F491933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1226 | 660 | 1003 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0011741|Ga0496109_0011741_5631_6476 |
| Length | 281 |
| Sequence | MAEEARSRLGRGLASLIGDVGGEAAHLDRPRAQRKVPIEFLKPNPRNPRREFADNELRELADSIRQHGVIQPIVVRPARGTQDRFEIIAGERRWRSAQIAGLHEVPIVPVDVSDSDALEIAIIEEAQGYHALAGEFKRSADDIAKIVGKSRSHIANMMRLTKLPAEVQRYIALGKLSAGHARALIGVPDPVAAAKRIIEGDLNVRQAEALAHVEGVPERKPHKARGRKTKDADTAALEKRVSDALGLAVSIDHRDSAGTVHIRYRDLDQLDEIVRRLEAST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 35 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 36 | 2791355199 | |||
| 37 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 38 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 39 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 40 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 41 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 42 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 43 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 44 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 45 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 46 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 47 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 48 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 53 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 54 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 55 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 56 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 57 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 58 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 59 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 60 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 61 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 62 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 63 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 64 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 65 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 66 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 67 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 68 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 69 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 70 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 73 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 74 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 75 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 76 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 77 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 78 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 79 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 80 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 81 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 82 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 85 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 86 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 87 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 88 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 89 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 90 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 91 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 92 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 93 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 94 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 95 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 96 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 97 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 98 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 99 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 100 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 101 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 102 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 103 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 104 | 2904699407 | |||
| 105 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 106 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 107 | 2906610324 | |||
| 108 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 109 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 110 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 111 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 112 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 113 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 114 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 115 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 116 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 117 | 2922368715 | |||
| 118 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 119 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 120 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 121 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 122 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 123 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 124 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 125 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 126 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 127 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 128 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 129 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 130 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 131 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 132 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 133 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 134 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 135 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 136 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 137 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 138 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 139 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 140 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 141 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 142 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 143 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 144 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 145 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 146 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 147 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 148 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 149 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 150 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 151 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 152 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 153 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 154 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 155 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 156 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 157 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 158 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 159 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 160 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 161 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 162 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 163 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 164 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 165 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 166 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 167 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 168 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 169 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 170 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 171 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 172 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 173 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 174 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 175 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 176 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 177 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 178 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 179 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 180 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 181 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 182 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 183 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 184 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 185 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 186 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 187 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 188 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 189 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 190 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 191 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 192 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 193 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 194 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 195 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 196 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 198 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 200 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 201 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 202 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 210 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 217 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 218 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 219 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 220 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 221 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 222 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 225 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 227 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 228 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 229 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 230 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 231 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 232 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 233 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 234 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 235 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 236 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 237 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 238 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 239 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 241 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 242 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 243 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 244 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 245 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 247 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 248 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 249 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 251 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 252 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 253 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 254 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 255 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 256 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 257 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 259 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 260 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 282 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 286 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 287 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 288 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 289 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 290 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 291 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 292 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 293 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 300 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 302 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 353 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 354 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 355 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 356 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 360 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 361 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 362 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 363 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 364 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 365 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 366 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 367 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 368 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 369 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 370 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 371 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 372 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 373 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 374 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 375 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 376 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 377 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 378 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 379 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 380 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 381 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 382 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 383 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 384 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 385 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 386 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 387 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 388 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 389 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 390 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 391 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 392 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 393 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 394 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 395 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 396 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 397 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 398 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 399 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 400 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 401 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 402 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 403 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 404 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 405 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 406 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 407 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 408 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 409 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 410 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 411 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 412 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 413 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 414 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 415 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 416 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 417 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 418 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 419 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 420 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 421 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 422 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 423 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 424 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 425 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 426 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 427 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 428 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 429 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 430 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 431 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 509 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 510 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 511 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 512 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 513 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 514 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 515 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 516 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 517 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 518 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 519 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 520 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 521 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 522 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 523 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 524 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 525 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 526 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 527 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 528 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 529 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 530 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 531 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 532 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 533 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 555 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 557 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 560 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 561 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 564 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 565 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 566 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 567 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 568 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 569 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 570 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 571 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 572 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 573 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 574 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 575 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 577 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 581 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 582 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 583 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 584 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 585 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 586 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 587 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 588 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 589 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 590 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 591 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 592 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 593 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 594 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 595 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 596 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 597 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 598 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 599 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 600 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 601 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 602 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 603 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 604 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 605 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 606 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 607 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 608 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 609 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 610 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 611 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 612 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 613 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 614 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 615 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 616 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 617 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 618 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 619 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 620 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 621 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 622 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 623 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 624 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 625 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 626 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 627 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 628 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 629 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 630 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 631 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 632 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 633 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 634 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 635 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 636 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 637 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 638 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 639 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 640 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 641 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 642 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 643 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 644 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 645 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 646 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 647 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 648 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 649 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 650 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 651 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 652 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 653 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 654 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 655 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 656 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 657 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 658 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 659 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 660 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.91 |
| Metatranscriptomes | 0.16 |
| Isolates | 17.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.11 |
| Nodule | 14.03 |
| Rhizoplane | 7.59 |
| Rhizosphere | 56.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000946 | 3300001979 | Bacteria | 12915 |
| 2 | JGI24737J22298_10024439 | 3300001990 | Bacteria | 1913 |
| 3 | JGI24735J21928_10009808 | 3300002067 | Bacteria | 3067 |
| 4 | JGI24738J21930_10006735 | 3300002075 | Bacteria | 2673 |
| 5 | JGI25406J46586_10000066 | 3300003203 | Bacteria | 48110 |
| 6 | JGI25406J46586_10002779 | 3300003203 | Bacteria | 8224 |
| 7 | JGI25153J46596_10003450 | 3300003215 | Bacteria | 8852 |
| 8 | JGI25153J46596_10011834 | 3300003215 | Bacteria | 3825 |
| 9 | JGI25160J50197_1003294 | 3300003354 | Bacteria | 7271 |
| 10 | JGI25404J52841_10007684 | 3300003659 | Bacteria | 2285 |
| 11 | Ga0055526_1043009 | 3300003771 | Bacteria | 1106 |
| 12 | Ga0055531_10014489 | 3300003794 | Bacteria | 3545 |
| 13 | Ga0065165_1000365 | 3300005262 | Bacteria | 74017 |
| 14 | Ga0065165_1001495 | 3300005262 | Bacteria | 24729 |
| 15 | Ga0065165_1019115 | 3300005262 | Bacteria | 2458 |
| 16 | Ga0070658_10068227 | 3300005327 | Bacteria | 2907 |
| 17 | Ga0070658_10084002 | 3300005327 | Bacteria | 2618 |
| 18 | Ga0070683_100005996 | 3300005329 | Bacteria | 10180 |
| 19 | Ga0070683_100013328 | 3300005329 | Bacteria | 7167 |
| 20 | Ga0070683_100421203 | 3300005329 | Bacteria | 1274 |
| 21 | Ga0070690_100211041 | 3300005330 | Bacteria | 1356 |
| 22 | Ga0068868_100016797 | 3300005338 | Bacteria | 5443 |
| 23 | Ga0070660_100038981 | 3300005339 | Bacteria | 3610 |
| 24 | Ga0070691_10133269 | 3300005341 | Bacteria | 1261 |
| 25 | Ga0070669_100066355 | 3300005353 | Bacteria | 2660 |
| 26 | Ga0070671_100129955 | 3300005355 | Bacteria | 2121 |
| 27 | Ga0070674_100088993 | 3300005356 | Bacteria | 2223 |
| 28 | Ga0070674_100234639 | 3300005356 | Bacteria | 1433 |
| 29 | Ga0070673_100084349 | 3300005364 | Bacteria | 2584 |
| 30 | Ga0070659_100118955 | 3300005366 | Bacteria | 2138 |
| 31 | Ga0070709_10000584 | 3300005434 | Bacteria | 21359 |
| 32 | Ga0070709_10004682 | 3300005434 | Bacteria | 7388 |
| 33 | Ga0070709_10013026 | 3300005434 | Bacteria | 4667 |
| 34 | Ga0070709_10105903 | 3300005434 | Bacteria | 1882 |
| 35 | Ga0070714_100004568 | 3300005435 | Bacteria | 10439 |
| 36 | Ga0070714_100118625 | 3300005435 | Bacteria | 2351 |
| 37 | Ga0070713_100005959 | 3300005436 | Bacteria | 8384 |
| 38 | Ga0070713_100010327 | 3300005436 | Bacteria | 6743 |
| 39 | Ga0070713_100157380 | 3300005436 | Bacteria | 2026 |
| 40 | Ga0070713_100415359 | 3300005436 | Bacteria | 1259 |
| 41 | Ga0070710_10002351 | 3300005437 | Bacteria | 8946 |
| 42 | Ga0070710_10004995 | 3300005437 | Bacteria | 6278 |
| 43 | Ga0070710_10109270 | 3300005437 | Bacteria | 1659 |
| 44 | Ga0070711_100000660 | 3300005439 | Bacteria | 18001 |
| 45 | Ga0070711_100004456 | 3300005439 | Bacteria | 8265 |
| 46 | Ga0070711_100019254 | 3300005439 | Bacteria | 4377 |
| 47 | Ga0070711_100022461 | 3300005439 | Bacteria | 4090 |
| 48 | Ga0070711_100474025 | 3300005439 | Bacteria | 1028 |
| 49 | Ga0070663_100062897 | 3300005455 | Bacteria | 2677 |
| 50 | Ga0070678_100015808 | 3300005456 | Bacteria | 4807 |
| 51 | Ga0070681_10014969 | 3300005458 | Bacteria | 7713 |
| 52 | Ga0070681_10051117 | 3300005458 | Bacteria | 4123 |
| 53 | Ga0070681_10089577 | 3300005458 | Bacteria | 3028 |
| 54 | Ga0070698_100068842 | 3300005471 | Bacteria | 3556 |
| 55 | Ga0070679_100039226 | 3300005530 | Bacteria | 4707 |
| 56 | Ga0070679_100044969 | 3300005530 | Bacteria | 4399 |
| 57 | Ga0070679_100066868 | 3300005530 | Bacteria | 3584 |
| 58 | Ga0070679_100120755 | 3300005530 | Bacteria | 2605 |
| 59 | Ga0070684_100007764 | 3300005535 | Bacteria | 8363 |
| 60 | Ga0070684_100024903 | 3300005535 | Bacteria | 5023 |
| 61 | Ga0070684_100058502 | 3300005535 | Bacteria | 3368 |
| 62 | Ga0070697_100289134 | 3300005536 | Bacteria | 1407 |
| 63 | Ga0068853_100001705 | 3300005539 | Bacteria | 16098 |
| 64 | Ga0068853_100029265 | 3300005539 | Bacteria | 4641 |
| 65 | Ga0068853_100086417 | 3300005539 | Bacteria | 2750 |
| 66 | Ga0068853_100196525 | 3300005539 | Bacteria | 1835 |
| 67 | Ga0068853_100279593 | 3300005539 | Bacteria | 1539 |
| 68 | Ga0070696_100109075 | 3300005546 | Bacteria | 1992 |
| 69 | Ga0070665_100028170 | 3300005548 | Bacteria | 5657 |
| 70 | Ga0070665_100099215 | 3300005548 | Bacteria | 2916 |
| 71 | Ga0070665_100250510 | 3300005548 | Bacteria | 1772 |
| 72 | Ga0068855_100015846 | 3300005563 | Bacteria | 9068 |
| 73 | Ga0068855_100034493 | 3300005563 | Bacteria | 6035 |
| 74 | Ga0068855_100274067 | 3300005563 | Bacteria | 1875 |
| 75 | Ga0068855_100526603 | 3300005563 | Bacteria | 1282 |
| 76 | Ga0070664_100189725 | 3300005564 | Bacteria | 1831 |
| 77 | Ga0068857_100021030 | 3300005577 | Bacteria | 5741 |
| 78 | Ga0068857_100041204 | 3300005577 | Bacteria | 4095 |
| 79 | Ga0068857_100227058 | 3300005577 | Bacteria | 1706 |
| 80 | Ga0068857_100576858 | 3300005577 | Bacteria | 1061 |
| 81 | Ga0068854_100222019 | 3300005578 | Bacteria | 1495 |
| 82 | Ga0068854_100318805 | 3300005578 | Bacteria | 1263 |
| 83 | Ga0068856_100005093 | 3300005614 | Bacteria | 12992 |
| 84 | Ga0068856_100012875 | 3300005614 | Bacteria | 8096 |
| 85 | Ga0068856_100065061 | 3300005614 | Bacteria | 3603 |
| 86 | Ga0068856_100129808 | 3300005614 | Bacteria | 2525 |
| 87 | Ga0068852_100042806 | 3300005616 | Bacteria | 3836 |
| 88 | Ga0068852_100104346 | 3300005616 | Bacteria | 2566 |
| 89 | Ga0068852_100341968 | 3300005616 | Bacteria | 1458 |
| 90 | Ga0068859_100184572 | 3300005617 | Bacteria | 2169 |
| 91 | Ga0068864_100026520 | 3300005618 | Bacteria | 4886 |
| 92 | Ga0068851_10002645 | 3300005834 | Bacteria | 7896 |
| 93 | Ga0068851_10030239 | 3300005834 | Bacteria | 2685 |
| 94 | Ga0068858_100033778 | 3300005842 | Bacteria | 4744 |
| 95 | Ga0068858_100094168 | 3300005842 | Bacteria | 2790 |
| 96 | Ga0068858_100394178 | 3300005842 | Bacteria | 1330 |
| 97 | Ga0068860_100001450 | 3300005843 | Bacteria | 25677 |
| 98 | Ga0068860_100136751 | 3300005843 | Bacteria | 2353 |
| 99 | Ga0081455_10009536 | 3300005937 | Bacteria | 9971 |
| 100 | Ga0081455_10010204 | 3300005937 | Bacteria | 9559 |
| 101 | Ga0081455_10037390 | 3300005937 | Bacteria | 4313 |
| 102 | Ga0081455_10048211 | 3300005937 | Bacteria | 3683 |
| 103 | Ga0081538_10086299 | 3300005981 | Bacteria | 1644 |
| 104 | Ga0081540_1003875 | 3300005983 | Bacteria | 11676 |
| 105 | Ga0081540_1005299 | 3300005983 | Bacteria | 9654 |
| 106 | Ga0081540_1011061 | 3300005983 | Bacteria | 6059 |
| 107 | Ga0081540_1012813 | 3300005983 | Bacteria | 5486 |
| 108 | Ga0081540_1021192 | 3300005983 | Bacteria | 3881 |
| 109 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 110 | Ga0081539_10004737 | 3300005985 | Bacteria | 14713 |
| 111 | Ga0081539_10029435 | 3300005985 | Bacteria | 3430 |
| 112 | Ga0070717_10006989 | 3300006028 | Bacteria | 8350 |
| 113 | Ga0070717_10043262 | 3300006028 | Bacteria | 3675 |
| 114 | Ga0070717_10088445 | 3300006028 | Bacteria | 2611 |
| 115 | Ga0075365_10066092 | 3300006038 | Bacteria | 2426 |
| 116 | Ga0075365_10318386 | 3300006038 | Bacteria | 1095 |
| 117 | Ga0075368_10003158 | 3300006042 | Bacteria | 5475 |
| 118 | Ga0075363_100016306 | 3300006048 | Bacteria | 3669 |
| 119 | Ga0070715_10000108 | 3300006163 | Bacteria | 20251 |
| 120 | Ga0070715_10019602 | 3300006163 | Bacteria | 2597 |
| 121 | Ga0070716_100002138 | 3300006173 | Bacteria | 9082 |
| 122 | Ga0070716_100013388 | 3300006173 | Bacteria | 4178 |
| 123 | Ga0070712_100047535 | 3300006175 | Bacteria | 2970 |
| 124 | Ga0070712_100240873 | 3300006175 | Bacteria | 1441 |
| 125 | Ga0075367_10092235 | 3300006178 | Bacteria | 1844 |
| 126 | Ga0075369_10043758 | 3300006186 | Bacteria | 1922 |
| 127 | Ga0075369_10076719 | 3300006186 | Bacteria | 1478 |
| 128 | Ga0075366_10061029 | 3300006195 | Bacteria | 2240 |
| 129 | Ga0097621_100249243 | 3300006237 | Bacteria | 1555 |
| 130 | Ga0075370_10156285 | 3300006353 | Bacteria | 1337 |
| 131 | Ga0068871_100330798 | 3300006358 | Bacteria | 1344 |
| 132 | Ga0075428_100045101 | 3300006844 | Bacteria | 4844 |
| 133 | Ga0075430_100389813 | 3300006846 | Bacteria | 1150 |
| 134 | Ga0075433_10217483 | 3300006852 | Bacteria | 1698 |
| 135 | Ga0068865_100349271 | 3300006881 | Bacteria | 1198 |
| 136 | Ga0075436_100397440 | 3300006914 | Bacteria | 998 |
| 137 | Ga0097620_100184562 | 3300006931 | Bacteria | 2169 |
| 138 | Ga0099823_1022515 | 3300006944 | Bacteria | 5827 |
| 139 | Ga0099795_10064146 | 3300007788 | Bacteria | 1371 |
| 140 | Ga0105240_10004955 | 3300009093 | Bacteria | 20025 |
| 141 | Ga0105240_10008228 | 3300009093 | Bacteria | 14944 |
| 142 | Ga0105240_10031181 | 3300009093 | Bacteria | 6917 |
| 143 | Ga0105245_10197939 | 3300009098 | Bacteria | 1928 |
| 144 | Ga0105245_10231917 | 3300009098 | Bacteria | 1786 |
| 145 | Ga0105247_10010882 | 3300009101 | Bacteria | 5496 |
| 146 | Ga0114129_10721610 | 3300009147 | Bacteria | 1279 |
| 147 | Ga0105241_10002286 | 3300009174 | Bacteria | 14395 |
| 148 | Ga0105241_10072988 | 3300009174 | Bacteria | 2669 |
| 149 | Ga0105241_10082572 | 3300009174 | Bacteria | 2519 |
| 150 | Ga0105248_10549277 | 3300009177 | Bacteria | 1303 |
| 151 | Ga0105237_10010095 | 3300009545 | Bacteria | 10071 |
| 152 | Ga0105237_10168546 | 3300009545 | Bacteria | 2189 |
| 153 | Ga0105237_10304187 | 3300009545 | Bacteria | 1598 |
| 154 | Ga0105237_10637369 | 3300009545 | Bacteria | 1073 |
| 155 | Ga0105237_10789028 | 3300009545 | Bacteria | 957 |
| 156 | Ga0105238_10000905 | 3300009551 | Bacteria | 30512 |
| 157 | Ga0105238_10015713 | 3300009551 | Bacteria | 7663 |
| 158 | Ga0105238_10030039 | 3300009551 | Bacteria | 5531 |
| 159 | Ga0105238_10050367 | 3300009551 | Bacteria | 4193 |
| 160 | Ga0105238_10074317 | 3300009551 | Bacteria | 3392 |
| 161 | Ga0105238_10597241 | 3300009551 | Bacteria | 1111 |
| 162 | Ga0105249_10164867 | 3300009553 | Bacteria | 2144 |
| 163 | Ga0105249_10269902 | 3300009553 | Bacteria | 1694 |
| 164 | Ga0105239_10002519 | 3300010375 | Bacteria | 23275 |
| 165 | Ga0105239_10024695 | 3300010375 | Bacteria | 6620 |
| 166 | Ga0105239_10064493 | 3300010375 | Bacteria | 4021 |
| 167 | Ga0105239_10080757 | 3300010375 | Bacteria | 3578 |
| 168 | Ga0105239_10199644 | 3300010375 | Bacteria | 2240 |
| 169 | Ga0105239_10211410 | 3300010375 | Bacteria | 2174 |
| 170 | Ga0105239_10279826 | 3300010375 | Bacteria | 1878 |
| 171 | Ga0105239_10356811 | 3300010375 | Bacteria | 1651 |
| 172 | Ga0105246_10081781 | 3300011119 | Bacteria | 2303 |
| 173 | Ga0157373_10053256 | 3300013100 | Bacteria | 2877 |
| 174 | Ga0157370_10129027 | 3300013104 | Bacteria | 2359 |
| 175 | Ga0157370_10402729 | 3300013104 | Bacteria | 1259 |
| 176 | Ga0157369_10071197 | 3300013105 | Bacteria | 3733 |
| 177 | Ga0157369_10684080 | 3300013105 | Bacteria | 1057 |
| 178 | Ga0157374_10228057 | 3300013296 | Bacteria | 1829 |
| 179 | Ga0157378_10743896 | 3300013297 | Bacteria | 1003 |
| 180 | Ga0163162_10277441 | 3300013306 | Bacteria | 1808 |
| 181 | Ga0157372_10271108 | 3300013307 | Bacteria | 1972 |
| 182 | Ga0157375_10028391 | 3300013308 | Bacteria | 5244 |
| 183 | Ga0157375_10293938 | 3300013308 | Bacteria | 1788 |
| 184 | Ga0157375_10410565 | 3300013308 | Bacteria | 1520 |
| 185 | Ga0163163_10002009 | 3300014325 | Bacteria | 17183 |
| 186 | Ga0163163_10033178 | 3300014325 | Bacteria | 4992 |
| 187 | Ga0157380_10127343 | 3300014326 | Bacteria | 2167 |
| 188 | Ga0182008_10159463 | 3300014497 | Bacteria | 1135 |
| 189 | Ga0157377_10178578 | 3300014745 | Bacteria | 1333 |
| 190 | Ga0157379_10179402 | 3300014968 | Bacteria | 1913 |
| 191 | Ga0157376_10010998 | 3300014969 | Bacteria | 6649 |
| 192 | Ga0206353_10148081 | 3300020082 | Bacteria | 1075 |
| 193 | Ga0206353_10567907 | 3300020082 | Bacteria | 2027 |
| 194 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 195 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 196 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 197 | Ga0214543_1001466 | 3300021327 | Bacteria | 45567 |
| 198 | Ga0213873_10024285 | 3300021358 | Bacteria | 1453 |
| 199 | Ga0213872_10015515 | 3300021361 | Bacteria | 3540 |
| 200 | Ga0213876_10002439 | 3300021384 | Bacteria | 10933 |
| 201 | Ga0209563_108642 | 3300025230 | Bacteria | 1592 |
| 202 | Ga0209677_100672 | 3300025253 | Bacteria | 17650 |
| 203 | Ga0209677_105633 | 3300025253 | Bacteria | 3210 |
| 204 | Ga0209148_1000282 | 3300025254 | Bacteria | 78016 |
| 205 | Ga0209233_1005872 | 3300025261 | Bacteria | 4028 |
| 206 | Ga0209455_1002393 | 3300025272 | Bacteria | 7284 |
| 207 | Ga0207673_1005554 | 3300025290 | Bacteria | 1542 |
| 208 | Ga0209564_1000321 | 3300025295 | Bacteria | 93331 |
| 209 | Ga0209564_1003702 | 3300025295 | Bacteria | 10062 |
| 210 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 211 | Ga0209758_1000635 | 3300025297 | Bacteria | 53736 |
| 212 | Ga0209758_1001996 | 3300025297 | Bacteria | 21984 |
| 213 | Ga0209758_1002493 | 3300025297 | Bacteria | 18700 |
| 214 | Ga0209758_1011302 | 3300025297 | Bacteria | 5193 |
| 215 | Ga0209758_1017490 | 3300025297 | Bacteria | 3566 |
| 216 | Ga0209256_1015129 | 3300025299 | Bacteria | 2720 |
| 217 | Ga0209256_1032713 | 3300025299 | Bacteria | 1407 |
| 218 | Ga0207426_1002082 | 3300025302 | Bacteria | 13833 |
| 219 | Ga0207426_1004116 | 3300025302 | Bacteria | 7310 |
| 220 | Ga0207426_1020494 | 3300025302 | Bacteria | 2297 |
| 221 | Ga0207426_1024931 | 3300025302 | Bacteria | 2021 |
| 222 | Ga0209257_1000473 | 3300025304 | Bacteria | 73323 |
| 223 | Ga0209257_1017693 | 3300025304 | Bacteria | 2792 |
| 224 | Ga0207697_10065589 | 3300025315 | Bacteria | 1515 |
| 225 | Ga0207656_10008173 | 3300025321 | Bacteria | 3840 |
| 226 | Ga0207692_10002026 | 3300025898 | Bacteria | 7732 |
| 227 | Ga0207692_10012905 | 3300025898 | Bacteria | 3605 |
| 228 | Ga0207647_10014195 | 3300025904 | Bacteria | 5498 |
| 229 | Ga0207647_10168847 | 3300025904 | Bacteria | 1274 |
| 230 | Ga0207685_10016028 | 3300025905 | Bacteria | 2388 |
| 231 | Ga0207685_10035616 | 3300025905 | Bacteria | 1818 |
| 232 | Ga0207699_10003043 | 3300025906 | Bacteria | 7960 |
| 233 | Ga0207699_10007202 | 3300025906 | Bacteria | 5431 |
| 234 | Ga0207699_10038283 | 3300025906 | Bacteria | 2747 |
| 235 | Ga0207699_10245906 | 3300025906 | Bacteria | 1231 |
| 236 | Ga0207699_10323155 | 3300025906 | Bacteria | 1083 |
| 237 | Ga0207645_10179478 | 3300025907 | Bacteria | 1389 |
| 238 | Ga0207684_10077500 | 3300025910 | Bacteria | 2827 |
| 239 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 240 | Ga0207654_10006549 | 3300025911 | Bacteria | 5860 |
| 241 | Ga0207654_10011597 | 3300025911 | Bacteria | 4498 |
| 242 | Ga0207654_10089954 | 3300025911 | Bacteria | 1869 |
| 243 | Ga0207707_10004700 | 3300025912 | Bacteria | 11981 |
| 244 | Ga0207707_10035006 | 3300025912 | Bacteria | 4391 |
| 245 | Ga0207707_10054133 | 3300025912 | Bacteria | 3493 |
| 246 | Ga0207707_10104173 | 3300025912 | Bacteria | 2479 |
| 247 | Ga0207707_10158480 | 3300025912 | Bacteria | 1979 |
| 248 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 249 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 250 | Ga0207695_10115822 | 3300025913 | Bacteria | 2654 |
| 251 | Ga0207695_10254960 | 3300025913 | Bacteria | 1653 |
| 252 | Ga0207695_10318707 | 3300025913 | Bacteria | 1444 |
| 253 | Ga0207671_10018412 | 3300025914 | Bacteria | 5360 |
| 254 | Ga0207671_10042434 | 3300025914 | Bacteria | 3367 |
| 255 | Ga0207671_10069130 | 3300025914 | Bacteria | 2633 |
| 256 | Ga0207671_10094158 | 3300025914 | Bacteria | 2260 |
| 257 | Ga0207671_10282289 | 3300025914 | Bacteria | 1310 |
| 258 | Ga0207671_10461891 | 3300025914 | Bacteria | 1012 |
| 259 | Ga0207693_10000310 | 3300025915 | Bacteria | 45408 |
| 260 | Ga0207693_10021450 | 3300025915 | Bacteria | 5132 |
| 261 | Ga0207693_10034078 | 3300025915 | Bacteria | 4016 |
| 262 | Ga0207693_10035714 | 3300025915 | Bacteria | 3919 |
| 263 | Ga0207693_10181848 | 3300025915 | Bacteria | 1655 |
| 264 | Ga0207693_10354295 | 3300025915 | Bacteria | 1148 |
| 265 | Ga0207663_10016715 | 3300025916 | Bacteria | 4075 |
| 266 | Ga0207663_10019867 | 3300025916 | Bacteria | 3793 |
| 267 | Ga0207663_10083697 | 3300025916 | Bacteria | 2096 |
| 268 | Ga0207660_10076914 | 3300025917 | Bacteria | 2441 |
| 269 | Ga0207660_10081275 | 3300025917 | Bacteria | 2381 |
| 270 | Ga0207660_10189160 | 3300025917 | Bacteria | 1602 |
| 271 | Ga0207657_10029294 | 3300025919 | Bacteria | 5013 |
| 272 | Ga0207657_10073517 | 3300025919 | Bacteria | 2889 |
| 273 | Ga0207657_10131985 | 3300025919 | Bacteria | 2046 |
| 274 | Ga0207649_10410030 | 3300025920 | Bacteria | 1016 |
| 275 | Ga0207652_10076915 | 3300025921 | Bacteria | 2911 |
| 276 | Ga0207652_10079219 | 3300025921 | Bacteria | 2870 |
| 277 | Ga0207652_10136044 | 3300025921 | Bacteria | 2194 |
| 278 | Ga0207681_10066644 | 3300025923 | Bacteria | 2493 |
| 279 | Ga0207694_10001009 | 3300025924 | Bacteria | 24556 |
| 280 | Ga0207694_10034117 | 3300025924 | Bacteria | 3901 |
| 281 | Ga0207694_10274993 | 3300025924 | Bacteria | 1382 |
| 282 | Ga0207687_10004089 | 3300025927 | Bacteria | 9778 |
| 283 | Ga0207687_10330306 | 3300025927 | Bacteria | 1237 |
| 284 | Ga0207687_10350902 | 3300025927 | Bacteria | 1202 |
| 285 | Ga0207700_10093504 | 3300025928 | Bacteria | 2380 |
| 286 | Ga0207700_10117026 | 3300025928 | Bacteria | 2154 |
| 287 | Ga0207700_10154584 | 3300025928 | Bacteria | 1899 |
| 288 | Ga0207664_10061778 | 3300025929 | Bacteria | 2990 |
| 289 | Ga0207664_10103518 | 3300025929 | Bacteria | 2356 |
| 290 | Ga0207664_10487302 | 3300025929 | Bacteria | 1103 |
| 291 | Ga0207664_10588483 | 3300025929 | Bacteria | 999 |
| 292 | Ga0207644_10066408 | 3300025931 | Bacteria | 2626 |
| 293 | Ga0207706_10203009 | 3300025933 | Bacteria | 1738 |
| 294 | Ga0207709_10250155 | 3300025935 | Bacteria | 1294 |
| 295 | Ga0207665_10001734 | 3300025939 | Bacteria | 14668 |
| 296 | Ga0207665_10004258 | 3300025939 | Bacteria | 9511 |
| 297 | Ga0207665_10061076 | 3300025939 | Bacteria | 2554 |
| 298 | Ga0207665_10085508 | 3300025939 | Bacteria | 2178 |
| 299 | Ga0207691_10172053 | 3300025940 | Bacteria | 1896 |
| 300 | Ga0207691_10203813 | 3300025940 | Bacteria | 1721 |
| 301 | Ga0207691_10441320 | 3300025940 | Bacteria | 1108 |
| 302 | Ga0207711_10211107 | 3300025941 | Bacteria | 1773 |
| 303 | Ga0207689_10039585 | 3300025942 | Bacteria | 3902 |
| 304 | Ga0207661_10044403 | 3300025944 | Bacteria | 3512 |
| 305 | Ga0207661_10056040 | 3300025944 | Bacteria | 3163 |
| 306 | Ga0207661_10073930 | 3300025944 | Bacteria | 2793 |
| 307 | Ga0207661_10175645 | 3300025944 | Bacteria | 1867 |
| 308 | Ga0207661_10670737 | 3300025944 | Bacteria | 953 |
| 309 | Ga0207679_10390674 | 3300025945 | Bacteria | 1222 |
| 310 | Ga0207667_10006596 | 3300025949 | Bacteria | 14034 |
| 311 | Ga0207667_10088774 | 3300025949 | Bacteria | 3196 |
| 312 | Ga0207667_10109852 | 3300025949 | Bacteria | 2844 |
| 313 | Ga0207667_10160793 | 3300025949 | Bacteria | 2310 |
| 314 | Ga0207667_10281972 | 3300025949 | Bacteria | 1698 |
| 315 | Ga0207640_10047734 | 3300025981 | Bacteria | 2764 |
| 316 | Ga0207640_10186435 | 3300025981 | Bacteria | 1560 |
| 317 | Ga0207658_10306396 | 3300025986 | Bacteria | 1370 |
| 318 | Ga0207677_10024413 | 3300026023 | Bacteria | 3756 |
| 319 | Ga0207677_10198955 | 3300026023 | Bacteria | 1591 |
| 320 | Ga0207703_10078340 | 3300026035 | Bacteria | 2746 |
| 321 | Ga0207703_10281990 | 3300026035 | Bacteria | 1509 |
| 322 | Ga0207639_10013217 | 3300026041 | Bacteria | 5772 |
| 323 | Ga0207639_10123004 | 3300026041 | Bacteria | 2135 |
| 324 | Ga0207678_10003936 | 3300026067 | Bacteria | 13364 |
| 325 | Ga0207678_10046674 | 3300026067 | Bacteria | 3746 |
| 326 | Ga0207678_10096010 | 3300026067 | Bacteria | 2533 |
| 327 | Ga0207678_10422037 | 3300026067 | Bacteria | 1157 |
| 328 | Ga0207708_10085681 | 3300026075 | Bacteria | 2424 |
| 329 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 330 | Ga0207702_10001701 | 3300026078 | Bacteria | 21732 |
| 331 | Ga0207702_10337936 | 3300026078 | Bacteria | 1438 |
| 332 | Ga0207641_10327266 | 3300026088 | Bacteria | 1455 |
| 333 | Ga0207648_10060413 | 3300026089 | Bacteria | 3305 |
| 334 | Ga0207648_10238899 | 3300026089 | Bacteria | 1617 |
| 335 | Ga0207676_10095612 | 3300026095 | Bacteria | 2450 |
| 336 | Ga0207676_10114523 | 3300026095 | Bacteria | 2262 |
| 337 | Ga0207674_10000890 | 3300026116 | Bacteria | 39065 |
| 338 | Ga0207674_10002298 | 3300026116 | Bacteria | 24210 |
| 339 | Ga0207674_10007766 | 3300026116 | Bacteria | 12478 |
| 340 | Ga0207674_10052673 | 3300026116 | Bacteria | 4150 |
| 341 | Ga0207674_10299290 | 3300026116 | Bacteria | 1558 |
| 342 | Ga0207675_100122516 | 3300026118 | Bacteria | 2461 |
| 343 | Ga0207675_100389764 | 3300026118 | Bacteria | 1371 |
| 344 | Ga0207683_10016524 | 3300026121 | Bacteria | 6283 |
| 345 | Ga0207683_10169315 | 3300026121 | Bacteria | 1978 |
| 346 | Ga0207698_10031595 | 3300026142 | Bacteria | 3824 |
| 347 | Ga0207698_10183463 | 3300026142 | Bacteria | 1856 |
| 348 | Ga0207698_10350202 | 3300026142 | Bacteria | 1395 |
| 349 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 350 | Ga0209389_1000182 | 3300027296 | Bacteria | 48705 |
| 351 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 352 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 353 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 354 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 355 | Ga0209489_100209 | 3300027361 | Bacteria | 96349 |
| 356 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 357 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 358 | Ga0209588_1073887 | 3300027671 | Bacteria | 1101 |
| 359 | Ga0268266_10045729 | 3300028379 | Bacteria | 3745 |
| 360 | Ga0268266_10184329 | 3300028379 | Bacteria | 1902 |
| 361 | Ga0268266_10199057 | 3300028379 | Bacteria | 1832 |
| 362 | Ga0268266_10410158 | 3300028379 | Bacteria | 1282 |
| 363 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 364 | Ga0265337_1018782 | 3300028556 | Bacteria | 2189 |
| 365 | Ga0265326_10008390 | 3300028558 | Bacteria | 3118 |
| 366 | Ga0265319_1012969 | 3300028563 | Bacteria | 3340 |
| 367 | Ga0265334_10013964 | 3300028573 | Bacteria | 3354 |
| 368 | Ga0265318_10016635 | 3300028577 | Bacteria | 3034 |
| 369 | Ga0265323_10007956 | 3300028653 | Bacteria | 4383 |
| 370 | Ga0265336_10000561 | 3300028666 | Bacteria | 21059 |
| 371 | Ga0307517_10001338 | 3300028786 | Bacteria | 41372 |
| 372 | Ga0307515_10125511 | 3300028794 | Bacteria | 2870 |
| 373 | Ga0307515_10140350 | 3300028794 | Bacteria | 2596 |
| 374 | Ga0265338_10000598 | 3300028800 | Bacteria | 63497 |
| 375 | Ga0265332_10016039 | 3300031238 | Bacteria | 3306 |
| 376 | Ga0265332_10027603 | 3300031238 | Bacteria | 2486 |
| 377 | Ga0265332_10072613 | 3300031238 | Bacteria | 1465 |
| 378 | Ga0265328_10044554 | 3300031239 | Bacteria | 1632 |
| 379 | Ga0265325_10009157 | 3300031241 | Bacteria | 5799 |
| 380 | Ga0265340_10041599 | 3300031247 | Bacteria | 2258 |
| 381 | Ga0265340_10042492 | 3300031247 | Bacteria | 2231 |
| 382 | Ga0265339_10007110 | 3300031249 | Bacteria | 7267 |
| 383 | Ga0265339_10029701 | 3300031249 | Bacteria | 3099 |
| 384 | Ga0265339_10099122 | 3300031249 | Bacteria | 1519 |
| 385 | Ga0265331_10027874 | 3300031250 | Bacteria | 2828 |
| 386 | Ga0265331_10100059 | 3300031250 | Bacteria | 1335 |
| 387 | Ga0307513_10105188 | 3300031456 | Bacteria | 2833 |
| 388 | Ga0307513_10164506 | 3300031456 | Bacteria | 2105 |
| 389 | Ga0307513_10169966 | 3300031456 | Bacteria | 2059 |
| 390 | Ga0307513_10222288 | 3300031456 | Bacteria | 1708 |
| 391 | Ga0307408_100239375 | 3300031548 | Bacteria | 1491 |
| 392 | Ga0265313_10041739 | 3300031595 | Bacteria | 2258 |
| 393 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 394 | Ga0307508_10078616 | 3300031616 | Bacteria | 2879 |
| 395 | Ga0265314_10005687 | 3300031711 | Bacteria | 11193 |
| 396 | Ga0265314_10147464 | 3300031711 | Bacteria | 1447 |
| 397 | Ga0265342_10005853 | 3300031712 | Bacteria | 9282 |
| 398 | Ga0307516_10006094 | 3300031730 | Bacteria | 14234 |
| 399 | Ga0307516_10010553 | 3300031730 | Bacteria | 10142 |
| 400 | Ga0307516_10104788 | 3300031730 | Bacteria | 2640 |
| 401 | Ga0307406_10168105 | 3300031901 | Bacteria | 1584 |
| 402 | Ga0307415_100362721 | 3300032126 | Bacteria | 1224 |
| 403 | Ga0307507_10027443 | 3300033179 | Bacteria | 6103 |
| 404 | Ga0307510_10024755 | 3300033180 | Bacteria | 6932 |
| 405 | Ga0307510_10025056 | 3300033180 | Bacteria | 6887 |
| 406 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 407 | Ga0316215_1002237 | 3300033544 | Bacteria | 1828 |
| 408 | Ga0373926_0039711 | 3300035083 | Bacteria | 1679 |
| 409 | Ga0373934_0002932 | 3300035086 | Bacteria | 6241 |
| 410 | Ga0373944_0042120 | 3300035089 | Bacteria | 1415 |
| 411 | Ga0373923_0009618 | 3300035111 | Bacteria | 3495 |
| 412 | Ga0373936_0016692 | 3300035113 | Bacteria | 2825 |
| 413 | Ga0373936_0036388 | 3300035113 | Bacteria | 1963 |
| 414 | Ga0373936_0070087 | 3300035113 | Bacteria | 1444 |
| 415 | Ga0373936_0133190 | 3300035113 | Bacteria | 1069 |
| 416 | Ga0373941_0063086 | 3300035115 | Bacteria | 1211 |
| 417 | Ga0373945_0002529 | 3300035116 | Bacteria | 5721 |
| 418 | Ga0373945_0019734 | 3300035116 | Bacteria | 2302 |
| 419 | Ga0373953_0000955 | 3300035117 | Bacteria | 8086 |
| 420 | Ga0373953_0034938 | 3300035117 | Bacteria | 1973 |
| 421 | Ga0373954_0018760 | 3300035118 | Bacteria | 3116 |
| 422 | Ga0373954_0018968 | 3300035118 | Bacteria | 3100 |
| 423 | Ga0373956_0068497 | 3300035119 | Bacteria | 1616 |
| 424 | Ga0373957_0006831 | 3300035120 | Bacteria | 3617 |
| 425 | Ga0373943_0002107 | 3300035170 | Bacteria | 9037 |
| 426 | Ga0373943_0046258 | 3300035170 | Bacteria | 2123 |
| 427 | Ga0373943_0056690 | 3300035170 | Bacteria | 1945 |
| 428 | Ga0373943_0083317 | 3300035170 | Bacteria | 1643 |
| 429 | Ga0373946_0001889 | 3300035171 | Bacteria | 7311 |
| 430 | Ga0373946_0104972 | 3300035171 | Bacteria | 1271 |
| 431 | Ga0373955_0005406 | 3300035172 | Bacteria | 5739 |
| 432 | Ga0373924_0005676 | 3300035410 | Bacteria | 4427 |
| 433 | Ga0373924_0060733 | 3300035410 | Bacteria | 1581 |
| 434 | Ga0373931_0019569 | 3300035691 | Bacteria | 3382 |
| 435 | Ga0373935_0000557 | 3300035692 | Bacteria | 19409 |
| 436 | Ga0373935_0308415 | 3300035692 | Bacteria | 1120 |
| 437 | Ga0373935_0443493 | 3300035692 | Bacteria | 937 |
| 438 | Ga0373927_0003654 | 3300035695 | Bacteria | 10968 |
| 439 | Ga0373927_0010418 | 3300035695 | Bacteria | 6199 |
| 440 | Ga0373927_0021960 | 3300035695 | Bacteria | 4182 |
| 441 | Ga0373927_0027049 | 3300035695 | Bacteria | 3748 |
| 442 | Ga0373927_0036371 | 3300035695 | Bacteria | 3202 |
| 443 | Ga0373927_0235046 | 3300035695 | Bacteria | 1204 |
| 444 | Ga0373933_0000031 | 3300035724 | Bacteria | 85038 |
| 445 | Ga0373933_0003419 | 3300035724 | Bacteria | 8846 |
| 446 | Ga0373933_0082944 | 3300035724 | Bacteria | 1968 |
| 447 | Ga0373947_0000509 | 3300035725 | Bacteria | 22579 |
| 448 | Ga0373947_0049307 | 3300035725 | Bacteria | 2528 |
| 449 | Ga0373947_0151339 | 3300035725 | Bacteria | 1495 |
| 450 | Ga0373947_0346433 | 3300035725 | Bacteria | 996 |
| 451 | Ga0373937_0033982 | 3300036401 | Bacteria | 4636 |
| 452 | Ga0373937_0284966 | 3300036401 | Bacteria | 1560 |
| 453 | Ga0373937_0380292 | 3300036401 | Bacteria | 1339 |
| 454 | Ga0373925_0001713 | 3300037068 | Bacteria | 18492 |
| 455 | Ga0373925_0025981 | 3300037068 | Bacteria | 4281 |
| 456 | Ga0373925_0078993 | 3300037068 | Bacteria | 2499 |
| 457 | Ga0373925_0110677 | 3300037068 | Bacteria | 2121 |
| 458 | Ga0373925_0110804 | 3300037068 | Bacteria | 2120 |
| 459 | Ga0373925_0192510 | 3300037068 | Bacteria | 1618 |
| 460 | Ga0373925_0205586 | 3300037068 | Bacteria | 1567 |
| 461 | Ga0395900_0003383 | 3300037418 | Bacteria | 17226 |
| 462 | Ga0395900_0080281 | 3300037418 | Bacteria | 3352 |
| 463 | Ga0395900_0546461 | 3300037418 | Bacteria | 1103 |
| 464 | Ga0395898_0013386 | 3300037466 | Bacteria | 8449 |
| 465 | Ga0395898_0018463 | 3300037466 | Bacteria | 7111 |
| 466 | Ga0395898_0079473 | 3300037466 | Bacteria | 3164 |
| 467 | Ga0395898_0099077 | 3300037466 | Bacteria | 2799 |
| 468 | Ga0395905_0005856 | 3300037471 | Bacteria | 12492 |
| 469 | Ga0395905_0023254 | 3300037471 | Bacteria | 5859 |
| 470 | Ga0395905_0060606 | 3300037471 | Bacteria | 3538 |
| 471 | Ga0395905_0165060 | 3300037471 | Bacteria | 2081 |
| 472 | Ga0436364_0709114 | 3300037853 | Bacteria | 1183 |
| 473 | Ga0395901_0161395 | 3300038443 | Bacteria | 2354 |
| 474 | Ga0395901_0224667 | 3300038443 | Bacteria | 1962 |
| 475 | Ga0436365_0076766 | 3300039437 | Bacteria | 1643 |
| 476 | Ga0436365_0803057 | 3300039437 | Bacteria | 5477 |
| 477 | Ga0436365_0958057 | 3300039437 | Bacteria | 1211 |
| 478 | Ga0436365_0966323 | 3300039437 | Bacteria | 3151 |
| 479 | Ga0436365_1369931 | 3300039437 | Bacteria | 1176 |
| 480 | Ga0436361_0336324 | 3300039447 | Bacteria | 2835 |
| 481 | Ga0436361_0937863 | 3300039447 | Bacteria | 1391 |
| 482 | Ga0436363_0697337 | 3300039450 | Bacteria | 2088 |
| 483 | Ga0439465_0013621 | 3300041413 | Bacteria | 2533 |
| 484 | Ga0466969_0128100 | 3300044656 | Bacteria | 1178 |
| 485 | Ga0466972_0000119 | 3300044658 | Bacteria | 66620 |
| 486 | Ga0466972_0010560 | 3300044658 | Bacteria | 4634 |
| 487 | Ga0466966_0034959 | 3300044684 | Bacteria | 3248 |
| 488 | Ga0466966_0041766 | 3300044684 | Bacteria | 2946 |
| 489 | Ga0466961_0000139 | 3300044693 | Bacteria | 48781 |
| 490 | Ga0466963_0080797 | 3300044694 | Bacteria | 2201 |
| 491 | Ga0466963_0117349 | 3300044694 | Bacteria | 1829 |
| 492 | Ga0466971_0174557 | 3300044719 | Bacteria | 1009 |
| 493 | Ga0466968_0017207 | 3300044735 | Bacteria | 2886 |
| 494 | Ga0466968_0021266 | 3300044735 | Bacteria | 2626 |
| 495 | Ga0466968_0100658 | 3300044735 | Bacteria | 1290 |
| 496 | Ga0466970_0045604 | 3300044765 | Bacteria | 2335 |
| 497 | Ga0466970_0185989 | 3300044765 | Bacteria | 1153 |
| 498 | Ga0466957_0035033 | 3300044842 | Bacteria | 3012 |
| 499 | Ga0466960_0000848 | 3300044901 | Bacteria | 10813 |
| 500 | Ga0466959_0034008 | 3300045049 | Bacteria | 3771 |
| 501 | Ga0466959_0053472 | 3300045049 | Bacteria | 2952 |
| 502 | Ga0466959_0240101 | 3300045049 | Bacteria | 1252 |
| 503 | Ga0466959_0361912 | 3300045049 | Bacteria | 988 |
| 504 | Ga0466967_0004006 | 3300045976 | Bacteria | 9819 |
| 505 | Ga0466967_0011512 | 3300045976 | Bacteria | 6706 |
| 506 | Ga0466967_0088324 | 3300045976 | Bacteria | 2813 |
| 507 | Ga0466967_0160685 | 3300045976 | Bacteria | 2108 |
| 508 | Ga0495592_0058216 | 3300046454 | Bacteria | 2850 |
| 509 | Ga0495592_0140768 | 3300046454 | Bacteria | 1678 |
| 510 | Ga0495592_0300267 | 3300046454 | Bacteria | 1044 |
| 511 | Ga0495603_0000047 | 3300046455 | Bacteria | 53081 |
| 512 | Ga0495603_0055753 | 3300046455 | Bacteria | 2341 |
| 513 | Ga0495603_0070506 | 3300046455 | Bacteria | 2054 |
| 514 | Ga0495629_0000320 | 3300046459 | Bacteria | 41151 |
| 515 | Ga0495629_0005536 | 3300046459 | Bacteria | 9427 |
| 516 | Ga0495629_0231283 | 3300046459 | Bacteria | 1274 |
| 517 | Ga0495638_0001094 | 3300046460 | Bacteria | 26401 |
| 518 | Ga0495638_0053016 | 3300046460 | Bacteria | 2524 |
| 519 | Ga0495641_0009584 | 3300046461 | Bacteria | 5738 |
| 520 | Ga0495651_0017530 | 3300046462 | Bacteria | 5546 |
| 521 | Ga0495651_0041190 | 3300046462 | Bacteria | 3588 |
| 522 | Ga0495651_0086113 | 3300046462 | Bacteria | 2365 |
| 523 | Ga0495651_0095034 | 3300046462 | Bacteria | 2230 |
| 524 | Ga0495653_0003027 | 3300046463 | Bacteria | 13478 |
| 525 | Ga0495653_0070906 | 3300046463 | Bacteria | 2606 |
| 526 | Ga0495580_0090453 | 3300046472 | Bacteria | 2131 |
| 527 | Ga0495582_0000043 | 3300046473 | Bacteria | 63647 |
| 528 | Ga0495582_0024699 | 3300046473 | Bacteria | 3289 |
| 529 | Ga0495582_0032646 | 3300046473 | Bacteria | 2862 |
| 530 | Ga0495582_0042626 | 3300046473 | Bacteria | 2499 |
| 531 | Ga0495605_0072307 | 3300046474 | Bacteria | 1627 |
| 532 | Ga0495605_0092896 | 3300046474 | Bacteria | 1396 |
| 533 | Ga0495639_0000091 | 3300046475 | Bacteria | 44027 |
| 534 | Ga0495662_0000128 | 3300046476 | Bacteria | 28645 |
| 535 | Ga0495664_0009771 | 3300046477 | Bacteria | 5377 |
| 536 | Ga0495664_0016934 | 3300046477 | Bacteria | 4162 |
| 537 | Ga0495664_0053492 | 3300046477 | Bacteria | 2401 |
| 538 | Ga0495584_0016366 | 3300046491 | Bacteria | 3782 |
| 539 | Ga0495584_0036022 | 3300046491 | Bacteria | 2500 |
| 540 | Ga0495585_0027616 | 3300046492 | Bacteria | 3239 |
| 541 | Ga0495594_0002035 | 3300046499 | Bacteria | 10525 |
| 542 | Ga0495594_0137115 | 3300046499 | Bacteria | 1387 |
| 543 | Ga0495596_0056530 | 3300046500 | Bacteria | 1532 |
| 544 | Ga0495607_0012073 | 3300046501 | Bacteria | 5715 |
| 545 | Ga0495583_0020205 | 3300046506 | Bacteria | 3457 |
| 546 | Ga0495606_0000252 | 3300046507 | Bacteria | 94511 |
| 547 | Ga0495606_0037168 | 3300046507 | Bacteria | 3308 |
| 548 | Ga0495606_0048505 | 3300046507 | Bacteria | 2792 |
| 549 | Ga0495606_0082443 | 3300046507 | Bacteria | 1996 |
| 550 | Ga0495606_0194800 | 3300046507 | Bacteria | 1159 |
| 551 | Ga0495608_0017766 | 3300046511 | Bacteria | 4918 |
| 552 | Ga0495610_0055708 | 3300046512 | Bacteria | 1904 |
| 553 | Ga0495616_0025586 | 3300046513 | Bacteria | 3151 |
| 554 | Ga0495616_0134523 | 3300046513 | Bacteria | 1130 |
| 555 | Ga0495618_0010884 | 3300046514 | Bacteria | 5507 |
| 556 | Ga0495620_0014398 | 3300046515 | Bacteria | 4020 |
| 557 | Ga0495628_0057540 | 3300046516 | Bacteria | 3058 |
| 558 | Ga0495628_0108009 | 3300046516 | Bacteria | 2142 |
| 559 | Ga0495628_0261808 | 3300046516 | Bacteria | 1289 |
| 560 | Ga0495628_0314815 | 3300046516 | Bacteria | 1156 |
| 561 | Ga0495630_0014946 | 3300046517 | Bacteria | 5661 |
| 562 | Ga0495631_0025195 | 3300046518 | Bacteria | 2741 |
| 563 | Ga0495631_0081283 | 3300046518 | Bacteria | 1398 |
| 564 | Ga0495637_0028566 | 3300046520 | Bacteria | 2490 |
| 565 | Ga0495643_0063715 | 3300046522 | Bacteria | 1949 |
| 566 | Ga0495644_0031813 | 3300046523 | Bacteria | 1994 |
| 567 | Ga0495648_0000286 | 3300046524 | Bacteria | 57430 |
| 568 | Ga0495648_0024325 | 3300046524 | Bacteria | 4127 |
| 569 | Ga0495648_0044368 | 3300046524 | Bacteria | 2776 |
| 570 | Ga0495648_0072499 | 3300046524 | Bacteria | 1992 |
| 571 | Ga0495648_0125545 | 3300046524 | Bacteria | 1372 |
| 572 | Ga0495666_0015987 | 3300046526 | Bacteria | 3737 |
| 573 | Ga0495666_0192723 | 3300046526 | Bacteria | 939 |
| 574 | Ga0495652_0011857 | 3300046529 | Bacteria | 7878 |
| 575 | Ga0495652_0034268 | 3300046529 | Bacteria | 4426 |
| 576 | Ga0495665_0000051 | 3300046531 | Bacteria | 46836 |
| 577 | Ga0495640_0007555 | 3300046533 | Bacteria | 8540 |
| 578 | Ga0495640_0018565 | 3300046533 | Bacteria | 5152 |
| 579 | Ga0495640_0074727 | 3300046533 | Bacteria | 2265 |
| 580 | Ga0495640_0112835 | 3300046533 | Bacteria | 1774 |
| 581 | Ga0495586_0047218 | 3300046535 | Bacteria | 2324 |
| 582 | Ga0495587_0008144 | 3300046536 | Bacteria | 6757 |
| 583 | Ga0495587_0029650 | 3300046536 | Bacteria | 3321 |
| 584 | Ga0495598_0005762 | 3300046537 | Bacteria | 2766 |
| 585 | Ga0495645_0021133 | 3300046543 | Bacteria | 4704 |
| 586 | Ga0495645_0102551 | 3300046543 | Bacteria | 2033 |
| 587 | Ga0495622_0015099 | 3300046557 | Bacteria | 3590 |
| 588 | Ga0495622_0021698 | 3300046557 | Bacteria | 2990 |
| 589 | Ga0495633_0006412 | 3300046558 | Bacteria | 6977 |
| 590 | Ga0495667_0004751 | 3300046559 | Bacteria | 9185 |
| 591 | Ga0495667_0006502 | 3300046559 | Bacteria | 7933 |
| 592 | Ga0495667_0033150 | 3300046559 | Bacteria | 3457 |
| 593 | Ga0495667_0175879 | 3300046559 | Bacteria | 1375 |
| 594 | Ga0495667_0188219 | 3300046559 | Bacteria | 1323 |
| 595 | Ga0495668_0029459 | 3300046616 | Bacteria | 3101 |
| 596 | Ga0495634_0000400 | 3300046642 | Bacteria | 42620 |
| 597 | Ga0495634_0021637 | 3300046642 | Bacteria | 4542 |
| 598 | Ga0495634_0044581 | 3300046642 | Bacteria | 3001 |
| 599 | Ga0495634_0076053 | 3300046642 | Bacteria | 2204 |
| 600 | Ga0495625_0017905 | 3300046660 | Bacteria | 5537 |
| 601 | Ga0495625_0104162 | 3300046660 | Bacteria | 1945 |
| 602 | Ga0495635_0000620 | 3300046663 | Bacteria | 22835 |
| 603 | Ga0495635_0002202 | 3300046663 | Bacteria | 13254 |
| 604 | Ga0495635_0004059 | 3300046663 | Bacteria | 10161 |
| 605 | Ga0495635_0043268 | 3300046663 | Bacteria | 3108 |
| 606 | Ga0495661_0019545 | 3300046665 | Bacteria | 4437 |
| 607 | Ga0495657_0006604 | 3300046675 | Bacteria | 9061 |
| 608 | Ga0495657_0013678 | 3300046675 | Bacteria | 5977 |
| 609 | Ga0495657_0030794 | 3300046675 | Bacteria | 3754 |
| 610 | Ga0495657_0042749 | 3300046675 | Bacteria | 3092 |
| 611 | Ga0495599_0009906 | 3300046678 | Bacteria | 5832 |
| 612 | Ga0495599_0069977 | 3300046678 | Bacteria | 2190 |
| 613 | Ga0495623_0012518 | 3300046679 | Bacteria | 5488 |
| 614 | Ga0495623_0037441 | 3300046679 | Bacteria | 3103 |
| 615 | Ga0495623_0213500 | 3300046679 | Bacteria | 1103 |
| 616 | Ga0495646_0000643 | 3300046680 | Bacteria | 19081 |
| 617 | Ga0495646_0043973 | 3300046680 | Bacteria | 2733 |
| 618 | Ga0495647_0002769 | 3300046681 | Bacteria | 5563 |
| 619 | Ga0495658_0000499 | 3300046683 | Bacteria | 21574 |
| 620 | Ga0495658_0114457 | 3300046683 | Bacteria | 1625 |
| 621 | Ga0495613_0008984 | 3300046689 | Bacteria | 7414 |
| 622 | Ga0495613_0025117 | 3300046689 | Bacteria | 4440 |
| 623 | Ga0495624_0003704 | 3300046690 | Bacteria | 11299 |
| 624 | Ga0495624_0021704 | 3300046690 | Bacteria | 4254 |
| 625 | Ga0495624_0096046 | 3300046690 | Bacteria | 1826 |
| 626 | Ga0495670_0001762 | 3300046691 | Bacteria | 10629 |
| 627 | Ga0495670_0125248 | 3300046691 | Bacteria | 1337 |
| 628 | Ga0495671_0161834 | 3300046692 | Bacteria | 1088 |
| 629 | Ga0495649_0012129 | 3300046694 | Bacteria | 5029 |
| 630 | Ga0495589_0051700 | 3300046794 | Bacteria | 2031 |
| 631 | Ga0495600_0011578 | 3300046809 | Bacteria | 5501 |
| 632 | Ga0495600_0013331 | 3300046809 | Bacteria | 5162 |
| 633 | Ga0495581_0000486 | 3300047315 | Bacteria | 20240 |
| 634 | Ga0495581_0061415 | 3300047315 | Bacteria | 2172 |
| 635 | Ga0495581_0114111 | 3300047315 | Bacteria | 1571 |
| 636 | Ga0495581_0115928 | 3300047315 | Bacteria | 1558 |
| 637 | Ga0495604_0010785 | 3300047317 | Bacteria | 7256 |
| 638 | Ga0495604_0023859 | 3300047317 | Bacteria | 4881 |
| 639 | Ga0495604_0031639 | 3300047317 | Bacteria | 4196 |
| 640 | Ga0495604_0145351 | 3300047317 | Bacteria | 1690 |
| 641 | Ga0495674_0005428 | 3300047319 | Bacteria | 12243 |
| 642 | Ga0495674_0023537 | 3300047319 | Bacteria | 5675 |
| 643 | Ga0495674_0131189 | 3300047319 | Bacteria | 2111 |
| 644 | Ga0495672_0022435 | 3300047320 | Bacteria | 4103 |
| 645 | Ga0495672_0066467 | 3300047320 | Bacteria | 2057 |
| 646 | Ga0495672_0081560 | 3300047320 | Bacteria | 1801 |
| 647 | Ga0495676_0061706 | 3300047321 | Bacteria | 2931 |
| 648 | Ga0495676_0087102 | 3300047321 | Bacteria | 2348 |
| 649 | Ga0495676_0108612 | 3300047321 | Bacteria | 2040 |
| 650 | Ga0495676_0114727 | 3300047321 | Bacteria | 1970 |
| 651 | Ga0495680_0000689 | 3300047322 | Bacteria | 37846 |
| 652 | Ga0495680_0001909 | 3300047322 | Bacteria | 21876 |
| 653 | Ga0495680_0040967 | 3300047322 | Bacteria | 3685 |
| 654 | Ga0495680_0099424 | 3300047322 | Bacteria | 2169 |
| 655 | Ga0495680_0231698 | 3300047322 | Bacteria | 1315 |
| 656 | Ga0495683_0044814 | 3300047323 | Bacteria | 2224 |
| 657 | Ga0495683_0073135 | 3300047323 | Bacteria | 1681 |
| 658 | Ga0495687_008047 | 3300047443 | Bacteria | 6093 |
| 659 | Ga0495675_0008329 | 3300047444 | Bacteria | 6418 |
| 660 | Ga0495675_0103236 | 3300047444 | Bacteria | 1782 |
| 661 | Ga0495681_0100394 | 3300047470 | Bacteria | 1266 |
| 662 | Ga0495684_0000313 | 3300047471 | Bacteria | 39705 |
| 663 | Ga0495684_0012322 | 3300047471 | Bacteria | 6595 |
| 664 | Ga0495684_0103192 | 3300047471 | Bacteria | 2155 |
| 665 | Ga0495684_0145236 | 3300047471 | Bacteria | 1777 |
| 666 | Ga0495684_0206990 | 3300047471 | Bacteria | 1444 |
| 667 | Ga0495686_0063919 | 3300047472 | Bacteria | 2279 |
| 668 | Ga0495593_0000005 | 3300047673 | Bacteria | 93984 |
| 669 | Ga0495593_0002672 | 3300047673 | Bacteria | 10727 |
| 670 | Ga0495593_0063063 | 3300047673 | Bacteria | 1936 |
| 671 | Ga0495602_0015257 | 3300048088 | Bacteria | 7760 |
| 672 | Ga0495602_0095535 | 3300048088 | Bacteria | 2453 |
| 673 | Ga0495602_0118872 | 3300048088 | Bacteria | 2130 |
| 674 | Ga0495614_0006832 | 3300048089 | Bacteria | 5104 |
| 675 | Ga0495626_0025505 | 3300048091 | Bacteria | 2890 |
| 676 | Ga0495626_0055731 | 3300048091 | Bacteria | 1811 |
| 677 | Ga0495626_0079507 | 3300048091 | Bacteria | 1459 |
| 678 | Ga0496100_0006321 | 3300048903 | Bacteria | 6455 |
| 679 | Ga0496100_0093302 | 3300048903 | Bacteria | 2059 |
| 680 | Ga0496100_0199871 | 3300048903 | Bacteria | 1456 |
| 681 | Ga0496100_0331609 | 3300048903 | Bacteria | 1145 |
| 682 | Ga0496101_0018505 | 3300048904 | Bacteria | 4738 |
| 683 | Ga0496101_0041241 | 3300048904 | Bacteria | 3291 |
| 684 | Ga0496101_0230209 | 3300048904 | Bacteria | 1440 |
| 685 | Ga0496101_0496314 | 3300048904 | Bacteria | 964 |
| 686 | Ga0496102_0001314 | 3300048905 | Bacteria | 22298 |
| 687 | Ga0496102_0009090 | 3300048905 | Bacteria | 8527 |
| 688 | Ga0496102_0542835 | 3300048905 | Bacteria | 1085 |
| 689 | Ga0496102_0554459 | 3300048905 | Bacteria | 1072 |
| 690 | Ga0496103_0025364 | 3300048906 | Bacteria | 3582 |
| 691 | Ga0496103_0047615 | 3300048906 | Bacteria | 2649 |
| 692 | Ga0496103_0250773 | 3300048906 | Bacteria | 1139 |
| 693 | Ga0496104_0002280 | 3300048907 | Bacteria | 16544 |
| 694 | Ga0496104_0003037 | 3300048907 | Bacteria | 14457 |
| 695 | Ga0496104_0007367 | 3300048907 | Bacteria | 9720 |
| 696 | Ga0496104_0018994 | 3300048907 | Bacteria | 6280 |
| 697 | Ga0496104_0030135 | 3300048907 | Bacteria | 5040 |
| 698 | Ga0496104_0159295 | 3300048907 | Bacteria | 2165 |
| 699 | Ga0496104_0272046 | 3300048907 | Bacteria | 1607 |
| 700 | Ga0496105_0000935 | 3300048908 | Bacteria | 19915 |
| 701 | Ga0496105_0003051 | 3300048908 | Bacteria | 12313 |
| 702 | Ga0496105_0027371 | 3300048908 | Bacteria | 4657 |
| 703 | Ga0496105_0040662 | 3300048908 | Bacteria | 3834 |
| 704 | Ga0496105_0126887 | 3300048908 | Bacteria | 2103 |
| 705 | Ga0496106_0000236 | 3300048909 | Bacteria | 38678 |
| 706 | Ga0496106_0014089 | 3300048909 | Bacteria | 5908 |
| 707 | Ga0496106_0060156 | 3300048909 | Bacteria | 2879 |
| 708 | Ga0496106_0126165 | 3300048909 | Bacteria | 2004 |
| 709 | Ga0496106_0264519 | 3300048909 | Bacteria | 1376 |
| 710 | Ga0496107_0003292 | 3300048910 | Bacteria | 10781 |
| 711 | Ga0496107_0091750 | 3300048910 | Bacteria | 2220 |
| 712 | Ga0496107_0110889 | 3300048910 | Bacteria | 2016 |
| 713 | Ga0496107_0130670 | 3300048910 | Bacteria | 1854 |
| 714 | Ga0496107_0152209 | 3300048910 | Bacteria | 1711 |
| 715 | Ga0496107_0171489 | 3300048910 | Bacteria | 1610 |
| 716 | Ga0496107_0239906 | 3300048910 | Bacteria | 1349 |
| 717 | Ga0496107_0244377 | 3300048910 | Bacteria | 1335 |
| 718 | Ga0496107_0265433 | 3300048910 | Bacteria | 1277 |
| 719 | Ga0496108_0000849 | 3300048911 | Bacteria | 23796 |
| 720 | Ga0496108_0016993 | 3300048911 | Bacteria | 5947 |
| 721 | Ga0496108_0047577 | 3300048911 | Bacteria | 3585 |
| 722 | Ga0496108_0053230 | 3300048911 | Bacteria | 3394 |
| 723 | Ga0496108_0304768 | 3300048911 | Bacteria | 1388 |
| 724 | Ga0496108_0360185 | 3300048911 | Bacteria | 1269 |
| 725 | Ga0496108_0372747 | 3300048911 | Bacteria | 1246 |
| 726 | Ga0496109_0000224 | 3300048912 | Bacteria | 55854 |
| 727 | Ga0496109_0010749 | 3300048912 | Bacteria | 7835 |
| 728 | Ga0496109_0011741 | 3300048912 | Bacteria | 7537 |
| 729 | Ga0496109_0073871 | 3300048912 | Bacteria | 3134 |
| 730 | Ga0496109_0148771 | 3300048912 | Bacteria | 2192 |
| 731 | Ga0496110_0004203 | 3300048913 | Bacteria | 11133 |
| 732 | Ga0496110_0008119 | 3300048913 | Bacteria | 8433 |
| 733 | Ga0496110_0027437 | 3300048913 | Bacteria | 4882 |
| 734 | Ga0496110_0056327 | 3300048913 | Bacteria | 3459 |
| 735 | Ga0496110_0132154 | 3300048913 | Bacteria | 2254 |
| 736 | Ga0496110_0151081 | 3300048913 | Bacteria | 2103 |
| 737 | Ga0496110_0197580 | 3300048913 | Bacteria | 1827 |
| 738 | Ga0496111_0008238 | 3300048914 | Bacteria | 6892 |
| 739 | Ga0496111_0010213 | 3300048914 | Bacteria | 6290 |
| 740 | Ga0496111_0043391 | 3300048914 | Bacteria | 3232 |
| 741 | Ga0496111_0057197 | 3300048914 | Bacteria | 2823 |
| 742 | Ga0496111_0196353 | 3300048914 | Bacteria | 1500 |
| 743 | Ga0496111_0352694 | 3300048914 | Bacteria | 1089 |
| 744 | Ga0496112_0000020 | 3300048915 | Bacteria | 169373 |
| 745 | Ga0496112_0001044 | 3300048915 | Bacteria | 20400 |
| 746 | Ga0496112_0014481 | 3300048915 | Bacteria | 7321 |
| 747 | Ga0496112_0032339 | 3300048915 | Bacteria | 5079 |
| 748 | Ga0496112_0036502 | 3300048915 | Bacteria | 4795 |
| 749 | Ga0496112_0128611 | 3300048915 | Bacteria | 2503 |
| 750 | Ga0496112_0218018 | 3300048915 | Bacteria | 1865 |
| 751 | Ga0496112_0462284 | 3300048915 | Bacteria | 1206 |
| 752 | Ga0496113_0006740 | 3300048916 | Bacteria | 7319 |
| 753 | Ga0496113_0037992 | 3300048916 | Bacteria | 3537 |
| 754 | Ga0496113_0043787 | 3300048916 | Bacteria | 3314 |
| 755 | Ga0496113_0051297 | 3300048916 | Bacteria | 3078 |
| 756 | Ga0496113_0059445 | 3300048916 | Bacteria | 2879 |
| 757 | Ga0496113_0076548 | 3300048916 | Bacteria | 2556 |
| 758 | Ga0496114_0009847 | 3300048917 | Bacteria | 7598 |
| 759 | Ga0496114_0079878 | 3300048917 | Bacteria | 2762 |
| 760 | Ga0496114_0306210 | 3300048917 | Bacteria | 1403 |
| 761 | Ga0496115_0023846 | 3300048918 | Bacteria | 4751 |
| 762 | Ga0496115_0029319 | 3300048918 | Bacteria | 4321 |
| 763 | Ga0496115_0087123 | 3300048918 | Bacteria | 2548 |
| 764 | Ga0496115_0087298 | 3300048918 | Bacteria | 2545 |
| 765 | Ga0496115_0100082 | 3300048918 | Bacteria | 2376 |
| 766 | Ga0496115_0140952 | 3300048918 | Bacteria | 1989 |
| 767 | Ga0496115_0286279 | 3300048918 | Bacteria | 1352 |
| 768 | Ga0496115_0372611 | 3300048918 | Bacteria | 1162 |
| 769 | Ga0496117_0021089 | 3300048920 | Bacteria | 5288 |
| 770 | Ga0496117_0036072 | 3300048920 | Bacteria | 3704 |
| 771 | Ga0496117_0120237 | 3300048920 | Bacteria | 1615 |
| 772 | Ga0496117_0153817 | 3300048920 | Bacteria | 1357 |
| 773 | Ga0496118_0003026 | 3300048921 | Bacteria | 21707 |
| 774 | Ga0496118_0027995 | 3300048921 | Bacteria | 4757 |
| 775 | Ga0496118_0048029 | 3300048921 | Bacteria | 3302 |
| 776 | Ga0496118_0064926 | 3300048921 | Bacteria | 2674 |
| 777 | Ga0496118_0090666 | 3300048921 | Bacteria | 2105 |
| 778 | Ga0496118_0154936 | 3300048921 | Bacteria | 1427 |
| 779 | Ga0496119_0006376 | 3300048922 | Bacteria | 10964 |
| 780 | Ga0496119_0038888 | 3300048922 | Bacteria | 3066 |
| 781 | Ga0496119_0072987 | 3300048922 | Bacteria | 2003 |
| 782 | Ga0496121_0000203 | 3300048924 | Bacteria | 130984 |
| 783 | Ga0496121_0000270 | 3300048924 | Bacteria | 108787 |
| 784 | Ga0496121_0001251 | 3300048924 | Bacteria | 44033 |
| 785 | Ga0496121_0002323 | 3300048924 | Bacteria | 29460 |
| 786 | Ga0496121_0015121 | 3300048924 | Bacteria | 8119 |
| 787 | Ga0496121_0042502 | 3300048924 | Bacteria | 3951 |
| 788 | Ga0496121_0045389 | 3300048924 | Bacteria | 3777 |
| 789 | Ga0496121_0130068 | 3300048924 | Bacteria | 1886 |
| 790 | Ga0496121_0133412 | 3300048924 | Bacteria | 1854 |
| 791 | Ga0496121_0171645 | 3300048924 | Bacteria | 1574 |
| 792 | Ga0496121_0267653 | 3300048924 | Bacteria | 1176 |
| 793 | Ga0496122_0032788 | 3300048925 | Bacteria | 4287 |
| 794 | Ga0496122_0052331 | 3300048925 | Bacteria | 3092 |
| 795 | Ga0496123_0010648 | 3300048926 | Bacteria | 8093 |
| 796 | Ga0496123_0101514 | 3300048926 | Bacteria | 1672 |
| 797 | Ga0496124_0011952 | 3300048927 | Bacteria | 8637 |
| 798 | Ga0496124_0048269 | 3300048927 | Bacteria | 3639 |
| 799 | Ga0496124_0070552 | 3300048927 | Bacteria | 2898 |
| 800 | Ga0496124_0114620 | 3300048927 | Bacteria | 2164 |
| 801 | Ga0496125_0000328 | 3300048928 | Bacteria | 91806 |
| 802 | Ga0496125_0000407 | 3300048928 | Bacteria | 80570 |
| 803 | Ga0496125_0003549 | 3300048928 | Bacteria | 18787 |
| 804 | Ga0496125_0024628 | 3300048928 | Bacteria | 5529 |
| 805 | Ga0496125_0043717 | 3300048928 | Bacteria | 3797 |
| 806 | Ga0496125_0059052 | 3300048928 | Bacteria | 3093 |
| 807 | Ga0496125_0070315 | 3300048928 | Bacteria | 2741 |
| 808 | Ga0496125_0087175 | 3300048928 | Bacteria | 2358 |
| 809 | Ga0496126_0010158 | 3300048929 | Bacteria | 9910 |
| 810 | Ga0496126_0016646 | 3300048929 | Bacteria | 7347 |
| 811 | Ga0496126_0025084 | 3300048929 | Bacteria | 5744 |
| 812 | Ga0496126_0027806 | 3300048929 | Bacteria | 5395 |
| 813 | Ga0496126_0035866 | 3300048929 | Bacteria | 4642 |
| 814 | Ga0496126_0065855 | 3300048929 | Bacteria | 3240 |
| 815 | Ga0496126_0086523 | 3300048929 | Bacteria | 2762 |
| 816 | Ga0496126_0088126 | 3300048929 | Bacteria | 2735 |
| 817 | Ga0496126_0142503 | 3300048929 | Bacteria | 2061 |
| 818 | Ga0496126_0174331 | 3300048929 | Bacteria | 1830 |
| 819 | Ga0496126_0208070 | 3300048929 | Bacteria | 1648 |
| 820 | Ga0496126_0286373 | 3300048929 | Bacteria | 1363 |
| 821 | Ga0495682_0011296 | 3300049460 | Bacteria | 3437 |
| 822 | Ga0495682_0055980 | 3300049460 | Bacteria | 1430 |
| 823 | Ga0501031_0012366 | 3300049568 | Bacteria | 5566 |
| 824 | Ga0501031_0142806 | 3300049568 | Bacteria | 1565 |
| 825 | Ga0501032_0000475 | 3300049569 | Bacteria | 32423 |
| 826 | Ga0501032_0042704 | 3300049569 | Bacteria | 3074 |
| 827 | Ga0501033_0000440 | 3300049570 | Bacteria | 39822 |
| 828 | Ga0501033_0001499 | 3300049570 | Bacteria | 20673 |
| 829 | Ga0501033_0012762 | 3300049570 | Bacteria | 6406 |
| 830 | Ga0501033_0117807 | 3300049570 | Bacteria | 1929 |
| 831 | Ga0501033_0119051 | 3300049570 | Bacteria | 1917 |
| 832 | Ga0501033_0345629 | 3300049570 | Bacteria | 1042 |
| 833 | Ga0501034_0000250 | 3300049571 | Bacteria | 99407 |
| 834 | Ga0501034_0028177 | 3300049571 | Bacteria | 5714 |
| 835 | Ga0501036_0000098 | 3300049572 | Bacteria | 54252 |
| 836 | Ga0501036_0044460 | 3300049572 | Bacteria | 3762 |
| 837 | Ga0501036_0061519 | 3300049572 | Bacteria | 3180 |
| 838 | Ga0501036_0115578 | 3300049572 | Bacteria | 2266 |
| 839 | Ga0501036_0150293 | 3300049572 | Bacteria | 1964 |
| 840 | Ga0501037_0000092 | 3300049573 | Bacteria | 83924 |
| 841 | Ga0501037_0016024 | 3300049573 | Bacteria | 5515 |
| 842 | Ga0501037_0105558 | 3300049573 | Bacteria | 2030 |
| 843 | Ga0501037_0106892 | 3300049573 | Bacteria | 2016 |
| 844 | Ga0501038_0000059 | 3300049574 | Bacteria | 92319 |
| 845 | Ga0501038_0000626 | 3300049574 | Bacteria | 31388 |
| 846 | Ga0501038_0042710 | 3300049574 | Bacteria | 3947 |
| 847 | Ga0501038_0199908 | 3300049574 | Bacteria | 1604 |
| 848 | Ga0501039_0000085 | 3300049575 | Bacteria | 70306 |
| 849 | Ga0501039_0021665 | 3300049575 | Bacteria | 4930 |
| 850 | Ga0501039_0137111 | 3300049575 | Bacteria | 1921 |
| 851 | Ga0501039_0142154 | 3300049575 | Bacteria | 1885 |
| 852 | Ga0501042_0035371 | 3300049578 | Bacteria | 3543 |
| 853 | Ga0501042_0060507 | 3300049578 | Bacteria | 2705 |
| 854 | Ga0501043_0011678 | 3300049579 | Bacteria | 6875 |
| 855 | Ga0501043_0289790 | 3300049579 | Bacteria | 1253 |
| 856 | Ga0501043_0313691 | 3300049579 | Bacteria | 1196 |
| 857 | Ga0501046_0000483 | 3300049580 | Bacteria | 39806 |
| 858 | Ga0501046_0013048 | 3300049580 | Bacteria | 7052 |
| 859 | Ga0501046_0028766 | 3300049580 | Bacteria | 4523 |
| 860 | Ga0501046_0050241 | 3300049580 | Bacteria | 3295 |
| 861 | Ga0501046_0235227 | 3300049580 | Bacteria | 1352 |
| 862 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 863 | Ga0501047_0010976 | 3300049581 | Bacteria | 8572 |
| 864 | Ga0501047_0020141 | 3300049581 | Bacteria | 6404 |
| 865 | Ga0501047_0142285 | 3300049581 | Bacteria | 2276 |
| 866 | Ga0501047_0244182 | 3300049581 | Bacteria | 1645 |
| 867 | Ga0501047_0428330 | 3300049581 | Bacteria | 1154 |
| 868 | Ga0501048_0002266 | 3300049582 | Bacteria | 14670 |
| 869 | Ga0501067_0000599 | 3300049583 | Bacteria | 19412 |
| 870 | Ga0501067_0114243 | 3300049583 | Bacteria | 1501 |
| 871 | Ga0501068_0004667 | 3300049584 | Bacteria | 7459 |
| 872 | Ga0501068_0056869 | 3300049584 | Bacteria | 2371 |
| 873 | Ga0501068_0065838 | 3300049584 | Bacteria | 2206 |
| 874 | Ga0501069_0055162 | 3300049585 | Bacteria | 2213 |
| 875 | Ga0501070_0006653 | 3300049586 | Bacteria | 9842 |
| 876 | Ga0501070_0062656 | 3300049586 | Bacteria | 3080 |
| 877 | Ga0501070_0180468 | 3300049586 | Bacteria | 1737 |
| 878 | Ga0501071_0039494 | 3300049587 | Bacteria | 3377 |
| 879 | Ga0501071_0073681 | 3300049587 | Bacteria | 2491 |
| 880 | Ga0501072_0001923 | 3300049588 | Bacteria | 15457 |
| 881 | Ga0501072_0226059 | 3300049588 | Bacteria | 1491 |
| 882 | Ga0501073_0000109 | 3300049589 | Bacteria | 53094 |
| 883 | Ga0501073_0056097 | 3300049589 | Bacteria | 2756 |
| 884 | Ga0501073_0104808 | 3300049589 | Bacteria | 1962 |
| 885 | Ga0501074_0036614 | 3300049590 | Bacteria | 3554 |
| 886 | Ga0501074_0100957 | 3300049590 | Bacteria | 2065 |
| 887 | Ga0501076_0021057 | 3300049592 | Bacteria | 4997 |
| 888 | Ga0501077_0060991 | 3300049593 | Bacteria | 2393 |
| 889 | Ga0501079_0002132 | 3300049741 | Bacteria | 14228 |
| 890 | Ga0501079_0091330 | 3300049741 | Bacteria | 2359 |
| 891 | Ga0501080_0005186 | 3300049742 | Bacteria | 11611 |
| 892 | Ga0501080_0031118 | 3300049742 | Bacteria | 4972 |
| 893 | Ga0501080_0181287 | 3300049742 | Bacteria | 1937 |
| 894 | Ga0501080_0186541 | 3300049742 | Bacteria | 1907 |
| 895 | Ga0501083_0001424 | 3300049744 | Bacteria | 16301 |
| 896 | Ga0501035_0001471 | 3300049822 | Bacteria | 24145 |
| 897 | Ga0501035_0035988 | 3300049822 | Bacteria | 4490 |
| 898 | Ga0501035_0082774 | 3300049822 | Bacteria | 2832 |
| 899 | Ga0501044_0000072 | 3300049823 | Bacteria | 124143 |
| 900 | Ga0501044_0001765 | 3300049823 | Bacteria | 25275 |
| 901 | Ga0501044_0009154 | 3300049823 | Bacteria | 10815 |
| 902 | Ga0501044_0547336 | 3300049823 | Bacteria | 1055 |
| 903 | Ga0501045_0370770 | 3300049824 | Bacteria | 1065 |
| 904 | nmdc:mga03n38_4895_c1 | 3300050490 | Bacteria | 4491 |
| 905 | nmdc:mga00v17_162020_c1 | 3300050491 | Bacteria | 1440 |
| 906 | nmdc:mga00v17_55279_c1 | 3300050491 | Bacteria | 2424 |
| 907 | nmdc:mga0yw44_208929_c1 | 3300050492 | Bacteria | 1291 |
| 908 | nmdc:mga0yw44_47348_c1 | 3300050492 | Bacteria | 2588 |
| 909 | nmdc:mga0yw44_83620_c1 | 3300050492 | Bacteria | 2005 |
| 910 | nmdc:mga0k408_58486_c1 | 3300050493 | Bacteria | 2239 |
| 911 | nmdc:mga06z11_120949_c1 | 3300050494 | Bacteria | 1461 |
| 912 | nmdc:mga06z11_255013_c1 | 3300050494 | Bacteria | 1034 |
| 913 | nmdc:mga04h51_4727_c1 | 3300050495 | Bacteria | 3414 |
| 914 | nmdc:mga07m45_112215_c1 | 3300050496 | Bacteria | 1571 |
| 915 | nmdc:mga07m45_113485_c1 | 3300050496 | Bacteria | 1562 |
| 916 | nmdc:mga07m45_226957_c1 | 3300050496 | Bacteria | 1087 |
| 917 | nmdc:mga09592_221455_c1 | 3300050508 | Bacteria | 1639 |
| 918 | nmdc:mga06r32_33397_c1 | 3300050510 | Bacteria | 4845 |
| 919 | nmdc:mga0rr50_314731_c1 | 3300050513 | Bacteria | 1311 |
| 920 | nmdc:mga0a205_223274_c1 | 3300050515 | Bacteria | 1769 |
| 921 | nmdc:mga0sz30_40195_c1 | 3300050516 | Bacteria | 1966 |
| 922 | Ga0495601_0049218 | 3300053077 | Bacteria | 2657 |
| 923 | Ga0495601_0086261 | 3300053077 | Bacteria | 2017 |
| 924 | Ga0495601_0233021 | 3300053077 | Bacteria | 1202 |
| 925 | Ga0500635_0048938 | 3300053080 | Bacteria | 1441 |
| 926 | Ga0500635_0055968 | 3300053080 | Bacteria | 1363 |
| 927 | Ga0495655_0003764 | 3300053083 | Bacteria | 2534 |
| 928 | Ga0495655_0012771 | 3300053083 | Bacteria | 1720 |
| 929 | Ga0495595_0000445 | 3300053084 | Bacteria | 15683 |
| 930 | Ga0495595_0005883 | 3300053084 | Bacteria | 4973 |
| 931 | Ga0495619_0000330 | 3300053085 | Bacteria | 33168 |
| 932 | Ga0500578_0079113 | 3300053086 | Bacteria | 2092 |
| 933 | Ga0500578_0118280 | 3300053086 | Bacteria | 1667 |
| 934 | Ga0500643_000063 | 3300053087 | Bacteria | 122135 |
| 935 | Ga0500643_034093 | 3300053087 | Bacteria | 1535 |
| 936 | Ga0500646_0000839 | 3300053090 | Bacteria | 8510 |
| 937 | Ga0500651_0006769 | 3300053093 | Bacteria | 6639 |
| 938 | Ga0500651_0006892 | 3300053093 | Bacteria | 6586 |
| 939 | Ga0500651_0194034 | 3300053093 | Bacteria | 1201 |
| 940 | Ga0500566_0000247 | 3300053094 | Bacteria | 28953 |
| 941 | Ga0500566_0003076 | 3300053094 | Bacteria | 9969 |
| 942 | Ga0500566_0005190 | 3300053094 | Bacteria | 7755 |
| 943 | Ga0500566_0202460 | 3300053094 | Bacteria | 1001 |
| 944 | Ga0500640_068405 | 3300053095 | Bacteria | 1527 |
| 945 | Ga0500641_0035557 | 3300053096 | Bacteria | 1988 |
| 946 | Ga0500554_003943 | 3300053102 | Bacteria | 3090 |
| 947 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 948 | Ga0500557_000037 | 3300053105 | Bacteria | 71114 |
| 949 | Ga0500569_001553 | 3300053109 | Bacteria | 4357 |
| 950 | Ga0500569_002673 | 3300053109 | Bacteria | 3551 |
| 951 | Ga0500572_000191 | 3300053111 | Bacteria | 21667 |
| 952 | Ga0500572_019537 | 3300053111 | Bacteria | 1770 |
| 953 | Ga0500593_065397 | 3300053117 | Bacteria | 1590 |
| 954 | Ga0500595_002654 | 3300053119 | Bacteria | 8699 |
| 955 | Ga0500595_014785 | 3300053119 | Bacteria | 2950 |
| 956 | Ga0500607_020092 | 3300053121 | Bacteria | 3774 |
| 957 | Ga0500608_000959 | 3300053122 | Bacteria | 10339 |
| 958 | Ga0500608_051127 | 3300053122 | Bacteria | 1985 |
| 959 | Ga0500614_019160 | 3300053123 | Bacteria | 1565 |
| 960 | Ga0500618_004575 | 3300053125 | Bacteria | 4370 |
| 961 | Ga0500618_017251 | 3300053125 | Bacteria | 1798 |
| 962 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 963 | Ga0500642_0000062 | 3300053130 | Bacteria | 58970 |
| 964 | Ga0500642_0011321 | 3300053130 | Bacteria | 3185 |
| 965 | Ga0500642_0048371 | 3300053130 | Bacteria | 1867 |
| 966 | Ga0500652_000555 | 3300053131 | Bacteria | 13010 |
| 967 | Ga0500658_0074733 | 3300053134 | Bacteria | 1437 |
| 968 | Ga0500658_0075077 | 3300053134 | Bacteria | 1434 |
| 969 | Ga0500559_0000179 | 3300053136 | Bacteria | 50232 |
| 970 | Ga0500559_0000398 | 3300053136 | Bacteria | 31511 |
| 971 | Ga0500559_0042227 | 3300053136 | Bacteria | 1989 |
| 972 | Ga0500559_0139060 | 3300053136 | Bacteria | 1136 |
| 973 | Ga0500564_110823 | 3300053138 | Bacteria | 1204 |
| 974 | Ga0500568_0000790 | 3300053139 | Bacteria | 22337 |
| 975 | Ga0500573_0232028 | 3300053140 | Bacteria | 961 |
| 976 | Ga0500577_0000399 | 3300053142 | Bacteria | 11105 |
| 977 | Ga0500586_007140 | 3300053145 | Bacteria | 2960 |
| 978 | Ga0500588_0031491 | 3300053146 | Bacteria | 1531 |
| 979 | Ga0500603_001290 | 3300053150 | Bacteria | 5756 |
| 980 | Ga0500603_007487 | 3300053150 | Bacteria | 2398 |
| 981 | Ga0500604_0001375 | 3300053151 | Bacteria | 6785 |
| 982 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 983 | Ga0500616_0018659 | 3300053153 | Bacteria | 3919 |
| 984 | Ga0500620_001178 | 3300053155 | Bacteria | 4665 |
| 985 | Ga0500622_0015984 | 3300053156 | Bacteria | 4015 |
| 986 | Ga0500622_0026331 | 3300053156 | Bacteria | 3071 |
| 987 | Ga0500622_0044474 | 3300053156 | Bacteria | 2301 |
| 988 | Ga0500630_065807 | 3300053159 | Bacteria | 1724 |
| 989 | Ga0500639_013853 | 3300053163 | Bacteria | 4239 |
| 990 | Ga0500639_022758 | 3300053163 | Bacteria | 3311 |
| 991 | Ga0500636_0000349 | 3300053177 | Bacteria | 25486 |
| 992 | Ga0500636_0060283 | 3300053177 | Bacteria | 2216 |
| 993 | Ga0500637_0017723 | 3300053178 | Bacteria | 3817 |
| 994 | Ga0500637_0215510 | 3300053178 | Bacteria | 1087 |
| 995 | Ga0500570_018767 | 3300053724 | Bacteria | 3871 |
| 996 | Ga0500625_024838 | 3300053729 | Bacteria | 2832 |
| 997 | Ga0500596_004482 | 3300053735 | Bacteria | 2554 |
| 998 | Ga0500596_007212 | 3300053735 | Bacteria | 1833 |
| 999 | Ga0500601_000064 | 3300053737 | Bacteria | 22081 |
| 1000 | Ga0501084_0185546 | 3300054114 | Bacteria | 1755 |
| 1001 | Ga0500661_021525 | 3300055283 | Bacteria | 1144 |
| 1002 | Ga0501082_0000028 | 3300060353 | Bacteria | 100580 |
| 1003 | Ga0501082_0144134 | 3300060353 | Bacteria | 2067 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100088993 | Ga0070674_1000889932 | 264 |
| 2 | 3300005364 | Ga0070673_100084349 | Ga0070673_1000843492 | 264 |
| 3 | 3300005843 | Ga0068860_100136751 | Ga0068860_1001367512 | 264 |
| 4 | 3300014326 | Ga0157380_10127343 | Ga0157380_101273432 | 264 |
| 5 | 3300026121 | Ga0207683_10169315 | Ga0207683_101693152 | 264 |
| 6 | 3300048904 | Ga0496101_0230209 | Ga0496101_0230209_95_1000 | 264 |
| 7 | 3300048909 | Ga0496106_0126165 | Ga0496106_0126165_89_994 | 264 |
| 8 | 3300049581 | Ga0501047_0020141 | Ga0501047_0020141_1135_2019 | 265 |
| 9 | 3300035695 | Ga0373927_0036371 | Ga0373927_0036371_15_830 | 268 |
| 10 | 3300037068 | Ga0373925_0205586 | Ga0373925_0205586_14_829 | 268 |
| 11 | 3300044735 | Ga0466968_0100658 | Ga0466968_0100658_296_1186 | 268 |
| 12 | 3300045049 | Ga0466959_0240101 | Ga0466959_0240101_242_1132 | 268 |
| 13 | 3300005530 | Ga0070679_100120755 | Ga0070679_1001207551 | 270 |
| 14 | 3300025290 | Ga0207673_1005554 | Ga0207673_10055541 | 270 |
| 15 | 3300048910 | Ga0496107_0265433 | Ga0496107_0265433_298_1122 | 273 |
| 16 | 3300048913 | Ga0496110_0197580 | Ga0496110_0197580_797_1621 | 273 |
| 17 | 3300050508 | nmdc:mga09592_221455_c1 | nmdc:mga09592_221455_c1_543_1367 | 273 |
| 18 | 3300050510 | nmdc:mga06r32_33397_c1 | nmdc:mga06r32_33397_c1_988_1812 | 273 |
| 19 | 3300050515 | nmdc:mga0a205_223274_c1 | nmdc:mga0a205_223274_c1_482_1306 | 273 |
| 20 | 3300037853 | Ga0436364_0709114 | Ga0436364_0709114_182_1099 | 274 |
| 21 | 3300048907 | Ga0496104_0003037 | Ga0496104_0003037_3917_4807 | 276 |
| 22 | 3300048911 | Ga0496108_0372747 | Ga0496108_0372747_139_1029 | 276 |
| 23 | 3300048914 | Ga0496111_0352694 | Ga0496111_0352694_60_950 | 276 |
| 24 | 3300048917 | Ga0496114_0306210 | Ga0496114_0306210_195_1085 | 276 |
| 25 | 3300048918 | Ga0496115_0140952 | Ga0496115_0140952_364_1254 | 276 |
| 26 | 3300003659 | JGI25404J52841_10007684 | JGI25404J52841_100076841 | 278 |
| 27 | 3300005983 | Ga0081540_1003875 | Ga0081540_10038759 | 278 |
| 28 | 3300048912 | Ga0496109_0011741 | Ga0496109_0011741_5631_6476 | 279 |
| 29 | 3300025272 | Ga0209455_1002393 | Ga0209455_10023933 | 282 |
| 30 | 3300048903 | Ga0496100_0199871 | Ga0496100_0199871_514_1404 | 282 |
| 31 | 3300048907 | Ga0496104_0002280 | Ga0496104_0002280_8771_9661 | 282 |
| 32 | 3300048908 | Ga0496105_0027371 | Ga0496105_0027371_2234_3124 | 282 |
| 33 | 3300048911 | Ga0496108_0053230 | Ga0496108_0053230_131_1021 | 282 |
| 34 | 3300048912 | Ga0496109_0073871 | Ga0496109_0073871_1858_2748 | 282 |
| 35 | 3300048918 | Ga0496115_0100082 | Ga0496115_0100082_567_1457 | 282 |
| 36 | 3300041413 | Ga0439465_0013621 | Ga0439465_0013621_131_1027 | 283 |
| 37 | 3300009147 | Ga0114129_10721610 | Ga0114129_107216101 | 284 |
| 38 | 3300048924 | Ga0496121_0045389 | Ga0496121_0045389_1055_1948 | 284 |
| 39 | 3300053119 | Ga0500595_002654 | Ga0500595_002654_6296_7183 | 284 |
| 40 | 3300005937 | Ga0081455_10048211 | Ga0081455_100482112 | 285 |
| 41 | 3300026067 | Ga0207678_10096010 | Ga0207678_100960103 | 285 |
| 42 | 3300006237 | Ga0097621_100249243 | Ga0097621_1002492432 | 287 |
| 43 | 3300026075 | Ga0207708_10085681 | Ga0207708_100856812 | 287 |
| 44 | 3300027671 | Ga0209588_1073887 | Ga0209588_10738871 | 287 |
| 45 | 3300005981 | Ga0081538_10086299 | Ga0081538_100862991 | 288 |
| 46 | 3300009545 | Ga0105237_10637369 | Ga0105237_106373691 | 288 |
| 47 | 3300035116 | Ga0373945_0002529 | Ga0373945_0002529_3400_4269 | 288 |
| 48 | 3300035170 | Ga0373943_0083317 | Ga0373943_0083317_462_1331 | 288 |
| 49 | 3300035171 | Ga0373946_0104972 | Ga0373946_0104972_16_885 | 288 |
| 50 | 3300037068 | Ga0373925_0025981 | Ga0373925_0025981_1156_2025 | 288 |
| 51 | 3300046472 | Ga0495580_0090453 | Ga0495580_0090453_845_1714 | 288 |
| 52 | 3300046473 | Ga0495582_0042626 | Ga0495582_0042626_1083_1952 | 288 |
| 53 | 3300046474 | Ga0495605_0072307 | Ga0495605_0072307_636_1505 | 288 |
| 54 | 3300046491 | Ga0495584_0016366 | Ga0495584_0016366_2677_3546 | 288 |
| 55 | 3300046492 | Ga0495585_0027616 | Ga0495585_0027616_331_1200 | 288 |
| 56 | 3300046523 | Ga0495644_0031813 | Ga0495644_0031813_937_1806 | 288 |
| 57 | 3300046537 | Ga0495598_0005762 | Ga0495598_0005762_226_1095 | 288 |
| 58 | 3300046558 | Ga0495633_0006412 | Ga0495633_0006412_520_1389 | 288 |
| 59 | 3300046683 | Ga0495658_0114457 | Ga0495658_0114457_600_1469 | 288 |
| 60 | 3300046689 | Ga0495613_0025117 | Ga0495613_0025117_1943_2812 | 288 |
| 61 | 3300046691 | Ga0495670_0125248 | Ga0495670_0125248_213_1082 | 288 |
| 62 | 3300047321 | Ga0495676_0108612 | Ga0495676_0108612_774_1643 | 288 |
| 63 | iso_pu_bacteria | 2508501128 | 2509152633 | 288 |
| 64 | iso_pu_bacteria | 2513237096 | 2513658813 | 288 |
| 65 | iso_pu_bacteria | 2513237137 | 2513860820 | 288 |
| 66 | iso_pu_bacteria | 2513237145 | 2513921077 | 288 |
| 67 | iso_pu_bacteria | 2517572143 | 2517888842 | 288 |
| 68 | iso_pu_bacteria | 2524023228 | 2524537054 | 288 |
| 69 | iso_pu_bacteria | 2643221651 | 2644290946 | 288 |
| 70 | iso_pu_bacteria | 2667528175 | 2671119944 | 288 |
| 71 | iso_pu_bacteria | 2721755755 | 2723841642 | 288 |
| 72 | iso_pu_bacteria | 2728368998 | 2728754989 | 288 |
| 73 | iso_pu_bacteria | 2791355197 | 2793072930 | 288 |
| 74 | iso_pu_bacteria | 2791355199 | 2793082750 | 288 |
| 75 | iso_pu_bacteria | 2885374607 | 2885382850 | 288 |
| 76 | iso_pu_bacteria | 2885383462 | 2885388844 | 288 |
| 77 | iso_pu_bacteria | 2893066018 | 2893067378 | 288 |
| 78 | iso_pu_bacteria | 2903748898 | 2903748955 | 288 |
| 79 | iso_pu_bacteria | 2904699407 | 2904708824 | 288 |
| 80 | iso_pu_bacteria | 2906610324 | 2906613874 | 288 |
| 81 | iso_pu_bacteria | 2906635258 | 2906642332 | 288 |
| 82 | iso_pu_bacteria | 2906660503 | 2906667360 | 288 |
| 83 | iso_pu_bacteria | 2908739725 | 2908747444 | 288 |
| 84 | iso_pu_bacteria | 2908756301 | 2908756587 | 288 |
| 85 | iso_pu_bacteria | 2922361189 | 2922364000 | 288 |
| 86 | iso_pu_bacteria | 2922386360 | 2922392566 | 288 |
| 87 | iso_pu_bacteria | 3005474847 | 3005475061 | 288 |
| 88 | iso_pu_bacteria | 8006933436 | 8006936235 | 288 |
| 89 | iso_pu_bacteria | 8006964411 | 8006969360 | 288 |
| 90 | iso_pu_bacteria | 8006973647 | 8006976180 | 288 |
| 91 | iso_pu_bacteria | 8056673599 | 8056675743 | 288 |
| 92 | iso_pu_bacteria | 8056681323 | 8056687394 | 288 |
| 93 | iso_pu_bacteria | 8056689827 | 8056690958 | 288 |
| 94 | 3300005329 | Ga0070683_100013328 | Ga0070683_1000133286 | 289 |
| 95 | 3300005436 | Ga0070713_100010327 | Ga0070713_1000103272 | 289 |
| 96 | 3300005530 | Ga0070679_100044969 | Ga0070679_1000449694 | 289 |
| 97 | 3300005535 | Ga0070684_100024903 | Ga0070684_1000249035 | 289 |
| 98 | 3300005546 | Ga0070696_100109075 | Ga0070696_1001090752 | 289 |
| 99 | 3300005983 | Ga0081540_1005299 | Ga0081540_10052998 | 289 |
| 100 | 3300005985 | Ga0081539_10029435 | Ga0081539_100294352 | 289 |
| 101 | 3300006163 | Ga0070715_10019602 | Ga0070715_100196022 | 289 |
| 102 | 3300006173 | Ga0070716_100013388 | Ga0070716_1000133883 | 289 |
| 103 | 3300006844 | Ga0075428_100045101 | Ga0075428_1000451012 | 289 |
| 104 | 3300006852 | Ga0075433_10217483 | Ga0075433_102174832 | 289 |
| 105 | 3300025905 | Ga0207685_10016028 | Ga0207685_100160282 | 289 |
| 106 | 3300025912 | Ga0207707_10035006 | Ga0207707_100350064 | 289 |
| 107 | 3300025913 | Ga0207695_10254960 | Ga0207695_102549602 | 289 |
| 108 | 3300025914 | Ga0207671_10094158 | Ga0207671_100941583 | 289 |
| 109 | 3300025915 | Ga0207693_10035714 | Ga0207693_100357144 | 289 |
| 110 | 3300025917 | Ga0207660_10076914 | Ga0207660_100769142 | 289 |
| 111 | 3300025928 | Ga0207700_10093504 | Ga0207700_100935042 | 289 |
| 112 | 3300025929 | Ga0207664_10487302 | Ga0207664_104873022 | 289 |
| 113 | 3300025939 | Ga0207665_10004258 | Ga0207665_100042584 | 289 |
| 114 | 3300025944 | Ga0207661_10044403 | Ga0207661_100444033 | 289 |
| 115 | 3300025949 | Ga0207667_10281972 | Ga0207667_102819722 | 289 |
| 116 | 3300046518 | Ga0495631_0081283 | Ga0495631_0081283_391_1284 | 289 |
| 117 | 3300049568 | Ga0501031_0012366 | Ga0501031_0012366_22_897 | 289 |
| 118 | 3300049569 | Ga0501032_0000475 | Ga0501032_0000475_13075_13950 | 289 |
| 119 | 3300049570 | Ga0501033_0001499 | Ga0501033_0001499_4233_5108 | 289 |
| 120 | 3300049571 | Ga0501034_0000250 | Ga0501034_0000250_43967_44842 | 289 |
| 121 | 3300049572 | Ga0501036_0000098 | Ga0501036_0000098_22711_23586 | 289 |
| 122 | 3300049573 | Ga0501037_0000092 | Ga0501037_0000092_50795_51670 | 289 |
| 123 | 3300049574 | Ga0501038_0000059 | Ga0501038_0000059_21831_22706 | 289 |
| 124 | 3300049575 | Ga0501039_0000085 | Ga0501039_0000085_52685_53560 | 289 |
| 125 | 3300049578 | Ga0501042_0060507 | Ga0501042_0060507_97_972 | 289 |
| 126 | 3300049580 | Ga0501046_0000483 | Ga0501046_0000483_28861_29736 | 289 |
| 127 | 3300049581 | Ga0501047_0000022 | Ga0501047_0000022_150000_150875 | 289 |
| 128 | 3300049582 | Ga0501048_0002266 | Ga0501048_0002266_5339_6214 | 289 |
| 129 | 3300049583 | Ga0501067_0000599 | Ga0501067_0000599_8432_9307 | 289 |
| 130 | 3300049584 | Ga0501068_0004667 | Ga0501068_0004667_1429_2304 | 289 |
| 131 | 3300049585 | Ga0501069_0055162 | Ga0501069_0055162_932_1807 | 289 |
| 132 | 3300049586 | Ga0501070_0006653 | Ga0501070_0006653_990_1865 | 289 |
| 133 | 3300049587 | Ga0501071_0039494 | Ga0501071_0039494_1023_1898 | 289 |
| 134 | 3300049588 | Ga0501072_0001923 | Ga0501072_0001923_843_1718 | 289 |
| 135 | 3300049589 | Ga0501073_0000109 | Ga0501073_0000109_49885_50760 | 289 |
| 136 | 3300049590 | Ga0501074_0036614 | Ga0501074_0036614_2601_3476 | 289 |
| 137 | 3300049741 | Ga0501079_0002132 | Ga0501079_0002132_10030_10905 | 289 |
| 138 | 3300049742 | Ga0501080_0005186 | Ga0501080_0005186_2695_3570 | 289 |
| 139 | 3300049744 | Ga0501083_0001424 | Ga0501083_0001424_6611_7486 | 289 |
| 140 | 3300049822 | Ga0501035_0001471 | Ga0501035_0001471_3790_4665 | 289 |
| 141 | 3300049823 | Ga0501044_0000072 | Ga0501044_0000072_36597_37472 | 289 |
| 142 | 3300049824 | Ga0501045_0370770 | Ga0501045_0370770_106_981 | 289 |
| 143 | 3300060353 | Ga0501082_0144134 | Ga0501082_0144134_228_1103 | 289 |
| 144 | iso_pu_bacteria | 2507262055 | 2507505246 | 289 |
| 145 | iso_pu_bacteria | 2508501009 | 2508539167 | 289 |
| 146 | iso_pu_bacteria | 2513237098 | 2513674587 | 289 |
| 147 | iso_pu_bacteria | 2513237101 | 2513695111 | 289 |
| 148 | iso_pu_bacteria | 2515154112 | 2515627442 | 289 |
| 149 | iso_pu_bacteria | 2524023210 | 2524467848 | 289 |
| 150 | iso_pu_bacteria | 2874590934 | 2874594445 | 289 |
| 151 | iso_pu_bacteria | 2874604998 | 2874608064 | 289 |
| 152 | iso_pu_bacteria | 2874645413 | 2874649818 | 289 |
| 153 | iso_pu_bacteria | 2876771140 | 2876773937 | 289 |
| 154 | iso_pu_bacteria | 2876818435 | 2876821817 | 289 |
| 155 | iso_pu_bacteria | 2879074833 | 2879078339 | 289 |
| 156 | iso_pu_bacteria | 2879110137 | 2879112171 | 289 |
| 157 | iso_pu_bacteria | 2879127579 | 2879130600 | 289 |
| 158 | iso_pu_bacteria | 2879142872 | 2879147123 | 289 |
| 159 | iso_pu_bacteria | 2889033259 | 2889035490 | 289 |
| 160 | iso_pu_bacteria | 2903768456 | 2903770760 | 289 |
| 161 | iso_pu_bacteria | 2935608549 | 2935615725 | 289 |
| 162 | iso_pu_bacteria | 2935648319 | 2935653641 | 289 |
| 163 | iso_pu_bacteria | 2935656913 | 2935662390 | 289 |
| 164 | iso_pu_bacteria | 2935769743 | 2935773042 | 289 |
| 165 | iso_pu_bacteria | 2935777560 | 2935782985 | 289 |
| 166 | iso_pu_bacteria | 2935785616 | 2935787969 | 289 |
| 167 | iso_pu_bacteria | 2935793552 | 2935796455 | 289 |
| 168 | iso_pu_bacteria | 2935819856 | 2935825477 | 289 |
| 169 | iso_pu_bacteria | 2935847175 | 2935853266 | 289 |
| 170 | iso_pu_bacteria | 2935908558 | 2935914739 | 289 |
| 171 | iso_pu_bacteria | 2935916978 | 2935918715 | 289 |
| 172 | iso_pu_bacteria | 2935926038 | 2935931568 | 289 |
| 173 | iso_pu_bacteria | 2935934488 | 2935940165 | 289 |
| 174 | iso_pu_bacteria | 2935942939 | 2935947488 | 289 |
| 175 | iso_pu_bacteria | 2935951376 | 2935956260 | 289 |
| 176 | iso_pu_bacteria | 2935967501 | 2935973053 | 289 |
| 177 | iso_pu_bacteria | 2935975950 | 2935980704 | 289 |
| 178 | iso_pu_bacteria | 2936011229 | 2936016692 | 289 |
| 179 | iso_pu_bacteria | 2936019824 | 2936025325 | 289 |
| 180 | iso_pu_bacteria | 2936028420 | 2936034167 | 289 |
| 181 | iso_pu_bacteria | 2936046547 | 2936052224 | 289 |
| 182 | iso_pu_bacteria | 2936055302 | 2936056315 | 289 |
| 183 | iso_pu_bacteria | 8006984368 | 8006990922 | 289 |
| 184 | iso_pu_bacteria | 8006994254 | 8006996511 | 289 |
| 185 | iso_pu_bacteria | 8016522445 | 8016526139 | 289 |
| 186 | iso_pu_bacteria | 8016539877 | 8016544055 | 289 |
| 187 | iso_pu_bacteria | 8016557553 | 8016557677 | 289 |
| 188 | iso_pu_bacteria | 8016566248 | 8016569460 | 289 |
| 189 | iso_pu_bacteria | 8016575299 | 8016582073 | 289 |
| 190 | iso_pu_bacteria | 8016595262 | 8016595710 | 289 |
| 191 | iso_pu_bacteria | 8016603502 | 8016606566 | 289 |
| 192 | iso_pu_bacteria | 8016613128 | 8016618468 | 289 |
| 193 | iso_pu_bacteria | 8016622563 | 8016623160 | 289 |
| 194 | iso_pu_bacteria | 8019530166 | 8019531027 | 289 |
| 195 | iso_pu_bacteria | 8019538911 | 8019540553 | 289 |
| 196 | iso_pu_bacteria | 8019547302 | 8019550174 | 289 |
| 197 | iso_pu_bacteria | 8019619141 | 8019622970 | 289 |
| 198 | iso_pu_bacteria | 8019629233 | 8019630136 | 289 |
| 199 | iso_pu_bacteria | 8019638758 | 8019640476 | 289 |
| 200 | iso_pu_bacteria | 8019659431 | 8019666970 | 289 |
| 201 | iso_pu_bacteria | 8019668869 | 8019676727 | 289 |
| 202 | iso_pu_bacteria | 8019678201 | 8019679263 | 289 |
| 203 | iso_pu_bacteria | 8019687851 | 8019696240 | 289 |
| 204 | 3300005439 | Ga0070711_100474025 | Ga0070711_1004740251 | 290 |
| 205 | 3300005563 | Ga0068855_100274067 | Ga0068855_1002740671 | 290 |
| 206 | 3300005617 | Ga0068859_100184572 | Ga0068859_1001845723 | 290 |
| 207 | 3300006038 | Ga0075365_10318386 | Ga0075365_103183862 | 290 |
| 208 | 3300006931 | Ga0097620_100184562 | Ga0097620_1001845623 | 290 |
| 209 | 3300013100 | Ga0157373_10053256 | Ga0157373_100532563 | 290 |
| 210 | 3300013308 | Ga0157375_10410565 | Ga0157375_104105651 | 290 |
| 211 | 3300014325 | Ga0163163_10002009 | Ga0163163_1000200914 | 290 |
| 212 | 3300025297 | Ga0209758_1002493 | Ga0209758_10024937 | 290 |
| 213 | 3300025915 | Ga0207693_10354295 | Ga0207693_103542951 | 290 |
| 214 | 3300025919 | Ga0207657_10131985 | Ga0207657_101319852 | 290 |
| 215 | 3300025942 | Ga0207689_10039585 | Ga0207689_100395854 | 290 |
| 216 | 3300035691 | Ga0373931_0019569 | Ga0373931_0019569_153_1031 | 290 |
| 217 | 3300037418 | Ga0395900_0546461 | Ga0395900_0546461_116_994 | 290 |
| 218 | 3300037466 | Ga0395898_0079473 | Ga0395898_0079473_275_1153 | 290 |
| 219 | 3300046507 | Ga0495606_0000252 | Ga0495606_0000252_72500_73378 | 290 |
| 220 | 3300046524 | Ga0495648_0024325 | Ga0495648_0024325_2883_3764 | 290 |
| 221 | 3300048905 | Ga0496102_0542835 | Ga0496102_0542835_15_893 | 290 |
| 222 | 3300048907 | Ga0496104_0018994 | Ga0496104_0018994_4183_5061 | 290 |
| 223 | 3300048909 | Ga0496106_0264519 | Ga0496106_0264519_467_1345 | 290 |
| 224 | 3300048910 | Ga0496107_0171489 | Ga0496107_0171489_713_1591 | 290 |
| 225 | 3300048910 | Ga0496107_0244377 | Ga0496107_0244377_90_980 | 290 |
| 226 | 3300048913 | Ga0496110_0008119 | Ga0496110_0008119_4812_5690 | 290 |
| 227 | 3300048914 | Ga0496111_0010213 | Ga0496111_0010213_4636_5514 | 290 |
| 228 | 3300048914 | Ga0496111_0196353 | Ga0496111_0196353_555_1433 | 290 |
| 229 | 3300048915 | Ga0496112_0000020 | Ga0496112_0000020_55591_56469 | 290 |
| 230 | 3300048915 | Ga0496112_0032339 | Ga0496112_0032339_1141_2019 | 290 |
| 231 | 3300048916 | Ga0496113_0076548 | Ga0496113_0076548_1422_2300 | 290 |
| 232 | 3300048918 | Ga0496115_0087123 | Ga0496115_0087123_1180_2058 | 290 |
| 233 | 3300048920 | Ga0496117_0120237 | Ga0496117_0120237_649_1527 | 290 |
| 234 | 3300048924 | Ga0496121_0001251 | Ga0496121_0001251_1566_2456 | 290 |
| 235 | 3300048924 | Ga0496121_0002323 | Ga0496121_0002323_1157_2035 | 290 |
| 236 | 3300048924 | Ga0496121_0133412 | Ga0496121_0133412_223_1110 | 290 |
| 237 | 3300048926 | Ga0496123_0101514 | Ga0496123_0101514_696_1583 | 290 |
| 238 | 3300048928 | Ga0496125_0070315 | Ga0496125_0070315_209_1096 | 290 |
| 239 | 3300048929 | Ga0496126_0016646 | Ga0496126_0016646_4076_4966 | 290 |
| 240 | 3300048929 | Ga0496126_0174331 | Ga0496126_0174331_223_1101 | 290 |
| 241 | 3300049568 | Ga0501031_0142806 | Ga0501031_0142806_288_1166 | 290 |
| 242 | 3300049570 | Ga0501033_0117807 | Ga0501033_0117807_433_1311 | 290 |
| 243 | 3300049570 | Ga0501033_0119051 | Ga0501033_0119051_705_1583 | 290 |
| 244 | 3300049570 | Ga0501033_0345629 | Ga0501033_0345629_112_990 | 290 |
| 245 | 3300049574 | Ga0501038_0199908 | Ga0501038_0199908_679_1557 | 290 |
| 246 | 3300049575 | Ga0501039_0142154 | Ga0501039_0142154_901_1779 | 290 |
| 247 | 3300049579 | Ga0501043_0289790 | Ga0501043_0289790_289_1167 | 290 |
| 248 | 3300049581 | Ga0501047_0244182 | Ga0501047_0244182_750_1628 | 290 |
| 249 | 3300049742 | Ga0501080_0186541 | Ga0501080_0186541_666_1544 | 290 |
| 250 | 3300050492 | nmdc:mga0yw44_208929_c1 | nmdc:mga0yw44_208929_c1_118_993 | 290 |
| 251 | 3300053093 | Ga0500651_0006892 | Ga0500651_0006892_3881_4759 | 290 |
| 252 | 3300053130 | Ga0500642_0011321 | Ga0500642_0011321_2002_2880 | 290 |
| 253 | 3300053156 | Ga0500622_0015984 | Ga0500622_0015984_232_1110 | 290 |
| 254 | 3300053177 | Ga0500636_0060283 | Ga0500636_0060283_759_1640 | 290 |
| 255 | iso_pu_bacteria | 2508501042 | 2508695485 | 290 |
| 256 | iso_pu_bacteria | 2511231028 | 2511400222 | 290 |
| 257 | iso_pu_bacteria | 2513237092 | 2513625345 | 290 |
| 258 | iso_pu_bacteria | 2513237094 | 2513644164 | 290 |
| 259 | iso_pu_bacteria | 2513237095 | 2513651516 | 290 |
| 260 | iso_pu_bacteria | 2513237102 | 2513705241 | 290 |
| 261 | iso_pu_bacteria | 2513237104 | 2513720304 | 290 |
| 262 | iso_pu_bacteria | 2513237139 | 2513873528 | 290 |
| 263 | iso_pu_bacteria | 2513237161 | 2514012485 | 290 |
| 264 | iso_pu_bacteria | 2517093001 | 2517107711 | 290 |
| 265 | iso_pu_bacteria | 2524023205 | 2524440890 | 290 |
| 266 | iso_pu_bacteria | 2528768022 | 2528852938 | 290 |
| 267 | iso_pu_bacteria | 2617270735 | 2617352398 | 290 |
| 268 | iso_pu_bacteria | 2617270741 | 2617373761 | 290 |
| 269 | iso_pu_bacteria | 2744054633 | 2745081688 | 290 |
| 270 | iso_pu_bacteria | 2791355196 | 2793062042 | 290 |
| 271 | iso_pu_bacteria | 2802429603 | 2805915612 | 290 |
| 272 | iso_pu_bacteria | 2816332527 | 2818237649 | 290 |
| 273 | iso_pu_bacteria | 2824600985 | 2824604584 | 290 |
| 274 | iso_pu_bacteria | 2824609381 | 2824612325 | 290 |
| 275 | iso_pu_bacteria | 2824617872 | 2824624500 | 290 |
| 276 | iso_pu_bacteria | 2824626560 | 2824633415 | 290 |
| 277 | iso_pu_bacteria | 2824635225 | 2824640288 | 290 |
| 278 | iso_pu_bacteria | 2824644064 | 2824647278 | 290 |
| 279 | iso_pu_bacteria | 2824653114 | 2824655190 | 290 |
| 280 | iso_pu_bacteria | 2824661429 | 2824667559 | 290 |
| 281 | iso_pu_bacteria | 2824671348 | 2824676625 | 290 |
| 282 | iso_pu_bacteria | 2824679649 | 2824684230 | 290 |
| 283 | iso_pu_bacteria | 2824687955 | 2824694701 | 290 |
| 284 | iso_pu_bacteria | 2824696289 | 2824704127 | 290 |
| 285 | iso_pu_bacteria | 2824704595 | 2824708929 | 290 |
| 286 | iso_pu_bacteria | 2824714736 | 2824717406 | 290 |
| 287 | iso_pu_bacteria | 2824723954 | 2824727631 | 290 |
| 288 | iso_pu_bacteria | 2824732956 | 2824737795 | 290 |
| 289 | iso_pu_bacteria | 2824746037 | 2824752227 | 290 |
| 290 | iso_pu_bacteria | 2824753945 | 2824759956 | 290 |
| 291 | iso_pu_bacteria | 2824763712 | 2824770390 | 290 |
| 292 | iso_pu_bacteria | 2824773399 | 2824775522 | 290 |
| 293 | iso_pu_bacteria | 2838122688 | 2838124513 | 290 |
| 294 | iso_pu_bacteria | 2841941048 | 2841945200 | 290 |
| 295 | iso_pu_bacteria | 2841949485 | 2841951981 | 290 |
| 296 | iso_pu_bacteria | 2841957949 | 2841965434 | 290 |
| 297 | iso_pu_bacteria | 2841966195 | 2841970623 | 290 |
| 298 | iso_pu_bacteria | 2841974524 | 2841979972 | 290 |
| 299 | iso_pu_bacteria | 2841983080 | 2841985152 | 290 |
| 300 | iso_pu_bacteria | 2842038055 | 2842043509 | 290 |
| 301 | iso_pu_bacteria | 2842045827 | 2842052501 | 290 |
| 302 | iso_pu_bacteria | 2844315083 | 2844315336 | 290 |
| 303 | iso_pu_bacteria | 2847930680 | 2847931073 | 290 |
| 304 | iso_pu_bacteria | 2847939898 | 2847942155 | 290 |
| 305 | iso_pu_bacteria | 2849076700 | 2849083035 | 290 |
| 306 | iso_pu_bacteria | 2857509624 | 2857511925 | 290 |
| 307 | iso_pu_bacteria | 2874612657 | 2874613436 | 290 |
| 308 | iso_pu_bacteria | 2874620515 | 2874624782 | 290 |
| 309 | iso_pu_bacteria | 2874628541 | 2874628795 | 290 |
| 310 | iso_pu_bacteria | 2876761206 | 2876768927 | 290 |
| 311 | iso_pu_bacteria | 2879083081 | 2879085907 | 290 |
| 312 | iso_pu_bacteria | 2879099564 | 2879106022 | 290 |
| 313 | iso_pu_bacteria | 2881364244 | 2881365317 | 290 |
| 314 | iso_pu_bacteria | 2881665667 | 2881668185 | 290 |
| 315 | iso_pu_bacteria | 2885366525 | 2885371028 | 290 |
| 316 | iso_pu_bacteria | 2885409591 | 2885411662 | 290 |
| 317 | iso_pu_bacteria | 2888378607 | 2888379593 | 290 |
| 318 | iso_pu_bacteria | 2888388044 | 2888390681 | 290 |
| 319 | iso_pu_bacteria | 2888419890 | 2888420306 | 290 |
| 320 | iso_pu_bacteria | 2903727486 | 2903732197 | 290 |
| 321 | iso_pu_bacteria | 2904666416 | 2904670263 | 290 |
| 322 | iso_pu_bacteria | 2904711408 | 2904713178 | 290 |
| 323 | iso_pu_bacteria | 2906602504 | 2906604274 | 290 |
| 324 | iso_pu_bacteria | 2906626472 | 2906628957 | 290 |
| 325 | iso_pu_bacteria | 2906643746 | 2906648178 | 290 |
| 326 | iso_pu_bacteria | 2908775508 | 2908776277 | 290 |
| 327 | iso_pu_bacteria | 2922368715 | 2922368936 | 290 |
| 328 | iso_pu_bacteria | 2922393267 | 2922394239 | 290 |
| 329 | iso_pu_bacteria | 2929615660 | 2929618601 | 290 |
| 330 | iso_pu_bacteria | 2929624759 | 2929628714 | 290 |
| 331 | iso_pu_bacteria | 2932784394 | 2932792923 | 290 |
| 332 | iso_pu_bacteria | 2932794094 | 2932794317 | 290 |
| 333 | iso_pu_bacteria | 2932801729 | 2932808089 | 290 |
| 334 | iso_pu_bacteria | 2932809354 | 2932812165 | 290 |
| 335 | iso_pu_bacteria | 2932818245 | 2932823155 | 290 |
| 336 | iso_pu_bacteria | 2932828146 | 2932836072 | 290 |
| 337 | iso_pu_bacteria | 2933577622 | 2933580687 | 290 |
| 338 | iso_pu_bacteria | 2935616580 | 2935618521 | 290 |
| 339 | iso_pu_bacteria | 2935638405 | 2935641078 | 290 |
| 340 | iso_pu_bacteria | 2935665750 | 2935669994 | 290 |
| 341 | iso_pu_bacteria | 2935675223 | 2935679156 | 290 |
| 342 | iso_pu_bacteria | 2935684952 | 2935690025 | 290 |
| 343 | iso_pu_bacteria | 2935694250 | 2935698544 | 290 |
| 344 | iso_pu_bacteria | 2935703347 | 2935711480 | 290 |
| 345 | iso_pu_bacteria | 2935713505 | 2935717544 | 290 |
| 346 | iso_pu_bacteria | 2935722832 | 2935723786 | 290 |
| 347 | iso_pu_bacteria | 2935732158 | 2935739995 | 290 |
| 348 | iso_pu_bacteria | 2935741537 | 2935749258 | 290 |
| 349 | iso_pu_bacteria | 2935750917 | 2935757379 | 290 |
| 350 | iso_pu_bacteria | 2935760218 | 2935763535 | 290 |
| 351 | iso_pu_bacteria | 2935801545 | 2935809958 | 290 |
| 352 | iso_pu_bacteria | 2935810662 | 2935816264 | 290 |
| 353 | iso_pu_bacteria | 2935827899 | 2935835657 | 290 |
| 354 | iso_pu_bacteria | 2935837841 | 2935844608 | 290 |
| 355 | iso_pu_bacteria | 2935855204 | 2935862946 | 290 |
| 356 | iso_pu_bacteria | 2935864058 | 2935866688 | 290 |
| 357 | iso_pu_bacteria | 2935873716 | 2935874995 | 290 |
| 358 | iso_pu_bacteria | 2935883170 | 2935890149 | 290 |
| 359 | iso_pu_bacteria | 2935959822 | 2935962636 | 290 |
| 360 | iso_pu_bacteria | 2935984226 | 2935985143 | 290 |
| 361 | iso_pu_bacteria | 2935992306 | 2935999729 | 290 |
| 362 | iso_pu_bacteria | 2936002035 | 2936010573 | 290 |
| 363 | iso_pu_bacteria | 2936037263 | 2936041269 | 290 |
| 364 | iso_pu_bacteria | 2940556831 | 2940563292 | 290 |
| 365 | iso_pu_bacteria | 2941531003 | 2941535514 | 290 |
| 366 | iso_pu_bacteria | 2941538514 | 2941543207 | 290 |
| 367 | iso_pu_bacteria | 3005483717 | 3005489070 | 290 |
| 368 | iso_pu_bacteria | 3005506211 | 3005509160 | 290 |
| 369 | iso_pu_bacteria | 3005594810 | 3005595050 | 290 |
| 370 | iso_pu_bacteria | 3005710791 | 3005710998 | 290 |
| 371 | iso_pu_bacteria | 3005718088 | 3005718303 | 290 |
| 372 | iso_pu_bacteria | 8006926726 | 8006927890 | 290 |
| 373 | iso_pu_bacteria | 8016511872 | 8016518182 | 290 |
| 374 | iso_pu_bacteria | 8016583857 | 8016586370 | 290 |
| 375 | iso_pu_bacteria | 8017057580 | 8017058465 | 290 |
| 376 | iso_pu_bacteria | 8019576017 | 8019577231 | 290 |
| 377 | iso_pu_bacteria | 8019586578 | 8019595311 | 290 |
| 378 | iso_pu_bacteria | 8019597564 | 8019606447 | 290 |
| 379 | iso_pu_bacteria | 8019648815 | 8019652470 | 290 |
| 380 | iso_pu_bacteria | 8055742211 | 8055742451 | 290 |
| 381 | iso_pu_bacteria | 8056967851 | 8056971288 | 290 |
| 382 | 3300005435 | Ga0070714_100118625 | Ga0070714_1001186252 | 291 |
| 383 | 3300005437 | Ga0070710_10109270 | Ga0070710_101092702 | 291 |
| 384 | 3300005439 | Ga0070711_100019254 | Ga0070711_1000192544 | 291 |
| 385 | 3300005548 | Ga0070665_100028170 | Ga0070665_1000281704 | 291 |
| 386 | 3300005614 | Ga0068856_100005093 | Ga0068856_1000050939 | 291 |
| 387 | 3300005937 | Ga0081455_10010204 | Ga0081455_100102048 | 291 |
| 388 | 3300006028 | Ga0070717_10088445 | Ga0070717_100884452 | 291 |
| 389 | 3300013104 | Ga0157370_10402729 | Ga0157370_104027291 | 291 |
| 390 | 3300013297 | Ga0157378_10743896 | Ga0157378_107438961 | 291 |
| 391 | 3300021358 | Ga0213873_10024285 | Ga0213873_100242852 | 291 |
| 392 | 3300021384 | Ga0213876_10002439 | Ga0213876_100024393 | 291 |
| 393 | 3300025906 | Ga0207699_10007202 | Ga0207699_100072023 | 291 |
| 394 | 3300025916 | Ga0207663_10083697 | Ga0207663_100836972 | 291 |
| 395 | 3300025929 | Ga0207664_10103518 | Ga0207664_101035182 | 291 |
| 396 | 3300025981 | Ga0207640_10047734 | Ga0207640_100477342 | 291 |
| 397 | 3300026078 | Ga0207702_10001701 | Ga0207702_1000170121 | 291 |
| 398 | 3300028379 | Ga0268266_10045729 | Ga0268266_100457293 | 291 |
| 399 | 3300031456 | Ga0307513_10222288 | Ga0307513_102222881 | 291 |
| 400 | 3300031711 | Ga0265314_10005687 | Ga0265314_100056874 | 291 |
| 401 | 3300039437 | Ga0436365_0803057 | Ga0436365_0803057_2335_3219 | 291 |
| 402 | 3300044684 | Ga0466966_0034959 | Ga0466966_0034959_588_1463 | 291 |
| 403 | 3300044735 | Ga0466968_0021266 | Ga0466968_0021266_578_1453 | 291 |
| 404 | 3300046462 | Ga0495651_0095034 | Ga0495651_0095034_82_963 | 291 |
| 405 | 3300046559 | Ga0495667_0033150 | Ga0495667_0033150_1048_1929 | 291 |
| 406 | 3300046675 | Ga0495657_0042749 | Ga0495657_0042749_1160_2041 | 291 |
| 407 | 3300047322 | Ga0495680_0231698 | Ga0495680_0231698_269_1144 | 291 |
| 408 | 3300048907 | Ga0496104_0030135 | Ga0496104_0030135_544_1422 | 291 |
| 409 | 3300048909 | Ga0496106_0000236 | Ga0496106_0000236_28909_29787 | 291 |
| 410 | 3300048910 | Ga0496107_0003292 | Ga0496107_0003292_134_1012 | 291 |
| 411 | 3300048911 | Ga0496108_0000849 | Ga0496108_0000849_17754_18632 | 291 |
| 412 | 3300048912 | Ga0496109_0000224 | Ga0496109_0000224_19538_20416 | 291 |
| 413 | 3300048913 | Ga0496110_0004203 | Ga0496110_0004203_7835_8713 | 291 |
| 414 | 3300048915 | Ga0496112_0001044 | Ga0496112_0001044_4695_5573 | 291 |
| 415 | 3300048916 | Ga0496113_0006740 | Ga0496113_0006740_5616_6494 | 291 |
| 416 | 3300048927 | Ga0496124_0070552 | Ga0496124_0070552_550_1440 | 291 |
| 417 | 3300048929 | Ga0496126_0025084 | Ga0496126_0025084_2506_3387 | 291 |
| 418 | 3300049570 | Ga0501033_0000440 | Ga0501033_0000440_23895_24776 | 291 |
| 419 | 3300049570 | Ga0501033_0012762 | Ga0501033_0012762_1613_2494 | 291 |
| 420 | 3300049571 | Ga0501034_0028177 | Ga0501034_0028177_4192_5073 | 291 |
| 421 | 3300049572 | Ga0501036_0044460 | Ga0501036_0044460_1091_1972 | 291 |
| 422 | 3300049572 | Ga0501036_0115578 | Ga0501036_0115578_819_1700 | 291 |
| 423 | 3300049572 | Ga0501036_0150293 | Ga0501036_0150293_471_1352 | 291 |
| 424 | 3300049573 | Ga0501037_0016024 | Ga0501037_0016024_4334_5215 | 291 |
| 425 | 3300049573 | Ga0501037_0106892 | Ga0501037_0106892_1037_1918 | 291 |
| 426 | 3300049574 | Ga0501038_0042710 | Ga0501038_0042710_1119_2000 | 291 |
| 427 | 3300049575 | Ga0501039_0137111 | Ga0501039_0137111_206_1087 | 291 |
| 428 | 3300049578 | Ga0501042_0035371 | Ga0501042_0035371_60_941 | 291 |
| 429 | 3300049579 | Ga0501043_0313691 | Ga0501043_0313691_226_1107 | 291 |
| 430 | 3300049580 | Ga0501046_0013048 | Ga0501046_0013048_4354_5235 | 291 |
| 431 | 3300049580 | Ga0501046_0050241 | Ga0501046_0050241_1471_2355 | 291 |
| 432 | 3300049580 | Ga0501046_0235227 | Ga0501046_0235227_84_965 | 291 |
| 433 | 3300049583 | Ga0501067_0114243 | Ga0501067_0114243_537_1418 | 291 |
| 434 | 3300049584 | Ga0501068_0056869 | Ga0501068_0056869_237_1118 | 291 |
| 435 | 3300049584 | Ga0501068_0065838 | Ga0501068_0065838_592_1473 | 291 |
| 436 | 3300049586 | Ga0501070_0180468 | Ga0501070_0180468_492_1373 | 291 |
| 437 | 3300049587 | Ga0501071_0073681 | Ga0501071_0073681_278_1159 | 291 |
| 438 | 3300049588 | Ga0501072_0226059 | Ga0501072_0226059_490_1371 | 291 |
| 439 | 3300049589 | Ga0501073_0056097 | Ga0501073_0056097_1077_1958 | 291 |
| 440 | 3300049589 | Ga0501073_0104808 | Ga0501073_0104808_599_1480 | 291 |
| 441 | 3300049592 | Ga0501076_0021057 | Ga0501076_0021057_2598_3479 | 291 |
| 442 | 3300049593 | Ga0501077_0060991 | Ga0501077_0060991_496_1377 | 291 |
| 443 | 3300049741 | Ga0501079_0091330 | Ga0501079_0091330_1219_2100 | 291 |
| 444 | 3300049742 | Ga0501080_0181287 | Ga0501080_0181287_973_1854 | 291 |
| 445 | 3300049822 | Ga0501035_0035988 | Ga0501035_0035988_316_1197 | 291 |
| 446 | 3300049822 | Ga0501035_0082774 | Ga0501035_0082774_1601_2482 | 291 |
| 447 | 3300049823 | Ga0501044_0001765 | Ga0501044_0001765_9634_10515 | 291 |
| 448 | 3300049823 | Ga0501044_0547336 | Ga0501044_0547336_135_1019 | 291 |
| 449 | 3300053093 | Ga0500651_0194034 | Ga0500651_0194034_45_932 | 291 |
| 450 | 3300053111 | Ga0500572_000191 | Ga0500572_000191_1816_2700 | 291 |
| 451 | 3300053119 | Ga0500595_014785 | Ga0500595_014785_97_978 | 291 |
| 452 | 3300053130 | Ga0500642_0048371 | Ga0500642_0048371_745_1635 | 291 |
| 453 | 3300053136 | Ga0500559_0000179 | Ga0500559_0000179_45627_46511 | 291 |
| 454 | 3300053163 | Ga0500639_022758 | Ga0500639_022758_1402_2286 | 291 |
| 455 | 3300053735 | Ga0500596_004482 | Ga0500596_004482_590_1474 | 291 |
| 456 | 3300054114 | Ga0501084_0185546 | Ga0501084_0185546_542_1423 | 291 |
| 457 | 3300001990 | JGI24737J22298_10024439 | JGI24737J22298_100244392 | 292 |
| 458 | 3300002067 | JGI24735J21928_10009808 | JGI24735J21928_100098083 | 292 |
| 459 | 3300005338 | Ga0068868_100016797 | Ga0068868_1000167974 | 292 |
| 460 | 3300005434 | Ga0070709_10000584 | Ga0070709_100005841 | 292 |
| 461 | 3300005436 | Ga0070713_100157380 | Ga0070713_1001573802 | 292 |
| 462 | 3300005437 | Ga0070710_10002351 | Ga0070710_100023512 | 292 |
| 463 | 3300005439 | Ga0070711_100022461 | Ga0070711_1000224614 | 292 |
| 464 | 3300005455 | Ga0070663_100062897 | Ga0070663_1000628972 | 292 |
| 465 | 3300005456 | Ga0070678_100015808 | Ga0070678_1000158085 | 292 |
| 466 | 3300005536 | Ga0070697_100289134 | Ga0070697_1002891343 | 292 |
| 467 | 3300005539 | Ga0068853_100086417 | Ga0068853_1000864171 | 292 |
| 468 | 3300005548 | Ga0070665_100099215 | Ga0070665_1000992152 | 292 |
| 469 | 3300005563 | Ga0068855_100015846 | Ga0068855_1000158462 | 292 |
| 470 | 3300005564 | Ga0070664_100189725 | Ga0070664_1001897252 | 292 |
| 471 | 3300005577 | Ga0068857_100576858 | Ga0068857_1005768582 | 292 |
| 472 | 3300005578 | Ga0068854_100222019 | Ga0068854_1002220192 | 292 |
| 473 | 3300005578 | Ga0068854_100318805 | Ga0068854_1003188052 | 292 |
| 474 | 3300005614 | Ga0068856_100012875 | Ga0068856_1000128754 | 292 |
| 475 | 3300005616 | Ga0068852_100341968 | Ga0068852_1003419682 | 292 |
| 476 | 3300005618 | Ga0068864_100026520 | Ga0068864_1000265204 | 292 |
| 477 | 3300005834 | Ga0068851_10030239 | Ga0068851_100302391 | 292 |
| 478 | 3300005842 | Ga0068858_100033778 | Ga0068858_1000337784 | 292 |
| 479 | 3300005842 | Ga0068858_100094168 | Ga0068858_1000941682 | 292 |
| 480 | 3300005842 | Ga0068858_100394178 | Ga0068858_1003941782 | 292 |
| 481 | 3300005843 | Ga0068860_100001450 | Ga0068860_10000145023 | 292 |
| 482 | 3300006028 | Ga0070717_10006989 | Ga0070717_100069894 | 292 |
| 483 | 3300006358 | Ga0068871_100330798 | Ga0068871_1003307982 | 292 |
| 484 | 3300006881 | Ga0068865_100349271 | Ga0068865_1003492712 | 292 |
| 485 | 3300006914 | Ga0075436_100397440 | Ga0075436_1003974402 | 292 |
| 486 | 3300007788 | Ga0099795_10064146 | Ga0099795_100641461 | 292 |
| 487 | 3300009093 | Ga0105240_10008228 | Ga0105240_1000822813 | 292 |
| 488 | 3300009101 | Ga0105247_10010882 | Ga0105247_100108822 | 292 |
| 489 | 3300009551 | Ga0105238_10015713 | Ga0105238_100157136 | 292 |
| 490 | 3300009551 | Ga0105238_10050367 | Ga0105238_100503672 | 292 |
| 491 | 3300009551 | Ga0105238_10074317 | Ga0105238_100743173 | 292 |
| 492 | 3300010375 | Ga0105239_10024695 | Ga0105239_100246954 | 292 |
| 493 | 3300010375 | Ga0105239_10064493 | Ga0105239_100644934 | 292 |
| 494 | 3300010375 | Ga0105239_10199644 | Ga0105239_101996442 | 292 |
| 495 | 3300010375 | Ga0105239_10211410 | Ga0105239_102114102 | 292 |
| 496 | 3300010375 | Ga0105239_10279826 | Ga0105239_102798262 | 292 |
| 497 | 3300011119 | Ga0105246_10081781 | Ga0105246_100817812 | 292 |
| 498 | 3300013104 | Ga0157370_10129027 | Ga0157370_101290272 | 292 |
| 499 | 3300013296 | Ga0157374_10228057 | Ga0157374_102280571 | 292 |
| 500 | 3300013307 | Ga0157372_10271108 | Ga0157372_102711082 | 292 |
| 501 | 3300013308 | Ga0157375_10028391 | Ga0157375_100283914 | 292 |
| 502 | 3300014325 | Ga0163163_10033178 | Ga0163163_100331784 | 292 |
| 503 | 3300014497 | Ga0182008_10159463 | Ga0182008_101594632 | 292 |
| 504 | 3300014968 | Ga0157379_10179402 | Ga0157379_101794022 | 292 |
| 505 | 3300014969 | Ga0157376_10010998 | Ga0157376_100109984 | 292 |
| 506 | 3300025898 | Ga0207692_10012905 | Ga0207692_100129052 | 292 |
| 507 | 3300025904 | Ga0207647_10168847 | Ga0207647_101688471 | 292 |
| 508 | 3300025906 | Ga0207699_10038283 | Ga0207699_100382832 | 292 |
| 509 | 3300025906 | Ga0207699_10323155 | Ga0207699_103231551 | 292 |
| 510 | 3300025907 | Ga0207645_10179478 | Ga0207645_101794781 | 292 |
| 511 | 3300025910 | Ga0207684_10077500 | Ga0207684_100775002 | 292 |
| 512 | 3300025915 | Ga0207693_10181848 | Ga0207693_101818482 | 292 |
| 513 | 3300025916 | Ga0207663_10016715 | Ga0207663_100167152 | 292 |
| 514 | 3300025920 | Ga0207649_10410030 | Ga0207649_104100301 | 292 |
| 515 | 3300025924 | Ga0207694_10274993 | Ga0207694_102749931 | 292 |
| 516 | 3300025927 | Ga0207687_10004089 | Ga0207687_100040892 | 292 |
| 517 | 3300025928 | Ga0207700_10117026 | Ga0207700_101170262 | 292 |
| 518 | 3300025929 | Ga0207664_10061778 | Ga0207664_100617783 | 292 |
| 519 | 3300025929 | Ga0207664_10588483 | Ga0207664_105884831 | 292 |
| 520 | 3300025939 | Ga0207665_10061076 | Ga0207665_100610763 | 292 |
| 521 | 3300025939 | Ga0207665_10085508 | Ga0207665_100855082 | 292 |
| 522 | 3300025940 | Ga0207691_10172053 | Ga0207691_101720532 | 292 |
| 523 | 3300025940 | Ga0207691_10441320 | Ga0207691_104413201 | 292 |
| 524 | 3300025941 | Ga0207711_10211107 | Ga0207711_102111071 | 292 |
| 525 | 3300025944 | Ga0207661_10073930 | Ga0207661_100739302 | 292 |
| 526 | 3300025949 | Ga0207667_10088774 | Ga0207667_100887744 | 292 |
| 527 | 3300026023 | Ga0207677_10024413 | Ga0207677_100244132 | 292 |
| 528 | 3300026035 | Ga0207703_10078340 | Ga0207703_100783402 | 292 |
| 529 | 3300026035 | Ga0207703_10281990 | Ga0207703_102819903 | 292 |
| 530 | 3300026041 | Ga0207639_10123004 | Ga0207639_101230042 | 292 |
| 531 | 3300026067 | Ga0207678_10003936 | Ga0207678_1000393612 | 292 |
| 532 | 3300026088 | Ga0207641_10327266 | Ga0207641_103272662 | 292 |
| 533 | 3300026089 | Ga0207648_10238899 | Ga0207648_102388992 | 292 |
| 534 | 3300026095 | Ga0207676_10095612 | Ga0207676_100956123 | 292 |
| 535 | 3300026116 | Ga0207674_10000890 | Ga0207674_100008902 | 292 |
| 536 | 3300026121 | Ga0207683_10016524 | Ga0207683_100165245 | 292 |
| 537 | 3300027357 | Ga0209589_1000021 | Ga0209589_1000021120 | 292 |
| 538 | 3300027361 | Ga0209489_100028 | Ga0209489_100028120 | 292 |
| 539 | 3300027363 | Ga0209700_100037 | Ga0209700_100037120 | 292 |
| 540 | 3300028379 | Ga0268266_10199057 | Ga0268266_101990572 | 292 |
| 541 | 3300028381 | Ga0268264_10000062 | Ga0268264_1000006218 | 292 |
| 542 | 3300028556 | Ga0265337_1018782 | Ga0265337_10187822 | 292 |
| 543 | 3300028558 | Ga0265326_10008390 | Ga0265326_100083903 | 292 |
| 544 | 3300028563 | Ga0265319_1012969 | Ga0265319_10129692 | 292 |
| 545 | 3300028573 | Ga0265334_10013964 | Ga0265334_100139643 | 292 |
| 546 | 3300028577 | Ga0265318_10016635 | Ga0265318_100166352 | 292 |
| 547 | 3300028653 | Ga0265323_10007956 | Ga0265323_100079564 | 292 |
| 548 | 3300028666 | Ga0265336_10000561 | Ga0265336_100005617 | 292 |
| 549 | 3300028800 | Ga0265338_10000598 | Ga0265338_1000059831 | 292 |
| 550 | 3300031238 | Ga0265332_10027603 | Ga0265332_100276032 | 292 |
| 551 | 3300031247 | Ga0265340_10041599 | Ga0265340_100415992 | 292 |
| 552 | 3300031249 | Ga0265339_10029701 | Ga0265339_100297011 | 292 |
| 553 | 3300031250 | Ga0265331_10100059 | Ga0265331_101000592 | 292 |
| 554 | 3300031456 | Ga0307513_10164506 | Ga0307513_101645061 | 292 |
| 555 | 3300031548 | Ga0307408_100239375 | Ga0307408_1002393752 | 292 |
| 556 | 3300031616 | Ga0307508_10000002 | Ga0307508_1000000244 | 292 |
| 557 | 3300031616 | Ga0307508_10078616 | Ga0307508_100786162 | 292 |
| 558 | 3300031730 | Ga0307516_10006094 | Ga0307516_100060944 | 292 |
| 559 | 3300032126 | Ga0307415_100362721 | Ga0307415_1003627212 | 292 |
| 560 | 3300033442 | Ga0315911_1000008 | Ga0315911_1000008309 | 292 |
| 561 | 3300033544 | Ga0316215_1002237 | Ga0316215_10022372 | 292 |
| 562 | 3300035083 | Ga0373926_0039711 | Ga0373926_0039711_465_1343 | 292 |
| 563 | 3300035086 | Ga0373934_0002932 | Ga0373934_0002932_4387_5265 | 292 |
| 564 | 3300035089 | Ga0373944_0042120 | Ga0373944_0042120_223_1101 | 292 |
| 565 | 3300035111 | Ga0373923_0009618 | Ga0373923_0009618_1319_2200 | 292 |
| 566 | 3300035113 | Ga0373936_0016692 | Ga0373936_0016692_583_1464 | 292 |
| 567 | 3300035113 | Ga0373936_0036388 | Ga0373936_0036388_532_1410 | 292 |
| 568 | 3300035115 | Ga0373941_0063086 | Ga0373941_0063086_96_974 | 292 |
| 569 | 3300035116 | Ga0373945_0019734 | Ga0373945_0019734_367_1248 | 292 |
| 570 | 3300035117 | Ga0373953_0000955 | Ga0373953_0000955_876_1754 | 292 |
| 571 | 3300035117 | Ga0373953_0034938 | Ga0373953_0034938_112_990 | 292 |
| 572 | 3300035118 | Ga0373954_0018760 | Ga0373954_0018760_1178_2056 | 292 |
| 573 | 3300035118 | Ga0373954_0018968 | Ga0373954_0018968_2169_3047 | 292 |
| 574 | 3300035119 | Ga0373956_0068497 | Ga0373956_0068497_221_1099 | 292 |
| 575 | 3300035120 | Ga0373957_0006831 | Ga0373957_0006831_1352_2230 | 292 |
| 576 | 3300035170 | Ga0373943_0002107 | Ga0373943_0002107_2167_3048 | 292 |
| 577 | 3300035170 | Ga0373943_0046258 | Ga0373943_0046258_172_1050 | 292 |
| 578 | 3300035171 | Ga0373946_0001889 | Ga0373946_0001889_6190_7071 | 292 |
| 579 | 3300035172 | Ga0373955_0005406 | Ga0373955_0005406_3690_4568 | 292 |
| 580 | 3300035410 | Ga0373924_0005676 | Ga0373924_0005676_210_1088 | 292 |
| 581 | 3300035410 | Ga0373924_0060733 | Ga0373924_0060733_170_1051 | 292 |
| 582 | 3300035692 | Ga0373935_0000557 | Ga0373935_0000557_4257_5138 | 292 |
| 583 | 3300035692 | Ga0373935_0308415 | Ga0373935_0308415_165_1043 | 292 |
| 584 | 3300035692 | Ga0373935_0443493 | Ga0373935_0443493_31_909 | 292 |
| 585 | 3300035695 | Ga0373927_0003654 | Ga0373927_0003654_6338_7219 | 292 |
| 586 | 3300035695 | Ga0373927_0010418 | Ga0373927_0010418_1128_2006 | 292 |
| 587 | 3300035695 | Ga0373927_0021960 | Ga0373927_0021960_184_1062 | 292 |
| 588 | 3300035695 | Ga0373927_0235046 | Ga0373927_0235046_148_1026 | 292 |
| 589 | 3300035724 | Ga0373933_0000031 | Ga0373933_0000031_47925_48803 | 292 |
| 590 | 3300035724 | Ga0373933_0003419 | Ga0373933_0003419_6627_7505 | 292 |
| 591 | 3300035724 | Ga0373933_0082944 | Ga0373933_0082944_965_1843 | 292 |
| 592 | 3300035725 | Ga0373947_0000509 | Ga0373947_0000509_9060_9941 | 292 |
| 593 | 3300035725 | Ga0373947_0049307 | Ga0373947_0049307_208_1086 | 292 |
| 594 | 3300035725 | Ga0373947_0346433 | Ga0373947_0346433_40_918 | 292 |
| 595 | 3300036401 | Ga0373937_0033982 | Ga0373937_0033982_3080_3961 | 292 |
| 596 | 3300036401 | Ga0373937_0284966 | Ga0373937_0284966_629_1507 | 292 |
| 597 | 3300036401 | Ga0373937_0380292 | Ga0373937_0380292_210_1091 | 292 |
| 598 | 3300037068 | Ga0373925_0001713 | Ga0373925_0001713_4193_5074 | 292 |
| 599 | 3300037068 | Ga0373925_0078993 | Ga0373925_0078993_1302_2180 | 292 |
| 600 | 3300037068 | Ga0373925_0110677 | Ga0373925_0110677_1036_1914 | 292 |
| 601 | 3300037068 | Ga0373925_0192510 | Ga0373925_0192510_357_1235 | 292 |
| 602 | 3300037466 | Ga0395898_0018463 | Ga0395898_0018463_1015_1893 | 292 |
| 603 | 3300037471 | Ga0395905_0023254 | Ga0395905_0023254_617_1495 | 292 |
| 604 | 3300038443 | Ga0395901_0224667 | Ga0395901_0224667_324_1202 | 292 |
| 605 | 3300039437 | Ga0436365_0966323 | Ga0436365_0966323_935_1828 | 292 |
| 606 | 3300039437 | Ga0436365_1369931 | Ga0436365_1369931_67_957 | 292 |
| 607 | 3300045976 | Ga0466967_0004006 | Ga0466967_0004006_5304_6182 | 292 |
| 608 | 3300045976 | Ga0466967_0088324 | Ga0466967_0088324_1444_2337 | 292 |
| 609 | 3300046454 | Ga0495592_0058216 | Ga0495592_0058216_643_1521 | 292 |
| 610 | 3300046454 | Ga0495592_0140768 | Ga0495592_0140768_464_1342 | 292 |
| 611 | 3300046454 | Ga0495592_0300267 | Ga0495592_0300267_43_927 | 292 |
| 612 | 3300046455 | Ga0495603_0000047 | Ga0495603_0000047_36840_37721 | 292 |
| 613 | 3300046455 | Ga0495603_0055753 | Ga0495603_0055753_220_1098 | 292 |
| 614 | 3300046459 | Ga0495629_0000320 | Ga0495629_0000320_36815_37696 | 292 |
| 615 | 3300046459 | Ga0495629_0231283 | Ga0495629_0231283_201_1079 | 292 |
| 616 | 3300046461 | Ga0495641_0009584 | Ga0495641_0009584_4709_5590 | 292 |
| 617 | 3300046462 | Ga0495651_0041190 | Ga0495651_0041190_1053_1931 | 292 |
| 618 | 3300046463 | Ga0495653_0003027 | Ga0495653_0003027_10979_11857 | 292 |
| 619 | 3300046463 | Ga0495653_0070906 | Ga0495653_0070906_1700_2578 | 292 |
| 620 | 3300046473 | Ga0495582_0000043 | Ga0495582_0000043_38688_39569 | 292 |
| 621 | 3300046473 | Ga0495582_0024699 | Ga0495582_0024699_557_1435 | 292 |
| 622 | 3300046473 | Ga0495582_0032646 | Ga0495582_0032646_142_1020 | 292 |
| 623 | 3300046475 | Ga0495639_0000091 | Ga0495639_0000091_14288_15169 | 292 |
| 624 | 3300046476 | Ga0495662_0000128 | Ga0495662_0000128_13265_14146 | 292 |
| 625 | 3300046477 | Ga0495664_0053492 | Ga0495664_0053492_915_1793 | 292 |
| 626 | 3300046499 | Ga0495594_0002035 | Ga0495594_0002035_3514_4395 | 292 |
| 627 | 3300046507 | Ga0495606_0194800 | Ga0495606_0194800_40_918 | 292 |
| 628 | 3300046514 | Ga0495618_0010884 | Ga0495618_0010884_670_1548 | 292 |
| 629 | 3300046516 | Ga0495628_0108009 | Ga0495628_0108009_1113_1994 | 292 |
| 630 | 3300046516 | Ga0495628_0261808 | Ga0495628_0261808_248_1126 | 292 |
| 631 | 3300046517 | Ga0495630_0014946 | Ga0495630_0014946_4715_5596 | 292 |
| 632 | 3300046526 | Ga0495666_0015987 | Ga0495666_0015987_1700_2581 | 292 |
| 633 | 3300046529 | Ga0495652_0011857 | Ga0495652_0011857_5950_6828 | 292 |
| 634 | 3300046531 | Ga0495665_0000051 | Ga0495665_0000051_38746_39627 | 292 |
| 635 | 3300046533 | Ga0495640_0007555 | Ga0495640_0007555_2967_3848 | 292 |
| 636 | 3300046533 | Ga0495640_0074727 | Ga0495640_0074727_498_1376 | 292 |
| 637 | 3300046535 | Ga0495586_0047218 | Ga0495586_0047218_616_1494 | 292 |
| 638 | 3300046536 | Ga0495587_0008144 | Ga0495587_0008144_1173_2051 | 292 |
| 639 | 3300046536 | Ga0495587_0029650 | Ga0495587_0029650_625_1503 | 292 |
| 640 | 3300046543 | Ga0495645_0021133 | Ga0495645_0021133_2378_3256 | 292 |
| 641 | 3300046543 | Ga0495645_0102551 | Ga0495645_0102551_1080_1958 | 292 |
| 642 | 3300046557 | Ga0495622_0015099 | Ga0495622_0015099_75_956 | 292 |
| 643 | 3300046557 | Ga0495622_0021698 | Ga0495622_0021698_1992_2882 | 292 |
| 644 | 3300046559 | Ga0495667_0004751 | Ga0495667_0004751_3692_4570 | 292 |
| 645 | 3300046559 | Ga0495667_0175879 | Ga0495667_0175879_101_979 | 292 |
| 646 | 3300046559 | Ga0495667_0188219 | Ga0495667_0188219_106_984 | 292 |
| 647 | 3300046642 | Ga0495634_0000400 | Ga0495634_0000400_33935_34816 | 292 |
| 648 | 3300046642 | Ga0495634_0021637 | Ga0495634_0021637_2799_3677 | 292 |
| 649 | 3300046642 | Ga0495634_0076053 | Ga0495634_0076053_1297_2175 | 292 |
| 650 | 3300046663 | Ga0495635_0000620 | Ga0495635_0000620_20428_21309 | 292 |
| 651 | 3300046663 | Ga0495635_0002202 | Ga0495635_0002202_4615_5493 | 292 |
| 652 | 3300046675 | Ga0495657_0013678 | Ga0495657_0013678_482_1360 | 292 |
| 653 | 3300046678 | Ga0495599_0009906 | Ga0495599_0009906_771_1649 | 292 |
| 654 | 3300046678 | Ga0495599_0069977 | Ga0495599_0069977_314_1192 | 292 |
| 655 | 3300046679 | Ga0495623_0037441 | Ga0495623_0037441_1015_1893 | 292 |
| 656 | 3300046680 | Ga0495646_0000643 | Ga0495646_0000643_13946_14824 | 292 |
| 657 | 3300046680 | Ga0495646_0043973 | Ga0495646_0043973_1805_2686 | 292 |
| 658 | 3300046681 | Ga0495647_0002769 | Ga0495647_0002769_3293_4174 | 292 |
| 659 | 3300046683 | Ga0495658_0000499 | Ga0495658_0000499_14760_15641 | 292 |
| 660 | 3300046690 | Ga0495624_0003704 | Ga0495624_0003704_6120_7001 | 292 |
| 661 | 3300046690 | Ga0495624_0096046 | Ga0495624_0096046_830_1708 | 292 |
| 662 | 3300047315 | Ga0495581_0000486 | Ga0495581_0000486_217_1098 | 292 |
| 663 | 3300047315 | Ga0495581_0061415 | Ga0495581_0061415_1089_1967 | 292 |
| 664 | 3300047315 | Ga0495581_0115928 | Ga0495581_0115928_57_935 | 292 |
| 665 | 3300047317 | Ga0495604_0031639 | Ga0495604_0031639_1917_2795 | 292 |
| 666 | 3300047319 | Ga0495674_0005428 | Ga0495674_0005428_344_1222 | 292 |
| 667 | 3300047319 | Ga0495674_0023537 | Ga0495674_0023537_1688_2569 | 292 |
| 668 | 3300047319 | Ga0495674_0131189 | Ga0495674_0131189_371_1249 | 292 |
| 669 | 3300047320 | Ga0495672_0022435 | Ga0495672_0022435_1069_1950 | 292 |
| 670 | 3300047320 | Ga0495672_0066467 | Ga0495672_0066467_1119_1997 | 292 |
| 671 | 3300047320 | Ga0495672_0081560 | Ga0495672_0081560_44_922 | 292 |
| 672 | 3300047321 | Ga0495676_0061706 | Ga0495676_0061706_171_1052 | 292 |
| 673 | 3300047322 | Ga0495680_0001909 | Ga0495680_0001909_1051_1929 | 292 |
| 674 | 3300047322 | Ga0495680_0040967 | Ga0495680_0040967_2329_3207 | 292 |
| 675 | 3300047322 | Ga0495680_0099424 | Ga0495680_0099424_96_977 | 292 |
| 676 | 3300047444 | Ga0495675_0103236 | Ga0495675_0103236_610_1488 | 292 |
| 677 | 3300047471 | Ga0495684_0000313 | Ga0495684_0000313_15393_16271 | 292 |
| 678 | 3300047471 | Ga0495684_0012322 | Ga0495684_0012322_18_899 | 292 |
| 679 | 3300047471 | Ga0495684_0103192 | Ga0495684_0103192_690_1568 | 292 |
| 680 | 3300047471 | Ga0495684_0206990 | Ga0495684_0206990_501_1379 | 292 |
| 681 | 3300047673 | Ga0495593_0000005 | Ga0495593_0000005_2232_3113 | 292 |
| 682 | 3300047673 | Ga0495593_0002672 | Ga0495593_0002672_7398_8276 | 292 |
| 683 | 3300048088 | Ga0495602_0118872 | Ga0495602_0118872_482_1360 | 292 |
| 684 | 3300048089 | Ga0495614_0006832 | Ga0495614_0006832_3676_4557 | 292 |
| 685 | 3300048091 | Ga0495626_0055731 | Ga0495626_0055731_425_1315 | 292 |
| 686 | 3300048903 | Ga0496100_0006321 | Ga0496100_0006321_4263_5141 | 292 |
| 687 | 3300048903 | Ga0496100_0331609 | Ga0496100_0331609_68_955 | 292 |
| 688 | 3300048904 | Ga0496101_0018505 | Ga0496101_0018505_678_1556 | 292 |
| 689 | 3300048905 | Ga0496102_0001314 | Ga0496102_0001314_10001_10879 | 292 |
| 690 | 3300048905 | Ga0496102_0554459 | Ga0496102_0554459_97_975 | 292 |
| 691 | 3300048906 | Ga0496103_0047615 | Ga0496103_0047615_126_1004 | 292 |
| 692 | 3300048907 | Ga0496104_0007367 | Ga0496104_0007367_4581_5459 | 292 |
| 693 | 3300048908 | Ga0496105_0003051 | Ga0496105_0003051_9305_10183 | 292 |
| 694 | 3300048908 | Ga0496105_0040662 | Ga0496105_0040662_874_1752 | 292 |
| 695 | 3300048909 | Ga0496106_0014089 | Ga0496106_0014089_4615_5493 | 292 |
| 696 | 3300048910 | Ga0496107_0091750 | Ga0496107_0091750_522_1409 | 292 |
| 697 | 3300048910 | Ga0496107_0110889 | Ga0496107_0110889_271_1149 | 292 |
| 698 | 3300048911 | Ga0496108_0016993 | Ga0496108_0016993_1333_2211 | 292 |
| 699 | 3300048911 | Ga0496108_0304768 | Ga0496108_0304768_21_899 | 292 |
| 700 | 3300048911 | Ga0496108_0360185 | Ga0496108_0360185_117_995 | 292 |
| 701 | 3300048912 | Ga0496109_0010749 | Ga0496109_0010749_3672_4550 | 292 |
| 702 | 3300048912 | Ga0496109_0148771 | Ga0496109_0148771_45_932 | 292 |
| 703 | 3300048913 | Ga0496110_0027437 | Ga0496110_0027437_88_966 | 292 |
| 704 | 3300048913 | Ga0496110_0056327 | Ga0496110_0056327_56_934 | 292 |
| 705 | 3300048913 | Ga0496110_0132154 | Ga0496110_0132154_1101_1979 | 292 |
| 706 | 3300048914 | Ga0496111_0008238 | Ga0496111_0008238_1425_2303 | 292 |
| 707 | 3300048915 | Ga0496112_0014481 | Ga0496112_0014481_2418_3296 | 292 |
| 708 | 3300048915 | Ga0496112_0128611 | Ga0496112_0128611_272_1150 | 292 |
| 709 | 3300048915 | Ga0496112_0218018 | Ga0496112_0218018_93_971 | 292 |
| 710 | 3300048915 | Ga0496112_0462284 | Ga0496112_0462284_283_1161 | 292 |
| 711 | 3300048916 | Ga0496113_0037992 | Ga0496113_0037992_61_939 | 292 |
| 712 | 3300048916 | Ga0496113_0059445 | Ga0496113_0059445_965_1843 | 292 |
| 713 | 3300048917 | Ga0496114_0009847 | Ga0496114_0009847_4481_5359 | 292 |
| 714 | 3300048918 | Ga0496115_0023846 | Ga0496115_0023846_1634_2512 | 292 |
| 715 | 3300048918 | Ga0496115_0087298 | Ga0496115_0087298_810_1688 | 292 |
| 716 | 3300048918 | Ga0496115_0372611 | Ga0496115_0372611_34_912 | 292 |
| 717 | 3300048920 | Ga0496117_0021089 | Ga0496117_0021089_2928_3806 | 292 |
| 718 | 3300048920 | Ga0496117_0153817 | Ga0496117_0153817_363_1256 | 292 |
| 719 | 3300048921 | Ga0496118_0003026 | Ga0496118_0003026_5012_5890 | 292 |
| 720 | 3300048921 | Ga0496118_0027995 | Ga0496118_0027995_1842_2735 | 292 |
| 721 | 3300048922 | Ga0496119_0038888 | Ga0496119_0038888_253_1146 | 292 |
| 722 | 3300048924 | Ga0496121_0000203 | Ga0496121_0000203_126307_127185 | 292 |
| 723 | 3300048924 | Ga0496121_0000270 | Ga0496121_0000270_114_992 | 292 |
| 724 | 3300048924 | Ga0496121_0042502 | Ga0496121_0042502_1413_2306 | 292 |
| 725 | 3300048925 | Ga0496122_0052331 | Ga0496122_0052331_1880_2761 | 292 |
| 726 | 3300048927 | Ga0496124_0011952 | Ga0496124_0011952_3805_4683 | 292 |
| 727 | 3300048927 | Ga0496124_0048269 | Ga0496124_0048269_1028_1921 | 292 |
| 728 | 3300048928 | Ga0496125_0000328 | Ga0496125_0000328_46152_47039 | 292 |
| 729 | 3300048928 | Ga0496125_0024628 | Ga0496125_0024628_1024_1902 | 292 |
| 730 | 3300048928 | Ga0496125_0087175 | Ga0496125_0087175_680_1573 | 292 |
| 731 | 3300048929 | Ga0496126_0010158 | Ga0496126_0010158_3761_4639 | 292 |
| 732 | 3300048929 | Ga0496126_0086523 | Ga0496126_0086523_1647_2525 | 292 |
| 733 | 3300048929 | Ga0496126_0088126 | Ga0496126_0088126_637_1515 | 292 |
| 734 | 3300049569 | Ga0501032_0042704 | Ga0501032_0042704_291_1175 | 292 |
| 735 | 3300049573 | Ga0501037_0105558 | Ga0501037_0105558_619_1503 | 292 |
| 736 | 3300049574 | Ga0501038_0000626 | Ga0501038_0000626_45_929 | 292 |
| 737 | 3300049575 | Ga0501039_0021665 | Ga0501039_0021665_2003_2887 | 292 |
| 738 | 3300049579 | Ga0501043_0011678 | Ga0501043_0011678_2044_2928 | 292 |
| 739 | 3300049581 | Ga0501047_0142285 | Ga0501047_0142285_774_1658 | 292 |
| 740 | 3300049823 | Ga0501044_0009154 | Ga0501044_0009154_7907_8791 | 292 |
| 741 | 3300050491 | nmdc:mga00v17_162020_c1 | nmdc:mga00v17_162020_c1_151_1032 | 292 |
| 742 | 3300050494 | nmdc:mga06z11_255013_c1 | nmdc:mga06z11_255013_c1_39_920 | 292 |
| 743 | 3300053077 | Ga0495601_0086261 | Ga0495601_0086261_622_1500 | 292 |
| 744 | 3300053077 | Ga0495601_0233021 | Ga0495601_0233021_271_1149 | 292 |
| 745 | 3300053080 | Ga0500635_0055968 | Ga0500635_0055968_337_1215 | 292 |
| 746 | 3300053084 | Ga0495595_0000445 | Ga0495595_0000445_849_1727 | 292 |
| 747 | 3300053084 | Ga0495595_0005883 | Ga0495595_0005883_3488_4366 | 292 |
| 748 | 3300053085 | Ga0495619_0000330 | Ga0495619_0000330_610_1488 | 292 |
| 749 | 3300053094 | Ga0500566_0000247 | Ga0500566_0000247_14899_15789 | 292 |
| 750 | 3300053121 | Ga0500607_020092 | Ga0500607_020092_1381_2271 | 292 |
| 751 | 3300053125 | Ga0500618_004575 | Ga0500618_004575_1578_2468 | 292 |
| 752 | 3300053125 | Ga0500618_017251 | Ga0500618_017251_814_1704 | 292 |
| 753 | 3300053136 | Ga0500559_0000398 | Ga0500559_0000398_4730_5620 | 292 |
| 754 | 3300053136 | Ga0500559_0139060 | Ga0500559_0139060_120_998 | 292 |
| 755 | 3300053140 | Ga0500573_0232028 | Ga0500573_0232028_31_909 | 292 |
| 756 | 3300053178 | Ga0500637_0215510 | Ga0500637_0215510_177_1055 | 292 |
| 757 | 3300053735 | Ga0500596_007212 | Ga0500596_007212_871_1749 | 292 |
| 758 | 3300003203 | JGI25406J46586_10002779 | JGI25406J46586_100027793 | 293 |
| 759 | 3300003215 | JGI25153J46596_10003450 | JGI25153J46596_100034506 | 293 |
| 760 | 3300005327 | Ga0070658_10068227 | Ga0070658_100682274 | 293 |
| 761 | 3300005327 | Ga0070658_10084002 | Ga0070658_100840022 | 293 |
| 762 | 3300005329 | Ga0070683_100005996 | Ga0070683_1000059965 | 293 |
| 763 | 3300005356 | Ga0070674_100234639 | Ga0070674_1002346391 | 293 |
| 764 | 3300005434 | Ga0070709_10013026 | Ga0070709_100130264 | 293 |
| 765 | 3300005436 | Ga0070713_100415359 | Ga0070713_1004153592 | 293 |
| 766 | 3300005439 | Ga0070711_100004456 | Ga0070711_1000044566 | 293 |
| 767 | 3300005458 | Ga0070681_10014969 | Ga0070681_100149693 | 293 |
| 768 | 3300005458 | Ga0070681_10051117 | Ga0070681_100511173 | 293 |
| 769 | 3300005458 | Ga0070681_10089577 | Ga0070681_100895772 | 293 |
| 770 | 3300005530 | Ga0070679_100039226 | Ga0070679_1000392262 | 293 |
| 771 | 3300005530 | Ga0070679_100066868 | Ga0070679_1000668682 | 293 |
| 772 | 3300005535 | Ga0070684_100007764 | Ga0070684_1000077644 | 293 |
| 773 | 3300005539 | Ga0068853_100279593 | Ga0068853_1002795932 | 293 |
| 774 | 3300005548 | Ga0070665_100250510 | Ga0070665_1002505102 | 293 |
| 775 | 3300005577 | Ga0068857_100041204 | Ga0068857_1000412044 | 293 |
| 776 | 3300005614 | Ga0068856_100129808 | Ga0068856_1001298083 | 293 |
| 777 | 3300005937 | Ga0081455_10037390 | Ga0081455_100373905 | 293 |
| 778 | 3300005983 | Ga0081540_1011061 | Ga0081540_10110612 | 293 |
| 779 | 3300005983 | Ga0081540_1021192 | Ga0081540_10211921 | 293 |
| 780 | 3300005985 | Ga0081539_10004737 | Ga0081539_100047374 | 293 |
| 781 | 3300006846 | Ga0075430_100389813 | Ga0075430_1003898132 | 293 |
| 782 | 3300009098 | Ga0105245_10197939 | Ga0105245_101979392 | 293 |
| 783 | 3300009545 | Ga0105237_10168546 | Ga0105237_101685462 | 293 |
| 784 | 3300009545 | Ga0105237_10304187 | Ga0105237_103041872 | 293 |
| 785 | 3300009545 | Ga0105237_10789028 | Ga0105237_107890281 | 293 |
| 786 | 3300009553 | Ga0105249_10269902 | Ga0105249_102699022 | 293 |
| 787 | 3300010375 | Ga0105239_10356811 | Ga0105239_103568112 | 293 |
| 788 | 3300013105 | Ga0157369_10071197 | Ga0157369_100711971 | 293 |
| 789 | 3300013105 | Ga0157369_10684080 | Ga0157369_106840801 | 293 |
| 790 | 3300013306 | Ga0163162_10277441 | Ga0163162_102774412 | 293 |
| 791 | 3300020082 | Ga0206353_10567907 | Ga0206353_105679072 | 293 |
| 792 | 3300025297 | Ga0209758_1011302 | Ga0209758_10113024 | 293 |
| 793 | 3300025906 | Ga0207699_10245906 | Ga0207699_102459061 | 293 |
| 794 | 3300025912 | Ga0207707_10004700 | Ga0207707_100047004 | 293 |
| 795 | 3300025912 | Ga0207707_10104173 | Ga0207707_101041732 | 293 |
| 796 | 3300025912 | Ga0207707_10158480 | Ga0207707_101584802 | 293 |
| 797 | 3300025913 | Ga0207695_10318707 | Ga0207695_103187072 | 293 |
| 798 | 3300025915 | Ga0207693_10021450 | Ga0207693_100214505 | 293 |
| 799 | 3300025915 | Ga0207693_10034078 | Ga0207693_100340784 | 293 |
| 800 | 3300025919 | Ga0207657_10073517 | Ga0207657_100735172 | 293 |
| 801 | 3300025921 | Ga0207652_10079219 | Ga0207652_100792192 | 293 |
| 802 | 3300025921 | Ga0207652_10136044 | Ga0207652_101360442 | 293 |
| 803 | 3300025927 | Ga0207687_10330306 | Ga0207687_103303061 | 293 |
| 804 | 3300025944 | Ga0207661_10056040 | Ga0207661_100560403 | 293 |
| 805 | 3300025944 | Ga0207661_10670737 | Ga0207661_106707371 | 293 |
| 806 | 3300025949 | Ga0207667_10109852 | Ga0207667_101098521 | 293 |
| 807 | 3300026078 | Ga0207702_10337936 | Ga0207702_103379361 | 293 |
| 808 | 3300026089 | Ga0207648_10060413 | Ga0207648_100604133 | 293 |
| 809 | 3300026116 | Ga0207674_10052673 | Ga0207674_100526734 | 293 |
| 810 | 3300026118 | Ga0207675_100389764 | Ga0207675_1003897641 | 293 |
| 811 | 3300028379 | Ga0268266_10410158 | Ga0268266_104101582 | 293 |
| 812 | 3300028794 | Ga0307515_10125511 | Ga0307515_101255112 | 293 |
| 813 | 3300031238 | Ga0265332_10016039 | Ga0265332_100160393 | 293 |
| 814 | 3300031239 | Ga0265328_10044554 | Ga0265328_100445542 | 293 |
| 815 | 3300031241 | Ga0265325_10009157 | Ga0265325_100091574 | 293 |
| 816 | 3300031249 | Ga0265339_10007110 | Ga0265339_100071104 | 293 |
| 817 | 3300031250 | Ga0265331_10027874 | Ga0265331_100278742 | 293 |
| 818 | 3300031456 | Ga0307513_10105188 | Ga0307513_101051883 | 293 |
| 819 | 3300031595 | Ga0265313_10041739 | Ga0265313_100417392 | 293 |
| 820 | 3300031711 | Ga0265314_10147464 | Ga0265314_101474641 | 293 |
| 821 | 3300031712 | Ga0265342_10005853 | Ga0265342_100058535 | 293 |
| 822 | 3300033180 | Ga0307510_10025056 | Ga0307510_100250566 | 293 |
| 823 | 3300035113 | Ga0373936_0070087 | Ga0373936_0070087_226_1122 | 293 |
| 824 | 3300035695 | Ga0373927_0027049 | Ga0373927_0027049_1433_2317 | 293 |
| 825 | 3300035725 | Ga0373947_0151339 | Ga0373947_0151339_255_1148 | 293 |
| 826 | 3300037068 | Ga0373925_0110804 | Ga0373925_0110804_301_1185 | 293 |
| 827 | 3300037418 | Ga0395900_0080281 | Ga0395900_0080281_2252_3136 | 293 |
| 828 | 3300037466 | Ga0395898_0099077 | Ga0395898_0099077_1373_2257 | 293 |
| 829 | 3300037471 | Ga0395905_0165060 | Ga0395905_0165060_59_943 | 293 |
| 830 | 3300039437 | Ga0436365_0076766 | Ga0436365_0076766_263_1144 | 293 |
| 831 | 3300039447 | Ga0436361_0336324 | Ga0436361_0336324_598_1479 | 293 |
| 832 | 3300039447 | Ga0436361_0937863 | Ga0436361_0937863_450_1331 | 293 |
| 833 | 3300039450 | Ga0436363_0697337 | Ga0436363_0697337_224_1105 | 293 |
| 834 | 3300044694 | Ga0466963_0080797 | Ga0466963_0080797_1222_2103 | 293 |
| 835 | 3300045049 | Ga0466959_0053472 | Ga0466959_0053472_1225_2106 | 293 |
| 836 | 3300045049 | Ga0466959_0361912 | Ga0466959_0361912_37_918 | 293 |
| 837 | 3300045976 | Ga0466967_0011512 | Ga0466967_0011512_4411_5292 | 293 |
| 838 | 3300046455 | Ga0495603_0070506 | Ga0495603_0070506_678_1571 | 293 |
| 839 | 3300046477 | Ga0495664_0016934 | Ga0495664_0016934_1831_2712 | 293 |
| 840 | 3300046499 | Ga0495594_0137115 | Ga0495594_0137115_218_1111 | 293 |
| 841 | 3300046507 | Ga0495606_0048505 | Ga0495606_0048505_1746_2630 | 293 |
| 842 | 3300046524 | Ga0495648_0000286 | Ga0495648_0000286_33671_34552 | 293 |
| 843 | 3300047315 | Ga0495581_0114111 | Ga0495581_0114111_114_998 | 293 |
| 844 | 3300047321 | Ga0495676_0087102 | Ga0495676_0087102_1352_2236 | 293 |
| 845 | 3300048906 | Ga0496103_0250773 | Ga0496103_0250773_194_1075 | 293 |
| 846 | 3300048907 | Ga0496104_0272046 | Ga0496104_0272046_244_1128 | 293 |
| 847 | 3300048910 | Ga0496107_0130670 | Ga0496107_0130670_538_1431 | 293 |
| 848 | 3300048910 | Ga0496107_0239906 | Ga0496107_0239906_205_1092 | 293 |
| 849 | 3300048915 | Ga0496112_0036502 | Ga0496112_0036502_644_1525 | 293 |
| 850 | 3300048924 | Ga0496121_0267653 | Ga0496121_0267653_231_1112 | 293 |
| 851 | 3300048929 | Ga0496126_0035866 | Ga0496126_0035866_3340_4221 | 293 |
| 852 | 3300048929 | Ga0496126_0208070 | Ga0496126_0208070_197_1078 | 293 |
| 853 | 3300048929 | Ga0496126_0286373 | Ga0496126_0286373_109_990 | 293 |
| 854 | 3300049580 | Ga0501046_0028766 | Ga0501046_0028766_1751_2632 | 293 |
| 855 | 3300049581 | Ga0501047_0010976 | Ga0501047_0010976_4552_5433 | 293 |
| 856 | 3300049581 | Ga0501047_0428330 | Ga0501047_0428330_65_949 | 293 |
| 857 | 3300049586 | Ga0501070_0062656 | Ga0501070_0062656_73_954 | 293 |
| 858 | 3300049590 | Ga0501074_0100957 | Ga0501074_0100957_117_998 | 293 |
| 859 | 3300049742 | Ga0501080_0031118 | Ga0501080_0031118_458_1339 | 293 |
| 860 | 3300050513 | nmdc:mga0rr50_314731_c1 | nmdc:mga0rr50_314731_c1_194_1084 | 293 |
| 861 | 3300053077 | Ga0495601_0049218 | Ga0495601_0049218_806_1687 | 293 |
| 862 | 3300053080 | Ga0500635_0048938 | Ga0500635_0048938_123_1004 | 293 |
| 863 | 3300053083 | Ga0495655_0003764 | Ga0495655_0003764_820_1704 | 293 |
| 864 | 3300053094 | Ga0500566_0005190 | Ga0500566_0005190_994_1878 | 293 |
| 865 | 3300053094 | Ga0500566_0202460 | Ga0500566_0202460_45_929 | 293 |
| 866 | 3300053095 | Ga0500640_068405 | Ga0500640_068405_194_1078 | 293 |
| 867 | 3300053096 | Ga0500641_0035557 | Ga0500641_0035557_55_939 | 293 |
| 868 | 3300053102 | Ga0500554_003943 | Ga0500554_003943_373_1254 | 293 |
| 869 | 3300053111 | Ga0500572_019537 | Ga0500572_019537_196_1080 | 293 |
| 870 | 3300053122 | Ga0500608_051127 | Ga0500608_051127_566_1450 | 293 |
| 871 | 3300053123 | Ga0500614_019160 | Ga0500614_019160_194_1078 | 293 |
| 872 | 3300053136 | Ga0500559_0042227 | Ga0500559_0042227_554_1438 | 293 |
| 873 | 3300053150 | Ga0500603_001290 | Ga0500603_001290_2027_2908 | 293 |
| 874 | 3300053150 | Ga0500603_007487 | Ga0500603_007487_913_1797 | 293 |
| 875 | 3300053159 | Ga0500630_065807 | Ga0500630_065807_553_1437 | 293 |
| 876 | 3300053163 | Ga0500639_013853 | Ga0500639_013853_2169_3053 | 293 |
| 877 | 3300053178 | Ga0500637_0017723 | Ga0500637_0017723_2810_3691 | 293 |
| 878 | 3300002075 | JGI24738J21930_10006735 | JGI24738J21930_100067352 | 294 |
| 879 | 3300003215 | JGI25153J46596_10011834 | JGI25153J46596_100118344 | 294 |
| 880 | 3300003771 | Ga0055526_1043009 | Ga0055526_10430091 | 294 |
| 881 | 3300003794 | Ga0055531_10014489 | Ga0055531_100144893 | 294 |
| 882 | 3300005262 | Ga0065165_1000365 | Ga0065165_100036520 | 294 |
| 883 | 3300005262 | Ga0065165_1001495 | Ga0065165_100149521 | 294 |
| 884 | 3300005262 | Ga0065165_1019115 | Ga0065165_10191151 | 294 |
| 885 | 3300005353 | Ga0070669_100066355 | Ga0070669_1000663552 | 294 |
| 886 | 3300005355 | Ga0070671_100129955 | Ga0070671_1001299552 | 294 |
| 887 | 3300005539 | Ga0068853_100196525 | Ga0068853_1001965251 | 294 |
| 888 | 3300005563 | Ga0068855_100526603 | Ga0068855_1005266032 | 294 |
| 889 | 3300005577 | Ga0068857_100227058 | Ga0068857_1002270581 | 294 |
| 890 | 3300005616 | Ga0068852_100042806 | Ga0068852_1000428064 | 294 |
| 891 | 3300005937 | Ga0081455_10009536 | Ga0081455_100095367 | 294 |
| 892 | 3300005983 | Ga0081540_1012813 | Ga0081540_10128135 | 294 |
| 893 | 3300006042 | Ga0075368_10003158 | Ga0075368_100031584 | 294 |
| 894 | 3300006048 | Ga0075363_100016306 | Ga0075363_1000163062 | 294 |
| 895 | 3300006186 | Ga0075369_10076719 | Ga0075369_100767192 | 294 |
| 896 | 3300006195 | Ga0075366_10061029 | Ga0075366_100610291 | 294 |
| 897 | 3300006353 | Ga0075370_10156285 | Ga0075370_101562852 | 294 |
| 898 | 3300006944 | Ga0099823_1022515 | Ga0099823_10225152 | 294 |
| 899 | 3300009093 | Ga0105240_10031181 | Ga0105240_100311814 | 294 |
| 900 | 3300009174 | Ga0105241_10072988 | Ga0105241_100729882 | 294 |
| 901 | 3300009174 | Ga0105241_10082572 | Ga0105241_100825723 | 294 |
| 902 | 3300009545 | Ga0105237_10010095 | Ga0105237_100100954 | 294 |
| 903 | 3300009551 | Ga0105238_10597241 | Ga0105238_105972411 | 294 |
| 904 | 3300009553 | Ga0105249_10164867 | Ga0105249_101648671 | 294 |
| 905 | 3300010375 | Ga0105239_10080757 | Ga0105239_100807572 | 294 |
| 906 | 3300013308 | Ga0157375_10293938 | Ga0157375_102939381 | 294 |
| 907 | 3300014745 | Ga0157377_10178578 | Ga0157377_101785781 | 294 |
| 908 | 3300021320 | Ga0214544_1000016 | Ga0214544_1000016169 | 294 |
| 909 | 3300021321 | Ga0214542_1000016 | Ga0214542_100001633 | 294 |
| 910 | 3300021324 | Ga0214545_1000008 | Ga0214545_100000839 | 294 |
| 911 | 3300021327 | Ga0214543_1001466 | Ga0214543_100146633 | 294 |
| 912 | 3300025230 | Ga0209563_108642 | Ga0209563_1086421 | 294 |
| 913 | 3300025253 | Ga0209677_105633 | Ga0209677_1056333 | 294 |
| 914 | 3300025254 | Ga0209148_1000282 | Ga0209148_100028222 | 294 |
| 915 | 3300025261 | Ga0209233_1005872 | Ga0209233_10058723 | 294 |
| 916 | 3300025295 | Ga0209564_1003702 | Ga0209564_10037025 | 294 |
| 917 | 3300025297 | Ga0209758_1000069 | Ga0209758_100006953 | 294 |
| 918 | 3300025297 | Ga0209758_1000635 | Ga0209758_100063541 | 294 |
| 919 | 3300025297 | Ga0209758_1001996 | Ga0209758_100199617 | 294 |
| 920 | 3300025297 | Ga0209758_1017490 | Ga0209758_10174903 | 294 |
| 921 | 3300025299 | Ga0209256_1015129 | Ga0209256_10151293 | 294 |
| 922 | 3300025299 | Ga0209256_1032713 | Ga0209256_10327131 | 294 |
| 923 | 3300025302 | Ga0207426_1002082 | Ga0207426_10020822 | 294 |
| 924 | 3300025302 | Ga0207426_1020494 | Ga0207426_10204941 | 294 |
| 925 | 3300025302 | Ga0207426_1024931 | Ga0207426_10249312 | 294 |
| 926 | 3300025304 | Ga0209257_1000473 | Ga0209257_100047342 | 294 |
| 927 | 3300025304 | Ga0209257_1017693 | Ga0209257_10176931 | 294 |
| 928 | 3300025315 | Ga0207697_10065589 | Ga0207697_100655892 | 294 |
| 929 | 3300025904 | Ga0207647_10014195 | Ga0207647_100141954 | 294 |
| 930 | 3300025911 | Ga0207654_10006549 | Ga0207654_100065494 | 294 |
| 931 | 3300025911 | Ga0207654_10011597 | Ga0207654_100115972 | 294 |
| 932 | 3300025911 | Ga0207654_10089954 | Ga0207654_100899543 | 294 |
| 933 | 3300025913 | Ga0207695_10000107 | Ga0207695_10000107224 | 294 |
| 934 | 3300025914 | Ga0207671_10018412 | Ga0207671_100184122 | 294 |
| 935 | 3300025923 | Ga0207681_10066644 | Ga0207681_100666442 | 294 |
| 936 | 3300025931 | Ga0207644_10066408 | Ga0207644_100664082 | 294 |
| 937 | 3300025933 | Ga0207706_10203009 | Ga0207706_102030092 | 294 |
| 938 | 3300025935 | Ga0207709_10250155 | Ga0207709_102501552 | 294 |
| 939 | 3300025940 | Ga0207691_10203813 | Ga0207691_102038133 | 294 |
| 940 | 3300025986 | Ga0207658_10306396 | Ga0207658_103063961 | 294 |
| 941 | 3300026023 | Ga0207677_10198955 | Ga0207677_101989551 | 294 |
| 942 | 3300026067 | Ga0207678_10046674 | Ga0207678_100466744 | 294 |
| 943 | 3300026116 | Ga0207674_10299290 | Ga0207674_102992901 | 294 |
| 944 | 3300026118 | Ga0207675_100122516 | Ga0207675_1001225161 | 294 |
| 945 | 3300026142 | Ga0207698_10183463 | Ga0207698_101834631 | 294 |
| 946 | 3300026142 | Ga0207698_10350202 | Ga0207698_103502021 | 294 |
| 947 | 3300027296 | Ga0209389_1000033 | Ga0209389_100003331 | 294 |
| 948 | 3300027296 | Ga0209389_1000182 | Ga0209389_100018247 | 294 |
| 949 | 3300027357 | Ga0209589_1000040 | Ga0209589_100004031 | 294 |
| 950 | 3300027361 | Ga0209489_100045 | Ga0209489_10004543 | 294 |
| 951 | 3300027361 | Ga0209489_100209 | Ga0209489_10020947 | 294 |
| 952 | 3300027363 | Ga0209700_100011 | Ga0209700_100011199 | 294 |
| 953 | 3300028379 | Ga0268266_10184329 | Ga0268266_101843292 | 294 |
| 954 | 3300033180 | Ga0307510_10024755 | Ga0307510_100247555 | 294 |
| 955 | 3300035113 | Ga0373936_0133190 | Ga0373936_0133190_137_1039 | 294 |
| 956 | 3300037471 | Ga0395905_0005856 | Ga0395905_0005856_409_1296 | 294 |
| 957 | 3300037471 | Ga0395905_0060606 | Ga0395905_0060606_2623_3507 | 294 |
| 958 | 3300039437 | Ga0436365_0958057 | Ga0436365_0958057_67_954 | 294 |
| 959 | 3300044656 | Ga0466969_0128100 | Ga0466969_0128100_158_1045 | 294 |
| 960 | 3300044658 | Ga0466972_0000119 | Ga0466972_0000119_48498_49385 | 294 |
| 961 | 3300044658 | Ga0466972_0010560 | Ga0466972_0010560_2640_3527 | 294 |
| 962 | 3300044693 | Ga0466961_0000139 | Ga0466961_0000139_21025_21912 | 294 |
| 963 | 3300044694 | Ga0466963_0117349 | Ga0466963_0117349_522_1409 | 294 |
| 964 | 3300044719 | Ga0466971_0174557 | Ga0466971_0174557_103_990 | 294 |
| 965 | 3300044735 | Ga0466968_0017207 | Ga0466968_0017207_138_1025 | 294 |
| 966 | 3300044765 | Ga0466970_0045604 | Ga0466970_0045604_1192_2079 | 294 |
| 967 | 3300044765 | Ga0466970_0185989 | Ga0466970_0185989_255_1142 | 294 |
| 968 | 3300044842 | Ga0466957_0035033 | Ga0466957_0035033_2043_2930 | 294 |
| 969 | 3300044901 | Ga0466960_0000848 | Ga0466960_0000848_2350_3237 | 294 |
| 970 | 3300045049 | Ga0466959_0034008 | Ga0466959_0034008_1556_2443 | 294 |
| 971 | 3300045976 | Ga0466967_0160685 | Ga0466967_0160685_1069_1956 | 294 |
| 972 | 3300046459 | Ga0495629_0005536 | Ga0495629_0005536_2361_3248 | 294 |
| 973 | 3300046460 | Ga0495638_0001094 | Ga0495638_0001094_17801_18688 | 294 |
| 974 | 3300046462 | Ga0495651_0017530 | Ga0495651_0017530_1898_2785 | 294 |
| 975 | 3300046474 | Ga0495605_0092896 | Ga0495605_0092896_333_1220 | 294 |
| 976 | 3300046477 | Ga0495664_0009771 | Ga0495664_0009771_3029_3916 | 294 |
| 977 | 3300046491 | Ga0495584_0036022 | Ga0495584_0036022_897_1784 | 294 |
| 978 | 3300046500 | Ga0495596_0056530 | Ga0495596_0056530_141_1028 | 294 |
| 979 | 3300046507 | Ga0495606_0037168 | Ga0495606_0037168_1194_2081 | 294 |
| 980 | 3300046511 | Ga0495608_0017766 | Ga0495608_0017766_3156_4043 | 294 |
| 981 | 3300046513 | Ga0495616_0134523 | Ga0495616_0134523_55_942 | 294 |
| 982 | 3300046516 | Ga0495628_0057540 | Ga0495628_0057540_1276_2163 | 294 |
| 983 | 3300046516 | Ga0495628_0314815 | Ga0495628_0314815_75_962 | 294 |
| 984 | 3300046524 | Ga0495648_0072499 | Ga0495648_0072499_276_1163 | 294 |
| 985 | 3300046524 | Ga0495648_0125545 | Ga0495648_0125545_345_1232 | 294 |
| 986 | 3300046526 | Ga0495666_0192723 | Ga0495666_0192723_16_903 | 294 |
| 987 | 3300046529 | Ga0495652_0034268 | Ga0495652_0034268_3256_4143 | 294 |
| 988 | 3300046533 | Ga0495640_0018565 | Ga0495640_0018565_1227_2114 | 294 |
| 989 | 3300046533 | Ga0495640_0112835 | Ga0495640_0112835_839_1726 | 294 |
| 990 | 3300046559 | Ga0495667_0006502 | Ga0495667_0006502_1951_2838 | 294 |
| 991 | 3300046616 | Ga0495668_0029459 | Ga0495668_0029459_1637_2524 | 294 |
| 992 | 3300046642 | Ga0495634_0044581 | Ga0495634_0044581_447_1334 | 294 |
| 993 | 3300046660 | Ga0495625_0104162 | Ga0495625_0104162_959_1846 | 294 |
| 994 | 3300046663 | Ga0495635_0004059 | Ga0495635_0004059_7363_8250 | 294 |
| 995 | 3300046663 | Ga0495635_0043268 | Ga0495635_0043268_245_1132 | 294 |
| 996 | 3300046675 | Ga0495657_0006604 | Ga0495657_0006604_5415_6302 | 294 |
| 997 | 3300046675 | Ga0495657_0030794 | Ga0495657_0030794_1084_1971 | 294 |
| 998 | 3300046679 | Ga0495623_0012518 | Ga0495623_0012518_1251_2138 | 294 |
| 999 | 3300046689 | Ga0495613_0008984 | Ga0495613_0008984_3872_4759 | 294 |
| 1000 | 3300046690 | Ga0495624_0021704 | Ga0495624_0021704_2137_3024 | 294 |
| 1001 | 3300046694 | Ga0495649_0012129 | Ga0495649_0012129_342_1229 | 294 |
| 1002 | 3300046809 | Ga0495600_0011578 | Ga0495600_0011578_1505_2392 | 294 |
| 1003 | 3300046809 | Ga0495600_0013331 | Ga0495600_0013331_4081_4968 | 294 |
| 1004 | 3300047317 | Ga0495604_0010785 | Ga0495604_0010785_5397_6284 | 294 |
| 1005 | 3300047317 | Ga0495604_0023859 | Ga0495604_0023859_2653_3540 | 294 |
| 1006 | 3300047321 | Ga0495676_0114727 | Ga0495676_0114727_403_1290 | 294 |
| 1007 | 3300047322 | Ga0495680_0000689 | Ga0495680_0000689_11621_12508 | 294 |
| 1008 | 3300047323 | Ga0495683_0044814 | Ga0495683_0044814_351_1238 | 294 |
| 1009 | 3300047323 | Ga0495683_0073135 | Ga0495683_0073135_712_1599 | 294 |
| 1010 | 3300047443 | Ga0495687_008047 | Ga0495687_008047_1201_2088 | 294 |
| 1011 | 3300047444 | Ga0495675_0008329 | Ga0495675_0008329_3219_4106 | 294 |
| 1012 | 3300047471 | Ga0495684_0145236 | Ga0495684_0145236_343_1230 | 294 |
| 1013 | 3300047673 | Ga0495593_0063063 | Ga0495593_0063063_225_1112 | 294 |
| 1014 | 3300048088 | Ga0495602_0015257 | Ga0495602_0015257_3624_4511 | 294 |
| 1015 | 3300048088 | Ga0495602_0095535 | Ga0495602_0095535_1521_2408 | 294 |
| 1016 | 3300048091 | Ga0495626_0025505 | Ga0495626_0025505_1017_1904 | 294 |
| 1017 | 3300048091 | Ga0495626_0079507 | Ga0495626_0079507_69_956 | 294 |
| 1018 | 3300048903 | Ga0496100_0093302 | Ga0496100_0093302_45_932 | 294 |
| 1019 | 3300048904 | Ga0496101_0496314 | Ga0496101_0496314_14_901 | 294 |
| 1020 | 3300048905 | Ga0496102_0009090 | Ga0496102_0009090_1865_2752 | 294 |
| 1021 | 3300048906 | Ga0496103_0025364 | Ga0496103_0025364_2376_3263 | 294 |
| 1022 | 3300048907 | Ga0496104_0159295 | Ga0496104_0159295_667_1554 | 294 |
| 1023 | 3300048908 | Ga0496105_0000935 | Ga0496105_0000935_18112_18999 | 294 |
| 1024 | 3300048908 | Ga0496105_0126887 | Ga0496105_0126887_387_1274 | 294 |
| 1025 | 3300048910 | Ga0496107_0152209 | Ga0496107_0152209_456_1343 | 294 |
| 1026 | 3300048911 | Ga0496108_0047577 | Ga0496108_0047577_437_1324 | 294 |
| 1027 | 3300048913 | Ga0496110_0151081 | Ga0496110_0151081_72_959 | 294 |
| 1028 | 3300048914 | Ga0496111_0043391 | Ga0496111_0043391_992_1879 | 294 |
| 1029 | 3300048914 | Ga0496111_0057197 | Ga0496111_0057197_451_1338 | 294 |
| 1030 | 3300048916 | Ga0496113_0043787 | Ga0496113_0043787_2359_3246 | 294 |
| 1031 | 3300048916 | Ga0496113_0051297 | Ga0496113_0051297_397_1284 | 294 |
| 1032 | 3300048917 | Ga0496114_0079878 | Ga0496114_0079878_1808_2695 | 294 |
| 1033 | 3300048918 | Ga0496115_0029319 | Ga0496115_0029319_1569_2456 | 294 |
| 1034 | 3300048918 | Ga0496115_0286279 | Ga0496115_0286279_427_1314 | 294 |
| 1035 | 3300048921 | Ga0496118_0154936 | Ga0496118_0154936_96_983 | 294 |
| 1036 | 3300048922 | Ga0496119_0006376 | Ga0496119_0006376_2603_3490 | 294 |
| 1037 | 3300048922 | Ga0496119_0072987 | Ga0496119_0072987_44_931 | 294 |
| 1038 | 3300048924 | Ga0496121_0130068 | Ga0496121_0130068_94_981 | 294 |
| 1039 | 3300048924 | Ga0496121_0171645 | Ga0496121_0171645_508_1395 | 294 |
| 1040 | 3300048927 | Ga0496124_0114620 | Ga0496124_0114620_491_1378 | 294 |
| 1041 | 3300048928 | Ga0496125_0000407 | Ga0496125_0000407_63917_64810 | 294 |
| 1042 | 3300048928 | Ga0496125_0043717 | Ga0496125_0043717_250_1137 | 294 |
| 1043 | 3300048929 | Ga0496126_0027806 | Ga0496126_0027806_3781_4668 | 294 |
| 1044 | 3300048929 | Ga0496126_0065855 | Ga0496126_0065855_418_1311 | 294 |
| 1045 | 3300049460 | Ga0495682_0011296 | Ga0495682_0011296_1352_2239 | 294 |
| 1046 | 3300049460 | Ga0495682_0055980 | Ga0495682_0055980_101_988 | 294 |
| 1047 | 3300050490 | nmdc:mga03n38_4895_c1 | nmdc:mga03n38_4895_c1_1976_2863 | 294 |
| 1048 | 3300050491 | nmdc:mga00v17_55279_c1 | nmdc:mga00v17_55279_c1_981_1868 | 294 |
| 1049 | 3300050492 | nmdc:mga0yw44_47348_c1 | nmdc:mga0yw44_47348_c1_1599_2486 | 294 |
| 1050 | 3300050493 | nmdc:mga0k408_58486_c1 | nmdc:mga0k408_58486_c1_38_925 | 294 |
| 1051 | 3300050494 | nmdc:mga06z11_120949_c1 | nmdc:mga06z11_120949_c1_363_1250 | 294 |
| 1052 | 3300050495 | nmdc:mga04h51_4727_c1 | nmdc:mga04h51_4727_c1_369_1256 | 294 |
| 1053 | 3300050496 | nmdc:mga07m45_112215_c1 | nmdc:mga07m45_112215_c1_456_1343 | 294 |
| 1054 | 3300050496 | nmdc:mga07m45_113485_c1 | nmdc:mga07m45_113485_c1_118_1005 | 294 |
| 1055 | 3300050496 | nmdc:mga07m45_226957_c1 | nmdc:mga07m45_226957_c1_52_939 | 294 |
| 1056 | 3300050516 | nmdc:mga0sz30_40195_c1 | nmdc:mga0sz30_40195_c1_977_1864 | 294 |
| 1057 | 3300053083 | Ga0495655_0012771 | Ga0495655_0012771_70_957 | 294 |
| 1058 | 3300053086 | Ga0500578_0079113 | Ga0500578_0079113_1095_1982 | 294 |
| 1059 | 3300053086 | Ga0500578_0118280 | Ga0500578_0118280_770_1657 | 294 |
| 1060 | 3300053087 | Ga0500643_000063 | Ga0500643_000063_52605_53492 | 294 |
| 1061 | 3300053094 | Ga0500566_0003076 | Ga0500566_0003076_2467_3354 | 294 |
| 1062 | 3300053105 | Ga0500557_000037 | Ga0500557_000037_47621_48505 | 294 |
| 1063 | 3300053109 | Ga0500569_001553 | Ga0500569_001553_1831_2718 | 294 |
| 1064 | 3300053130 | Ga0500642_0000062 | Ga0500642_0000062_47581_48465 | 294 |
| 1065 | 3300053134 | Ga0500658_0075077 | Ga0500658_0075077_113_1000 | 294 |
| 1066 | 3300053138 | Ga0500564_110823 | Ga0500564_110823_20_907 | 294 |
| 1067 | 3300053142 | Ga0500577_0000399 | Ga0500577_0000399_6211_7107 | 294 |
| 1068 | 3300053153 | Ga0500616_0018659 | Ga0500616_0018659_2953_3840 | 294 |
| 1069 | 3300053155 | Ga0500620_001178 | Ga0500620_001178_1341_2228 | 294 |
| 1070 | 3300053156 | Ga0500622_0026331 | Ga0500622_0026331_2082_2969 | 294 |
| 1071 | 3300053177 | Ga0500636_0000349 | Ga0500636_0000349_18922_19809 | 294 |
| 1072 | 3300053729 | Ga0500625_024838 | Ga0500625_024838_78_962 | 294 |
| 1073 | 3300053737 | Ga0500601_000064 | Ga0500601_000064_14694_15581 | 294 |
| 1074 | 3300055283 | Ga0500661_021525 | Ga0500661_021525_188_1075 | 294 |
| 1075 | 3300009093 | Ga0105240_10004955 | Ga0105240_100049554 | 295 |
| 1076 | 3300009174 | Ga0105241_10002286 | Ga0105241_100022868 | 295 |
| 1077 | 3300009551 | Ga0105238_10000905 | Ga0105238_1000090527 | 295 |
| 1078 | 3300010375 | Ga0105239_10002519 | Ga0105239_100025198 | 295 |
| 1079 | 3300025981 | Ga0207640_10186435 | Ga0207640_101864352 | 295 |
| 1080 | 3300060353 | Ga0501082_0000028 | Ga0501082_0000028_77288_78187 | 295 |
| 1081 | iso_pu_bacteria | 2602042107 | 2603858527 | 295 |
| 1082 | iso_pu_bacteria | 2857524615 | 2857526351 | 295 |
| 1083 | iso_pu_bacteria | 2919073203 | 2919073802 | 295 |
| 1084 | 3300047317 | Ga0495604_0145351 | Ga0495604_0145351_692_1585 | 296 |
| 1085 | 3300048904 | Ga0496101_0041241 | Ga0496101_0041241_208_1107 | 296 |
| 1086 | 3300048909 | Ga0496106_0060156 | Ga0496106_0060156_1759_2658 | 296 |
| 1087 | 3300003203 | JGI25406J46586_10000066 | JGI25406J46586_1000006626 | 297 |
| 1088 | 3300005330 | Ga0070690_100211041 | Ga0070690_1002110412 | 297 |
| 1089 | 3300005985 | Ga0081539_10000064 | Ga0081539_1000006452 | 297 |
| 1090 | 3300006175 | Ga0070712_100240873 | Ga0070712_1002408732 | 297 |
| 1091 | 3300025295 | Ga0209564_1000321 | Ga0209564_100032156 | 297 |
| 1092 | 3300026067 | Ga0207678_10422037 | Ga0207678_104220371 | 297 |
| 1093 | 3300026095 | Ga0207676_10114523 | Ga0207676_101145233 | 297 |
| 1094 | 3300053724 | Ga0500570_018767 | Ga0500570_018767_581_1561 | 297 |
| 1095 | iso_pu_bacteria | 3005587118 | 3005592211 | 297 |
| 1096 | 3300009098 | Ga0105245_10231917 | Ga0105245_102319172 | 298 |
| 1097 | 3300009177 | Ga0105248_10549277 | Ga0105248_105492771 | 298 |
| 1098 | 3300025927 | Ga0207687_10350902 | Ga0207687_103509022 | 298 |
| 1099 | 3300047472 | Ga0495686_0063919 | Ga0495686_0063919_1222_2130 | 298 |
| 1100 | 3300049572 | Ga0501036_0061519 | Ga0501036_0061519_1950_2852 | 298 |
| 1101 | 3300005329 | Ga0070683_100421203 | Ga0070683_1004212032 | 299 |
| 1102 | 3300005339 | Ga0070660_100038981 | Ga0070660_1000389812 | 299 |
| 1103 | 3300005341 | Ga0070691_10133269 | Ga0070691_101332692 | 299 |
| 1104 | 3300005366 | Ga0070659_100118955 | Ga0070659_1001189552 | 299 |
| 1105 | 3300005434 | Ga0070709_10105903 | Ga0070709_101059031 | 299 |
| 1106 | 3300005471 | Ga0070698_100068842 | Ga0070698_1000688423 | 299 |
| 1107 | 3300005535 | Ga0070684_100058502 | Ga0070684_1000585022 | 299 |
| 1108 | 3300005539 | Ga0068853_100029265 | Ga0068853_1000292654 | 299 |
| 1109 | 3300005614 | Ga0068856_100065061 | Ga0068856_1000650614 | 299 |
| 1110 | 3300005616 | Ga0068852_100104346 | Ga0068852_1001043463 | 299 |
| 1111 | 3300006038 | Ga0075365_10066092 | Ga0075365_100660922 | 299 |
| 1112 | 3300006178 | Ga0075367_10092235 | Ga0075367_100922352 | 299 |
| 1113 | 3300006186 | Ga0075369_10043758 | Ga0075369_100437582 | 299 |
| 1114 | 3300009551 | Ga0105238_10030039 | Ga0105238_100300393 | 299 |
| 1115 | 3300020082 | Ga0206353_10148081 | Ga0206353_101480811 | 299 |
| 1116 | 3300025253 | Ga0209677_100672 | Ga0209677_1006725 | 299 |
| 1117 | 3300025912 | Ga0207707_10054133 | Ga0207707_100541333 | 299 |
| 1118 | 3300025913 | Ga0207695_10115822 | Ga0207695_101158221 | 299 |
| 1119 | 3300025914 | Ga0207671_10069130 | Ga0207671_100691302 | 299 |
| 1120 | 3300025917 | Ga0207660_10081275 | Ga0207660_100812751 | 299 |
| 1121 | 3300025919 | Ga0207657_10029294 | Ga0207657_100292944 | 299 |
| 1122 | 3300025921 | Ga0207652_10076915 | Ga0207652_100769152 | 299 |
| 1123 | 3300025924 | Ga0207694_10034117 | Ga0207694_100341172 | 299 |
| 1124 | 3300025944 | Ga0207661_10175645 | Ga0207661_101756451 | 299 |
| 1125 | 3300025945 | Ga0207679_10390674 | Ga0207679_103906741 | 299 |
| 1126 | 3300025949 | Ga0207667_10160793 | Ga0207667_101607932 | 299 |
| 1127 | 3300026041 | Ga0207639_10013217 | Ga0207639_100132174 | 299 |
| 1128 | 3300026116 | Ga0207674_10007766 | Ga0207674_100077664 | 299 |
| 1129 | 3300028794 | Ga0307515_10140350 | Ga0307515_101403503 | 299 |
| 1130 | 3300031238 | Ga0265332_10072613 | Ga0265332_100726132 | 299 |
| 1131 | 3300031247 | Ga0265340_10042492 | Ga0265340_100424922 | 299 |
| 1132 | 3300031249 | Ga0265339_10099122 | Ga0265339_100991222 | 299 |
| 1133 | 3300031456 | Ga0307513_10169966 | Ga0307513_101699662 | 299 |
| 1134 | 3300031730 | Ga0307516_10010553 | Ga0307516_100105533 | 299 |
| 1135 | 3300031730 | Ga0307516_10104788 | Ga0307516_101047883 | 299 |
| 1136 | 3300031901 | Ga0307406_10168105 | Ga0307406_101681052 | 299 |
| 1137 | 3300033179 | Ga0307507_10027443 | Ga0307507_100274434 | 299 |
| 1138 | 3300035170 | Ga0373943_0056690 | Ga0373943_0056690_535_1503 | 299 |
| 1139 | 3300046460 | Ga0495638_0053016 | Ga0495638_0053016_1098_2009 | 299 |
| 1140 | 3300046462 | Ga0495651_0086113 | Ga0495651_0086113_973_1881 | 299 |
| 1141 | 3300046501 | Ga0495607_0012073 | Ga0495607_0012073_321_1232 | 299 |
| 1142 | 3300046506 | Ga0495583_0020205 | Ga0495583_0020205_1215_2126 | 299 |
| 1143 | 3300046507 | Ga0495606_0082443 | Ga0495606_0082443_119_1030 | 299 |
| 1144 | 3300046512 | Ga0495610_0055708 | Ga0495610_0055708_157_1068 | 299 |
| 1145 | 3300046513 | Ga0495616_0025586 | Ga0495616_0025586_1191_2102 | 299 |
| 1146 | 3300046515 | Ga0495620_0014398 | Ga0495620_0014398_2578_3489 | 299 |
| 1147 | 3300046518 | Ga0495631_0025195 | Ga0495631_0025195_917_1828 | 299 |
| 1148 | 3300046520 | Ga0495637_0028566 | Ga0495637_0028566_1258_2169 | 299 |
| 1149 | 3300046522 | Ga0495643_0063715 | Ga0495643_0063715_707_1618 | 299 |
| 1150 | 3300046524 | Ga0495648_0044368 | Ga0495648_0044368_959_1870 | 299 |
| 1151 | 3300046660 | Ga0495625_0017905 | Ga0495625_0017905_3532_4443 | 299 |
| 1152 | 3300046665 | Ga0495661_0019545 | Ga0495661_0019545_3279_4190 | 299 |
| 1153 | 3300046679 | Ga0495623_0213500 | Ga0495623_0213500_21_929 | 299 |
| 1154 | 3300046691 | Ga0495670_0001762 | Ga0495670_0001762_8049_8960 | 299 |
| 1155 | 3300046692 | Ga0495671_0161834 | Ga0495671_0161834_132_1043 | 299 |
| 1156 | 3300046794 | Ga0495589_0051700 | Ga0495589_0051700_710_1621 | 299 |
| 1157 | 3300047470 | Ga0495681_0100394 | Ga0495681_0100394_60_971 | 299 |
| 1158 | 3300048920 | Ga0496117_0036072 | Ga0496117_0036072_2402_3313 | 299 |
| 1159 | 3300048921 | Ga0496118_0048029 | Ga0496118_0048029_1207_2118 | 299 |
| 1160 | 3300048921 | Ga0496118_0064926 | Ga0496118_0064926_1107_2018 | 299 |
| 1161 | 3300048921 | Ga0496118_0090666 | Ga0496118_0090666_1003_1914 | 299 |
| 1162 | 3300048924 | Ga0496121_0015121 | Ga0496121_0015121_2457_3368 | 299 |
| 1163 | 3300048925 | Ga0496122_0032788 | Ga0496122_0032788_2336_3247 | 299 |
| 1164 | 3300048926 | Ga0496123_0010648 | Ga0496123_0010648_1037_1948 | 299 |
| 1165 | 3300048928 | Ga0496125_0003549 | Ga0496125_0003549_1098_2009 | 299 |
| 1166 | 3300048928 | Ga0496125_0059052 | Ga0496125_0059052_1062_1973 | 299 |
| 1167 | 3300048929 | Ga0496126_0142503 | Ga0496126_0142503_929_1840 | 299 |
| 1168 | 3300050492 | nmdc:mga0yw44_83620_c1 | nmdc:mga0yw44_83620_c1_1082_1993 | 299 |
| 1169 | 3300053087 | Ga0500643_034093 | Ga0500643_034093_431_1342 | 299 |
| 1170 | 3300053090 | Ga0500646_0000839 | Ga0500646_0000839_6910_7821 | 299 |
| 1171 | 3300053093 | Ga0500651_0006769 | Ga0500651_0006769_5085_5996 | 299 |
| 1172 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_333811_334722 | 299 |
| 1173 | 3300053109 | Ga0500569_002673 | Ga0500569_002673_1929_2840 | 299 |
| 1174 | 3300053117 | Ga0500593_065397 | Ga0500593_065397_663_1574 | 299 |
| 1175 | 3300053122 | Ga0500608_000959 | Ga0500608_000959_9055_9966 | 299 |
| 1176 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_152564_153475 | 299 |
| 1177 | 3300053131 | Ga0500652_000555 | Ga0500652_000555_11187_12098 | 299 |
| 1178 | 3300053134 | Ga0500658_0074733 | Ga0500658_0074733_192_1103 | 299 |
| 1179 | 3300053139 | Ga0500568_0000790 | Ga0500568_0000790_13008_13919 | 299 |
| 1180 | 3300053145 | Ga0500586_007140 | Ga0500586_007140_985_1896 | 299 |
| 1181 | 3300053146 | Ga0500588_0031491 | Ga0500588_0031491_289_1200 | 299 |
| 1182 | 3300053151 | Ga0500604_0001375 | Ga0500604_0001375_5779_6690 | 299 |
| 1183 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_329652_330563 | 299 |
| 1184 | 3300053156 | Ga0500622_0044474 | Ga0500622_0044474_105_1016 | 299 |
| 1185 | 3300005434 | Ga0070709_10004682 | Ga0070709_100046824 | 300 |
| 1186 | 3300005435 | Ga0070714_100004568 | Ga0070714_1000045682 | 300 |
| 1187 | 3300005436 | Ga0070713_100005959 | Ga0070713_1000059596 | 300 |
| 1188 | 3300005437 | Ga0070710_10004995 | Ga0070710_100049955 | 300 |
| 1189 | 3300005439 | Ga0070711_100000660 | Ga0070711_1000006605 | 300 |
| 1190 | 3300006028 | Ga0070717_10043262 | Ga0070717_100432624 | 300 |
| 1191 | 3300006163 | Ga0070715_10000108 | Ga0070715_100001082 | 300 |
| 1192 | 3300006173 | Ga0070716_100002138 | Ga0070716_1000021382 | 300 |
| 1193 | 3300006175 | Ga0070712_100047535 | Ga0070712_1000475353 | 300 |
| 1194 | 3300021361 | Ga0213872_10015515 | Ga0213872_100155151 | 300 |
| 1195 | 3300025898 | Ga0207692_10002026 | Ga0207692_100020264 | 300 |
| 1196 | 3300025905 | Ga0207685_10035616 | Ga0207685_100356162 | 300 |
| 1197 | 3300025906 | Ga0207699_10003043 | Ga0207699_100030436 | 300 |
| 1198 | 3300025914 | Ga0207671_10282289 | Ga0207671_102822891 | 300 |
| 1199 | 3300025915 | Ga0207693_10000310 | Ga0207693_1000031035 | 300 |
| 1200 | 3300025916 | Ga0207663_10019867 | Ga0207663_100198673 | 300 |
| 1201 | 3300025917 | Ga0207660_10189160 | Ga0207660_101891602 | 300 |
| 1202 | 3300025928 | Ga0207700_10154584 | Ga0207700_101545842 | 300 |
| 1203 | 3300025939 | Ga0207665_10001734 | Ga0207665_1000173410 | 300 |
| 1204 | 3300028786 | Ga0307517_10001338 | Ga0307517_1000133834 | 300 |
| 1205 | 3300044684 | Ga0466966_0041766 | Ga0466966_0041766_861_1781 | 300 |
| 1206 | iso_pu_bacteria | 2513237141 | 2513888766 | 300 |
| 1207 | 3300003354 | JGI25160J50197_1003294 | JGI25160J50197_10032941 | 301 |
| 1208 | 3300025302 | Ga0207426_1004116 | Ga0207426_10041166 | 301 |
| 1209 | 3300025914 | Ga0207671_10461891 | Ga0207671_104618911 | 301 |
| 1210 | 3300037418 | Ga0395900_0003383 | Ga0395900_0003383_15959_16999 | 301 |
| 1211 | 3300037466 | Ga0395898_0013386 | Ga0395898_0013386_229_1269 | 301 |
| 1212 | 3300038443 | Ga0395901_0161395 | Ga0395901_0161395_1161_2201 | 301 |
| 1213 | 3300001979 | JGI24740J21852_10000946 | JGI24740J21852_100009469 | 302 |
| 1214 | 3300005539 | Ga0068853_100001705 | Ga0068853_10000170512 | 302 |
| 1215 | 3300005563 | Ga0068855_100034493 | Ga0068855_1000344934 | 302 |
| 1216 | 3300005577 | Ga0068857_100021030 | Ga0068857_1000210304 | 302 |
| 1217 | 3300005834 | Ga0068851_10002645 | Ga0068851_100026454 | 302 |
| 1218 | 3300025321 | Ga0207656_10008173 | Ga0207656_100081732 | 302 |
| 1219 | 3300025911 | Ga0207654_10000058 | Ga0207654_1000005857 | 302 |
| 1220 | 3300025913 | Ga0207695_10000453 | Ga0207695_1000045342 | 302 |
| 1221 | 3300025914 | Ga0207671_10042434 | Ga0207671_100424342 | 302 |
| 1222 | 3300025924 | Ga0207694_10001009 | Ga0207694_100010098 | 302 |
| 1223 | 3300025949 | Ga0207667_10006596 | Ga0207667_1000659611 | 302 |
| 1224 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004240 | 302 |
| 1225 | 3300026116 | Ga0207674_10002298 | Ga0207674_1000229810 | 302 |
| 1226 | 3300026142 | Ga0207698_10031595 | Ga0207698_100315952 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6y93-assembly1.cif.gz_A | crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) | 0.9508 | 137 | 231 |
| 6y93-assembly1.cif.gz_B | crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) | 0.9249 | 128 | 231 |
| 7bhy-assembly1.cif.gz_B | dna-binding domain of deor in complex with the dna operator | 0.8998 | 144 | 180 |
| 6t1f-assembly2.cif.gz_D | crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site | 0.893 | 41 | 231 |
| 6t1f-assembly2.cif.gz_D | crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site | 0.8799 | 41 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G118_97_208_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9468 | 120 | 227 | 1.10.10.2830 |
| af_Q2FUQ5_107_218_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9464 | 120 | 228 | 1.10.10.2830 |
| af_Q2FUQ5_43_106_3.90.1530.30 | Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; | 0.9392 | 55 | 119 | 3.90.1530.30 |
| af_P9WIJ9_142_255_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9322 | 120 | 228 | 1.10.10.2830 |
| 1vz0A01 | Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; | 0.9192 | 61 | 119 | 3.90.1530.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4RMR3-F1-model_v4 | deleted | 0.955 | 123 | 231 |
|
| AF-A0A838M0W9-F1-model_v4 | ParB/RepB/Spo0J family partition protein | 0.8631 | 117 | 231 |
GO:0003677
GO:0005694 GO:0007059 |
| AF-A0A2R7S9F1-F1-model_v4 | ParB/Sulfiredoxin domain-containing protein | 0.8614 | 41 | 232 |
GO:0003677
GO:0005694 GO:0007059 GO:0045881 |
| AF-N6Y954-F1-model_v4 | ParB family protein | 0.8519 | 41 | 227 |
GO:0003677
GO:0005694 GO:0007059 |
| AF-A0A1F8VSX0-F1-model_v4 | ParB/Sulfiredoxin domain-containing protein | 0.8478 | 41 | 231 |
GO:0003677
GO:0005694 GO:0007059 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar