 | Ga0501032_0082763 | 3300049569 | Bacteria | 2135 |
| 1127 | Ga0501032_0184321 | 3300049569 | Bacteria | 1366 |
| 1128 | Ga0501034_0220989 | 3300049571 | Bacteria | 1847 |
| 1129 | Ga0501034_0470966 | 3300049571 | Bacteria | 1172 |
| 1130 | Ga0501036_0131789 | 3300049572 | Bacteria | 2110 |
| 1131 | Ga0501037_0036525 | 3300049573 | Bacteria | 3621 |
| 1132 | Ga0501037_0252132 | 3300049573 | Bacteria | 1235 |
| 1133 | Ga0501038_0011902 | 3300049574 | Bacteria | 7941 |
| 1134 | Ga0501038_0029198 | 3300049574 | Bacteria | 4890 |
| 1135 | Ga0501039_0103131 | 3300049575 | Bacteria | 2227 |
| 1136 | Ga0501039_0165564 | 3300049575 | Bacteria | 1738 |
| 1137 | Ga0501040_0040969 | 3300049576 | Bacteria | 3154 |
| 1138 | Ga0501040_0080203 | 3300049576 | Bacteria | 2260 |
| 1139 | Ga0501040_0176671 | 3300049576 | Bacteria | 1513 |
| 1140 | Ga0501040_0383694 | 3300049576 | Bacteria | 1008 |
| 1141 | Ga0501041_0023985 | 3300049577 | Bacteria | 3660 |
| 1142 | Ga0501041_0227281 | 3300049577 | Bacteria | 1171 |
| 1143 | Ga0501042_0119003 | 3300049578 | Bacteria | 1901 |
| 1144 | Ga0501043_0014332 | 3300049579 | Bacteria | 6204 |
| 1145 | Ga0501043_0047600 | 3300049579 | Bacteria | 3371 |
| 1146 | Ga0501046_0028687 | 3300049580 | Bacteria | 4531 |
| 1147 | Ga0501046_0112744 | 3300049580 | Bacteria | 2076 |
| 1148 | Ga0501046_0186025 | 3300049580 | Bacteria | 1551 |
| 1149 | Ga0501047_0019591 | 3300049581 | Bacteria | 6492 |
| 1150 | Ga0501047_0029942 | 3300049581 | Bacteria | 5247 |
| 1151 | Ga0501047_0291019 | 3300049581 | Bacteria | 1477 |
| 1152 | Ga0501047_0405438 | 3300049581 | Bacteria | 1196 |
| 1153 | Ga0501070_0042534 | 3300049586 | Bacteria | 3784 |
| 1154 | Ga0501070_0069675 | 3300049586 | Bacteria | 2912 |
| 1155 | Ga0501070_0097328 | 3300049586 | Bacteria | 2434 |
| 1156 | Ga0501071_0238684 | 3300049587 | Bacteria | 1370 |
| 1157 | Ga0501071_0421544 | 3300049587 | Bacteria | 1020 |
| 1158 | Ga0501072_0010585 | 3300049588 | Bacteria | 7024 |
| 1159 | Ga0501074_0246973 | 3300049590 | Bacteria | 1269 |
| 1160 | Ga0501075_0078651 | 3300049591 | Bacteria | 2496 |
| 1161 | Ga0501076_0069214 | 3300049592 | Bacteria | 2820 |
| 1162 | Ga0501076_0244716 | 3300049592 | Bacteria | 1467 |
| 1163 | Ga0501209_057742 | 3300049656 | Bacteria | 1075 |
| 1164 | Ga0501217_010354 | 3300049661 | Bacteria | 2041 |
| 1165 | Ga0501223_008477 | 3300049663 | Bacteria | 2097 |
| 1166 | Ga0501224_001238 | 3300049664 | Bacteria | 3359 |
| 1167 | Ga0501227_018036 | 3300049665 | Bacteria | 1598 |
| 1168 | Ga0501228_005012 | 3300049666 | Bacteria | 1159 |
| 1169 | Ga0501230_009571 | 3300049667 | Bacteria | 1494 |
| 1170 | Ga0501233_004905 | 3300049668 | Bacteria | 2474 |
| 1171 | Ga0501235_007524 | 3300049669 | Bacteria | 2370 |
| 1172 | Ga0501249_012864 | 3300049679 | Bacteria | 1773 |
| 1173 | Ga0501249_054659 | 3300049679 | Bacteria | 919 |
| 1174 | Ga0501258_005248 | 3300049687 | Bacteria | 1251 |
| 1175 | Ga0501221_041781 | 3300049704 | Bacteria | 1002 |
| 1176 | Ga0501225_0004791 | 3300049705 | Bacteria | 4004 |
| 1177 | Ga0501234_001400 | 3300049707 | Bacteria | 3791 |
| 1178 | Ga0501245_012427 | 3300049708 | Bacteria | 1249 |
| 1179 | Ga0501079_0019559 | 3300049741 | Bacteria | 5172 |
| 1180 | Ga0501079_0035622 | 3300049741 | Bacteria | 3832 |
| 1181 | Ga0501080_0443846 | 3300049742 | Bacteria | 1164 |
| 1182 | Ga0501080_0570580 | 3300049742 | Bacteria | 1007 |
| 1183 | Ga0501081_0148167 | 3300049743 | Bacteria | 1685 |
| 1184 | Ga0501081_0314868 | 3300049743 | Bacteria | 1149 |
| 1185 | Ga0501083_0309541 | 3300049744 | Bacteria | 1027 |
| 1186 | Ga0501266_003064 | 3300049763 | Bacteria | 2080 |
| 1187 | Ga0501268_008523 | 3300049765 | Bacteria | 1555 |
| 1188 | Ga0501274_002181 | 3300049771 | Bacteria | 1526 |
| 1189 | Ga0501283_008388 | 3300049779 | Bacteria | 1488 |
| 1190 | Ga0501035_0052570 | 3300049822 | Bacteria | 3645 |
| 1191 | Ga0501035_0204036 | 3300049822 | Bacteria | 1694 |
| 1192 | Ga0501035_0288383 | 3300049822 | Bacteria | 1386 |
| 1193 | Ga0501044_0007223 | 3300049823 | Bacteria | 12218 |
| 1194 | Ga0501044_0064096 | 3300049823 | Bacteria | 3753 |
| 1195 | Ga0501044_0152540 | 3300049823 | Bacteria | 2292 |
| 1196 | Ga0501045_0032763 | 3300049824 | Bacteria | 3766 |
| 1197 | Ga0501212_001652 | 3300049851 | Bacteria | 2552 |
| 1198 | nmdc:mga0k408_122928_c1 | 3300050493 | Bacteria | 1538 |
| 1199 | nmdc:mga05p37_151379_c1 | 3300050507 | Bacteria | 2837 |
| 1200 | nmdc:mga05p37_57467_c1 | 3300050507 | Bacteria | 4792 |
| 1201 | nmdc:mga09592_50694_c1 | 3300050508 | Bacteria | 3501 |
| 1202 | nmdc:mga09592_74630_c1 | 3300050508 | Bacteria | 2882 |
| 1203 | nmdc:mga0qj67_75775_c1 | 3300050509 | Bacteria | 2690 |
| 1204 | nmdc:mga0qj67_77954_c1 | 3300050509 | Bacteria | 2652 |
| 1205 | nmdc:mga0qj67_87554_c1 | 3300050509 | Bacteria | 2500 |
| 1206 | nmdc:mga0qj67_90728_c1 | 3300050509 | Bacteria | 2455 |
| 1207 | nmdc:mga06r32_259645_c1 | 3300050510 | Bacteria | 1725 |
| 1208 | nmdc:mga06r32_303714_c1 | 3300050510 | Bacteria | 1582 |
| 1209 | nmdc:mga06r32_310188_c1 | 3300050510 | Bacteria | 1563 |
| 1210 | nmdc:mga06r32_6558_c1 | 3300050510 | Bacteria | 10457 |
| 1211 | nmdc:mga08y16_1022_c1 | 3300050511 | Bacteria | 27431 |
| 1212 | nmdc:mga08y16_281933_c1 | 3300050511 | Bacteria | 1714 |
| 1213 | nmdc:mga08y16_46413_c1 | 3300050511 | Bacteria | 4548 |
| 1214 | nmdc:mga08y16_597362_c1 | 3300050511 | Bacteria | 1113 |
| 1215 | nmdc:mga0n895_21843_c1 | 3300050512 | Bacteria | 5991 |
| 1216 | nmdc:mga0rr50_135710_c1 | 3300050513 | Bacteria | 1974 |
| 1217 | nmdc:mga0a205_17997_c1 | 3300050515 | Bacteria | 6635 |
| 1218 | nmdc:mga0a205_26534_c1 | 3300050515 | Bacteria | 5526 |
| 1219 | nmdc:mga0a205_27367_c1 | 3300050515 | Bacteria | 5446 |
| 1220 | Ga0495601_0102656 | 3300053077 | Bacteria | 1848 |
| 1221 | Ga0495612_0004309 | 3300053078 | Bacteria | 5903 |
| 1222 | Ga0495619_0002351 | 3300053085 | Bacteria | 12447 |
| 1223 | Ga0495619_0062582 | 3300053085 | Bacteria | 2477 |
| 1224 | Ga0501084_0221154 | 3300054114 | Bacteria | 1598 |
| 1225 | Ga0501082_0071941 | 3300060353 | Bacteria | 2978 |
| 1226 | Ga0501082_0086997 | 3300060353 | Bacteria | 2696 |
| 1227 | Ga0466962_0078952 | 3300061719 | Bacteria | 1573 |
| 1228 | Ga0530510_0055415 | 3300061734 | Bacteria | 2864 |
| 1229 | Ga0065712_10220080 | |||
| 1230 | LJQas_1006187 | |||
| 1231 | Ga0055536_1006040 | |||
| 1232 | Ga0058863_10017357 | |||
| 1233 | Ga0058863_10086968 | |||
| 1234 | Ga0058863_10124246 | |||
| 1235 | Ga0058863_11781841 | |||
| 1236 | Ga0058861_11830918 | |||
| 1237 | Ga0058861_12045205 | |||
| 1238 | Ga0058861_12068682 | |||
| 1239 | Ga0058861_12070180 | |||
| 1240 | Ga0058862_12797539 | |||
| 1241 | Ga0058862_12888623 | |||
| 1242 | Ga0065165_1000131 | |||
| 1243 | Ga0065704_10014908 | |||
| 1244 | Ga0065712_10130506 | |||
| 1245 | Ga0065715_10135391 | |||
| 1246 | Ga0065707_10024835 | |||
| 1247 | Ga0070658_10030953 | |||
| 1248 | Ga0070658_10045112 | |||
| 1249 | Ga0070658_10120109 | |||
| 1250 | Ga0070658_10171352 | |||
| 1251 | Ga0070658_10506187 | |||
| 1252 | Ga0070676_10000896 | |||
| 1253 | Ga0070676_10010363 | |||
| 1254 | Ga0070676_10141630 | |||
| 1255 | Ga0070683_100003340 | |||
| 1256 | Ga0070683_100006197 | |||
| 1257 | Ga0070683_100046570 | |||
| 1258 | Ga0070683_100058071 | |||
| 1259 | Ga0070683_100071412 | |||
| 1260 | Ga0070683_100130283 | |||
| 1261 | Ga0070683_100163138 | |||
| 1262 | Ga0070683_100253323 | |||
| 1263 | Ga0070683_100417731 | |||
| 1264 | Ga0070690_100021133 | |||
| 1265 | Ga0070690_100054901 | |||
| 1266 | Ga0070690_100173738 | |||
| 1267 | Ga0070670_100016207 | |||
| 1268 | Ga0070670_100095610 | |||
| 1269 | Ga0070670_100240332 | |||
| 1270 | Ga0070677_10107002 | |||
| 1271 | Ga0068869_100003669 | |||
| 1272 | Ga0068869_100057193 | |||
| 1273 | Ga0068869_100148652 | |||
| 1274 | Ga0070666_10093653 | |||
| 1275 | Ga0070666_10154722 | |||
| 1276 | Ga0070680_100004063 | |||
| 1277 | Ga0070680_100005527 | |||
| 1278 | Ga0070680_100025720 | |||
| 1279 | Ga0070680_100037118 | |||
| 1280 | Ga0070680_100048050 | |||
| 1281 | Ga0070680_100062828 | |||
| 1282 | Ga0070680_100067284 | |||
| 1283 | Ga0070680_100094132 | |||
| 1284 | Ga0070680_100103171 | |||
| 1285 | Ga0070680_100106030 | |||
| 1286 | Ga0070680_100148940 | |||
| 1287 | Ga0070680_100163795 | |||
| 1288 | Ga0070680_100175503 | |||
| 1289 | Ga0070680_100179989 | |||
| 1290 | Ga0070680_100203783 | |||
| 1291 | Ga0070680_100309742 | |||
| 1292 | Ga0070682_100026044 | |||
| 1293 | Ga0070682_100029919 | |||
| 1294 | Ga0070682_100057682 | |||
| 1295 | Ga0070682_100060558 | |||
| 1296 | Ga0070682_100096638 | |||
| 1297 | Ga0070682_100235067 | |||
| 1298 | Ga0068868_100043273 | |||
| 1299 | Ga0068868_100141727 | |||
| 1300 | Ga0068868_100229320 | |||
| 1301 | Ga0068868_100334057 | |||
| 1302 | Ga0070660_100143024 | |||
| 1303 | Ga0070660_100293209 | |||
| 1304 | Ga0070660_100301949 | |||
| 1305 | Ga0070689_100012783 | |||
| 1306 | Ga0070689_100031628 | |||
| 1307 | Ga0070689_100040239 | |||
| 1308 | Ga0070689_100154947 | |||
| 1309 | Ga0070691_10042806 | |||
| 1310 | Ga0070691_10050992 | |||
| 1311 | Ga0070687_100026607 | |||
| 1312 | Ga0070661_100013855 | |||
| 1313 | Ga0070661_100028453 | |||
| 1314 | Ga0070661_100029610 | |||
| 1315 | Ga0070661_100029667 | |||
| 1316 | Ga0070661_100063709 | |||
| 1317 | Ga0070661_100216264 | |||
| 1318 | Ga0070661_100249809 | |||
| 1319 | Ga0070661_100253420 | |||
| 1320 | Ga0070692_10020992 | |||
| 1321 | Ga0070692_10030572 | |||
| 1322 | Ga0070692_10070694 | |||
| 1323 | Ga0070668_100000990 | |||
| 1324 | Ga0070668_100017369 | |||
| 1325 | Ga0070668_100044436 | |||
| 1326 | Ga0070668_100089192 | |||
| 1327 | Ga0070669_100002074 | |||
| 1328 | Ga0070669_100025980 | |||
| 1329 | Ga0070669_100066368 | |||
| 1330 | Ga0070675_100003059 | |||
| 1331 | Ga0070675_100006526 | |||
| 1332 | Ga0070675_100058013 | |||
| 1333 | Ga0070671_100072541 | |||
| 1334 | Ga0070671_100119817 | |||
| 1335 | Ga0070671_100159410 | |||
| 1336 | Ga0070674_100001338 | |||
| 1337 | Ga0070674_100075414 | |||
| 1338 | Ga0070674_100137876 | |||
| 1339 | Ga0070674_100444582 | |||
| 1340 | Ga0070673_100006677 | |||
| 1341 | Ga0070673_100024226 | |||
| 1342 | Ga0070673_100153788 | |||
| 1343 | Ga0070673_100187913 | |||
| 1344 | Ga0070673_100329863 | |||
| 1345 | Ga0070688_100028355 | |||
| 1346 | Ga0070688_100037041 | |||
| 1347 | Ga0070659_100002785 | |||
| 1348 | Ga0070659_100012581 | |||
| 1349 | Ga0070659_100108977 | |||
| 1350 | Ga0070659_100116694 | |||
| 1351 | Ga0070659_100185248 | |||
| 1352 | Ga0070667_100043630 | |||
| 1353 | Ga0070667_100093065 | |||
| 1354 | Ga0070667_100111431 | |||
| 1355 | Ga0070667_100128161 | |||
| 1356 | Ga0070667_100170052 | |||
| 1357 | Ga0070667_100228951 | |||
| 1358 | Ga0070703_10041333 | |||
| 1359 | Ga0070709_10006385 | |||
| 1360 | Ga0070714_100016130 | |||
| 1361 | Ga0070714_100018849 | |||
| 1362 | Ga0070714_100139880 | |||
| 1363 | Ga0070714_100200652 | |||
| 1364 | Ga0070713_100008004 | |||
| 1365 | Ga0070713_100035372 | |||
| 1366 | Ga0070713_100065550 | |||
| 1367 | Ga0070713_100286532 | |||
| 1368 | Ga0070710_10016585 | |||
| 1369 | Ga0070710_10064387 | |||
| 1370 | Ga0070701_10194692 | |||
| 1371 | Ga0070711_100025951 | |||
| 1372 | Ga0070711_100036243 | |||
| 1373 | Ga0070711_100079312 | |||
| 1374 | Ga0070705_100003623 | |||
| 1375 | Ga0070705_100325140 | |||
| 1376 | Ga0070700_100204357 | |||
| 1377 | Ga0070700_100443977 | |||
| 1378 | Ga0070694_100111310 | |||
| 1379 | Ga0070708_100001661 | |||
| 1380 | Ga0070708_100018839 | |||
| 1381 | Ga0070708_100020893 | |||
| 1382 | Ga0070708_100338186 | |||
| 1383 | Ga0070663_100005346 | |||
| 1384 | Ga0070678_100006200 | |||
| 1385 | Ga0070678_100053888 | |||
| 1386 | Ga0070662_100006245 | |||
| 1387 | Ga0070662_100011148 | |||
| 1388 | Ga0070662_100047159 | |||
| 1389 | Ga0070662_100054587 | |||
| 1390 | Ga0070662_100059628 | |||
| 1391 | Ga0070662_100118516 | |||
| 1392 | Ga0070662_100251955 | |||
| 1393 | Ga0070681_10001182 | |||
| 1394 | Ga0070681_10030030 | |||
| 1395 | Ga0070681_10044619 | |||
| 1396 | Ga0070681_10053922 | |||
| 1397 | Ga0070681_10067823 | |||
| 1398 | Ga0070681_10078280 | |||
| 1399 | Ga0070681_10153736 | |||
| 1400 | Ga0070681_10160574 | |||
| 1401 | Ga0070681_10171280 | |||
| 1402 | Ga0070681_10200760 | |||
| 1403 | Ga0070681_10252646 | |||
| 1404 | Ga0070681_10402893 | |||
| 1405 | Ga0070681_10505405 | |||
| 1406 | Ga0070681_10515824 | |||
| 1407 | Ga0070681_10585687 | |||
| 1408 | Ga0070681_10662384 | |||
| 1409 | Ga0070681_10716662 | |||
| 1410 | Ga0068867_100006780 | |||
| 1411 | Ga0068867_100037348 | |||
| 1412 | Ga0068867_100079269 | |||
| 1413 | Ga0068867_100158633 | |||
| 1414 | Ga0070685_10086131 | |||
| 1415 | Ga0070706_100115208 | |||
| 1416 | Ga0070706_100188726 | |||
| 1417 | Ga0070707_100071326 | |||
| 1418 | Ga0070698_100001954 | |||
| 1419 | Ga0070698_100024253 | |||
| 1420 | Ga0070698_100052230 | |||
| 1421 | Ga0070698_100115071 | |||
| 1422 | Ga0070698_100189783 | |||
| 1423 | Ga0070699_100017326 | |||
| 1424 | Ga0070699_100243299 | |||
| 1425 | Ga0070699_100248507 | |||
| 1426 | Ga0070699_100303757 | |||
| 1427 | Ga0070679_100000601 | |||
| 1428 | Ga0070679_100001848 | |||
| 1429 | Ga0070679_100019482 | |||
| 1430 | Ga0070679_100023697 | |||
| 1431 | Ga0070679_100038523 | |||
| 1432 | Ga0070679_100052627 | |||
| 1433 | Ga0070679_100068775 | |||
| 1434 | Ga0070679_100091847 | |||
| 1435 | Ga0070679_100095030 | |||
| 1436 | Ga0070679_100113323 | |||
| 1437 | Ga0070679_100113336 | |||
| 1438 | Ga0070679_100165137 | |||
| 1439 | Ga0070679_100249770 | |||
| 1440 | Ga0070679_100257749 | |||
| 1441 | Ga0070684_100002577 | |||
| 1442 | Ga0070684_100005718 | |||
| 1443 | Ga0070684_100041533 | |||
| 1444 | Ga0070684_100066458 | |||
| 1445 | Ga0070684_100072750 | |||
| 1446 | Ga0070684_100092190 | |||
| 1447 | Ga0070684_100106633 | |||
| 1448 | Ga0070684_100152966 | |||
| 1449 | Ga0070684_100301363 | |||
| 1450 | Ga0070684_100302271 | |||
| 1451 | Ga0070684_100349691 | |||
| 1452 | Ga0070697_100190886 | |||
| 1453 | Ga0068853_100040762 | |||
| 1454 | Ga0068853_100096330 | |||
| 1455 | Ga0068853_100203663 | |||
| 1456 | Ga0068853_100205913 | |||
| 1457 | Ga0068853_100214746 | |||
| 1458 | Ga0070672_100003949 | |||
| 1459 | Ga0070672_100038933 | |||
| 1460 | Ga0070672_100061495 | |||
| 1461 | Ga0070672_100079274 | |||
| 1462 | Ga0070686_100059565 | |||
| 1463 | Ga0070686_100158982 | |||
| 1464 | Ga0070686_100171206 | |||
| 1465 | Ga0070686_100215576 | |||
| 1466 | Ga0070695_100006164 | |||
| 1467 | Ga0070695_100013525 | |||
| 1468 | Ga0070695_100401927 | |||
| 1469 | Ga0070696_100000402 | |||
| 1470 | Ga0070696_100004370 | |||
| 1471 | Ga0070696_100022063 | |||
| 1472 | Ga0070696_100111425 | |||
| 1473 | Ga0070693_100054124 | |||
| 1474 | Ga0070693_100075365 | |||
| 1475 | Ga0070665_100028793 | |||
| 1476 | Ga0070665_100124547 | |||
| 1477 | Ga0070665_100230766 | |||
| 1478 | Ga0070704_100212348 | |||
| 1479 | Ga0068855_100008032 | |||
| 1480 | Ga0068855_100063431 | |||
| 1481 | Ga0068855_100075666 | |||
| 1482 | Ga0068855_100132631 | |||
| 1483 | Ga0068855_100167043 | |||
| 1484 | Ga0068855_100257123 | |||
| 1485 | Ga0068855_100269245 | |||
| 1486 | Ga0068855_100466223 | |||
| 1487 | Ga0068855_100597234 | |||
| 1488 | Ga0068855_100622768 | |||
| 1489 | Ga0068855_100886266 | |||
| 1490 | Ga0070664_100008033 | |||
| 1491 | Ga0070664_100113420 | |||
| 1492 | Ga0070664_100145371 | |||
| 1493 | Ga0070664_100229505 | |||
| 1494 | Ga0070664_100337824 | |||
| 1495 | Ga0068857_100009735 | |||
| 1496 | Ga0068857_100015888 | |||
| 1497 | Ga0068857_100024265 | |||
| 1498 | Ga0068857_100054772 | |||
| 1499 | Ga0068857_100067276 | |||
| 1500 | Ga0068857_100068315 | |||
| 1501 | Ga0068857_100292587 | |||
| 1502 | Ga0068854_100000444 | |||
| 1503 | Ga0068854_100008727 | |||
| 1504 | Ga0068854_100013720 | |||
| 1505 | Ga0068854_100051465 | |||
| 1506 | Ga0068854_100585640 | |||
| 1507 | Ga0068854_100625852 | |||
| 1508 | Ga0068856_100073182 | |||
| 1509 | Ga0068856_100088427 | |||
| 1510 | Ga0068856_100250348 | |||
| 1511 | Ga0068856_100262205 | |||
| 1512 | Ga0070702_100047710 | |||
| 1513 | Ga0068852_100009981 | |||
| 1514 | Ga0068852_100029062 | |||
| 1515 | Ga0068852_100068754 | |||
| 1516 | Ga0068852_100238569 | |||
| 1517 | Ga0068852_100379756 | |||
| 1518 | Ga0068852_100439541 | |||
| 1519 | Ga0068859_100017117 | |||
| 1520 | Ga0068859_100039441 | |||
| 1521 | Ga0068859_100044463 | |||
| 1522 | Ga0068859_100075086 | |||
| 1523 | Ga0068859_100287128 | |||
| 1524 | Ga0068864_100012293 | |||
| 1525 | Ga0068866_10000625 | |||
| 1526 | Ga0068861_100028185 | |||
| 1527 | Ga0068861_100159667 | |||
| 1528 | Ga0068861_100470097 | |||
| 1529 | Ga0068851_10035251 | |||
| 1530 | Ga0068851_10036179 | |||
| 1531 | Ga0068870_10011998 | |||
| 1532 | Ga0068870_10055691 | |||
| 1533 | Ga0068863_100023269 | |||
| 1534 | Ga0068863_100029946 | |||
| 1535 | Ga0068863_100119013 | |||
| 1536 | Ga0068863_100587566 | |||
| 1537 | Ga0068858_100083441 | |||
| 1538 | Ga0068858_100181183 | |||
| 1539 | Ga0068858_100327658 | |||
| 1540 | Ga0068860_100025031 | |||
| 1541 | Ga0068860_100057895 | |||
| 1542 | Ga0068860_100180185 | |||
| 1543 | Ga0068862_100003483 | |||
| 1544 | Ga0081539_10001506 | |||
| 1545 | Ga0081539_10023333 | |||
| 1546 | Ga0070717_10018982 | |||
| 1547 | Ga0070717_10122418 | |||
| 1548 | Ga0070716_100014957 | |||
| 1549 | Ga0070712_100039564 | |||
| 1550 | Ga0070712_100139555 | |||
| 1551 | Ga0070712_100229717 | |||
| 1552 | Ga0097621_100453116 | |||
| 1553 | Ga0068871_100103372 | |||
| 1554 | Ga0068871_100143085 | |||
| 1555 | Ga0075428_100044329 | |||
| 1556 | Ga0075428_100091987 | |||
| 1557 | Ga0075430_100040306 | |||
| 1558 | Ga0075430_100054598 | |||
| 1559 | Ga0075430_100057895 | |||
| 1560 | Ga0075430_100081302 | |||
| 1561 | Ga0075430_100100001 | |||
| 1562 | Ga0075431_100066106 | |||
| 1563 | Ga0075431_100085342 | |||
| 1564 | Ga0075431_100089199 | |||
| 1565 | Ga0075431_100130129 | |||
| 1566 | Ga0075431_100341131 | |||
| 1567 | Ga0075433_10008454 | |||
| 1568 | Ga0075433_10017586 | |||
| 1569 | Ga0075434_100293178 | |||
| 1570 | Ga0075429_100019213 | |||
| 1571 | Ga0075429_100055132 | |||
| 1572 | Ga0075429_100181478 | |||
| 1573 | Ga0068865_100047651 | |||
| 1574 | Ga0068865_100050694 | |||
| 1575 | Ga0068865_100438500 | |||
| 1576 | Ga0075436_100011027 | |||
| 1577 | Ga0075436_100149178 | |||
| 1578 | Ga0097620_100017115 | |||
| 1579 | Ga0097620_100039441 | |||
| 1580 | Ga0097620_100044456 | |||
| 1581 | Ga0097620_100075085 | |||
| 1582 | Ga0097620_100287131 | |||
| 1583 | Ga0075435_100151205 | |||
| 1584 | Ga0099795_10031621 | |||
| 1585 | Ga0105240_10053668 | |||
| 1586 | Ga0105240_10056546 | |||
| 1587 | Ga0105240_10101231 | |||
| 1588 | Ga0105240_10123211 | |||
| 1589 | Ga0105240_10171625 | |||
| 1590 | Ga0105240_10337410 | |||
| 1591 | Ga0105240_10741251 | |||
| 1592 | Ga0111539_10070760 | |||
| 1593 | Ga0111539_10080966 | |||
| 1594 | Ga0111539_10454897 | |||
| 1595 | Ga0105245_10078468 | |||
| 1596 | Ga0105245_10131671 | |||
| 1597 | Ga0105245_10155732 | |||
| 1598 | Ga0105245_10169504 | |||
| 1599 | Ga0105247_10193293 | |||
| 1600 | Ga0114129_10034794 | |||
| 1601 | Ga0114129_10074165 | |||
| 1602 | Ga0114129_10346555 | |||
| 1603 | Ga0105243_10140503 | |||
| 1604 | Ga0105241_10008410 | |||
| 1605 | Ga0105241_10089216 | |||
| 1606 | Ga0105241_10435464 | |||
| 1607 | Ga0105242_10007285 | |||
| 1608 | Ga0105242_10034725 | |||
| 1609 | Ga0105242_10149144 | |||
| 1610 | Ga0105248_10040839 | |||
| 1611 | Ga0105248_10050747 | |||
| 1612 | Ga0105248_10058180 | |||
| 1613 | Ga0105248_10122714 | |||
| 1614 | Ga0105248_10524641 | |||
| 1615 | Ga0105237_10178898 | |||
| 1616 | Ga0105237_10220165 | |||
| 1617 | Ga0105237_10474801 | |||
| 1618 | Ga0105238_10029825 | |||
| 1619 | Ga0105238_10075953 | |||
| 1620 | Ga0105238_10269246 | |||
| 1621 | Ga0105249_10000247 | |||
| 1622 | Ga0105249_10018979 | |||
| 1623 | Ga0105249_10173030 | |||
| 1624 | Ga0105249_10239032 | |||
| 1625 | Ga0099796_10021104 | |||
| 1626 | Ga0105239_10043771 | |||
| 1627 | Ga0105239_10121410 | |||
| 1628 | Ga0105239_10172198 | |||
| 1629 | Ga0105246_10031841 | |||
| 1630 | Ga0105246_10625625 | |||
| 1631 | Ga0157373_10008827 | |||
| 1632 | Ga0157373_10024036 | |||
| 1633 | Ga0157373_10078858 | |||
| 1634 | Ga0157373_10134672 | |||
| 1635 | Ga0157373_10193303 | |||
| 1636 | Ga0157373_10257524 | |||
| 1637 | Ga0157371_10010154 | |||
| 1638 | Ga0157371_10011380 | |||
| 1639 | Ga0157371_10076830 | |||
| 1640 | Ga0157371_10099341 | |||
| 1641 | Ga0157370_10061565 | |||
| 1642 | Ga0157370_10375609 | |||
| 1643 | Ga0157370_10392922 | |||
| 1644 | Ga0157370_10448021 | |||
| 1645 | Ga0157370_10668109 | |||
| 1646 | Ga0157369_10129033 | |||
| 1647 | Ga0157369_10217195 | |||
| 1648 | Ga0157369_10224152 | |||
| 1649 | Ga0157369_10234440 | |||
| 1650 | Ga0157369_10267556 | |||
| 1651 | Ga0157369_10277522 | |||
| 1652 | Ga0157369_10699947 | |||
| 1653 | Ga0157374_10019472 | |||
| 1654 | Ga0157374_10253601 | |||
| 1655 | Ga0157374_10326581 | |||
| 1656 | Ga0157374_10460651 | |||
| 1657 | Ga0157374_10826845 | |||
| 1658 | Ga0157378_10107312 | |||
| 1659 | Ga0157378_10398123 | |||
| 1660 | Ga0163162_10000968 | |||
| 1661 | Ga0163162_10135225 | |||
| 1662 | Ga0163162_10674155 | |||
| 1663 | Ga0157372_10017897 | |||
| 1664 | Ga0157372_10019172 | |||
| 1665 | Ga0157372_10062629 | |||
| 1666 | Ga0157372_10141012 | |||
| 1667 | Ga0157372_10217816 | |||
| 1668 | Ga0157372_10219048 | |||
| 1669 | Ga0157372_10223667 | |||
| 1670 | Ga0157372_10228177 | |||
| 1671 | Ga0157372_10249173 | |||
| 1672 | Ga0157372_10370207 | |||
| 1673 | Ga0157372_10461114 | |||
| 1674 | Ga0157372_10934412 | |||
| 1675 | Ga0157372_11177403 | |||
| 1676 | Ga0157375_10020665 | |||
| 1677 | Ga0157375_10116648 | |||
| 1678 | Ga0157380_10041125 | |||
| 1679 | Ga0157380_10117896 | |||
| 1680 | Ga0182008_10006718 | |||
| 1681 | Ga0157377_10001976 | |||
| 1682 | Ga0157377_10057641 | |||
| 1683 | Ga0157377_10064324 | |||
| 1684 | Ga0157379_10032210 | |||
| 1685 | Ga0157379_10412704 | |||
| 1686 | Ga0157376_10049138 | |||
| 1687 | Ga0157376_10074835 | |||
| 1688 | Ga0157376_10141281 | |||
| 1689 | Ga0157376_10155951 | |||
| 1690 | Ga0163161_10252959 | |||
| 1691 | Ga0197907_11051130 | |||
| 1692 | Ga0213876_10010709 | |||
| 1693 | Ga0213876_10031971 | |||
| 1694 | Ga0209676_1000332 | |||
| 1695 | Ga0207697_10011385 | |||
| 1696 | Ga0207697_10014185 | |||
| 1697 | Ga0207682_10011727 | |||
| 1698 | Ga0207682_10016764 | |||
| 1699 | Ga0207692_10015454 | |||
| 1700 | Ga0207692_10077555 | |||
| 1701 | Ga0207642_10000869 | |||
| 1702 | Ga0207710_10143982 | |||
| 1703 | Ga0207688_10027380 | |||
| 1704 | Ga0207688_10044712 | |||
| 1705 | Ga0207680_10024431 | |||
| 1706 | Ga0207680_10025729 | |||
| 1707 | Ga0207647_10012888 | |||
| 1708 | Ga0207647_10206493 | |||
| 1709 | Ga0207685_10159264 | |||
| 1710 | Ga0207699_10001230 | |||
| 1711 | Ga0207699_10126913 | |||
| 1712 | Ga0207645_10001246 | |||
| 1713 | Ga0207645_10002969 | |||
| 1714 | Ga0207645_10018114 | |||
| 1715 | Ga0207645_10185904 | |||
| 1716 | Ga0207645_10193849 | |||
| 1717 | Ga0207643_10003364 | |||
| 1718 | Ga0207643_10057418 | |||
| 1719 | Ga0207705_10027229 | |||
| 1720 | Ga0207705_10029211 | |||
| 1721 | Ga0207705_10031424 | |||
| 1722 | Ga0207705_10031835 | |||
| 1723 | Ga0207705_10043315 | |||
| 1724 | Ga0207705_10079711 | |||
| 1725 | Ga0207705_10122539 | |||
| 1726 | Ga0207705_10172522 | |||
| 1727 | Ga0207705_10276084 | |||
| 1728 | Ga0207684_10477754 | |||
| 1729 | Ga0207654_10005914 | |||
| 1730 | Ga0207654_10028743 | |||
| 1731 | Ga0207654_10099830 | |||
| 1732 | Ga0207654_10270197 | |||
| 1733 | Ga0207707_10000784 | |||
| 1734 | Ga0207707_10002248 | |||
| 1735 | Ga0207707_10003943 | |||
| 1736 | Ga0207707_10004141 | |||
| 1737 | Ga0207707_10010236 | |||
| 1738 | Ga0207707_10012860 | |||
| 1739 | Ga0207707_10020853 | |||
| 1740 | Ga0207707_10041250 | |||
| 1741 | Ga0207707_10074382 | |||
| 1742 | Ga0207707_10075446 | |||
| 1743 | Ga0207707_10097923 | |||
| 1744 | Ga0207707_10136471 | |||
| 1745 | Ga0207707_10212597 | |||
| 1746 | Ga0207707_10254088 | |||
| 1747 | Ga0207707_10275027 | |||
| 1748 | Ga0207707_10384637 | |||
| 1749 | Ga0207695_10002690 | |||
| 1750 | Ga0207695_10003067 | |||
| 1751 | Ga0207695_10004617 | |||
| 1752 | Ga0207695_10013424 | |||
| 1753 | Ga0207695_10066239 | |||
| 1754 | Ga0207695_10070341 | |||
| 1755 | Ga0207695_10226018 | |||
| 1756 | Ga0207695_10226195 | |||
| 1757 | Ga0207671_10264370 | |||
| 1758 | Ga0207693_10003338 | |||
| 1759 | Ga0207693_10084216 | |||
| 1760 | Ga0207693_10144717 | |||
| 1761 | Ga0207663_10012846 | |||
| 1762 | Ga0207663_10023350 | |||
| 1763 | Ga0207660_10001291 | |||
| 1764 | Ga0207660_10013204 | |||
| 1765 | Ga0207660_10032435 | |||
| 1766 | Ga0207660_10044376 | |||
| 1767 | Ga0207660_10054390 | |||
| 1768 | Ga0207660_10055934 | |||
| 1769 | Ga0207660_10057759 | |||
| 1770 | Ga0207660_10088243 | |||
| 1771 | Ga0207660_10103162 | |||
| 1772 | Ga0207660_10139720 | |||
| 1773 | Ga0207660_10200740 | |||
| 1774 | Ga0207660_10213249 | |||
| 1775 | Ga0207660_10249325 | |||
| 1776 | Ga0207660_10330852 | |||
| 1777 | Ga0207662_10006823 | |||
| 1778 | Ga0207662_10020855 | |||
| 1779 | Ga0207662_10037541 | |||
| 1780 | Ga0207662_10297302 | |||
| 1781 | Ga0207657_10001138 | |||
| 1782 | Ga0207657_10054086 | |||
| 1783 | Ga0207657_10100403 | |||
| 1784 | Ga0207657_10110156 | |||
| 1785 | Ga0207657_10202823 | |||
| 1786 | Ga0207657_10405023 | |||
| 1787 | Ga0207649_10002377 | |||
| 1788 | Ga0207649_10004410 | |||
| 1789 | Ga0207649_10007666 | |||
| 1790 | Ga0207649_10008227 | |||
| 1791 | Ga0207649_10013748 | |||
| 1792 | Ga0207649_10032190 | |||
| 1793 | Ga0207649_10156162 | |||
| 1794 | Ga0207649_10178625 | |||
| 1795 | Ga0207649_10310550 | |||
| 1796 | Ga0207652_10002905 | |||
| 1797 | Ga0207652_10004165 | |||
| 1798 | Ga0207652_10012004 | |||
| 1799 | Ga0207652_10015685 | |||
| 1800 | Ga0207652_10019965 | |||
| 1801 | Ga0207652_10038944 | |||
| 1802 | Ga0207652_10042922 | |||
| 1803 | Ga0207652_10067099 | |||
| 1804 | Ga0207652_10069714 | |||
| 1805 | Ga0207652_10093206 | |||
| 1806 | Ga0207652_10094537 | |||
| 1807 | Ga0207652_10180913 | |||
| 1808 | Ga0207652_10469355 | |||
| 1809 | Ga0207652_10522591 | |||
| 1810 | Ga0207652_10646286 | |||
| 1811 | Ga0207652_10697419 | |||
| 1812 | Ga0207646_10019243 | |||
| 1813 | Ga0207646_10035672 | |||
| 1814 | Ga0207646_10201520 | |||
| 1815 | Ga0207646_10280505 | |||
| 1816 | Ga0207681_10001456 | |||
| 1817 | Ga0207681_10023008 | |||
| 1818 | Ga0207681_10032436 | |||
| 1819 | Ga0207694_10026946 | |||
| 1820 | Ga0207694_10248765 | |||
| 1821 | Ga0207694_10327240 | |||
| 1822 | Ga0207650_10034430 | |||
| 1823 | Ga0207650_10086726 | |||
| 1824 | Ga0207650_10245208 | |||
| 1825 | Ga0207650_10503674 | |||
| 1826 | Ga0207659_10007653 | |||
| 1827 | Ga0207659_10017541 | |||
| 1828 | Ga0207659_10022346 | |||
| 1829 | Ga0207659_10051549 | |||
| 1830 | Ga0207659_10218655 | |||
| 1831 | Ga0207687_10075869 | |||
| 1832 | Ga0207687_10117584 | |||
| 1833 | Ga0207700_10021907 | |||
| 1834 | Ga0207700_10039951 | |||
| 1835 | Ga0207700_10744429 | |||
| 1836 | Ga0207664_10009225 | |||
| 1837 | Ga0207664_10012437 | |||
| 1838 | Ga0207664_10030097 | |||
| 1839 | Ga0207664_10059661 | |||
| 1840 | Ga0207664_10150502 | |||
| 1841 | Ga0207644_10081250 | |||
| 1842 | Ga0207644_10157705 | |||
| 1843 | Ga0207644_10228772 | |||
| 1844 | Ga0207690_10039753 | |||
| 1845 | Ga0207690_10080789 | |||
| 1846 | Ga0207690_10631067 | |||
| 1847 | Ga0207706_10000025 | |||
| 1848 | Ga0207706_10030641 | |||
| 1849 | Ga0207706_10044843 | |||
| 1850 | Ga0207706_10085090 | |||
| 1851 | Ga0207706_10150224 | |||
| 1852 | Ga0207706_10279971 | |||
| 1853 | Ga0207706_10320634 | |||
| 1854 | Ga0207686_10001115 | |||
| 1855 | Ga0207686_10022147 | |||
| 1856 | Ga0207686_10060773 | |||
| 1857 | Ga0207686_10085618 | |||
| 1858 | Ga0207709_10081832 | |||
| 1859 | Ga0207670_10005135 | |||
| 1860 | Ga0207670_10018648 | |||
| 1861 | Ga0207670_10107499 | |||
| 1862 | Ga0207669_10000638 | |||
| 1863 | Ga0207704_10004727 | |||
| 1864 | Ga0207704_10242662 | |||
| 1865 | Ga0207665_10024947 | |||
| 1866 | Ga0207665_10102606 | |||
| 1867 | Ga0207691_10003543 | |||
| 1868 | Ga0207691_10013350 | |||
| 1869 | Ga0207691_10032808 | |||
| 1870 | Ga0207691_10046795 | |||
| 1871 | Ga0207691_10102934 | |||
| 1872 | Ga0207691_10153386 | |||
| 1873 | Ga0207711_10002753 | |||
| 1874 | Ga0207711_10006251 | |||
| 1875 | Ga0207711_10469843 | |||
| 1876 | Ga0207711_10683652 | |||
| 1877 | Ga0207711_10746633 | |||
| 1878 | Ga0207689_10005455 | |||
| 1879 | Ga0207689_10019641 | |||
| 1880 | Ga0207689_10117716 | |||
| 1881 | Ga0207689_10488156 | |||
| 1882 | Ga0207661_10001853 | |||
| 1883 | Ga0207661_10001907 | |||
| 1884 | Ga0207661_10004866 | |||
| 1885 | Ga0207661_10007267 | |||
| 1886 | Ga0207661_10008533 | |||
| 1887 | Ga0207661_10034637 | |||
| 1888 | Ga0207661_10047859 | |||
| 1889 | Ga0207661_10167950 | |||
| 1890 | Ga0207661_10198084 | |||
| 1891 | Ga0207661_10217134 | |||
| 1892 | Ga0207661_10299851 | |||
| 1893 | Ga0207661_10463489 | |||
| 1894 | Ga0207679_10001341 | |||
| 1895 | Ga0207679_10006587 | |||
| 1896 | Ga0207679_10092083 | |||
| 1897 | Ga0207679_10192419 | |||
| 1898 | Ga0207679_10215775 | |||
| 1899 | Ga0207679_10218788 | |||
| 1900 | Ga0207667_10034763 | |||
| 1901 | Ga0207667_10056597 | |||
| 1902 | Ga0207667_10105114 | |||
| 1903 | Ga0207667_10126128 | |||
| 1904 | Ga0207667_10126755 | |||
| 1905 | Ga0207667_10233566 | |||
| 1906 | Ga0207667_10281980 | |||
| 1907 | Ga0207667_10300053 | |||
| 1908 | Ga0207667_10466524 | |||
| 1909 | Ga0207667_10537287 | |||
| 1910 | Ga0207651_10021908 | |||
| 1911 | Ga0207651_10036217 | |||
| 1912 | Ga0207651_10170424 | |||
| 1913 | Ga0207651_10173474 | |||
| 1914 | Ga0207651_10400513 | |||
| 1915 | Ga0207651_10570192 | |||
| 1916 | Ga0207712_10000236 | |||
| 1917 | Ga0207712_10004705 | |||
| 1918 | Ga0207712_10013022 | |||
| 1919 | Ga0207712_10019662 | |||
| 1920 | Ga0207668_10002200 | |||
| 1921 | Ga0207668_10014204 | |||
| 1922 | Ga0207668_10045377 | |||
| 1923 | Ga0207668_10052171 | |||
| 1924 | Ga0207668_10388631 | |||
| 1925 | Ga0207640_10000324 | |||
| 1926 | Ga0207640_10001124 | |||
| 1927 | Ga0207640_10001854 | |||
| 1928 | Ga0207640_10015432 | |||
| 1929 | Ga0207640_10065476 | |||
| 1930 | Ga0207640_10287500 | |||
| 1931 | Ga0207640_10312773 | |||
| 1932 | Ga0207640_10609114 | |||
| 1933 | Ga0207658_10078185 | |||
| 1934 | Ga0207658_10121737 | |||
| 1935 | Ga0207658_10390115 | |||
| 1936 | Ga0207677_10058774 | |||
| 1937 | Ga0207677_10092972 | |||
| 1938 | Ga0207703_10051872 | |||
| 1939 | Ga0207703_10052835 | |||
| 1940 | Ga0207703_10297709 | |||
| 1941 | Ga0207639_10031292 | |||
| 1942 | Ga0207639_10051893 | |||
| 1943 | Ga0207639_10220672 | |||
| 1944 | Ga0207639_10276977 | |||
| 1945 | Ga0207639_10580316 | |||
| 1946 | Ga0207639_10682003 | |||
| 1947 | Ga0207678_10012023 | |||
| 1948 | Ga0207678_10071359 | |||
| 1949 | Ga0207678_10076305 | |||
| 1950 | Ga0207678_10086322 | |||
| 1951 | Ga0207678_10146850 | |||
| 1952 | Ga0207708_10012624 | |||
| 1953 | Ga0207708_10077845 | |||
| 1954 | Ga0207708_10112088 | |||
| 1955 | Ga0207702_10036288 | |||
| 1956 | Ga0207702_10556254 | |||
| 1957 | Ga0207641_10007192 | |||
| 1958 | Ga0207641_10115304 | |||
| 1959 | Ga0207641_10133751 | |||
| 1960 | Ga0207648_10000138 | |||
| 1961 | Ga0207648_10048391 | |||
| 1962 | Ga0207648_10097740 | |||
| 1963 | Ga0207648_10099910 | |||
| 1964 | Ga0207648_10203821 | |||
| 1965 | Ga0207676_10435635 | |||
| 1966 | Ga0207676_10894139 | |||
| 1967 | Ga0207674_10019045 | |||
| 1968 | Ga0207674_10048059 | |||
| 1969 | Ga0207674_10048180 | |||
| 1970 | Ga0207674_10082972 | |||
| 1971 | Ga0207674_10086885 | |||
| 1972 | Ga0207674_10090084 | |||
| 1973 | Ga0207674_10101100 | |||
| 1974 | Ga0207674_10110465 | |||
| 1975 | Ga0207674_10168287 | |||
| 1976 | Ga0207674_10296702 | |||
| 1977 | Ga0207675_100001482 | |||
| 1978 | Ga0207675_100006697 | |||
| 1979 | Ga0207675_100117992 | |||
| 1980 | Ga0207675_100244793 | |||
| 1981 | Ga0207683_10006013 | |||
| 1982 | Ga0207683_10018004 | |||
| 1983 | Ga0207683_10028596 | |||
| 1984 | Ga0207683_10035142 | |||
| 1985 | Ga0207698_10019363 | |||
| 1986 | Ga0207698_10036093 | |||
| 1987 | Ga0207698_10038152 | |||
| 1988 | Ga0207698_10463610 | |||
| 1989 | Ga0207698_10561203 | |||
| 1990 | Ga0207698_10744398 | |||
| 1991 | Ga0209969_1009191 | |||
| 1992 | Ga0209981_1002273 | |||
| 1993 | Ga0210000_1008961 | |||
| 1994 | Ga0209995_1006746 | |||
| 1995 | Ga0209968_1003096 | |||
| 1996 | Ga0209999_1000199 | |||
| 1997 | Ga0209999_1002599 | |||
| 1998 | Ga0209970_1008724 | |||
| 1999 | Ga0209966_1000982 | |||
| 2000 | Ga0209998_10003458 | |||
| 2001 | Ga0209974_10021093 | |||
| 2002 | Ga0207428_10118944 | |||
| 2003 | Ga0268266_10047291 | |||
| 2004 | Ga0268266_10484725 | |||
| 2005 | Ga0268265_10002653 | |||
| 2006 | Ga0268265_10060632 | |||
| 2007 | Ga0268264_10005398 | |||
| 2008 | Ga0268264_10012146 | |||
| 2009 | Ga0268264_10252891 | |||
| 2010 | Ga0265318_10091847 | |||
| 2011 | Ga0265332_10001239 | |||
| 2012 | Ga0265327_10004939 | |||
| 2013 | Ga0307513_10331498 | |||
| 2014 | Ga0307408_100002760 | |||
| 2015 | Ga0307408_100019763 | |||
| 2016 | Ga0307408_100052712 | |||
| 2017 | Ga0307408_100062503 | |||
| 2018 | Ga0307408_100066008 | |||
| 2019 | Ga0307408_100153960 | |||
| 2020 | Ga0307408_100223526 | |||
| 2021 | Ga0265314_10004621 | |||
| 2022 | Ga0265314_10017451 | |||
| 2023 | Ga0316576_10015012 | |||
| 2024 | Ga0316578_10041302 | |||
| 2025 | Ga0307405_10003326 | |||
| 2026 | Ga0307405_10004504 | |||
| 2027 | Ga0307405_10051278 | |||
| 2028 | Ga0307405_10061362 | |||
| 2029 | Ga0307405_10079157 | |||
| 2030 | Ga0307405_10081500 | |||
| 2031 | Ga0307405_10152371 | |||
| 2032 | Ga0307405_10228399 | |||
| 2033 | Ga0307405_10235083 | |||
| 2034 | Ga0307405_10315118 | |||
| 2035 | Ga0307405_10508407 | |||
| 2036 | Ga0307413_10001842 | |||
| 2037 | Ga0307413_10002091 | |||
| 2038 | Ga0307413_10002387 | |||
| 2039 | Ga0307413_10037954 | |||
| 2040 | Ga0307413_10055726 | |||
| 2041 | Ga0307413_10079652 | |||
| 2042 | Ga0307413_10106244 | |||
| 2043 | Ga0307413_10111837 | |||
| 2044 | Ga0307413_10261069 | |||
| 2045 | Ga0307413_10388818 | |||
| 2046 | Ga0307410_10022252 | |||
| 2047 | Ga0307410_10054670 | |||
| 2048 | Ga0307410_10070477 | |||
| 2049 | Ga0307410_10105816 | |||
| 2050 | Ga0307410_10109480 | |||
| 2051 | Ga0307410_10369891 | |||
| 2052 | Ga0307406_10001264 | |||
| 2053 | Ga0307406_10020026 | |||
| 2054 | Ga0307406_10030981 | |||
| 2055 | Ga0307406_10033014 | |||
| 2056 | Ga0307406_10144685 | |||
| 2057 | Ga0307406_10208490 | |||
| 2058 | Ga0307407_10005111 | |||
| 2059 | Ga0307407_10021693 | |||
| 2060 | Ga0307407_10047832 | |||
| 2061 | Ga0307407_10216503 | |||
| 2062 | Ga0307412_10005885 | |||
| 2063 | Ga0307412_10007821 | |||
| 2064 | Ga0307412_10060199 | |||
| 2065 | Ga0307412_10075320 | |||
| 2066 | Ga0307412_10202806 | |||
| 2067 | Ga0307412_10407017 | |||
| 2068 | Ga0307409_100032235 | |||
| 2069 | Ga0307409_100079067 | |||
| 2070 | Ga0307409_100105590 | |||
| 2071 | Ga0307409_100119375 | |||
| 2072 | Ga0307409_100124031 | |||
| 2073 | Ga0307409_100206649 | |||
| 2074 | Ga0307409_100254111 | |||
| 2075 | Ga0307409_100331104 | |||
| 2076 | Ga0307409_100498924 | |||
| 2077 | Ga0307409_100623915 | |||
| 2078 | Ga0307416_100009003 | |||
| 2079 | Ga0307416_100016074 | |||
| 2080 | Ga0307416_100047021 | |||
| 2081 | Ga0307416_100092060 | |||
| 2082 | Ga0307416_100113896 | |||
| 2083 | Ga0307416_100116989 | |||
| 2084 | Ga0307416_100117798 | |||
| 2085 | Ga0307416_100118263 | |||
| 2086 | Ga0307416_100196081 | |||
| 2087 | Ga0307416_100209312 | |||
| 2088 | Ga0307416_100270316 | |||
| 2089 | Ga0307416_100314182 | |||
| 2090 | Ga0307416_100357375 | |||
| 2091 | Ga0307416_100364805 | |||
| 2092 | Ga0307416_100375061 | |||
| 2093 | Ga0307416_100832026 | |||
| 2094 | Ga0307414_10049512 | |||
| 2095 | Ga0307414_10086998 | |||
| 2096 | Ga0307414_10151426 | |||
| 2097 | Ga0307414_10341665 | |||
| 2098 | Ga0307411_10005072 | |||
| 2099 | Ga0307411_10072801 | |||
| 2100 | Ga0307411_10132943 | |||
| 2101 | Ga0307411_10158935 | |||
| 2102 | Ga0307411_10226050 | |||
| 2103 | Ga0307411_10298126 | |||
| 2104 | Ga0307415_100004310 | |||
| 2105 | Ga0307415_100004471 | |||
| 2106 | Ga0307415_100006886 | |||
| 2107 | Ga0307415_100023196 | |||
| 2108 | Ga0307415_100041357 | |||
| 2109 | Ga0307415_100077926 | |||
| 2110 | Ga0307415_100116777 | |||
| 2111 | Ga0307415_100127589 | |||
| 2112 | Ga0307415_100282987 | |||
| 2113 | Ga0307415_100315483 | |||
| 2114 | Ga0307415_100342471 | |||
| 2115 | Ga0373926_0074468 | |||
| 2116 | Ga0373929_0050970 | |||
| 2117 | Ga0373934_0001304 | |||
| 2118 | Ga0373934_0104066 | |||
| 2119 | Ga0373944_0025955 | |||
| 2120 | Ga0373923_0000756 | |||
| 2121 | Ga0373953_0014696 | |||
| 2122 | Ga0373953_0097427 | |||
| 2123 | Ga0373954_0006856 | |||
| 2124 | Ga0373956_0001329 | |||
| 2125 | Ga0373956_0023371 | |||
| 2126 | Ga0373943_0057545 | |||
| 2127 | Ga0373943_0089557 | |||
| 2128 | Ga0373946_0054283 | |||
| 2129 | Ga0373946_0096626 | |||
| 2130 | Ga0373955_0000309 | |||
| 2131 | Ga0373955_0272419 | |||
| 2132 | Ga0373962_0069140 | |||
| 2133 | Ga0373924_0001445 | |||
| 2134 | Ga0373931_0017434 | |||
| 2135 | Ga0373935_0001142 | |||
| 2136 | Ga0373935_0058549 | |||
| 2137 | Ga0373927_0134380 | |||
| 2138 | Ga0373927_0160288 | |||
| 2139 | Ga0373927_0238483 | |||
| 2140 | Ga0373933_0000191 | |||
| 2141 | Ga0373933_0002765 | |||
| 2142 | Ga0373933_0266640 | |||
| 2143 | Ga0373947_0036655 | |||
| 2144 | Ga0373947_0236917 | |||
| 2145 | Ga0373937_0000625 | |||
| 2146 | Ga0373937_0063603 | |||
| 2147 | Ga0373937_0616041 | |||
| 2148 | Ga0373937_0662822 | |||
| 2149 | Ga0373925_0005112 | |||
| 2150 | Ga0395899_0151372 | |||
| 2151 | Ga0395905_0025260 | |||
| 2152 | Ga0395901_0001770 | |||
| 2153 | Ga0436365_0023278 | |||
| 2154 | Ga0436365_0408308 | |||
| 2155 | Ga0451804_0380477 | |||
| 2156 | Ga0439433_0015813 | |||
| 2157 | Ga0439448_0036131 | |||
| 2158 | Ga0439432_037604 | |||
| 2159 | Ga0450896_011384 | |||
| 2160 | Ga0439446_0009762 | |||
| 2161 | Ga0439446_0029363 | |||
| 2162 | Ga0451577_0000001 | |||
| 2163 | Ga0451577_0003185 | |||
| 2164 | Ga0451577_0083322 | |||
| 2165 | Ga0451577_0141188 | |||
| 2166 | Ga0451577_0524250 | |||
| 2167 | Ga0453683_0033780 | |||
| 2168 | Ga0466966_0001530 | |||
| 2169 | Ga0466966_0006135 | |||
| 2170 | Ga0466961_0042804 | |||
| 2171 | Ga0466961_0160956 | |||
| 2172 | Ga0466961_0204760 | |||
| 2173 | Ga0466963_0055834 | |||
| 2174 | Ga0453684_0026762 | |||
| 2175 | Ga0453684_0062783 | |||
| 2176 | Ga0466971_0087484 | |||
| 2177 | Ga0466957_0076776 | |||
| 2178 | Ga0466957_0209596 | |||
| 2179 | Ga0466959_0016263 | |||
| 2180 | Ga0466959_0049416 | |||
| 2181 | Ga0451576_0153457 | |||
| 2182 | Ga0451576_0237355 | |||
| 2183 | Ga0451576_0510035 | |||
| 2184 | Ga0466958_0185693 | |||
| 2185 | Ga0466967_0065040 | |||
| 2186 | Ga0466967_0821743 | |||
| 2187 | Ga0466967_1095808 | |||
| 2188 | Ga0495592_0001172 | |||
| 2189 | Ga0495592_0009293 | |||
| 2190 | Ga0495603_0003416 | |||
| 2191 | Ga0495603_0043390 | |||
| 2192 | Ga0495603_0076014 | |||
| 2193 | Ga0495629_0009752 | |||
| 2194 | Ga0495629_0019579 | |||
| 2195 | Ga0495629_0042049 | |||
| 2196 | Ga0495629_0048696 | |||
| 2197 | Ga0495629_0073936 | |||
| 2198 | Ga0495629_0077215 | |||
| 2199 | Ga0495629_0128626 | |||
| 2200 | Ga0495629_0223629 | |||
| 2201 | Ga0495629_0266222 | |||
| 2202 | Ga0495651_0000116 | |||
| 2203 | Ga0495651_0011176 | |||
| 2204 | Ga0495651_0017188 | |||
| 2205 | Ga0495653_0000992 | |||
| 2206 | Ga0495653_0007356 | |||
| 2207 | Ga0495653_0026437 | |||
| 2208 | Ga0495580_0016230 | |||
| 2209 | Ga0495580_0047588 | |||
| 2210 | Ga0495580_0087356 | |||
| 2211 | Ga0495580_0113415 | |||
| 2212 | Ga0495582_0004886 | |||
| 2213 | Ga0495582_0010686 | |||
| 2214 | Ga0495582_0036644 | |||
| 2215 | Ga0495582_0050921 | |||
| 2216 | Ga0495582_0150032 | |||
| 2217 | Ga0495639_0004714 | |||
| 2218 | Ga0495639_0019583 | |||
| 2219 | Ga0495662_0035604 | |||
| 2220 | Ga0495664_0013790 | |||
| 2221 | Ga0495585_0144448 | |||
| 2222 | Ga0495594_0005611 | |||
| 2223 | Ga0495594_0007853 | |||
| 2224 | Ga0495594_0010292 | |||
| 2225 | Ga0495594_0012873 | |||
| 2226 | Ga0495594_0020695 | |||
| 2227 | Ga0495594_0140901 | |||
| 2228 | Ga0495594_0199284 | |||
| 2229 | Ga0495596_0010087 | |||
| 2230 | Ga0495608_0001013 | |||
| 2231 | Ga0495608_0033181 | |||
| 2232 | Ga0495608_0073497 | |||
| 2233 | Ga0495608_0103342 | |||
| 2234 | Ga0495618_0218814 | |||
| 2235 | Ga0495628_0000113 | |||
| 2236 | Ga0495630_0019876 | |||
| 2237 | Ga0495630_0048337 | |||
| 2238 | Ga0495630_0050774 | |||
| 2239 | Ga0495630_0094702 | |||
| 2240 | Ga0495663_0020324 | |||
| 2241 | Ga0495642_0274020 | |||
| 2242 | Ga0495652_0001031 | |||
| 2243 | Ga0495652_0001095 | |||
| 2244 | Ga0495652_0123654 | |||
| 2245 | Ga0495652_0133218 | |||
| 2246 | Ga0495665_0002814 | |||
| 2247 | Ga0495665_0014539 | |||
| 2248 | Ga0495665_0023640 | |||
| 2249 | Ga0495665_0076291 | |||
| 2250 | Ga0495586_0015359 | |||
| 2251 | Ga0495586_0065516 | |||
| 2252 | Ga0495586_0095659 | |||
| 2253 | Ga0495587_0000143 | |||
| 2254 | Ga0495645_0001110 | |||
| 2255 | Ga0495645_0001766 | |||
| 2256 | Ga0495645_0334115 | |||
| 2257 | Ga0495645_0461199 | |||
| 2258 | Ga0495622_0052951 | |||
| 2259 | Ga0495633_0104185 | |||
| 2260 | Ga0495667_0001636 | |||
| 2261 | Ga0495667_0016331 | |||
| 2262 | Ga0495667_0024990 | |||
| 2263 | Ga0495667_0073783 | |||
| 2264 | Ga0495635_0000158 | |||
| 2265 | Ga0495635_0054906 | |||
| 2266 | Ga0495659_0053455 | |||
| 2267 | Ga0495659_0087973 | |||
| 2268 | Ga0495659_0123527 | |||
| 2269 | Ga0495659_0143222 | |||
| 2270 | Ga0495588_0030623 | |||
| 2271 | Ga0495588_0297274 | |||
| 2272 | Ga0495657_0000476 | |||
| 2273 | Ga0495657_0049025 | |||
| 2274 | Ga0495657_0059269 | |||
| 2275 | Ga0495657_0113082 | |||
| 2276 | Ga0495599_0000553 | |||
| 2277 | Ga0495599_0010652 | |||
| 2278 | Ga0495599_0015785 | |||
| 2279 | Ga0495599_0073902 | |||
| 2280 | Ga0495623_0000017 | |||
| 2281 | Ga0495623_0017452 | |||
| 2282 | Ga0495623_0101934 | |||
| 2283 | Ga0495623_0108146 | |||
| 2284 | Ga0495646_0002016 | |||
| 2285 | Ga0495646_0016342 | |||
| 2286 | Ga0495646_0089993 | |||
| 2287 | Ga0495658_0002526 | |||
| 2288 | Ga0495658_0166410 | |||
| 2289 | Ga0495658_0285154 | |||
| 2290 | Ga0495658_0305619 | |||
| 2291 | Ga0495669_0171122 | |||
| 2292 | Ga0495613_0060691 | |||
| 2293 | Ga0495613_0067704 | |||
| 2294 | Ga0495613_0068168 | |||
| 2295 | Ga0495613_0077081 | |||
| 2296 | Ga0495670_0054140 | |||
| 2297 | Ga0495600_0000063 | |||
| 2298 | Ga0495600_0043058 | |||
| 2299 | Ga0495600_0245756 | |||
| 2300 | Ga0495581_0010867 | |||
| 2301 | Ga0495581_0022768 | |||
| 2302 | Ga0495604_0000017 | |||
| 2303 | Ga0495604_0021369 | |||
| 2304 | Ga0495604_0104964 | |||
| 2305 | Ga0495636_0119308 | |||
| 2306 | Ga0495674_0003779 | |||
| 2307 | Ga0495674_0014556 | |||
| 2308 | Ga0495674_0022976 | |||
| 2309 | Ga0495672_0004623 | |||
| 2310 | Ga0495676_0257331 | |||
| 2311 | Ga0495680_0007844 | |||
| 2312 | Ga0495680_0013035 | |||
| 2313 | Ga0495680_0627083 | |||
| 2314 | Ga0495675_0079198 | |||
| 2315 | Ga0495675_0129471 | |||
| 2316 | Ga0495675_0170389 | |||
| 2317 | Ga0495684_0000095 | |||
| 2318 | Ga0495684_0023565 | |||
| 2319 | Ga0495684_0026626 | |||
| 2320 | Ga0495684_0071242 | |||
| 2321 | Ga0495593_0020541 | |||
| 2322 | Ga0495602_0001119 | |||
| 2323 | Ga0495602_0013466 | |||
| 2324 | Ga0496100_0109226 | |||
| 2325 | Ga0496101_0056945 | |||
| 2326 | Ga0496101_0125918 | |||
| 2327 | Ga0496104_0103483 | |||
| 2328 | Ga0496105_0059694 | |||
| 2329 | Ga0496105_0071848 | |||
| 2330 | Ga0496106_0003759 | |||
| 2331 | Ga0496106_0064193 | |||
| 2332 | Ga0496106_0157904 | |||
| 2333 | Ga0496107_0134588 | |||
| 2334 | Ga0496107_0387268 | |||
| 2335 | Ga0496108_0430642 | |||
| 2336 | Ga0496112_0002541 | |||
| 2337 | Ga0496112_0043501 | |||
| 2338 | Ga0496112_0104391 | |||
| 2339 | Ga0496112_0248569 | |||
| 2340 | Ga0496113_0016753 | |||
| 2341 | Ga0496113_0156046 | |||
| 2342 | Ga0496114_0136082 | |||
| 2343 | Ga0496115_0052769 | |||
| 2344 | Ga0496115_0082370 | |||
| 2345 | Ga0496115_0376515 | |||
| 2346 | Ga0501304_000552 | |||
| 2347 | Ga0501291_018783 | |||
| 2348 | Ga0501292_015075 | |||
| 2349 | Ga0501299_013743 | |||
| 2350 | Ga0501314_000038 | |||
| 2351 | Ga0501031_0036052 | |||
| 2352 | Ga0501031_0182846 | |||
| 2353 | Ga0501031_0417637 | |||
| 2354 | Ga0501032_0082763 | |||
| 2355 | Ga0501032_0184321 | |||
| 2356 | Ga0501034_0220989 | |||
| 2357 | Ga0501034_0470966 | |||
| 2358 | Ga0501036_0131789 | |||
| 2359 | Ga0501037_0036525 | |||
| 2360 | Ga0501037_0252132 | |||
| 2361 | Ga0501038_0011902 | |||
| 2362 | Ga0501038_0029198 | |||
| 2363 | Ga0501039_0103131 | |||
| 2364 | Ga0501039_0165564 | |||
| 2365 | Ga0501040_0040969 | |||
| 2366 | Ga0501040_0080203 | |||
| 2367 | Ga0501040_0176671 | |||
| 2368 | Ga0501040_0383694 | |||
| 2369 | Ga0501041_0023985 | |||
| 2370 | Ga0501041_0227281 | |||
| 2371 | Ga0501042_0119003 | |||
| 2372 | Ga0501043_0014332 | |||
| 2373 | Ga0501043_0047600 | |||
| 2374 | Ga0501046_0028687 | |||
| 2375 | Ga0501046_0112744 | |||
| 2376 | Ga0501046_0186025 | |||
| 2377 | Ga0501047_0019591 | |||
| 2378 | Ga0501047_0029942 | |||
| 2379 | Ga0501047_0291019 | |||
| 2380 | Ga0501047_0405438 | |||
| 2381 | Ga0501070_0042534 | |||
| 2382 | Ga0501070_0069675 | |||
| 2383 | Ga0501070_0097328 | |||
| 2384 | Ga0501071_0238684 | |||
| 2385 | Ga0501071_0421544 | |||
| 2386 | Ga0501072_0010585 | |||
| 2387 | Ga0501074_0246973 | |||
| 2388 | Ga0501075_0078651 | |||
| 2389 | Ga0501076_0069214 | |||
| 2390 | Ga0501076_0244716 | |||
| 2391 | Ga0501209_057742 | |||
| 2392 | Ga0501217_010354 | |||
| 2393 | Ga0501223_008477 | |||
| 2394 | Ga0501224_001238 | |||
| 2395 | Ga0501227_018036 | |||
| 2396 | Ga0501228_005012 | |||
| 2397 | Ga0501230_009571 | |||
| 2398 | Ga0501233_004905 | |||
| 2399 | Ga0501235_007524 | |||
| 2400 | Ga0501249_012864 | |||
| 2401 | Ga0501249_054659 | |||
| 2402 | Ga0501258_005248 | |||
| 2403 | Ga0501221_041781 | |||
| 2404 | Ga0501225_0004791 | |||
| 2405 | Ga0501234_001400 | |||
| 2406 | Ga0501245_012427 | |||
| 2407 | Ga0501079_0019559 | |||
| 2408 | Ga0501079_0035622 | |||
| 2409 | Ga0501080_0443846 | |||
| 2410 | Ga0501080_0570580 | |||
| 2411 | Ga0501081_0148167 | |||
| 2412 | Ga0501081_0314868 | |||
| 2413 | Ga0501083_0309541 | |||
| 2414 | Ga0501266_003064 | |||
| 2415 | Ga0501268_008523 | |||
| 2416 | Ga0501274_002181 | |||
| 2417 | Ga0501283_008388 | |||
| 2418 | Ga0501035_0052570 | |||
| 2419 | Ga0501035_0204036 | |||
| 2420 | Ga0501035_0288383 | |||
| 2421 | Ga0501044_0007223 | |||
| 2422 | Ga0501044_0064096 | |||
| 2423 | Ga0501044_0152540 | |||
| 2424 | Ga0501045_0032763 | |||
| 2425 | Ga0501212_001652 | |||
| 2426 | nmdc:mga0k408_122928_c1 | |||
| 2427 | nmdc:mga05p37_151379_c1 | |||
| 2428 | nmdc:mga05p37_57467_c1 | |||
| 2429 | nmdc:mga09592_50694_c1 | |||
| 2430 | nmdc:mga09592_74630_c1 | |||
| 2431 | nmdc:mga0qj67_75775_c1 | |||
| 2432 | nmdc:mga0qj67_77954_c1 | |||
| 2433 | nmdc:mga0qj67_87554_c1 | |||
| 2434 | nmdc:mga0qj67_90728_c1 | |||
| 2435 | nmdc:mga06r32_259645_c1 | |||
| 2436 | nmdc:mga06r32_303714_c1 | |||
| 2437 | nmdc:mga06r32_310188_c1 | |||
| 2438 | nmdc:mga06r32_6558_c1 | |||
| 2439 | nmdc:mga08y16_1022_c1 | |||
| 2440 | nmdc:mga08y16_281933_c1 | |||
| 2441 | nmdc:mga08y16_46413_c1 | |||
| 2442 | nmdc:mga08y16_597362_c1 | |||
| 2443 | nmdc:mga0n895_21843_c1 | |||
| 2444 | nmdc:mga0rr50_135710_c1 | |||
| 2445 | nmdc:mga0a205_17997_c1 | |||
| 2446 | nmdc:mga0a205_26534_c1 | |||
| 2447 | nmdc:mga0a205_27367_c1 | |||
| 2448 | Ga0495601_0102656 | |||
| 2449 | Ga0495612_0004309 | |||
| 2450 | Ga0495619_0002351 | |||
| 2451 | Ga0495619_0062582 | |||
| 2452 | Ga0501084_0221154 | |||
| 2453 | Ga0501082_0071941 | |||
| 2454 | Ga0501082_0086997 | |||
| 2455 | Ga0466962_0078952 | |||
| 2456 | Ga0530510_0055415 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c04-assembly1.cif.gz_A | identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui | 0.977 | 62 | 195 |
| 1c04-assembly1.cif.gz_A | identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui | 0.9629 | 62 | 195 |
| 8c91-assembly1.cif.gz_C | cryo-em captures early ribosome assembly in action | 0.9249 | 23 | 200 |
| 8c91-assembly1.cif.gz_C | cryo-em captures early ribosome assembly in action | 0.9025 | 23 | 200 |
| 3iy9-assembly1.cif.gz_B | leishmania tarentolae mitochondrial large ribosomal subunit model | 0.8842 | 81 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6R9C6_19_86_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9954 | 131 | 196 | 2.30.30.30 |
| af_E7F8R3_156_236_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9926 | 125 | 195 | 2.30.30.30 |
| af_P92812_354_429_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9857 | 125 | 195 | 2.30.30.30 |
| af_A4HTH9_204_277_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9839 | 125 | 194 | 2.30.30.30 |
| af_Q5A7P6_207_283_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9836 | 124 | 195 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R4I6R4-F1-model_v4 | Ribosomal protein L2 | 0.9911 | 74 | 197 |
GO:0003723
GO:0003735 GO:0005762 GO:0009507 GO:0016740 GO:0032543 |
| AF-A0A0F2I9X1-F1-model_v4 | 50S ribosomal protein L2 | 0.9903 | 62 | 187 |
GO:0002181
GO:0003723 GO:0003735 GO:0015934 GO:0016740 |
| AF-D8KXK9-F1-model_v4 | Ribosomal protein L2 | 0.9851 | 74 | 196 |
GO:0003723
GO:0003735 GO:0005762 GO:0009507 GO:0032543 |
| AF-A0A0F2I9X1-F1-model_v4 | 50S ribosomal protein L2 | 0.9675 | 62 | 187 |
GO:0002181
GO:0003723 GO:0003735 GO:0015934 GO:0016740 |
| AF-D8KXK9-F1-model_v4 | Ribosomal protein L2 | 0.9619 | 74 | 196 |
GO:0003723
GO:0003735 GO:0005762 GO:0009507 GO:0032543 |