F491933

General Info

Members Datasets Scaffolds Average Seq Length
1226 660 1003 294

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0011741|Ga0496109_0011741_5631_6476
Length 281
Sequence MAEEARSRLGRGLASLIGDVGGEAAHLDRPRAQRKVPIEFLKPNPRNPRREFADNELRELADSIRQHGVIQPIVVRPARGTQDRFEIIAGERRWRSAQIAGLHEVPIVPVDVSDSDALEIAIIEEAQGYHALAGEFKRSADDIAKIVGKSRSHIANMMRLTKLPAEVQRYIALGKLSAGHARALIGVPDPVAAAKRIIEGDLNVRQAEALAHVEGVPERKPHKARGRKTKDADTAALEKRVSDALGLAVSIDHRDSAGTVHIRYRDLDQLDEIVRRLEAST

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
55 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
56 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
57 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
58 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
64 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
65 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
74 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
75 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
76 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
77 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
78 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
79 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
80 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
81 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
93 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
94 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
95 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
96 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
97 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
98 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
99 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
100 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
101 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
102 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
103 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
104 2904699407
105 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906610324
108 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
109 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
110 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
111 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
112 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
113 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
114 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
115 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922368715
118 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
119 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
120 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
121 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
122 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
123 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
124 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
125 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
126 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
127 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
128 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
129 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
130 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
131 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
132 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
133 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
134 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
135 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
136 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
137 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
138 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
139 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
140 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
141 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
142 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
143 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
144 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
145 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
146 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
147 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
148 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
149 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
150 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
151 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
152 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
153 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
154 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
155 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
156 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
157 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
158 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
159 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
160 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
161 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
162 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
163 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
164 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
165 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
166 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
167 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
168 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
169 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
170 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
171 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
172 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
173 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
174 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
175 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
176 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
177 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
178 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
179 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
180 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
181 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
182 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
183 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
184 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
185 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
186 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
187 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
188 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
189 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
190 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
191 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
192 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
193 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
194 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
195 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
196 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
197 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
198 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
199 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
200 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
201 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
202 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
203 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
204 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
205 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
206 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
207 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
208 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
209 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
210 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
211 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
212 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
213 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
214 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
215 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
216 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
217 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
218 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
219 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
220 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
221 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
222 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
223 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
224 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
225 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
226 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
227 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
228 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
229 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
230 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
231 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
232 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
233 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
234 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
235 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
236 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
237 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
238 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
239 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
240 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
241 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
242 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
243 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
244 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
245 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
246 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
247 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
248 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
249 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
250 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
251 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
252 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
253 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
254 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
255 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
256 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
257 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
258 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
259 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
260 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
261 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
262 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
263 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
264 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
265 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
266 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
267 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
268 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
269 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
270 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
271 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
272 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
273 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
274 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
275 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
276 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
277 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
278 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
279 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
280 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
281 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
282 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
283 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
284 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
285 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
286 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
287 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
288 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
289 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
290 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
291 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
292 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
293 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
297 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
299 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
301 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
303 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
353 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
354 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
355 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
356 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
360 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
361 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
362 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
363 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
364 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
365 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
366 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
367 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
368 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
369 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
370 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
371 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
372 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
373 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
374 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
375 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
376 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
377 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
378 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
379 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
380 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
381 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
382 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
383 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
384 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
385 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
386 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
387 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
388 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
389 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
390 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
391 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
392 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
393 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
394 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
395 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
396 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
397 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
398 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
399 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
400 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
401 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
402 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
403 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
404 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
405 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
406 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
407 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
408 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
409 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
410 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
411 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
412 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
413 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
414 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
415 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
416 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
417 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
418 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
419 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
420 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
421 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
422 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
423 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
424 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
425 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
426 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
427 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
428 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
429 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
430 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
431 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
432 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
433 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
434 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
435 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
436 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
437 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
438 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
439 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
440 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
441 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
442 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
443 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
444 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
445 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
446 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
447 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
448 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
449 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
450 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
451 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
452 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
453 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
454 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
455 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
456 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
457 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
458 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
459 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
460 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
461 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
462 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
463 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
464 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
465 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
466 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
467 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
468 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
469 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
470 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
471 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
472 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
473 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
474 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
475 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
476 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
477 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
478 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
479 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
480 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
481 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
482 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
483 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
484 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
485 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
486 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
487 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
488 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
489 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
490 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
491 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
492 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
493 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
494 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
495 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
496 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
497 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
498 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
499 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
500 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
501 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
502 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
503 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
504 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
505 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
506 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
507 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
508 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
509 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
510 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
511 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
512 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
513 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
514 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
515 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
516 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
517 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
518 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
519 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
520 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
521 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
522 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
523 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
524 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
525 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
526 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
527 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
528 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
529 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
530 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
531 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
532 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
533 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
534 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
537 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
539 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
540 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
543 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
545 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
548 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
549 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
550 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
551 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
552 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
553 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
554 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
555 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
556 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
557 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
558 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
559 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
560 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
563 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
564 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
565 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
566 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
567 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
568 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
569 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
570 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
571 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
572 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
573 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
574 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
575 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
576 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
577 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
578 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
579 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
580 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
581 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
582 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
583 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
584 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
585 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
586 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
587 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
588 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
589 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
590 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
591 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
592 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
593 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
594 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
595 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
596 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
597 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
598 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
599 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
600 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
601 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
602 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
603 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
604 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
605 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
606 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
607 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
608 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
609 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
610 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
611 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
612 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
613 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
614 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
615 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
616 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
617 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
618 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
619 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
620 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
621 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
622 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
623 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
624 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
625 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
626 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
627 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
628 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
629 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
630 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
631 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
632 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
633 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
634 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
635 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
636 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
637 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
638 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
639 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
640 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
641 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
642 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
643 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
644 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
645 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
646 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
647 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
648 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
649 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
650 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
651 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
652 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
653 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
654 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
655 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
656 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
657 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
658 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
659 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
660 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.91
Metatranscriptomes 0.16
Isolates 17.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 14.03
Rhizoplane 7.59
Rhizosphere 56.93
Stem 0
Stem Tuber 0
Unclassified 11.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000946 3300001979 Bacteria 12915
2 JGI24737J22298_10024439 3300001990 Bacteria 1913
3 JGI24735J21928_10009808 3300002067 Bacteria 3067
4 JGI24738J21930_10006735 3300002075 Bacteria 2673
5 JGI25406J46586_10000066 3300003203 Bacteria 48110
6 JGI25406J46586_10002779 3300003203 Bacteria 8224
7 JGI25153J46596_10003450 3300003215 Bacteria 8852
8 JGI25153J46596_10011834 3300003215 Bacteria 3825
9 JGI25160J50197_1003294 3300003354 Bacteria 7271
10 JGI25404J52841_10007684 3300003659 Bacteria 2285
11 Ga0055526_1043009 3300003771 Bacteria 1106
12 Ga0055531_10014489 3300003794 Bacteria 3545
13 Ga0065165_1000365 3300005262 Bacteria 74017
14 Ga0065165_1001495 3300005262 Bacteria 24729
15 Ga0065165_1019115 3300005262 Bacteria 2458
16 Ga0070658_10068227 3300005327 Bacteria 2907
17 Ga0070658_10084002 3300005327 Bacteria 2618
18 Ga0070683_100005996 3300005329 Bacteria 10180
19 Ga0070683_100013328 3300005329 Bacteria 7167
20 Ga0070683_100421203 3300005329 Bacteria 1274
21 Ga0070690_100211041 3300005330 Bacteria 1356
22 Ga0068868_100016797 3300005338 Bacteria 5443
23 Ga0070660_100038981 3300005339 Bacteria 3610
24 Ga0070691_10133269 3300005341 Bacteria 1261
25 Ga0070669_100066355 3300005353 Bacteria 2660
26 Ga0070671_100129955 3300005355 Bacteria 2121
27 Ga0070674_100088993 3300005356 Bacteria 2223
28 Ga0070674_100234639 3300005356 Bacteria 1433
29 Ga0070673_100084349 3300005364 Bacteria 2584
30 Ga0070659_100118955 3300005366 Bacteria 2138
31 Ga0070709_10000584 3300005434 Bacteria 21359
32 Ga0070709_10004682 3300005434 Bacteria 7388
33 Ga0070709_10013026 3300005434 Bacteria 4667
34 Ga0070709_10105903 3300005434 Bacteria 1882
35 Ga0070714_100004568 3300005435 Bacteria 10439
36 Ga0070714_100118625 3300005435 Bacteria 2351
37 Ga0070713_100005959 3300005436 Bacteria 8384
38 Ga0070713_100010327 3300005436 Bacteria 6743
39 Ga0070713_100157380 3300005436 Bacteria 2026
40 Ga0070713_100415359 3300005436 Bacteria 1259
41 Ga0070710_10002351 3300005437 Bacteria 8946
42 Ga0070710_10004995 3300005437 Bacteria 6278
43 Ga0070710_10109270 3300005437 Bacteria 1659
44 Ga0070711_100000660 3300005439 Bacteria 18001
45 Ga0070711_100004456 3300005439 Bacteria 8265
46 Ga0070711_100019254 3300005439 Bacteria 4377
47 Ga0070711_100022461 3300005439 Bacteria 4090
48 Ga0070711_100474025 3300005439 Bacteria 1028
49 Ga0070663_100062897 3300005455 Bacteria 2677
50 Ga0070678_100015808 3300005456 Bacteria 4807
51 Ga0070681_10014969 3300005458 Bacteria 7713
52 Ga0070681_10051117 3300005458 Bacteria 4123
53 Ga0070681_10089577 3300005458 Bacteria 3028
54 Ga0070698_100068842 3300005471 Bacteria 3556
55 Ga0070679_100039226 3300005530 Bacteria 4707
56 Ga0070679_100044969 3300005530 Bacteria 4399
57 Ga0070679_100066868 3300005530 Bacteria 3584
58 Ga0070679_100120755 3300005530 Bacteria 2605
59 Ga0070684_100007764 3300005535 Bacteria 8363
60 Ga0070684_100024903 3300005535 Bacteria 5023
61 Ga0070684_100058502 3300005535 Bacteria 3368
62 Ga0070697_100289134 3300005536 Bacteria 1407
63 Ga0068853_100001705 3300005539 Bacteria 16098
64 Ga0068853_100029265 3300005539 Bacteria 4641
65 Ga0068853_100086417 3300005539 Bacteria 2750
66 Ga0068853_100196525 3300005539 Bacteria 1835
67 Ga0068853_100279593 3300005539 Bacteria 1539
68 Ga0070696_100109075 3300005546 Bacteria 1992
69 Ga0070665_100028170 3300005548 Bacteria 5657
70 Ga0070665_100099215 3300005548 Bacteria 2916
71 Ga0070665_100250510 3300005548 Bacteria 1772
72 Ga0068855_100015846 3300005563 Bacteria 9068
73 Ga0068855_100034493 3300005563 Bacteria 6035
74 Ga0068855_100274067 3300005563 Bacteria 1875
75 Ga0068855_100526603 3300005563 Bacteria 1282
76 Ga0070664_100189725 3300005564 Bacteria 1831
77 Ga0068857_100021030 3300005577 Bacteria 5741
78 Ga0068857_100041204 3300005577 Bacteria 4095
79 Ga0068857_100227058 3300005577 Bacteria 1706
80 Ga0068857_100576858 3300005577 Bacteria 1061
81 Ga0068854_100222019 3300005578 Bacteria 1495
82 Ga0068854_100318805 3300005578 Bacteria 1263
83 Ga0068856_100005093 3300005614 Bacteria 12992
84 Ga0068856_100012875 3300005614 Bacteria 8096
85 Ga0068856_100065061 3300005614 Bacteria 3603
86 Ga0068856_100129808 3300005614 Bacteria 2525
87 Ga0068852_100042806 3300005616 Bacteria 3836
88 Ga0068852_100104346 3300005616 Bacteria 2566
89 Ga0068852_100341968 3300005616 Bacteria 1458
90 Ga0068859_100184572 3300005617 Bacteria 2169
91 Ga0068864_100026520 3300005618 Bacteria 4886
92 Ga0068851_10002645 3300005834 Bacteria 7896
93 Ga0068851_10030239 3300005834 Bacteria 2685
94 Ga0068858_100033778 3300005842 Bacteria 4744
95 Ga0068858_100094168 3300005842 Bacteria 2790
96 Ga0068858_100394178 3300005842 Bacteria 1330
97 Ga0068860_100001450 3300005843 Bacteria 25677
98 Ga0068860_100136751 3300005843 Bacteria 2353
99 Ga0081455_10009536 3300005937 Bacteria 9971
100 Ga0081455_10010204 3300005937 Bacteria 9559
101 Ga0081455_10037390 3300005937 Bacteria 4313
102 Ga0081455_10048211 3300005937 Bacteria 3683
103 Ga0081538_10086299 3300005981 Bacteria 1644
104 Ga0081540_1003875 3300005983 Bacteria 11676
105 Ga0081540_1005299 3300005983 Bacteria 9654
106 Ga0081540_1011061 3300005983 Bacteria 6059
107 Ga0081540_1012813 3300005983 Bacteria 5486
108 Ga0081540_1021192 3300005983 Bacteria 3881
109 Ga0081539_10000064 3300005985 Bacteria 247020
110 Ga0081539_10004737 3300005985 Bacteria 14713
111 Ga0081539_10029435 3300005985 Bacteria 3430
112 Ga0070717_10006989 3300006028 Bacteria 8350
113 Ga0070717_10043262 3300006028 Bacteria 3675
114 Ga0070717_10088445 3300006028 Bacteria 2611
115 Ga0075365_10066092 3300006038 Bacteria 2426
116 Ga0075365_10318386 3300006038 Bacteria 1095
117 Ga0075368_10003158 3300006042 Bacteria 5475
118 Ga0075363_100016306 3300006048 Bacteria 3669
119 Ga0070715_10000108 3300006163 Bacteria 20251
120 Ga0070715_10019602 3300006163 Bacteria 2597
121 Ga0070716_100002138 3300006173 Bacteria 9082
122 Ga0070716_100013388 3300006173 Bacteria 4178
123 Ga0070712_100047535 3300006175 Bacteria 2970
124 Ga0070712_100240873 3300006175 Bacteria 1441
125 Ga0075367_10092235 3300006178 Bacteria 1844
126 Ga0075369_10043758 3300006186 Bacteria 1922
127 Ga0075369_10076719 3300006186 Bacteria 1478
128 Ga0075366_10061029 3300006195 Bacteria 2240
129 Ga0097621_100249243 3300006237 Bacteria 1555
130 Ga0075370_10156285 3300006353 Bacteria 1337
131 Ga0068871_100330798 3300006358 Bacteria 1344
132 Ga0075428_100045101 3300006844 Bacteria 4844
133 Ga0075430_100389813 3300006846 Bacteria 1150
134 Ga0075433_10217483 3300006852 Bacteria 1698
135 Ga0068865_100349271 3300006881 Bacteria 1198
136 Ga0075436_100397440 3300006914 Bacteria 998
137 Ga0097620_100184562 3300006931 Bacteria 2169
138 Ga0099823_1022515 3300006944 Bacteria 5827
139 Ga0099795_10064146 3300007788 Bacteria 1371
140 Ga0105240_10004955 3300009093 Bacteria 20025
141 Ga0105240_10008228 3300009093 Bacteria 14944
142 Ga0105240_10031181 3300009093 Bacteria 6917
143 Ga0105245_10197939 3300009098 Bacteria 1928
144 Ga0105245_10231917 3300009098 Bacteria 1786
145 Ga0105247_10010882 3300009101 Bacteria 5496
146 Ga0114129_10721610 3300009147 Bacteria 1279
147 Ga0105241_10002286 3300009174 Bacteria 14395
148 Ga0105241_10072988 3300009174 Bacteria 2669
149 Ga0105241_10082572 3300009174 Bacteria 2519
150 Ga0105248_10549277 3300009177 Bacteria 1303
151 Ga0105237_10010095 3300009545 Bacteria 10071
152 Ga0105237_10168546 3300009545 Bacteria 2189
153 Ga0105237_10304187 3300009545 Bacteria 1598
154 Ga0105237_10637369 3300009545 Bacteria 1073
155 Ga0105237_10789028 3300009545 Bacteria 957
156 Ga0105238_10000905 3300009551 Bacteria 30512
157 Ga0105238_10015713 3300009551 Bacteria 7663
158 Ga0105238_10030039 3300009551 Bacteria 5531
159 Ga0105238_10050367 3300009551 Bacteria 4193
160 Ga0105238_10074317 3300009551 Bacteria 3392
161 Ga0105238_10597241 3300009551 Bacteria 1111
162 Ga0105249_10164867 3300009553 Bacteria 2144
163 Ga0105249_10269902 3300009553 Bacteria 1694
164 Ga0105239_10002519 3300010375 Bacteria 23275
165 Ga0105239_10024695 3300010375 Bacteria 6620
166 Ga0105239_10064493 3300010375 Bacteria 4021
167 Ga0105239_10080757 3300010375 Bacteria 3578
168 Ga0105239_10199644 3300010375 Bacteria 2240
169 Ga0105239_10211410 3300010375 Bacteria 2174
170 Ga0105239_10279826 3300010375 Bacteria 1878
171 Ga0105239_10356811 3300010375 Bacteria 1651
172 Ga0105246_10081781 3300011119 Bacteria 2303
173 Ga0157373_10053256 3300013100 Bacteria 2877
174 Ga0157370_10129027 3300013104 Bacteria 2359
175 Ga0157370_10402729 3300013104 Bacteria 1259
176 Ga0157369_10071197 3300013105 Bacteria 3733
177 Ga0157369_10684080 3300013105 Bacteria 1057
178 Ga0157374_10228057 3300013296 Bacteria 1829
179 Ga0157378_10743896 3300013297 Bacteria 1003
180 Ga0163162_10277441 3300013306 Bacteria 1808
181 Ga0157372_10271108 3300013307 Bacteria 1972
182 Ga0157375_10028391 3300013308 Bacteria 5244
183 Ga0157375_10293938 3300013308 Bacteria 1788
184 Ga0157375_10410565 3300013308 Bacteria 1520
185 Ga0163163_10002009 3300014325 Bacteria 17183
186 Ga0163163_10033178 3300014325 Bacteria 4992
187 Ga0157380_10127343 3300014326 Bacteria 2167
188 Ga0182008_10159463 3300014497 Bacteria 1135
189 Ga0157377_10178578 3300014745 Bacteria 1333
190 Ga0157379_10179402 3300014968 Bacteria 1913
191 Ga0157376_10010998 3300014969 Bacteria 6649
192 Ga0206353_10148081 3300020082 Bacteria 1075
193 Ga0206353_10567907 3300020082 Bacteria 2027
194 Ga0214544_1000016 3300021320 Bacteria 204278
195 Ga0214542_1000016 3300021321 Bacteria 210332
196 Ga0214545_1000008 3300021324 Bacteria 215190
197 Ga0214543_1001466 3300021327 Bacteria 45567
198 Ga0213873_10024285 3300021358 Bacteria 1453
199 Ga0213872_10015515 3300021361 Bacteria 3540
200 Ga0213876_10002439 3300021384 Bacteria 10933
201 Ga0209563_108642 3300025230 Bacteria 1592
202 Ga0209677_100672 3300025253 Bacteria 17650
203 Ga0209677_105633 3300025253 Bacteria 3210
204 Ga0209148_1000282 3300025254 Bacteria 78016
205 Ga0209233_1005872 3300025261 Bacteria 4028
206 Ga0209455_1002393 3300025272 Bacteria 7284
207 Ga0207673_1005554 3300025290 Bacteria 1542
208 Ga0209564_1000321 3300025295 Bacteria 93331
209 Ga0209564_1003702 3300025295 Bacteria 10062
210 Ga0209758_1000069 3300025297 Bacteria 286161
211 Ga0209758_1000635 3300025297 Bacteria 53736
212 Ga0209758_1001996 3300025297 Bacteria 21984
213 Ga0209758_1002493 3300025297 Bacteria 18700
214 Ga0209758_1011302 3300025297 Bacteria 5193
215 Ga0209758_1017490 3300025297 Bacteria 3566
216 Ga0209256_1015129 3300025299 Bacteria 2720
217 Ga0209256_1032713 3300025299 Bacteria 1407
218 Ga0207426_1002082 3300025302 Bacteria 13833
219 Ga0207426_1004116 3300025302 Bacteria 7310
220 Ga0207426_1020494 3300025302 Bacteria 2297
221 Ga0207426_1024931 3300025302 Bacteria 2021
222 Ga0209257_1000473 3300025304 Bacteria 73323
223 Ga0209257_1017693 3300025304 Bacteria 2792
224 Ga0207697_10065589 3300025315 Bacteria 1515
225 Ga0207656_10008173 3300025321 Bacteria 3840
226 Ga0207692_10002026 3300025898 Bacteria 7732
227 Ga0207692_10012905 3300025898 Bacteria 3605
228 Ga0207647_10014195 3300025904 Bacteria 5498
229 Ga0207647_10168847 3300025904 Bacteria 1274
230 Ga0207685_10016028 3300025905 Bacteria 2388
231 Ga0207685_10035616 3300025905 Bacteria 1818
232 Ga0207699_10003043 3300025906 Bacteria 7960
233 Ga0207699_10007202 3300025906 Bacteria 5431
234 Ga0207699_10038283 3300025906 Bacteria 2747
235 Ga0207699_10245906 3300025906 Bacteria 1231
236 Ga0207699_10323155 3300025906 Bacteria 1083
237 Ga0207645_10179478 3300025907 Bacteria 1389
238 Ga0207684_10077500 3300025910 Bacteria 2827
239 Ga0207654_10000058 3300025911 Bacteria 75628
240 Ga0207654_10006549 3300025911 Bacteria 5860
241 Ga0207654_10011597 3300025911 Bacteria 4498
242 Ga0207654_10089954 3300025911 Bacteria 1869
243 Ga0207707_10004700 3300025912 Bacteria 11981
244 Ga0207707_10035006 3300025912 Bacteria 4391
245 Ga0207707_10054133 3300025912 Bacteria 3493
246 Ga0207707_10104173 3300025912 Bacteria 2479
247 Ga0207707_10158480 3300025912 Bacteria 1979
248 Ga0207695_10000107 3300025913 Bacteria 252606
249 Ga0207695_10000453 3300025913 Bacteria 89314
250 Ga0207695_10115822 3300025913 Bacteria 2654
251 Ga0207695_10254960 3300025913 Bacteria 1653
252 Ga0207695_10318707 3300025913 Bacteria 1444
253 Ga0207671_10018412 3300025914 Bacteria 5360
254 Ga0207671_10042434 3300025914 Bacteria 3367
255 Ga0207671_10069130 3300025914 Bacteria 2633
256 Ga0207671_10094158 3300025914 Bacteria 2260
257 Ga0207671_10282289 3300025914 Bacteria 1310
258 Ga0207671_10461891 3300025914 Bacteria 1012
259 Ga0207693_10000310 3300025915 Bacteria 45408
260 Ga0207693_10021450 3300025915 Bacteria 5132
261 Ga0207693_10034078 3300025915 Bacteria 4016
262 Ga0207693_10035714 3300025915 Bacteria 3919
263 Ga0207693_10181848 3300025915 Bacteria 1655
264 Ga0207693_10354295 3300025915 Bacteria 1148
265 Ga0207663_10016715 3300025916 Bacteria 4075
266 Ga0207663_10019867 3300025916 Bacteria 3793
267 Ga0207663_10083697 3300025916 Bacteria 2096
268 Ga0207660_10076914 3300025917 Bacteria 2441
269 Ga0207660_10081275 3300025917 Bacteria 2381
270 Ga0207660_10189160 3300025917 Bacteria 1602
271 Ga0207657_10029294 3300025919 Bacteria 5013
272 Ga0207657_10073517 3300025919 Bacteria 2889
273 Ga0207657_10131985 3300025919 Bacteria 2046
274 Ga0207649_10410030 3300025920 Bacteria 1016
275 Ga0207652_10076915 3300025921 Bacteria 2911
276 Ga0207652_10079219 3300025921 Bacteria 2870
277 Ga0207652_10136044 3300025921 Bacteria 2194
278 Ga0207681_10066644 3300025923 Bacteria 2493
279 Ga0207694_10001009 3300025924 Bacteria 24556
280 Ga0207694_10034117 3300025924 Bacteria 3901
281 Ga0207694_10274993 3300025924 Bacteria 1382
282 Ga0207687_10004089 3300025927 Bacteria 9778
283 Ga0207687_10330306 3300025927 Bacteria 1237
284 Ga0207687_10350902 3300025927 Bacteria 1202
285 Ga0207700_10093504 3300025928 Bacteria 2380
286 Ga0207700_10117026 3300025928 Bacteria 2154
287 Ga0207700_10154584 3300025928 Bacteria 1899
288 Ga0207664_10061778 3300025929 Bacteria 2990
289 Ga0207664_10103518 3300025929 Bacteria 2356
290 Ga0207664_10487302 3300025929 Bacteria 1103
291 Ga0207664_10588483 3300025929 Bacteria 999
292 Ga0207644_10066408 3300025931 Bacteria 2626
293 Ga0207706_10203009 3300025933 Bacteria 1738
294 Ga0207709_10250155 3300025935 Bacteria 1294
295 Ga0207665_10001734 3300025939 Bacteria 14668
296 Ga0207665_10004258 3300025939 Bacteria 9511
297 Ga0207665_10061076 3300025939 Bacteria 2554
298 Ga0207665_10085508 3300025939 Bacteria 2178
299 Ga0207691_10172053 3300025940 Bacteria 1896
300 Ga0207691_10203813 3300025940 Bacteria 1721
301 Ga0207691_10441320 3300025940 Bacteria 1108
302 Ga0207711_10211107 3300025941 Bacteria 1773
303 Ga0207689_10039585 3300025942 Bacteria 3902
304 Ga0207661_10044403 3300025944 Bacteria 3512
305 Ga0207661_10056040 3300025944 Bacteria 3163
306 Ga0207661_10073930 3300025944 Bacteria 2793
307 Ga0207661_10175645 3300025944 Bacteria 1867
308 Ga0207661_10670737 3300025944 Bacteria 953
309 Ga0207679_10390674 3300025945 Bacteria 1222
310 Ga0207667_10006596 3300025949 Bacteria 14034
311 Ga0207667_10088774 3300025949 Bacteria 3196
312 Ga0207667_10109852 3300025949 Bacteria 2844
313 Ga0207667_10160793 3300025949 Bacteria 2310
314 Ga0207667_10281972 3300025949 Bacteria 1698
315 Ga0207640_10047734 3300025981 Bacteria 2764
316 Ga0207640_10186435 3300025981 Bacteria 1560
317 Ga0207658_10306396 3300025986 Bacteria 1370
318 Ga0207677_10024413 3300026023 Bacteria 3756
319 Ga0207677_10198955 3300026023 Bacteria 1591
320 Ga0207703_10078340 3300026035 Bacteria 2746
321 Ga0207703_10281990 3300026035 Bacteria 1509
322 Ga0207639_10013217 3300026041 Bacteria 5772
323 Ga0207639_10123004 3300026041 Bacteria 2135
324 Ga0207678_10003936 3300026067 Bacteria 13364
325 Ga0207678_10046674 3300026067 Bacteria 3746
326 Ga0207678_10096010 3300026067 Bacteria 2533
327 Ga0207678_10422037 3300026067 Bacteria 1157
328 Ga0207708_10085681 3300026075 Bacteria 2424
329 Ga0207702_10000004 3300026078 Bacteria 422182
330 Ga0207702_10001701 3300026078 Bacteria 21732
331 Ga0207702_10337936 3300026078 Bacteria 1438
332 Ga0207641_10327266 3300026088 Bacteria 1455
333 Ga0207648_10060413 3300026089 Bacteria 3305
334 Ga0207648_10238899 3300026089 Bacteria 1617
335 Ga0207676_10095612 3300026095 Bacteria 2450
336 Ga0207676_10114523 3300026095 Bacteria 2262
337 Ga0207674_10000890 3300026116 Bacteria 39065
338 Ga0207674_10002298 3300026116 Bacteria 24210
339 Ga0207674_10007766 3300026116 Bacteria 12478
340 Ga0207674_10052673 3300026116 Bacteria 4150
341 Ga0207674_10299290 3300026116 Bacteria 1558
342 Ga0207675_100122516 3300026118 Bacteria 2461
343 Ga0207675_100389764 3300026118 Bacteria 1371
344 Ga0207683_10016524 3300026121 Bacteria 6283
345 Ga0207683_10169315 3300026121 Bacteria 1978
346 Ga0207698_10031595 3300026142 Bacteria 3824
347 Ga0207698_10183463 3300026142 Bacteria 1856
348 Ga0207698_10350202 3300026142 Bacteria 1395
349 Ga0209389_1000033 3300027296 Bacteria 131516
350 Ga0209389_1000182 3300027296 Bacteria 48705
351 Ga0209589_1000021 3300027357 Bacteria 186431
352 Ga0209589_1000040 3300027357 Bacteria 126550
353 Ga0209489_100028 3300027361 Bacteria 186431
354 Ga0209489_100045 3300027361 Bacteria 158225
355 Ga0209489_100209 3300027361 Bacteria 96349
356 Ga0209700_100011 3300027363 Bacteria 362159
357 Ga0209700_100037 3300027363 Bacteria 186431
358 Ga0209588_1073887 3300027671 Bacteria 1101
359 Ga0268266_10045729 3300028379 Bacteria 3745
360 Ga0268266_10184329 3300028379 Bacteria 1902
361 Ga0268266_10199057 3300028379 Bacteria 1832
362 Ga0268266_10410158 3300028379 Bacteria 1282
363 Ga0268264_10000062 3300028381 Bacteria 302110
364 Ga0265337_1018782 3300028556 Bacteria 2189
365 Ga0265326_10008390 3300028558 Bacteria 3118
366 Ga0265319_1012969 3300028563 Bacteria 3340
367 Ga0265334_10013964 3300028573 Bacteria 3354
368 Ga0265318_10016635 3300028577 Bacteria 3034
369 Ga0265323_10007956 3300028653 Bacteria 4383
370 Ga0265336_10000561 3300028666 Bacteria 21059
371 Ga0307517_10001338 3300028786 Bacteria 41372
372 Ga0307515_10125511 3300028794 Bacteria 2870
373 Ga0307515_10140350 3300028794 Bacteria 2596
374 Ga0265338_10000598 3300028800 Bacteria 63497
375 Ga0265332_10016039 3300031238 Bacteria 3306
376 Ga0265332_10027603 3300031238 Bacteria 2486
377 Ga0265332_10072613 3300031238 Bacteria 1465
378 Ga0265328_10044554 3300031239 Bacteria 1632
379 Ga0265325_10009157 3300031241 Bacteria 5799
380 Ga0265340_10041599 3300031247 Bacteria 2258
381 Ga0265340_10042492 3300031247 Bacteria 2231
382 Ga0265339_10007110 3300031249 Bacteria 7267
383 Ga0265339_10029701 3300031249 Bacteria 3099
384 Ga0265339_10099122 3300031249 Bacteria 1519
385 Ga0265331_10027874 3300031250 Bacteria 2828
386 Ga0265331_10100059 3300031250 Bacteria 1335
387 Ga0307513_10105188 3300031456 Bacteria 2833
388 Ga0307513_10164506 3300031456 Bacteria 2105
389 Ga0307513_10169966 3300031456 Bacteria 2059
390 Ga0307513_10222288 3300031456 Bacteria 1708
391 Ga0307408_100239375 3300031548 Bacteria 1491
392 Ga0265313_10041739 3300031595 Bacteria 2258
393 Ga0307508_10000002 3300031616 Bacteria 407635
394 Ga0307508_10078616 3300031616 Bacteria 2879
395 Ga0265314_10005687 3300031711 Bacteria 11193
396 Ga0265314_10147464 3300031711 Bacteria 1447
397 Ga0265342_10005853 3300031712 Bacteria 9282
398 Ga0307516_10006094 3300031730 Bacteria 14234
399 Ga0307516_10010553 3300031730 Bacteria 10142
400 Ga0307516_10104788 3300031730 Bacteria 2640
401 Ga0307406_10168105 3300031901 Bacteria 1584
402 Ga0307415_100362721 3300032126 Bacteria 1224
403 Ga0307507_10027443 3300033179 Bacteria 6103
404 Ga0307510_10024755 3300033180 Bacteria 6932
405 Ga0307510_10025056 3300033180 Bacteria 6887
406 Ga0315911_1000008 3300033442 Bacteria 381285
407 Ga0316215_1002237 3300033544 Bacteria 1828
408 Ga0373926_0039711 3300035083 Bacteria 1679
409 Ga0373934_0002932 3300035086 Bacteria 6241
410 Ga0373944_0042120 3300035089 Bacteria 1415
411 Ga0373923_0009618 3300035111 Bacteria 3495
412 Ga0373936_0016692 3300035113 Bacteria 2825
413 Ga0373936_0036388 3300035113 Bacteria 1963
414 Ga0373936_0070087 3300035113 Bacteria 1444
415 Ga0373936_0133190 3300035113 Bacteria 1069
416 Ga0373941_0063086 3300035115 Bacteria 1211
417 Ga0373945_0002529 3300035116 Bacteria 5721
418 Ga0373945_0019734 3300035116 Bacteria 2302
419 Ga0373953_0000955 3300035117 Bacteria 8086
420 Ga0373953_0034938 3300035117 Bacteria 1973
421 Ga0373954_0018760 3300035118 Bacteria 3116
422 Ga0373954_0018968 3300035118 Bacteria 3100
423 Ga0373956_0068497 3300035119 Bacteria 1616
424 Ga0373957_0006831 3300035120 Bacteria 3617
425 Ga0373943_0002107 3300035170 Bacteria 9037
426 Ga0373943_0046258 3300035170 Bacteria 2123
427 Ga0373943_0056690 3300035170 Bacteria 1945
428 Ga0373943_0083317 3300035170 Bacteria 1643
429 Ga0373946_0001889 3300035171 Bacteria 7311
430 Ga0373946_0104972 3300035171 Bacteria 1271
431 Ga0373955_0005406 3300035172 Bacteria 5739
432 Ga0373924_0005676 3300035410 Bacteria 4427
433 Ga0373924_0060733 3300035410 Bacteria 1581
434 Ga0373931_0019569 3300035691 Bacteria 3382
435 Ga0373935_0000557 3300035692 Bacteria 19409
436 Ga0373935_0308415 3300035692 Bacteria 1120
437 Ga0373935_0443493 3300035692 Bacteria 937
438 Ga0373927_0003654 3300035695 Bacteria 10968
439 Ga0373927_0010418 3300035695 Bacteria 6199
440 Ga0373927_0021960 3300035695 Bacteria 4182
441 Ga0373927_0027049 3300035695 Bacteria 3748
442 Ga0373927_0036371 3300035695 Bacteria 3202
443 Ga0373927_0235046 3300035695 Bacteria 1204
444 Ga0373933_0000031 3300035724 Bacteria 85038
445 Ga0373933_0003419 3300035724 Bacteria 8846
446 Ga0373933_0082944 3300035724 Bacteria 1968
447 Ga0373947_0000509 3300035725 Bacteria 22579
448 Ga0373947_0049307 3300035725 Bacteria 2528
449 Ga0373947_0151339 3300035725 Bacteria 1495
450 Ga0373947_0346433 3300035725 Bacteria 996
451 Ga0373937_0033982 3300036401 Bacteria 4636
452 Ga0373937_0284966 3300036401 Bacteria 1560
453 Ga0373937_0380292 3300036401 Bacteria 1339
454 Ga0373925_0001713 3300037068 Bacteria 18492
455 Ga0373925_0025981 3300037068 Bacteria 4281
456 Ga0373925_0078993 3300037068 Bacteria 2499
457 Ga0373925_0110677 3300037068 Bacteria 2121
458 Ga0373925_0110804 3300037068 Bacteria 2120
459 Ga0373925_0192510 3300037068 Bacteria 1618
460 Ga0373925_0205586 3300037068 Bacteria 1567
461 Ga0395900_0003383 3300037418 Bacteria 17226
462 Ga0395900_0080281 3300037418 Bacteria 3352
463 Ga0395900_0546461 3300037418 Bacteria 1103
464 Ga0395898_0013386 3300037466 Bacteria 8449
465 Ga0395898_0018463 3300037466 Bacteria 7111
466 Ga0395898_0079473 3300037466 Bacteria 3164
467 Ga0395898_0099077 3300037466 Bacteria 2799
468 Ga0395905_0005856 3300037471 Bacteria 12492
469 Ga0395905_0023254 3300037471 Bacteria 5859
470 Ga0395905_0060606 3300037471 Bacteria 3538
471 Ga0395905_0165060 3300037471 Bacteria 2081
472 Ga0436364_0709114 3300037853 Bacteria 1183
473 Ga0395901_0161395 3300038443 Bacteria 2354
474 Ga0395901_0224667 3300038443 Bacteria 1962
475 Ga0436365_0076766 3300039437 Bacteria 1643
476 Ga0436365_0803057 3300039437 Bacteria 5477
477 Ga0436365_0958057 3300039437 Bacteria 1211
478 Ga0436365_0966323 3300039437 Bacteria 3151
479 Ga0436365_1369931 3300039437 Bacteria 1176
480 Ga0436361_0336324 3300039447 Bacteria 2835
481 Ga0436361_0937863 3300039447 Bacteria 1391
482 Ga0436363_0697337 3300039450 Bacteria 2088
483 Ga0439465_0013621 3300041413 Bacteria 2533
484 Ga0466969_0128100 3300044656 Bacteria 1178
485 Ga0466972_0000119 3300044658 Bacteria 66620
486 Ga0466972_0010560 3300044658 Bacteria 4634
487 Ga0466966_0034959 3300044684 Bacteria 3248
488 Ga0466966_0041766 3300044684 Bacteria 2946
489 Ga0466961_0000139 3300044693 Bacteria 48781
490 Ga0466963_0080797 3300044694 Bacteria 2201
491 Ga0466963_0117349 3300044694 Bacteria 1829
492 Ga0466971_0174557 3300044719 Bacteria 1009
493 Ga0466968_0017207 3300044735 Bacteria 2886
494 Ga0466968_0021266 3300044735 Bacteria 2626
495 Ga0466968_0100658 3300044735 Bacteria 1290
496 Ga0466970_0045604 3300044765 Bacteria 2335
497 Ga0466970_0185989 3300044765 Bacteria 1153
498 Ga0466957_0035033 3300044842 Bacteria 3012
499 Ga0466960_0000848 3300044901 Bacteria 10813
500 Ga0466959_0034008 3300045049 Bacteria 3771
501 Ga0466959_0053472 3300045049 Bacteria 2952
502 Ga0466959_0240101 3300045049 Bacteria 1252
503 Ga0466959_0361912 3300045049 Bacteria 988
504 Ga0466967_0004006 3300045976 Bacteria 9819
505 Ga0466967_0011512 3300045976 Bacteria 6706
506 Ga0466967_0088324 3300045976 Bacteria 2813
507 Ga0466967_0160685 3300045976 Bacteria 2108
508 Ga0495592_0058216 3300046454 Bacteria 2850
509 Ga0495592_0140768 3300046454 Bacteria 1678
510 Ga0495592_0300267 3300046454 Bacteria 1044
511 Ga0495603_0000047 3300046455 Bacteria 53081
512 Ga0495603_0055753 3300046455 Bacteria 2341
513 Ga0495603_0070506 3300046455 Bacteria 2054
514 Ga0495629_0000320 3300046459 Bacteria 41151
515 Ga0495629_0005536 3300046459 Bacteria 9427
516 Ga0495629_0231283 3300046459 Bacteria 1274
517 Ga0495638_0001094 3300046460 Bacteria 26401
518 Ga0495638_0053016 3300046460 Bacteria 2524
519 Ga0495641_0009584 3300046461 Bacteria 5738
520 Ga0495651_0017530 3300046462 Bacteria 5546
521 Ga0495651_0041190 3300046462 Bacteria 3588
522 Ga0495651_0086113 3300046462 Bacteria 2365
523 Ga0495651_0095034 3300046462 Bacteria 2230
524 Ga0495653_0003027 3300046463 Bacteria 13478
525 Ga0495653_0070906 3300046463 Bacteria 2606
526 Ga0495580_0090453 3300046472 Bacteria 2131
527 Ga0495582_0000043 3300046473 Bacteria 63647
528 Ga0495582_0024699 3300046473 Bacteria 3289
529 Ga0495582_0032646 3300046473 Bacteria 2862
530 Ga0495582_0042626 3300046473 Bacteria 2499
531 Ga0495605_0072307 3300046474 Bacteria 1627
532 Ga0495605_0092896 3300046474 Bacteria 1396
533 Ga0495639_0000091 3300046475 Bacteria 44027
534 Ga0495662_0000128 3300046476 Bacteria 28645
535 Ga0495664_0009771 3300046477 Bacteria 5377
536 Ga0495664_0016934 3300046477 Bacteria 4162
537 Ga0495664_0053492 3300046477 Bacteria 2401
538 Ga0495584_0016366 3300046491 Bacteria 3782
539 Ga0495584_0036022 3300046491 Bacteria 2500
540 Ga0495585_0027616 3300046492 Bacteria 3239
541 Ga0495594_0002035 3300046499 Bacteria 10525
542 Ga0495594_0137115 3300046499 Bacteria 1387
543 Ga0495596_0056530 3300046500 Bacteria 1532
544 Ga0495607_0012073 3300046501 Bacteria 5715
545 Ga0495583_0020205 3300046506 Bacteria 3457
546 Ga0495606_0000252 3300046507 Bacteria 94511
547 Ga0495606_0037168 3300046507 Bacteria 3308
548 Ga0495606_0048505 3300046507 Bacteria 2792
549 Ga0495606_0082443 3300046507 Bacteria 1996
550 Ga0495606_0194800 3300046507 Bacteria 1159
551 Ga0495608_0017766 3300046511 Bacteria 4918
552 Ga0495610_0055708 3300046512 Bacteria 1904
553 Ga0495616_0025586 3300046513 Bacteria 3151
554 Ga0495616_0134523 3300046513 Bacteria 1130
555 Ga0495618_0010884 3300046514 Bacteria 5507
556 Ga0495620_0014398 3300046515 Bacteria 4020
557 Ga0495628_0057540 3300046516 Bacteria 3058
558 Ga0495628_0108009 3300046516 Bacteria 2142
559 Ga0495628_0261808 3300046516 Bacteria 1289
560 Ga0495628_0314815 3300046516 Bacteria 1156
561 Ga0495630_0014946 3300046517 Bacteria 5661
562 Ga0495631_0025195 3300046518 Bacteria 2741
563 Ga0495631_0081283 3300046518 Bacteria 1398
564 Ga0495637_0028566 3300046520 Bacteria 2490
565 Ga0495643_0063715 3300046522 Bacteria 1949
566 Ga0495644_0031813 3300046523 Bacteria 1994
567 Ga0495648_0000286 3300046524 Bacteria 57430
568 Ga0495648_0024325 3300046524 Bacteria 4127
569 Ga0495648_0044368 3300046524 Bacteria 2776
570 Ga0495648_0072499 3300046524 Bacteria 1992
571 Ga0495648_0125545 3300046524 Bacteria 1372
572 Ga0495666_0015987 3300046526 Bacteria 3737
573 Ga0495666_0192723 3300046526 Bacteria 939
574 Ga0495652_0011857 3300046529 Bacteria 7878
575 Ga0495652_0034268 3300046529 Bacteria 4426
576 Ga0495665_0000051 3300046531 Bacteria 46836
577 Ga0495640_0007555 3300046533 Bacteria 8540
578 Ga0495640_0018565 3300046533 Bacteria 5152
579 Ga0495640_0074727 3300046533 Bacteria 2265
580 Ga0495640_0112835 3300046533 Bacteria 1774
581 Ga0495586_0047218 3300046535 Bacteria 2324
582 Ga0495587_0008144 3300046536 Bacteria 6757
583 Ga0495587_0029650 3300046536 Bacteria 3321
584 Ga0495598_0005762 3300046537 Bacteria 2766
585 Ga0495645_0021133 3300046543 Bacteria 4704
586 Ga0495645_0102551 3300046543 Bacteria 2033
587 Ga0495622_0015099 3300046557 Bacteria 3590
588 Ga0495622_0021698 3300046557 Bacteria 2990
589 Ga0495633_0006412 3300046558 Bacteria 6977
590 Ga0495667_0004751 3300046559 Bacteria 9185
591 Ga0495667_0006502 3300046559 Bacteria 7933
592 Ga0495667_0033150 3300046559 Bacteria 3457
593 Ga0495667_0175879 3300046559 Bacteria 1375
594 Ga0495667_0188219 3300046559 Bacteria 1323
595 Ga0495668_0029459 3300046616 Bacteria 3101
596 Ga0495634_0000400 3300046642 Bacteria 42620
597 Ga0495634_0021637 3300046642 Bacteria 4542
598 Ga0495634_0044581 3300046642 Bacteria 3001
599 Ga0495634_0076053 3300046642 Bacteria 2204
600 Ga0495625_0017905 3300046660 Bacteria 5537
601 Ga0495625_0104162 3300046660 Bacteria 1945
602 Ga0495635_0000620 3300046663 Bacteria 22835
603 Ga0495635_0002202 3300046663 Bacteria 13254
604 Ga0495635_0004059 3300046663 Bacteria 10161
605 Ga0495635_0043268 3300046663 Bacteria 3108
606 Ga0495661_0019545 3300046665 Bacteria 4437
607 Ga0495657_0006604 3300046675 Bacteria 9061
608 Ga0495657_0013678 3300046675 Bacteria 5977
609 Ga0495657_0030794 3300046675 Bacteria 3754
610 Ga0495657_0042749 3300046675 Bacteria 3092
611 Ga0495599_0009906 3300046678 Bacteria 5832
612 Ga0495599_0069977 3300046678 Bacteria 2190
613 Ga0495623_0012518 3300046679 Bacteria 5488
614 Ga0495623_0037441 3300046679 Bacteria 3103
615 Ga0495623_0213500 3300046679 Bacteria 1103
616 Ga0495646_0000643 3300046680 Bacteria 19081
617 Ga0495646_0043973 3300046680 Bacteria 2733
618 Ga0495647_0002769 3300046681 Bacteria 5563
619 Ga0495658_0000499 3300046683 Bacteria 21574
620 Ga0495658_0114457 3300046683 Bacteria 1625
621 Ga0495613_0008984 3300046689 Bacteria 7414
622 Ga0495613_0025117 3300046689 Bacteria 4440
623 Ga0495624_0003704 3300046690 Bacteria 11299
624 Ga0495624_0021704 3300046690 Bacteria 4254
625 Ga0495624_0096046 3300046690 Bacteria 1826
626 Ga0495670_0001762 3300046691 Bacteria 10629
627 Ga0495670_0125248 3300046691 Bacteria 1337
628 Ga0495671_0161834 3300046692 Bacteria 1088
629 Ga0495649_0012129 3300046694 Bacteria 5029
630 Ga0495589_0051700 3300046794 Bacteria 2031
631 Ga0495600_0011578 3300046809 Bacteria 5501
632 Ga0495600_0013331 3300046809 Bacteria 5162
633 Ga0495581_0000486 3300047315 Bacteria 20240
634 Ga0495581_0061415 3300047315 Bacteria 2172
635 Ga0495581_0114111 3300047315 Bacteria 1571
636 Ga0495581_0115928 3300047315 Bacteria 1558
637 Ga0495604_0010785 3300047317 Bacteria 7256
638 Ga0495604_0023859 3300047317 Bacteria 4881
639 Ga0495604_0031639 3300047317 Bacteria 4196
640 Ga0495604_0145351 3300047317 Bacteria 1690
641 Ga0495674_0005428 3300047319 Bacteria 12243
642 Ga0495674_0023537 3300047319 Bacteria 5675
643 Ga0495674_0131189 3300047319 Bacteria 2111
644 Ga0495672_0022435 3300047320 Bacteria 4103
645 Ga0495672_0066467 3300047320 Bacteria 2057
646 Ga0495672_0081560 3300047320 Bacteria 1801
647 Ga0495676_0061706 3300047321 Bacteria 2931
648 Ga0495676_0087102 3300047321 Bacteria 2348
649 Ga0495676_0108612 3300047321 Bacteria 2040
650 Ga0495676_0114727 3300047321 Bacteria 1970
651 Ga0495680_0000689 3300047322 Bacteria 37846
652 Ga0495680_0001909 3300047322 Bacteria 21876
653 Ga0495680_0040967 3300047322 Bacteria 3685
654 Ga0495680_0099424 3300047322 Bacteria 2169
655 Ga0495680_0231698 3300047322 Bacteria 1315
656 Ga0495683_0044814 3300047323 Bacteria 2224
657 Ga0495683_0073135 3300047323 Bacteria 1681
658 Ga0495687_008047 3300047443 Bacteria 6093
659 Ga0495675_0008329 3300047444 Bacteria 6418
660 Ga0495675_0103236 3300047444 Bacteria 1782
661 Ga0495681_0100394 3300047470 Bacteria 1266
662 Ga0495684_0000313 3300047471 Bacteria 39705
663 Ga0495684_0012322 3300047471 Bacteria 6595
664 Ga0495684_0103192 3300047471 Bacteria 2155
665 Ga0495684_0145236 3300047471 Bacteria 1777
666 Ga0495684_0206990 3300047471 Bacteria 1444
667 Ga0495686_0063919 3300047472 Bacteria 2279
668 Ga0495593_0000005 3300047673 Bacteria 93984
669 Ga0495593_0002672 3300047673 Bacteria 10727
670 Ga0495593_0063063 3300047673 Bacteria 1936
671 Ga0495602_0015257 3300048088 Bacteria 7760
672 Ga0495602_0095535 3300048088 Bacteria 2453
673 Ga0495602_0118872 3300048088 Bacteria 2130
674 Ga0495614_0006832 3300048089 Bacteria 5104
675 Ga0495626_0025505 3300048091 Bacteria 2890
676 Ga0495626_0055731 3300048091 Bacteria 1811
677 Ga0495626_0079507 3300048091 Bacteria 1459
678 Ga0496100_0006321 3300048903 Bacteria 6455
679 Ga0496100_0093302 3300048903 Bacteria 2059
680 Ga0496100_0199871 3300048903 Bacteria 1456
681 Ga0496100_0331609 3300048903 Bacteria 1145
682 Ga0496101_0018505 3300048904 Bacteria 4738
683 Ga0496101_0041241 3300048904 Bacteria 3291
684 Ga0496101_0230209 3300048904 Bacteria 1440
685 Ga0496101_0496314 3300048904 Bacteria 964
686 Ga0496102_0001314 3300048905 Bacteria 22298
687 Ga0496102_0009090 3300048905 Bacteria 8527
688 Ga0496102_0542835 3300048905 Bacteria 1085
689 Ga0496102_0554459 3300048905 Bacteria 1072
690 Ga0496103_0025364 3300048906 Bacteria 3582
691 Ga0496103_0047615 3300048906 Bacteria 2649
692 Ga0496103_0250773 3300048906 Bacteria 1139
693 Ga0496104_0002280 3300048907 Bacteria 16544
694 Ga0496104_0003037 3300048907 Bacteria 14457
695 Ga0496104_0007367 3300048907 Bacteria 9720
696 Ga0496104_0018994 3300048907 Bacteria 6280
697 Ga0496104_0030135 3300048907 Bacteria 5040
698 Ga0496104_0159295 3300048907 Bacteria 2165
699 Ga0496104_0272046 3300048907 Bacteria 1607
700 Ga0496105_0000935 3300048908 Bacteria 19915
701 Ga0496105_0003051 3300048908 Bacteria 12313
702 Ga0496105_0027371 3300048908 Bacteria 4657
703 Ga0496105_0040662 3300048908 Bacteria 3834
704 Ga0496105_0126887 3300048908 Bacteria 2103
705 Ga0496106_0000236 3300048909 Bacteria 38678
706 Ga0496106_0014089 3300048909 Bacteria 5908
707 Ga0496106_0060156 3300048909 Bacteria 2879
708 Ga0496106_0126165 3300048909 Bacteria 2004
709 Ga0496106_0264519 3300048909 Bacteria 1376
710 Ga0496107_0003292 3300048910 Bacteria 10781
711 Ga0496107_0091750 3300048910 Bacteria 2220
712 Ga0496107_0110889 3300048910 Bacteria 2016
713 Ga0496107_0130670 3300048910 Bacteria 1854
714 Ga0496107_0152209 3300048910 Bacteria 1711
715 Ga0496107_0171489 3300048910 Bacteria 1610
716 Ga0496107_0239906 3300048910 Bacteria 1349
717 Ga0496107_0244377 3300048910 Bacteria 1335
718 Ga0496107_0265433 3300048910 Bacteria 1277
719 Ga0496108_0000849 3300048911 Bacteria 23796
720 Ga0496108_0016993 3300048911 Bacteria 5947
721 Ga0496108_0047577 3300048911 Bacteria 3585
722 Ga0496108_0053230 3300048911 Bacteria 3394
723 Ga0496108_0304768 3300048911 Bacteria 1388
724 Ga0496108_0360185 3300048911 Bacteria 1269
725 Ga0496108_0372747 3300048911 Bacteria 1246
726 Ga0496109_0000224 3300048912 Bacteria 55854
727 Ga0496109_0010749 3300048912 Bacteria 7835
728 Ga0496109_0011741 3300048912 Bacteria 7537
729 Ga0496109_0073871 3300048912 Bacteria 3134
730 Ga0496109_0148771 3300048912 Bacteria 2192
731 Ga0496110_0004203 3300048913 Bacteria 11133
732 Ga0496110_0008119 3300048913 Bacteria 8433
733 Ga0496110_0027437 3300048913 Bacteria 4882
734 Ga0496110_0056327 3300048913 Bacteria 3459
735 Ga0496110_0132154 3300048913 Bacteria 2254
736 Ga0496110_0151081 3300048913 Bacteria 2103
737 Ga0496110_0197580 3300048913 Bacteria 1827
738 Ga0496111_0008238 3300048914 Bacteria 6892
739 Ga0496111_0010213 3300048914 Bacteria 6290
740 Ga0496111_0043391 3300048914 Bacteria 3232
741 Ga0496111_0057197 3300048914 Bacteria 2823
742 Ga0496111_0196353 3300048914 Bacteria 1500
743 Ga0496111_0352694 3300048914 Bacteria 1089
744 Ga0496112_0000020 3300048915 Bacteria 169373
745 Ga0496112_0001044 3300048915 Bacteria 20400
746 Ga0496112_0014481 3300048915 Bacteria 7321
747 Ga0496112_0032339 3300048915 Bacteria 5079
748 Ga0496112_0036502 3300048915 Bacteria 4795
749 Ga0496112_0128611 3300048915 Bacteria 2503
750 Ga0496112_0218018 3300048915 Bacteria 1865
751 Ga0496112_0462284 3300048915 Bacteria 1206
752 Ga0496113_0006740 3300048916 Bacteria 7319
753 Ga0496113_0037992 3300048916 Bacteria 3537
754 Ga0496113_0043787 3300048916 Bacteria 3314
755 Ga0496113_0051297 3300048916 Bacteria 3078
756 Ga0496113_0059445 3300048916 Bacteria 2879
757 Ga0496113_0076548 3300048916 Bacteria 2556
758 Ga0496114_0009847 3300048917 Bacteria 7598
759 Ga0496114_0079878 3300048917 Bacteria 2762
760 Ga0496114_0306210 3300048917 Bacteria 1403
761 Ga0496115_0023846 3300048918 Bacteria 4751
762 Ga0496115_0029319 3300048918 Bacteria 4321
763 Ga0496115_0087123 3300048918 Bacteria 2548
764 Ga0496115_0087298 3300048918 Bacteria 2545
765 Ga0496115_0100082 3300048918 Bacteria 2376
766 Ga0496115_0140952 3300048918 Bacteria 1989
767 Ga0496115_0286279 3300048918 Bacteria 1352
768 Ga0496115_0372611 3300048918 Bacteria 1162
769 Ga0496117_0021089 3300048920 Bacteria 5288
770 Ga0496117_0036072 3300048920 Bacteria 3704
771 Ga0496117_0120237 3300048920 Bacteria 1615
772 Ga0496117_0153817 3300048920 Bacteria 1357
773 Ga0496118_0003026 3300048921 Bacteria 21707
774 Ga0496118_0027995 3300048921 Bacteria 4757
775 Ga0496118_0048029 3300048921 Bacteria 3302
776 Ga0496118_0064926 3300048921 Bacteria 2674
777 Ga0496118_0090666 3300048921 Bacteria 2105
778 Ga0496118_0154936 3300048921 Bacteria 1427
779 Ga0496119_0006376 3300048922 Bacteria 10964
780 Ga0496119_0038888 3300048922 Bacteria 3066
781 Ga0496119_0072987 3300048922 Bacteria 2003
782 Ga0496121_0000203 3300048924 Bacteria 130984
783 Ga0496121_0000270 3300048924 Bacteria 108787
784 Ga0496121_0001251 3300048924 Bacteria 44033
785 Ga0496121_0002323 3300048924 Bacteria 29460
786 Ga0496121_0015121 3300048924 Bacteria 8119
787 Ga0496121_0042502 3300048924 Bacteria 3951
788 Ga0496121_0045389 3300048924 Bacteria 3777
789 Ga0496121_0130068 3300048924 Bacteria 1886
790 Ga0496121_0133412 3300048924 Bacteria 1854
791 Ga0496121_0171645 3300048924 Bacteria 1574
792 Ga0496121_0267653 3300048924 Bacteria 1176
793 Ga0496122_0032788 3300048925 Bacteria 4287
794 Ga0496122_0052331 3300048925 Bacteria 3092
795 Ga0496123_0010648 3300048926 Bacteria 8093
796 Ga0496123_0101514 3300048926 Bacteria 1672
797 Ga0496124_0011952 3300048927 Bacteria 8637
798 Ga0496124_0048269 3300048927 Bacteria 3639
799 Ga0496124_0070552 3300048927 Bacteria 2898
800 Ga0496124_0114620 3300048927 Bacteria 2164
801 Ga0496125_0000328 3300048928 Bacteria 91806
802 Ga0496125_0000407 3300048928 Bacteria 80570
803 Ga0496125_0003549 3300048928 Bacteria 18787
804 Ga0496125_0024628 3300048928 Bacteria 5529
805 Ga0496125_0043717 3300048928 Bacteria 3797
806 Ga0496125_0059052 3300048928 Bacteria 3093
807 Ga0496125_0070315 3300048928 Bacteria 2741
808 Ga0496125_0087175 3300048928 Bacteria 2358
809 Ga0496126_0010158 3300048929 Bacteria 9910
810 Ga0496126_0016646 3300048929 Bacteria 7347
811 Ga0496126_0025084 3300048929 Bacteria 5744
812 Ga0496126_0027806 3300048929 Bacteria 5395
813 Ga0496126_0035866 3300048929 Bacteria 4642
814 Ga0496126_0065855 3300048929 Bacteria 3240
815 Ga0496126_0086523 3300048929 Bacteria 2762
816 Ga0496126_0088126 3300048929 Bacteria 2735
817 Ga0496126_0142503 3300048929 Bacteria 2061
818 Ga0496126_0174331 3300048929 Bacteria 1830
819 Ga0496126_0208070 3300048929 Bacteria 1648
820 Ga0496126_0286373 3300048929 Bacteria 1363
821 Ga0495682_0011296 3300049460 Bacteria 3437
822 Ga0495682_0055980 3300049460 Bacteria 1430
823 Ga0501031_0012366 3300049568 Bacteria 5566
824 Ga0501031_0142806 3300049568 Bacteria 1565
825 Ga0501032_0000475 3300049569 Bacteria 32423
826 Ga0501032_0042704 3300049569 Bacteria 3074
827 Ga0501033_0000440 3300049570 Bacteria 39822
828 Ga0501033_0001499 3300049570 Bacteria 20673
829 Ga0501033_0012762 3300049570 Bacteria 6406
830 Ga0501033_0117807 3300049570 Bacteria 1929
831 Ga0501033_0119051 3300049570 Bacteria 1917
832 Ga0501033_0345629 3300049570 Bacteria 1042
833 Ga0501034_0000250 3300049571 Bacteria 99407
834 Ga0501034_0028177 3300049571 Bacteria 5714
835 Ga0501036_0000098 3300049572 Bacteria 54252
836 Ga0501036_0044460 3300049572 Bacteria 3762
837 Ga0501036_0061519 3300049572 Bacteria 3180
838 Ga0501036_0115578 3300049572 Bacteria 2266
839 Ga0501036_0150293 3300049572 Bacteria 1964
840 Ga0501037_0000092 3300049573 Bacteria 83924
841 Ga0501037_0016024 3300049573 Bacteria 5515
842 Ga0501037_0105558 3300049573 Bacteria 2030
843 Ga0501037_0106892 3300049573 Bacteria 2016
844 Ga0501038_0000059 3300049574 Bacteria 92319
845 Ga0501038_0000626 3300049574 Bacteria 31388
846 Ga0501038_0042710 3300049574 Bacteria 3947
847 Ga0501038_0199908 3300049574 Bacteria 1604
848 Ga0501039_0000085 3300049575 Bacteria 70306
849 Ga0501039_0021665 3300049575 Bacteria 4930
850 Ga0501039_0137111 3300049575 Bacteria 1921
851 Ga0501039_0142154 3300049575 Bacteria 1885
852 Ga0501042_0035371 3300049578 Bacteria 3543
853 Ga0501042_0060507 3300049578 Bacteria 2705
854 Ga0501043_0011678 3300049579 Bacteria 6875
855 Ga0501043_0289790 3300049579 Bacteria 1253
856 Ga0501043_0313691 3300049579 Bacteria 1196
857 Ga0501046_0000483 3300049580 Bacteria 39806
858 Ga0501046_0013048 3300049580 Bacteria 7052
859 Ga0501046_0028766 3300049580 Bacteria 4523
860 Ga0501046_0050241 3300049580 Bacteria 3295
861 Ga0501046_0235227 3300049580 Bacteria 1352
862 Ga0501047_0000022 3300049581 Bacteria 249062
863 Ga0501047_0010976 3300049581 Bacteria 8572
864 Ga0501047_0020141 3300049581 Bacteria 6404
865 Ga0501047_0142285 3300049581 Bacteria 2276
866 Ga0501047_0244182 3300049581 Bacteria 1645
867 Ga0501047_0428330 3300049581 Bacteria 1154
868 Ga0501048_0002266 3300049582 Bacteria 14670
869 Ga0501067_0000599 3300049583 Bacteria 19412
870 Ga0501067_0114243 3300049583 Bacteria 1501
871 Ga0501068_0004667 3300049584 Bacteria 7459
872 Ga0501068_0056869 3300049584 Bacteria 2371
873 Ga0501068_0065838 3300049584 Bacteria 2206
874 Ga0501069_0055162 3300049585 Bacteria 2213
875 Ga0501070_0006653 3300049586 Bacteria 9842
876 Ga0501070_0062656 3300049586 Bacteria 3080
877 Ga0501070_0180468 3300049586 Bacteria 1737
878 Ga0501071_0039494 3300049587 Bacteria 3377
879 Ga0501071_0073681 3300049587 Bacteria 2491
880 Ga0501072_0001923 3300049588 Bacteria 15457
881 Ga0501072_0226059 3300049588 Bacteria 1491
882 Ga0501073_0000109 3300049589 Bacteria 53094
883 Ga0501073_0056097 3300049589 Bacteria 2756
884 Ga0501073_0104808 3300049589 Bacteria 1962
885 Ga0501074_0036614 3300049590 Bacteria 3554
886 Ga0501074_0100957 3300049590 Bacteria 2065
887 Ga0501076_0021057 3300049592 Bacteria 4997
888 Ga0501077_0060991 3300049593 Bacteria 2393
889 Ga0501079_0002132 3300049741 Bacteria 14228
890 Ga0501079_0091330 3300049741 Bacteria 2359
891 Ga0501080_0005186 3300049742 Bacteria 11611
892 Ga0501080_0031118 3300049742 Bacteria 4972
893 Ga0501080_0181287 3300049742 Bacteria 1937
894 Ga0501080_0186541 3300049742 Bacteria 1907
895 Ga0501083_0001424 3300049744 Bacteria 16301
896 Ga0501035_0001471 3300049822 Bacteria 24145
897 Ga0501035_0035988 3300049822 Bacteria 4490
898 Ga0501035_0082774 3300049822 Bacteria 2832
899 Ga0501044_0000072 3300049823 Bacteria 124143
900 Ga0501044_0001765 3300049823 Bacteria 25275
901 Ga0501044_0009154 3300049823 Bacteria 10815
902 Ga0501044_0547336 3300049823 Bacteria 1055
903 Ga0501045_0370770 3300049824 Bacteria 1065
904 nmdc:mga03n38_4895_c1 3300050490 Bacteria 4491
905 nmdc:mga00v17_162020_c1 3300050491 Bacteria 1440
906 nmdc:mga00v17_55279_c1 3300050491 Bacteria 2424
907 nmdc:mga0yw44_208929_c1 3300050492 Bacteria 1291
908 nmdc:mga0yw44_47348_c1 3300050492 Bacteria 2588
909 nmdc:mga0yw44_83620_c1 3300050492 Bacteria 2005
910 nmdc:mga0k408_58486_c1 3300050493 Bacteria 2239
911 nmdc:mga06z11_120949_c1 3300050494 Bacteria 1461
912 nmdc:mga06z11_255013_c1 3300050494 Bacteria 1034
913 nmdc:mga04h51_4727_c1 3300050495 Bacteria 3414
914 nmdc:mga07m45_112215_c1 3300050496 Bacteria 1571
915 nmdc:mga07m45_113485_c1 3300050496 Bacteria 1562
916 nmdc:mga07m45_226957_c1 3300050496 Bacteria 1087
917 nmdc:mga09592_221455_c1 3300050508 Bacteria 1639
918 nmdc:mga06r32_33397_c1 3300050510 Bacteria 4845
919 nmdc:mga0rr50_314731_c1 3300050513 Bacteria 1311
920 nmdc:mga0a205_223274_c1 3300050515 Bacteria 1769
921 nmdc:mga0sz30_40195_c1 3300050516 Bacteria 1966
922 Ga0495601_0049218 3300053077 Bacteria 2657
923 Ga0495601_0086261 3300053077 Bacteria 2017
924 Ga0495601_0233021 3300053077 Bacteria 1202
925 Ga0500635_0048938 3300053080 Bacteria 1441
926 Ga0500635_0055968 3300053080 Bacteria 1363
927 Ga0495655_0003764 3300053083 Bacteria 2534
928 Ga0495655_0012771 3300053083 Bacteria 1720
929 Ga0495595_0000445 3300053084 Bacteria 15683
930 Ga0495595_0005883 3300053084 Bacteria 4973
931 Ga0495619_0000330 3300053085 Bacteria 33168
932 Ga0500578_0079113 3300053086 Bacteria 2092
933 Ga0500578_0118280 3300053086 Bacteria 1667
934 Ga0500643_000063 3300053087 Bacteria 122135
935 Ga0500643_034093 3300053087 Bacteria 1535
936 Ga0500646_0000839 3300053090 Bacteria 8510
937 Ga0500651_0006769 3300053093 Bacteria 6639
938 Ga0500651_0006892 3300053093 Bacteria 6586
939 Ga0500651_0194034 3300053093 Bacteria 1201
940 Ga0500566_0000247 3300053094 Bacteria 28953
941 Ga0500566_0003076 3300053094 Bacteria 9969
942 Ga0500566_0005190 3300053094 Bacteria 7755
943 Ga0500566_0202460 3300053094 Bacteria 1001
944 Ga0500640_068405 3300053095 Bacteria 1527
945 Ga0500641_0035557 3300053096 Bacteria 1988
946 Ga0500554_003943 3300053102 Bacteria 3090
947 Ga0500556_0000006 3300053104 Bacteria 453982
948 Ga0500557_000037 3300053105 Bacteria 71114
949 Ga0500569_001553 3300053109 Bacteria 4357
950 Ga0500569_002673 3300053109 Bacteria 3551
951 Ga0500572_000191 3300053111 Bacteria 21667
952 Ga0500572_019537 3300053111 Bacteria 1770
953 Ga0500593_065397 3300053117 Bacteria 1590
954 Ga0500595_002654 3300053119 Bacteria 8699
955 Ga0500595_014785 3300053119 Bacteria 2950
956 Ga0500607_020092 3300053121 Bacteria 3774
957 Ga0500608_000959 3300053122 Bacteria 10339
958 Ga0500608_051127 3300053122 Bacteria 1985
959 Ga0500614_019160 3300053123 Bacteria 1565
960 Ga0500618_004575 3300053125 Bacteria 4370
961 Ga0500618_017251 3300053125 Bacteria 1798
962 Ga0500642_0000004 3300053130 Bacteria 433122
963 Ga0500642_0000062 3300053130 Bacteria 58970
964 Ga0500642_0011321 3300053130 Bacteria 3185
965 Ga0500642_0048371 3300053130 Bacteria 1867
966 Ga0500652_000555 3300053131 Bacteria 13010
967 Ga0500658_0074733 3300053134 Bacteria 1437
968 Ga0500658_0075077 3300053134 Bacteria 1434
969 Ga0500559_0000179 3300053136 Bacteria 50232
970 Ga0500559_0000398 3300053136 Bacteria 31511
971 Ga0500559_0042227 3300053136 Bacteria 1989
972 Ga0500559_0139060 3300053136 Bacteria 1136
973 Ga0500564_110823 3300053138 Bacteria 1204
974 Ga0500568_0000790 3300053139 Bacteria 22337
975 Ga0500573_0232028 3300053140 Bacteria 961
976 Ga0500577_0000399 3300053142 Bacteria 11105
977 Ga0500586_007140 3300053145 Bacteria 2960
978 Ga0500588_0031491 3300053146 Bacteria 1531
979 Ga0500603_001290 3300053150 Bacteria 5756
980 Ga0500603_007487 3300053150 Bacteria 2398
981 Ga0500604_0001375 3300053151 Bacteria 6785
982 Ga0500616_0000022 3300053153 Bacteria 460463
983 Ga0500616_0018659 3300053153 Bacteria 3919
984 Ga0500620_001178 3300053155 Bacteria 4665
985 Ga0500622_0015984 3300053156 Bacteria 4015
986 Ga0500622_0026331 3300053156 Bacteria 3071
987 Ga0500622_0044474 3300053156 Bacteria 2301
988 Ga0500630_065807 3300053159 Bacteria 1724
989 Ga0500639_013853 3300053163 Bacteria 4239
990 Ga0500639_022758 3300053163 Bacteria 3311
991 Ga0500636_0000349 3300053177 Bacteria 25486
992 Ga0500636_0060283 3300053177 Bacteria 2216
993 Ga0500637_0017723 3300053178 Bacteria 3817
994 Ga0500637_0215510 3300053178 Bacteria 1087
995 Ga0500570_018767 3300053724 Bacteria 3871
996 Ga0500625_024838 3300053729 Bacteria 2832
997 Ga0500596_004482 3300053735 Bacteria 2554
998 Ga0500596_007212 3300053735 Bacteria 1833
999 Ga0500601_000064 3300053737 Bacteria 22081
1000 Ga0501084_0185546 3300054114 Bacteria 1755
1001 Ga0500661_021525 3300055283 Bacteria 1144
1002 Ga0501082_0000028 3300060353 Bacteria 100580
1003 Ga0501082_0144134 3300060353 Bacteria 2067

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100088993 Ga0070674_1000889932 264
2 3300005364 Ga0070673_100084349 Ga0070673_1000843492 264
3 3300005843 Ga0068860_100136751 Ga0068860_1001367512 264
4 3300014326 Ga0157380_10127343 Ga0157380_101273432 264
5 3300026121 Ga0207683_10169315 Ga0207683_101693152 264
6 3300048904 Ga0496101_0230209 Ga0496101_0230209_95_1000 264
7 3300048909 Ga0496106_0126165 Ga0496106_0126165_89_994 264
8 3300049581 Ga0501047_0020141 Ga0501047_0020141_1135_2019 265
9 3300035695 Ga0373927_0036371 Ga0373927_0036371_15_830 268
10 3300037068 Ga0373925_0205586 Ga0373925_0205586_14_829 268
11 3300044735 Ga0466968_0100658 Ga0466968_0100658_296_1186 268
12 3300045049 Ga0466959_0240101 Ga0466959_0240101_242_1132 268
13 3300005530 Ga0070679_100120755 Ga0070679_1001207551 270
14 3300025290 Ga0207673_1005554 Ga0207673_10055541 270
15 3300048910 Ga0496107_0265433 Ga0496107_0265433_298_1122 273
16 3300048913 Ga0496110_0197580 Ga0496110_0197580_797_1621 273
17 3300050508 nmdc:mga09592_221455_c1 nmdc:mga09592_221455_c1_543_1367 273
18 3300050510 nmdc:mga06r32_33397_c1 nmdc:mga06r32_33397_c1_988_1812 273
19 3300050515 nmdc:mga0a205_223274_c1 nmdc:mga0a205_223274_c1_482_1306 273
20 3300037853 Ga0436364_0709114 Ga0436364_0709114_182_1099 274
21 3300048907 Ga0496104_0003037 Ga0496104_0003037_3917_4807 276
22 3300048911 Ga0496108_0372747 Ga0496108_0372747_139_1029 276
23 3300048914 Ga0496111_0352694 Ga0496111_0352694_60_950 276
24 3300048917 Ga0496114_0306210 Ga0496114_0306210_195_1085 276
25 3300048918 Ga0496115_0140952 Ga0496115_0140952_364_1254 276
26 3300003659 JGI25404J52841_10007684 JGI25404J52841_100076841 278
27 3300005983 Ga0081540_1003875 Ga0081540_10038759 278
28 3300048912 Ga0496109_0011741 Ga0496109_0011741_5631_6476 279
29 3300025272 Ga0209455_1002393 Ga0209455_10023933 282
30 3300048903 Ga0496100_0199871 Ga0496100_0199871_514_1404 282
31 3300048907 Ga0496104_0002280 Ga0496104_0002280_8771_9661 282
32 3300048908 Ga0496105_0027371 Ga0496105_0027371_2234_3124 282
33 3300048911 Ga0496108_0053230 Ga0496108_0053230_131_1021 282
34 3300048912 Ga0496109_0073871 Ga0496109_0073871_1858_2748 282
35 3300048918 Ga0496115_0100082 Ga0496115_0100082_567_1457 282
36 3300041413 Ga0439465_0013621 Ga0439465_0013621_131_1027 283
37 3300009147 Ga0114129_10721610 Ga0114129_107216101 284
38 3300048924 Ga0496121_0045389 Ga0496121_0045389_1055_1948 284
39 3300053119 Ga0500595_002654 Ga0500595_002654_6296_7183 284
40 3300005937 Ga0081455_10048211 Ga0081455_100482112 285
41 3300026067 Ga0207678_10096010 Ga0207678_100960103 285
42 3300006237 Ga0097621_100249243 Ga0097621_1002492432 287
43 3300026075 Ga0207708_10085681 Ga0207708_100856812 287
44 3300027671 Ga0209588_1073887 Ga0209588_10738871 287
45 3300005981 Ga0081538_10086299 Ga0081538_100862991 288
46 3300009545 Ga0105237_10637369 Ga0105237_106373691 288
47 3300035116 Ga0373945_0002529 Ga0373945_0002529_3400_4269 288
48 3300035170 Ga0373943_0083317 Ga0373943_0083317_462_1331 288
49 3300035171 Ga0373946_0104972 Ga0373946_0104972_16_885 288
50 3300037068 Ga0373925_0025981 Ga0373925_0025981_1156_2025 288
51 3300046472 Ga0495580_0090453 Ga0495580_0090453_845_1714 288
52 3300046473 Ga0495582_0042626 Ga0495582_0042626_1083_1952 288
53 3300046474 Ga0495605_0072307 Ga0495605_0072307_636_1505 288
54 3300046491 Ga0495584_0016366 Ga0495584_0016366_2677_3546 288
55 3300046492 Ga0495585_0027616 Ga0495585_0027616_331_1200 288
56 3300046523 Ga0495644_0031813 Ga0495644_0031813_937_1806 288
57 3300046537 Ga0495598_0005762 Ga0495598_0005762_226_1095 288
58 3300046558 Ga0495633_0006412 Ga0495633_0006412_520_1389 288
59 3300046683 Ga0495658_0114457 Ga0495658_0114457_600_1469 288
60 3300046689 Ga0495613_0025117 Ga0495613_0025117_1943_2812 288
61 3300046691 Ga0495670_0125248 Ga0495670_0125248_213_1082 288
62 3300047321 Ga0495676_0108612 Ga0495676_0108612_774_1643 288
63 iso_pu_bacteria 2508501128 2509152633 288
64 iso_pu_bacteria 2513237096 2513658813 288
65 iso_pu_bacteria 2513237137 2513860820 288
66 iso_pu_bacteria 2513237145 2513921077 288
67 iso_pu_bacteria 2517572143 2517888842 288
68 iso_pu_bacteria 2524023228 2524537054 288
69 iso_pu_bacteria 2643221651 2644290946 288
70 iso_pu_bacteria 2667528175 2671119944 288
71 iso_pu_bacteria 2721755755 2723841642 288
72 iso_pu_bacteria 2728368998 2728754989 288
73 iso_pu_bacteria 2791355197 2793072930 288
74 iso_pu_bacteria 2791355199 2793082750 288
75 iso_pu_bacteria 2885374607 2885382850 288
76 iso_pu_bacteria 2885383462 2885388844 288
77 iso_pu_bacteria 2893066018 2893067378 288
78 iso_pu_bacteria 2903748898 2903748955 288
79 iso_pu_bacteria 2904699407 2904708824 288
80 iso_pu_bacteria 2906610324 2906613874 288
81 iso_pu_bacteria 2906635258 2906642332 288
82 iso_pu_bacteria 2906660503 2906667360 288
83 iso_pu_bacteria 2908739725 2908747444 288
84 iso_pu_bacteria 2908756301 2908756587 288
85 iso_pu_bacteria 2922361189 2922364000 288
86 iso_pu_bacteria 2922386360 2922392566 288
87 iso_pu_bacteria 3005474847 3005475061 288
88 iso_pu_bacteria 8006933436 8006936235 288
89 iso_pu_bacteria 8006964411 8006969360 288
90 iso_pu_bacteria 8006973647 8006976180 288
91 iso_pu_bacteria 8056673599 8056675743 288
92 iso_pu_bacteria 8056681323 8056687394 288
93 iso_pu_bacteria 8056689827 8056690958 288
94 3300005329 Ga0070683_100013328 Ga0070683_1000133286 289
95 3300005436 Ga0070713_100010327 Ga0070713_1000103272 289
96 3300005530 Ga0070679_100044969 Ga0070679_1000449694 289
97 3300005535 Ga0070684_100024903 Ga0070684_1000249035 289
98 3300005546 Ga0070696_100109075 Ga0070696_1001090752 289
99 3300005983 Ga0081540_1005299 Ga0081540_10052998 289
100 3300005985 Ga0081539_10029435 Ga0081539_100294352 289
101 3300006163 Ga0070715_10019602 Ga0070715_100196022 289
102 3300006173 Ga0070716_100013388 Ga0070716_1000133883 289
103 3300006844 Ga0075428_100045101 Ga0075428_1000451012 289
104 3300006852 Ga0075433_10217483 Ga0075433_102174832 289
105 3300025905 Ga0207685_10016028 Ga0207685_100160282 289
106 3300025912 Ga0207707_10035006 Ga0207707_100350064 289
107 3300025913 Ga0207695_10254960 Ga0207695_102549602 289
108 3300025914 Ga0207671_10094158 Ga0207671_100941583 289
109 3300025915 Ga0207693_10035714 Ga0207693_100357144 289
110 3300025917 Ga0207660_10076914 Ga0207660_100769142 289
111 3300025928 Ga0207700_10093504 Ga0207700_100935042 289
112 3300025929 Ga0207664_10487302 Ga0207664_104873022 289
113 3300025939 Ga0207665_10004258 Ga0207665_100042584 289
114 3300025944 Ga0207661_10044403 Ga0207661_100444033 289
115 3300025949 Ga0207667_10281972 Ga0207667_102819722 289
116 3300046518 Ga0495631_0081283 Ga0495631_0081283_391_1284 289
117 3300049568 Ga0501031_0012366 Ga0501031_0012366_22_897 289
118 3300049569 Ga0501032_0000475 Ga0501032_0000475_13075_13950 289
119 3300049570 Ga0501033_0001499 Ga0501033_0001499_4233_5108 289
120 3300049571 Ga0501034_0000250 Ga0501034_0000250_43967_44842 289
121 3300049572 Ga0501036_0000098 Ga0501036_0000098_22711_23586 289
122 3300049573 Ga0501037_0000092 Ga0501037_0000092_50795_51670 289
123 3300049574 Ga0501038_0000059 Ga0501038_0000059_21831_22706 289
124 3300049575 Ga0501039_0000085 Ga0501039_0000085_52685_53560 289
125 3300049578 Ga0501042_0060507 Ga0501042_0060507_97_972 289
126 3300049580 Ga0501046_0000483 Ga0501046_0000483_28861_29736 289
127 3300049581 Ga0501047_0000022 Ga0501047_0000022_150000_150875 289
128 3300049582 Ga0501048_0002266 Ga0501048_0002266_5339_6214 289
129 3300049583 Ga0501067_0000599 Ga0501067_0000599_8432_9307 289
130 3300049584 Ga0501068_0004667 Ga0501068_0004667_1429_2304 289
131 3300049585 Ga0501069_0055162 Ga0501069_0055162_932_1807 289
132 3300049586 Ga0501070_0006653 Ga0501070_0006653_990_1865 289
133 3300049587 Ga0501071_0039494 Ga0501071_0039494_1023_1898 289
134 3300049588 Ga0501072_0001923 Ga0501072_0001923_843_1718 289
135 3300049589 Ga0501073_0000109 Ga0501073_0000109_49885_50760 289
136 3300049590 Ga0501074_0036614 Ga0501074_0036614_2601_3476 289
137 3300049741 Ga0501079_0002132 Ga0501079_0002132_10030_10905 289
138 3300049742 Ga0501080_0005186 Ga0501080_0005186_2695_3570 289
139 3300049744 Ga0501083_0001424 Ga0501083_0001424_6611_7486 289
140 3300049822 Ga0501035_0001471 Ga0501035_0001471_3790_4665 289
141 3300049823 Ga0501044_0000072 Ga0501044_0000072_36597_37472 289
142 3300049824 Ga0501045_0370770 Ga0501045_0370770_106_981 289
143 3300060353 Ga0501082_0144134 Ga0501082_0144134_228_1103 289
144 iso_pu_bacteria 2507262055 2507505246 289
145 iso_pu_bacteria 2508501009 2508539167 289
146 iso_pu_bacteria 2513237098 2513674587 289
147 iso_pu_bacteria 2513237101 2513695111 289
148 iso_pu_bacteria 2515154112 2515627442 289
149 iso_pu_bacteria 2524023210 2524467848 289
150 iso_pu_bacteria 2874590934 2874594445 289
151 iso_pu_bacteria 2874604998 2874608064 289
152 iso_pu_bacteria 2874645413 2874649818 289
153 iso_pu_bacteria 2876771140 2876773937 289
154 iso_pu_bacteria 2876818435 2876821817 289
155 iso_pu_bacteria 2879074833 2879078339 289
156 iso_pu_bacteria 2879110137 2879112171 289
157 iso_pu_bacteria 2879127579 2879130600 289
158 iso_pu_bacteria 2879142872 2879147123 289
159 iso_pu_bacteria 2889033259 2889035490 289
160 iso_pu_bacteria 2903768456 2903770760 289
161 iso_pu_bacteria 2935608549 2935615725 289
162 iso_pu_bacteria 2935648319 2935653641 289
163 iso_pu_bacteria 2935656913 2935662390 289
164 iso_pu_bacteria 2935769743 2935773042 289
165 iso_pu_bacteria 2935777560 2935782985 289
166 iso_pu_bacteria 2935785616 2935787969 289
167 iso_pu_bacteria 2935793552 2935796455 289
168 iso_pu_bacteria 2935819856 2935825477 289
169 iso_pu_bacteria 2935847175 2935853266 289
170 iso_pu_bacteria 2935908558 2935914739 289
171 iso_pu_bacteria 2935916978 2935918715 289
172 iso_pu_bacteria 2935926038 2935931568 289
173 iso_pu_bacteria 2935934488 2935940165 289
174 iso_pu_bacteria 2935942939 2935947488 289
175 iso_pu_bacteria 2935951376 2935956260 289
176 iso_pu_bacteria 2935967501 2935973053 289
177 iso_pu_bacteria 2935975950 2935980704 289
178 iso_pu_bacteria 2936011229 2936016692 289
179 iso_pu_bacteria 2936019824 2936025325 289
180 iso_pu_bacteria 2936028420 2936034167 289
181 iso_pu_bacteria 2936046547 2936052224 289
182 iso_pu_bacteria 2936055302 2936056315 289
183 iso_pu_bacteria 8006984368 8006990922 289
184 iso_pu_bacteria 8006994254 8006996511 289
185 iso_pu_bacteria 8016522445 8016526139 289
186 iso_pu_bacteria 8016539877 8016544055 289
187 iso_pu_bacteria 8016557553 8016557677 289
188 iso_pu_bacteria 8016566248 8016569460 289
189 iso_pu_bacteria 8016575299 8016582073 289
190 iso_pu_bacteria 8016595262 8016595710 289
191 iso_pu_bacteria 8016603502 8016606566 289
192 iso_pu_bacteria 8016613128 8016618468 289
193 iso_pu_bacteria 8016622563 8016623160 289
194 iso_pu_bacteria 8019530166 8019531027 289
195 iso_pu_bacteria 8019538911 8019540553 289
196 iso_pu_bacteria 8019547302 8019550174 289
197 iso_pu_bacteria 8019619141 8019622970 289
198 iso_pu_bacteria 8019629233 8019630136 289
199 iso_pu_bacteria 8019638758 8019640476 289
200 iso_pu_bacteria 8019659431 8019666970 289
201 iso_pu_bacteria 8019668869 8019676727 289
202 iso_pu_bacteria 8019678201 8019679263 289
203 iso_pu_bacteria 8019687851 8019696240 289
204 3300005439 Ga0070711_100474025 Ga0070711_1004740251 290
205 3300005563 Ga0068855_100274067 Ga0068855_1002740671 290
206 3300005617 Ga0068859_100184572 Ga0068859_1001845723 290
207 3300006038 Ga0075365_10318386 Ga0075365_103183862 290
208 3300006931 Ga0097620_100184562 Ga0097620_1001845623 290
209 3300013100 Ga0157373_10053256 Ga0157373_100532563 290
210 3300013308 Ga0157375_10410565 Ga0157375_104105651 290
211 3300014325 Ga0163163_10002009 Ga0163163_1000200914 290
212 3300025297 Ga0209758_1002493 Ga0209758_10024937 290
213 3300025915 Ga0207693_10354295 Ga0207693_103542951 290
214 3300025919 Ga0207657_10131985 Ga0207657_101319852 290
215 3300025942 Ga0207689_10039585 Ga0207689_100395854 290
216 3300035691 Ga0373931_0019569 Ga0373931_0019569_153_1031 290
217 3300037418 Ga0395900_0546461 Ga0395900_0546461_116_994 290
218 3300037466 Ga0395898_0079473 Ga0395898_0079473_275_1153 290
219 3300046507 Ga0495606_0000252 Ga0495606_0000252_72500_73378 290
220 3300046524 Ga0495648_0024325 Ga0495648_0024325_2883_3764 290
221 3300048905 Ga0496102_0542835 Ga0496102_0542835_15_893 290
222 3300048907 Ga0496104_0018994 Ga0496104_0018994_4183_5061 290
223 3300048909 Ga0496106_0264519 Ga0496106_0264519_467_1345 290
224 3300048910 Ga0496107_0171489 Ga0496107_0171489_713_1591 290
225 3300048910 Ga0496107_0244377 Ga0496107_0244377_90_980 290
226 3300048913 Ga0496110_0008119 Ga0496110_0008119_4812_5690 290
227 3300048914 Ga0496111_0010213 Ga0496111_0010213_4636_5514 290
228 3300048914 Ga0496111_0196353 Ga0496111_0196353_555_1433 290
229 3300048915 Ga0496112_0000020 Ga0496112_0000020_55591_56469 290
230 3300048915 Ga0496112_0032339 Ga0496112_0032339_1141_2019 290
231 3300048916 Ga0496113_0076548 Ga0496113_0076548_1422_2300 290
232 3300048918 Ga0496115_0087123 Ga0496115_0087123_1180_2058 290
233 3300048920 Ga0496117_0120237 Ga0496117_0120237_649_1527 290
234 3300048924 Ga0496121_0001251 Ga0496121_0001251_1566_2456 290
235 3300048924 Ga0496121_0002323 Ga0496121_0002323_1157_2035 290
236 3300048924 Ga0496121_0133412 Ga0496121_0133412_223_1110 290
237 3300048926 Ga0496123_0101514 Ga0496123_0101514_696_1583 290
238 3300048928 Ga0496125_0070315 Ga0496125_0070315_209_1096 290
239 3300048929 Ga0496126_0016646 Ga0496126_0016646_4076_4966 290
240 3300048929 Ga0496126_0174331 Ga0496126_0174331_223_1101 290
241 3300049568 Ga0501031_0142806 Ga0501031_0142806_288_1166 290
242 3300049570 Ga0501033_0117807 Ga0501033_0117807_433_1311 290
243 3300049570 Ga0501033_0119051 Ga0501033_0119051_705_1583 290
244 3300049570 Ga0501033_0345629 Ga0501033_0345629_112_990 290
245 3300049574 Ga0501038_0199908 Ga0501038_0199908_679_1557 290
246 3300049575 Ga0501039_0142154 Ga0501039_0142154_901_1779 290
247 3300049579 Ga0501043_0289790 Ga0501043_0289790_289_1167 290
248 3300049581 Ga0501047_0244182 Ga0501047_0244182_750_1628 290
249 3300049742 Ga0501080_0186541 Ga0501080_0186541_666_1544 290
250 3300050492 nmdc:mga0yw44_208929_c1 nmdc:mga0yw44_208929_c1_118_993 290
251 3300053093 Ga0500651_0006892 Ga0500651_0006892_3881_4759 290
252 3300053130 Ga0500642_0011321 Ga0500642_0011321_2002_2880 290
253 3300053156 Ga0500622_0015984 Ga0500622_0015984_232_1110 290
254 3300053177 Ga0500636_0060283 Ga0500636_0060283_759_1640 290
255 iso_pu_bacteria 2508501042 2508695485 290
256 iso_pu_bacteria 2511231028 2511400222 290
257 iso_pu_bacteria 2513237092 2513625345 290
258 iso_pu_bacteria 2513237094 2513644164 290
259 iso_pu_bacteria 2513237095 2513651516 290
260 iso_pu_bacteria 2513237102 2513705241 290
261 iso_pu_bacteria 2513237104 2513720304 290
262 iso_pu_bacteria 2513237139 2513873528 290
263 iso_pu_bacteria 2513237161 2514012485 290
264 iso_pu_bacteria 2517093001 2517107711 290
265 iso_pu_bacteria 2524023205 2524440890 290
266 iso_pu_bacteria 2528768022 2528852938 290
267 iso_pu_bacteria 2617270735 2617352398 290
268 iso_pu_bacteria 2617270741 2617373761 290
269 iso_pu_bacteria 2744054633 2745081688 290
270 iso_pu_bacteria 2791355196 2793062042 290
271 iso_pu_bacteria 2802429603 2805915612 290
272 iso_pu_bacteria 2816332527 2818237649 290
273 iso_pu_bacteria 2824600985 2824604584 290
274 iso_pu_bacteria 2824609381 2824612325 290
275 iso_pu_bacteria 2824617872 2824624500 290
276 iso_pu_bacteria 2824626560 2824633415 290
277 iso_pu_bacteria 2824635225 2824640288 290
278 iso_pu_bacteria 2824644064 2824647278 290
279 iso_pu_bacteria 2824653114 2824655190 290
280 iso_pu_bacteria 2824661429 2824667559 290
281 iso_pu_bacteria 2824671348 2824676625 290
282 iso_pu_bacteria 2824679649 2824684230 290
283 iso_pu_bacteria 2824687955 2824694701 290
284 iso_pu_bacteria 2824696289 2824704127 290
285 iso_pu_bacteria 2824704595 2824708929 290
286 iso_pu_bacteria 2824714736 2824717406 290
287 iso_pu_bacteria 2824723954 2824727631 290
288 iso_pu_bacteria 2824732956 2824737795 290
289 iso_pu_bacteria 2824746037 2824752227 290
290 iso_pu_bacteria 2824753945 2824759956 290
291 iso_pu_bacteria 2824763712 2824770390 290
292 iso_pu_bacteria 2824773399 2824775522 290
293 iso_pu_bacteria 2838122688 2838124513 290
294 iso_pu_bacteria 2841941048 2841945200 290
295 iso_pu_bacteria 2841949485 2841951981 290
296 iso_pu_bacteria 2841957949 2841965434 290
297 iso_pu_bacteria 2841966195 2841970623 290
298 iso_pu_bacteria 2841974524 2841979972 290
299 iso_pu_bacteria 2841983080 2841985152 290
300 iso_pu_bacteria 2842038055 2842043509 290
301 iso_pu_bacteria 2842045827 2842052501 290
302 iso_pu_bacteria 2844315083 2844315336 290
303 iso_pu_bacteria 2847930680 2847931073 290
304 iso_pu_bacteria 2847939898 2847942155 290
305 iso_pu_bacteria 2849076700 2849083035 290
306 iso_pu_bacteria 2857509624 2857511925 290
307 iso_pu_bacteria 2874612657 2874613436 290
308 iso_pu_bacteria 2874620515 2874624782 290
309 iso_pu_bacteria 2874628541 2874628795 290
310 iso_pu_bacteria 2876761206 2876768927 290
311 iso_pu_bacteria 2879083081 2879085907 290
312 iso_pu_bacteria 2879099564 2879106022 290
313 iso_pu_bacteria 2881364244 2881365317 290
314 iso_pu_bacteria 2881665667 2881668185 290
315 iso_pu_bacteria 2885366525 2885371028 290
316 iso_pu_bacteria 2885409591 2885411662 290
317 iso_pu_bacteria 2888378607 2888379593 290
318 iso_pu_bacteria 2888388044 2888390681 290
319 iso_pu_bacteria 2888419890 2888420306 290
320 iso_pu_bacteria 2903727486 2903732197 290
321 iso_pu_bacteria 2904666416 2904670263 290
322 iso_pu_bacteria 2904711408 2904713178 290
323 iso_pu_bacteria 2906602504 2906604274 290
324 iso_pu_bacteria 2906626472 2906628957 290
325 iso_pu_bacteria 2906643746 2906648178 290
326 iso_pu_bacteria 2908775508 2908776277 290
327 iso_pu_bacteria 2922368715 2922368936 290
328 iso_pu_bacteria 2922393267 2922394239 290
329 iso_pu_bacteria 2929615660 2929618601 290
330 iso_pu_bacteria 2929624759 2929628714 290
331 iso_pu_bacteria 2932784394 2932792923 290
332 iso_pu_bacteria 2932794094 2932794317 290
333 iso_pu_bacteria 2932801729 2932808089 290
334 iso_pu_bacteria 2932809354 2932812165 290
335 iso_pu_bacteria 2932818245 2932823155 290
336 iso_pu_bacteria 2932828146 2932836072 290
337 iso_pu_bacteria 2933577622 2933580687 290
338 iso_pu_bacteria 2935616580 2935618521 290
339 iso_pu_bacteria 2935638405 2935641078 290
340 iso_pu_bacteria 2935665750 2935669994 290
341 iso_pu_bacteria 2935675223 2935679156 290
342 iso_pu_bacteria 2935684952 2935690025 290
343 iso_pu_bacteria 2935694250 2935698544 290
344 iso_pu_bacteria 2935703347 2935711480 290
345 iso_pu_bacteria 2935713505 2935717544 290
346 iso_pu_bacteria 2935722832 2935723786 290
347 iso_pu_bacteria 2935732158 2935739995 290
348 iso_pu_bacteria 2935741537 2935749258 290
349 iso_pu_bacteria 2935750917 2935757379 290
350 iso_pu_bacteria 2935760218 2935763535 290
351 iso_pu_bacteria 2935801545 2935809958 290
352 iso_pu_bacteria 2935810662 2935816264 290
353 iso_pu_bacteria 2935827899 2935835657 290
354 iso_pu_bacteria 2935837841 2935844608 290
355 iso_pu_bacteria 2935855204 2935862946 290
356 iso_pu_bacteria 2935864058 2935866688 290
357 iso_pu_bacteria 2935873716 2935874995 290
358 iso_pu_bacteria 2935883170 2935890149 290
359 iso_pu_bacteria 2935959822 2935962636 290
360 iso_pu_bacteria 2935984226 2935985143 290
361 iso_pu_bacteria 2935992306 2935999729 290
362 iso_pu_bacteria 2936002035 2936010573 290
363 iso_pu_bacteria 2936037263 2936041269 290
364 iso_pu_bacteria 2940556831 2940563292 290
365 iso_pu_bacteria 2941531003 2941535514 290
366 iso_pu_bacteria 2941538514 2941543207 290
367 iso_pu_bacteria 3005483717 3005489070 290
368 iso_pu_bacteria 3005506211 3005509160 290
369 iso_pu_bacteria 3005594810 3005595050 290
370 iso_pu_bacteria 3005710791 3005710998 290
371 iso_pu_bacteria 3005718088 3005718303 290
372 iso_pu_bacteria 8006926726 8006927890 290
373 iso_pu_bacteria 8016511872 8016518182 290
374 iso_pu_bacteria 8016583857 8016586370 290
375 iso_pu_bacteria 8017057580 8017058465 290
376 iso_pu_bacteria 8019576017 8019577231 290
377 iso_pu_bacteria 8019586578 8019595311 290
378 iso_pu_bacteria 8019597564 8019606447 290
379 iso_pu_bacteria 8019648815 8019652470 290
380 iso_pu_bacteria 8055742211 8055742451 290
381 iso_pu_bacteria 8056967851 8056971288 290
382 3300005435 Ga0070714_100118625 Ga0070714_1001186252 291
383 3300005437 Ga0070710_10109270 Ga0070710_101092702 291
384 3300005439 Ga0070711_100019254 Ga0070711_1000192544 291
385 3300005548 Ga0070665_100028170 Ga0070665_1000281704 291
386 3300005614 Ga0068856_100005093 Ga0068856_1000050939 291
387 3300005937 Ga0081455_10010204 Ga0081455_100102048 291
388 3300006028 Ga0070717_10088445 Ga0070717_100884452 291
389 3300013104 Ga0157370_10402729 Ga0157370_104027291 291
390 3300013297 Ga0157378_10743896 Ga0157378_107438961 291
391 3300021358 Ga0213873_10024285 Ga0213873_100242852 291
392 3300021384 Ga0213876_10002439 Ga0213876_100024393 291
393 3300025906 Ga0207699_10007202 Ga0207699_100072023 291
394 3300025916 Ga0207663_10083697 Ga0207663_100836972 291
395 3300025929 Ga0207664_10103518 Ga0207664_101035182 291
396 3300025981 Ga0207640_10047734 Ga0207640_100477342 291
397 3300026078 Ga0207702_10001701 Ga0207702_1000170121 291
398 3300028379 Ga0268266_10045729 Ga0268266_100457293 291
399 3300031456 Ga0307513_10222288 Ga0307513_102222881 291
400 3300031711 Ga0265314_10005687 Ga0265314_100056874 291
401 3300039437 Ga0436365_0803057 Ga0436365_0803057_2335_3219 291
402 3300044684 Ga0466966_0034959 Ga0466966_0034959_588_1463 291
403 3300044735 Ga0466968_0021266 Ga0466968_0021266_578_1453 291
404 3300046462 Ga0495651_0095034 Ga0495651_0095034_82_963 291
405 3300046559 Ga0495667_0033150 Ga0495667_0033150_1048_1929 291
406 3300046675 Ga0495657_0042749 Ga0495657_0042749_1160_2041 291
407 3300047322 Ga0495680_0231698 Ga0495680_0231698_269_1144 291
408 3300048907 Ga0496104_0030135 Ga0496104_0030135_544_1422 291
409 3300048909 Ga0496106_0000236 Ga0496106_0000236_28909_29787 291
410 3300048910 Ga0496107_0003292 Ga0496107_0003292_134_1012 291
411 3300048911 Ga0496108_0000849 Ga0496108_0000849_17754_18632 291
412 3300048912 Ga0496109_0000224 Ga0496109_0000224_19538_20416 291
413 3300048913 Ga0496110_0004203 Ga0496110_0004203_7835_8713 291
414 3300048915 Ga0496112_0001044 Ga0496112_0001044_4695_5573 291
415 3300048916 Ga0496113_0006740 Ga0496113_0006740_5616_6494 291
416 3300048927 Ga0496124_0070552 Ga0496124_0070552_550_1440 291
417 3300048929 Ga0496126_0025084 Ga0496126_0025084_2506_3387 291
418 3300049570 Ga0501033_0000440 Ga0501033_0000440_23895_24776 291
419 3300049570 Ga0501033_0012762 Ga0501033_0012762_1613_2494 291
420 3300049571 Ga0501034_0028177 Ga0501034_0028177_4192_5073 291
421 3300049572 Ga0501036_0044460 Ga0501036_0044460_1091_1972 291
422 3300049572 Ga0501036_0115578 Ga0501036_0115578_819_1700 291
423 3300049572 Ga0501036_0150293 Ga0501036_0150293_471_1352 291
424 3300049573 Ga0501037_0016024 Ga0501037_0016024_4334_5215 291
425 3300049573 Ga0501037_0106892 Ga0501037_0106892_1037_1918 291
426 3300049574 Ga0501038_0042710 Ga0501038_0042710_1119_2000 291
427 3300049575 Ga0501039_0137111 Ga0501039_0137111_206_1087 291
428 3300049578 Ga0501042_0035371 Ga0501042_0035371_60_941 291
429 3300049579 Ga0501043_0313691 Ga0501043_0313691_226_1107 291
430 3300049580 Ga0501046_0013048 Ga0501046_0013048_4354_5235 291
431 3300049580 Ga0501046_0050241 Ga0501046_0050241_1471_2355 291
432 3300049580 Ga0501046_0235227 Ga0501046_0235227_84_965 291
433 3300049583 Ga0501067_0114243 Ga0501067_0114243_537_1418 291
434 3300049584 Ga0501068_0056869 Ga0501068_0056869_237_1118 291
435 3300049584 Ga0501068_0065838 Ga0501068_0065838_592_1473 291
436 3300049586 Ga0501070_0180468 Ga0501070_0180468_492_1373 291
437 3300049587 Ga0501071_0073681 Ga0501071_0073681_278_1159 291
438 3300049588 Ga0501072_0226059 Ga0501072_0226059_490_1371 291
439 3300049589 Ga0501073_0056097 Ga0501073_0056097_1077_1958 291
440 3300049589 Ga0501073_0104808 Ga0501073_0104808_599_1480 291
441 3300049592 Ga0501076_0021057 Ga0501076_0021057_2598_3479 291
442 3300049593 Ga0501077_0060991 Ga0501077_0060991_496_1377 291
443 3300049741 Ga0501079_0091330 Ga0501079_0091330_1219_2100 291
444 3300049742 Ga0501080_0181287 Ga0501080_0181287_973_1854 291
445 3300049822 Ga0501035_0035988 Ga0501035_0035988_316_1197 291
446 3300049822 Ga0501035_0082774 Ga0501035_0082774_1601_2482 291
447 3300049823 Ga0501044_0001765 Ga0501044_0001765_9634_10515 291
448 3300049823 Ga0501044_0547336 Ga0501044_0547336_135_1019 291
449 3300053093 Ga0500651_0194034 Ga0500651_0194034_45_932 291
450 3300053111 Ga0500572_000191 Ga0500572_000191_1816_2700 291
451 3300053119 Ga0500595_014785 Ga0500595_014785_97_978 291
452 3300053130 Ga0500642_0048371 Ga0500642_0048371_745_1635 291
453 3300053136 Ga0500559_0000179 Ga0500559_0000179_45627_46511 291
454 3300053163 Ga0500639_022758 Ga0500639_022758_1402_2286 291
455 3300053735 Ga0500596_004482 Ga0500596_004482_590_1474 291
456 3300054114 Ga0501084_0185546 Ga0501084_0185546_542_1423 291
457 3300001990 JGI24737J22298_10024439 JGI24737J22298_100244392 292
458 3300002067 JGI24735J21928_10009808 JGI24735J21928_100098083 292
459 3300005338 Ga0068868_100016797 Ga0068868_1000167974 292
460 3300005434 Ga0070709_10000584 Ga0070709_100005841 292
461 3300005436 Ga0070713_100157380 Ga0070713_1001573802 292
462 3300005437 Ga0070710_10002351 Ga0070710_100023512 292
463 3300005439 Ga0070711_100022461 Ga0070711_1000224614 292
464 3300005455 Ga0070663_100062897 Ga0070663_1000628972 292
465 3300005456 Ga0070678_100015808 Ga0070678_1000158085 292
466 3300005536 Ga0070697_100289134 Ga0070697_1002891343 292
467 3300005539 Ga0068853_100086417 Ga0068853_1000864171 292
468 3300005548 Ga0070665_100099215 Ga0070665_1000992152 292
469 3300005563 Ga0068855_100015846 Ga0068855_1000158462 292
470 3300005564 Ga0070664_100189725 Ga0070664_1001897252 292
471 3300005577 Ga0068857_100576858 Ga0068857_1005768582 292
472 3300005578 Ga0068854_100222019 Ga0068854_1002220192 292
473 3300005578 Ga0068854_100318805 Ga0068854_1003188052 292
474 3300005614 Ga0068856_100012875 Ga0068856_1000128754 292
475 3300005616 Ga0068852_100341968 Ga0068852_1003419682 292
476 3300005618 Ga0068864_100026520 Ga0068864_1000265204 292
477 3300005834 Ga0068851_10030239 Ga0068851_100302391 292
478 3300005842 Ga0068858_100033778 Ga0068858_1000337784 292
479 3300005842 Ga0068858_100094168 Ga0068858_1000941682 292
480 3300005842 Ga0068858_100394178 Ga0068858_1003941782 292
481 3300005843 Ga0068860_100001450 Ga0068860_10000145023 292
482 3300006028 Ga0070717_10006989 Ga0070717_100069894 292
483 3300006358 Ga0068871_100330798 Ga0068871_1003307982 292
484 3300006881 Ga0068865_100349271 Ga0068865_1003492712 292
485 3300006914 Ga0075436_100397440 Ga0075436_1003974402 292
486 3300007788 Ga0099795_10064146 Ga0099795_100641461 292
487 3300009093 Ga0105240_10008228 Ga0105240_1000822813 292
488 3300009101 Ga0105247_10010882 Ga0105247_100108822 292
489 3300009551 Ga0105238_10015713 Ga0105238_100157136 292
490 3300009551 Ga0105238_10050367 Ga0105238_100503672 292
491 3300009551 Ga0105238_10074317 Ga0105238_100743173 292
492 3300010375 Ga0105239_10024695 Ga0105239_100246954 292
493 3300010375 Ga0105239_10064493 Ga0105239_100644934 292
494 3300010375 Ga0105239_10199644 Ga0105239_101996442 292
495 3300010375 Ga0105239_10211410 Ga0105239_102114102 292
496 3300010375 Ga0105239_10279826 Ga0105239_102798262 292
497 3300011119 Ga0105246_10081781 Ga0105246_100817812 292
498 3300013104 Ga0157370_10129027 Ga0157370_101290272 292
499 3300013296 Ga0157374_10228057 Ga0157374_102280571 292
500 3300013307 Ga0157372_10271108 Ga0157372_102711082 292
501 3300013308 Ga0157375_10028391 Ga0157375_100283914 292
502 3300014325 Ga0163163_10033178 Ga0163163_100331784 292
503 3300014497 Ga0182008_10159463 Ga0182008_101594632 292
504 3300014968 Ga0157379_10179402 Ga0157379_101794022 292
505 3300014969 Ga0157376_10010998 Ga0157376_100109984 292
506 3300025898 Ga0207692_10012905 Ga0207692_100129052 292
507 3300025904 Ga0207647_10168847 Ga0207647_101688471 292
508 3300025906 Ga0207699_10038283 Ga0207699_100382832 292
509 3300025906 Ga0207699_10323155 Ga0207699_103231551 292
510 3300025907 Ga0207645_10179478 Ga0207645_101794781 292
511 3300025910 Ga0207684_10077500 Ga0207684_100775002 292
512 3300025915 Ga0207693_10181848 Ga0207693_101818482 292
513 3300025916 Ga0207663_10016715 Ga0207663_100167152 292
514 3300025920 Ga0207649_10410030 Ga0207649_104100301 292
515 3300025924 Ga0207694_10274993 Ga0207694_102749931 292
516 3300025927 Ga0207687_10004089 Ga0207687_100040892 292
517 3300025928 Ga0207700_10117026 Ga0207700_101170262 292
518 3300025929 Ga0207664_10061778 Ga0207664_100617783 292
519 3300025929 Ga0207664_10588483 Ga0207664_105884831 292
520 3300025939 Ga0207665_10061076 Ga0207665_100610763 292
521 3300025939 Ga0207665_10085508 Ga0207665_100855082 292
522 3300025940 Ga0207691_10172053 Ga0207691_101720532 292
523 3300025940 Ga0207691_10441320 Ga0207691_104413201 292
524 3300025941 Ga0207711_10211107 Ga0207711_102111071 292
525 3300025944 Ga0207661_10073930 Ga0207661_100739302 292
526 3300025949 Ga0207667_10088774 Ga0207667_100887744 292
527 3300026023 Ga0207677_10024413 Ga0207677_100244132 292
528 3300026035 Ga0207703_10078340 Ga0207703_100783402 292
529 3300026035 Ga0207703_10281990 Ga0207703_102819903 292
530 3300026041 Ga0207639_10123004 Ga0207639_101230042 292
531 3300026067 Ga0207678_10003936 Ga0207678_1000393612 292
532 3300026088 Ga0207641_10327266 Ga0207641_103272662 292
533 3300026089 Ga0207648_10238899 Ga0207648_102388992 292
534 3300026095 Ga0207676_10095612 Ga0207676_100956123 292
535 3300026116 Ga0207674_10000890 Ga0207674_100008902 292
536 3300026121 Ga0207683_10016524 Ga0207683_100165245 292
537 3300027357 Ga0209589_1000021 Ga0209589_1000021120 292
538 3300027361 Ga0209489_100028 Ga0209489_100028120 292
539 3300027363 Ga0209700_100037 Ga0209700_100037120 292
540 3300028379 Ga0268266_10199057 Ga0268266_101990572 292
541 3300028381 Ga0268264_10000062 Ga0268264_1000006218 292
542 3300028556 Ga0265337_1018782 Ga0265337_10187822 292
543 3300028558 Ga0265326_10008390 Ga0265326_100083903 292
544 3300028563 Ga0265319_1012969 Ga0265319_10129692 292
545 3300028573 Ga0265334_10013964 Ga0265334_100139643 292
546 3300028577 Ga0265318_10016635 Ga0265318_100166352 292
547 3300028653 Ga0265323_10007956 Ga0265323_100079564 292
548 3300028666 Ga0265336_10000561 Ga0265336_100005617 292
549 3300028800 Ga0265338_10000598 Ga0265338_1000059831 292
550 3300031238 Ga0265332_10027603 Ga0265332_100276032 292
551 3300031247 Ga0265340_10041599 Ga0265340_100415992 292
552 3300031249 Ga0265339_10029701 Ga0265339_100297011 292
553 3300031250 Ga0265331_10100059 Ga0265331_101000592 292
554 3300031456 Ga0307513_10164506 Ga0307513_101645061 292
555 3300031548 Ga0307408_100239375 Ga0307408_1002393752 292
556 3300031616 Ga0307508_10000002 Ga0307508_1000000244 292
557 3300031616 Ga0307508_10078616 Ga0307508_100786162 292
558 3300031730 Ga0307516_10006094 Ga0307516_100060944 292
559 3300032126 Ga0307415_100362721 Ga0307415_1003627212 292
560 3300033442 Ga0315911_1000008 Ga0315911_1000008309 292
561 3300033544 Ga0316215_1002237 Ga0316215_10022372 292
562 3300035083 Ga0373926_0039711 Ga0373926_0039711_465_1343 292
563 3300035086 Ga0373934_0002932 Ga0373934_0002932_4387_5265 292
564 3300035089 Ga0373944_0042120 Ga0373944_0042120_223_1101 292
565 3300035111 Ga0373923_0009618 Ga0373923_0009618_1319_2200 292
566 3300035113 Ga0373936_0016692 Ga0373936_0016692_583_1464 292
567 3300035113 Ga0373936_0036388 Ga0373936_0036388_532_1410 292
568 3300035115 Ga0373941_0063086 Ga0373941_0063086_96_974 292
569 3300035116 Ga0373945_0019734 Ga0373945_0019734_367_1248 292
570 3300035117 Ga0373953_0000955 Ga0373953_0000955_876_1754 292
571 3300035117 Ga0373953_0034938 Ga0373953_0034938_112_990 292
572 3300035118 Ga0373954_0018760 Ga0373954_0018760_1178_2056 292
573 3300035118 Ga0373954_0018968 Ga0373954_0018968_2169_3047 292
574 3300035119 Ga0373956_0068497 Ga0373956_0068497_221_1099 292
575 3300035120 Ga0373957_0006831 Ga0373957_0006831_1352_2230 292
576 3300035170 Ga0373943_0002107 Ga0373943_0002107_2167_3048 292
577 3300035170 Ga0373943_0046258 Ga0373943_0046258_172_1050 292
578 3300035171 Ga0373946_0001889 Ga0373946_0001889_6190_7071 292
579 3300035172 Ga0373955_0005406 Ga0373955_0005406_3690_4568 292
580 3300035410 Ga0373924_0005676 Ga0373924_0005676_210_1088 292
581 3300035410 Ga0373924_0060733 Ga0373924_0060733_170_1051 292
582 3300035692 Ga0373935_0000557 Ga0373935_0000557_4257_5138 292
583 3300035692 Ga0373935_0308415 Ga0373935_0308415_165_1043 292
584 3300035692 Ga0373935_0443493 Ga0373935_0443493_31_909 292
585 3300035695 Ga0373927_0003654 Ga0373927_0003654_6338_7219 292
586 3300035695 Ga0373927_0010418 Ga0373927_0010418_1128_2006 292
587 3300035695 Ga0373927_0021960 Ga0373927_0021960_184_1062 292
588 3300035695 Ga0373927_0235046 Ga0373927_0235046_148_1026 292
589 3300035724 Ga0373933_0000031 Ga0373933_0000031_47925_48803 292
590 3300035724 Ga0373933_0003419 Ga0373933_0003419_6627_7505 292
591 3300035724 Ga0373933_0082944 Ga0373933_0082944_965_1843 292
592 3300035725 Ga0373947_0000509 Ga0373947_0000509_9060_9941 292
593 3300035725 Ga0373947_0049307 Ga0373947_0049307_208_1086 292
594 3300035725 Ga0373947_0346433 Ga0373947_0346433_40_918 292
595 3300036401 Ga0373937_0033982 Ga0373937_0033982_3080_3961 292
596 3300036401 Ga0373937_0284966 Ga0373937_0284966_629_1507 292
597 3300036401 Ga0373937_0380292 Ga0373937_0380292_210_1091 292
598 3300037068 Ga0373925_0001713 Ga0373925_0001713_4193_5074 292
599 3300037068 Ga0373925_0078993 Ga0373925_0078993_1302_2180 292
600 3300037068 Ga0373925_0110677 Ga0373925_0110677_1036_1914 292
601 3300037068 Ga0373925_0192510 Ga0373925_0192510_357_1235 292
602 3300037466 Ga0395898_0018463 Ga0395898_0018463_1015_1893 292
603 3300037471 Ga0395905_0023254 Ga0395905_0023254_617_1495 292
604 3300038443 Ga0395901_0224667 Ga0395901_0224667_324_1202 292
605 3300039437 Ga0436365_0966323 Ga0436365_0966323_935_1828 292
606 3300039437 Ga0436365_1369931 Ga0436365_1369931_67_957 292
607 3300045976 Ga0466967_0004006 Ga0466967_0004006_5304_6182 292
608 3300045976 Ga0466967_0088324 Ga0466967_0088324_1444_2337 292
609 3300046454 Ga0495592_0058216 Ga0495592_0058216_643_1521 292
610 3300046454 Ga0495592_0140768 Ga0495592_0140768_464_1342 292
611 3300046454 Ga0495592_0300267 Ga0495592_0300267_43_927 292
612 3300046455 Ga0495603_0000047 Ga0495603_0000047_36840_37721 292
613 3300046455 Ga0495603_0055753 Ga0495603_0055753_220_1098 292
614 3300046459 Ga0495629_0000320 Ga0495629_0000320_36815_37696 292
615 3300046459 Ga0495629_0231283 Ga0495629_0231283_201_1079 292
616 3300046461 Ga0495641_0009584 Ga0495641_0009584_4709_5590 292
617 3300046462 Ga0495651_0041190 Ga0495651_0041190_1053_1931 292
618 3300046463 Ga0495653_0003027 Ga0495653_0003027_10979_11857 292
619 3300046463 Ga0495653_0070906 Ga0495653_0070906_1700_2578 292
620 3300046473 Ga0495582_0000043 Ga0495582_0000043_38688_39569 292
621 3300046473 Ga0495582_0024699 Ga0495582_0024699_557_1435 292
622 3300046473 Ga0495582_0032646 Ga0495582_0032646_142_1020 292
623 3300046475 Ga0495639_0000091 Ga0495639_0000091_14288_15169 292
624 3300046476 Ga0495662_0000128 Ga0495662_0000128_13265_14146 292
625 3300046477 Ga0495664_0053492 Ga0495664_0053492_915_1793 292
626 3300046499 Ga0495594_0002035 Ga0495594_0002035_3514_4395 292
627 3300046507 Ga0495606_0194800 Ga0495606_0194800_40_918 292
628 3300046514 Ga0495618_0010884 Ga0495618_0010884_670_1548 292
629 3300046516 Ga0495628_0108009 Ga0495628_0108009_1113_1994 292
630 3300046516 Ga0495628_0261808 Ga0495628_0261808_248_1126 292
631 3300046517 Ga0495630_0014946 Ga0495630_0014946_4715_5596 292
632 3300046526 Ga0495666_0015987 Ga0495666_0015987_1700_2581 292
633 3300046529 Ga0495652_0011857 Ga0495652_0011857_5950_6828 292
634 3300046531 Ga0495665_0000051 Ga0495665_0000051_38746_39627 292
635 3300046533 Ga0495640_0007555 Ga0495640_0007555_2967_3848 292
636 3300046533 Ga0495640_0074727 Ga0495640_0074727_498_1376 292
637 3300046535 Ga0495586_0047218 Ga0495586_0047218_616_1494 292
638 3300046536 Ga0495587_0008144 Ga0495587_0008144_1173_2051 292
639 3300046536 Ga0495587_0029650 Ga0495587_0029650_625_1503 292
640 3300046543 Ga0495645_0021133 Ga0495645_0021133_2378_3256 292
641 3300046543 Ga0495645_0102551 Ga0495645_0102551_1080_1958 292
642 3300046557 Ga0495622_0015099 Ga0495622_0015099_75_956 292
643 3300046557 Ga0495622_0021698 Ga0495622_0021698_1992_2882 292
644 3300046559 Ga0495667_0004751 Ga0495667_0004751_3692_4570 292
645 3300046559 Ga0495667_0175879 Ga0495667_0175879_101_979 292
646 3300046559 Ga0495667_0188219 Ga0495667_0188219_106_984 292
647 3300046642 Ga0495634_0000400 Ga0495634_0000400_33935_34816 292
648 3300046642 Ga0495634_0021637 Ga0495634_0021637_2799_3677 292
649 3300046642 Ga0495634_0076053 Ga0495634_0076053_1297_2175 292
650 3300046663 Ga0495635_0000620 Ga0495635_0000620_20428_21309 292
651 3300046663 Ga0495635_0002202 Ga0495635_0002202_4615_5493 292
652 3300046675 Ga0495657_0013678 Ga0495657_0013678_482_1360 292
653 3300046678 Ga0495599_0009906 Ga0495599_0009906_771_1649 292
654 3300046678 Ga0495599_0069977 Ga0495599_0069977_314_1192 292
655 3300046679 Ga0495623_0037441 Ga0495623_0037441_1015_1893 292
656 3300046680 Ga0495646_0000643 Ga0495646_0000643_13946_14824 292
657 3300046680 Ga0495646_0043973 Ga0495646_0043973_1805_2686 292
658 3300046681 Ga0495647_0002769 Ga0495647_0002769_3293_4174 292
659 3300046683 Ga0495658_0000499 Ga0495658_0000499_14760_15641 292
660 3300046690 Ga0495624_0003704 Ga0495624_0003704_6120_7001 292
661 3300046690 Ga0495624_0096046 Ga0495624_0096046_830_1708 292
662 3300047315 Ga0495581_0000486 Ga0495581_0000486_217_1098 292
663 3300047315 Ga0495581_0061415 Ga0495581_0061415_1089_1967 292
664 3300047315 Ga0495581_0115928 Ga0495581_0115928_57_935 292
665 3300047317 Ga0495604_0031639 Ga0495604_0031639_1917_2795 292
666 3300047319 Ga0495674_0005428 Ga0495674_0005428_344_1222 292
667 3300047319 Ga0495674_0023537 Ga0495674_0023537_1688_2569 292
668 3300047319 Ga0495674_0131189 Ga0495674_0131189_371_1249 292
669 3300047320 Ga0495672_0022435 Ga0495672_0022435_1069_1950 292
670 3300047320 Ga0495672_0066467 Ga0495672_0066467_1119_1997 292
671 3300047320 Ga0495672_0081560 Ga0495672_0081560_44_922 292
672 3300047321 Ga0495676_0061706 Ga0495676_0061706_171_1052 292
673 3300047322 Ga0495680_0001909 Ga0495680_0001909_1051_1929 292
674 3300047322 Ga0495680_0040967 Ga0495680_0040967_2329_3207 292
675 3300047322 Ga0495680_0099424 Ga0495680_0099424_96_977 292
676 3300047444 Ga0495675_0103236 Ga0495675_0103236_610_1488 292
677 3300047471 Ga0495684_0000313 Ga0495684_0000313_15393_16271 292
678 3300047471 Ga0495684_0012322 Ga0495684_0012322_18_899 292
679 3300047471 Ga0495684_0103192 Ga0495684_0103192_690_1568 292
680 3300047471 Ga0495684_0206990 Ga0495684_0206990_501_1379 292
681 3300047673 Ga0495593_0000005 Ga0495593_0000005_2232_3113 292
682 3300047673 Ga0495593_0002672 Ga0495593_0002672_7398_8276 292
683 3300048088 Ga0495602_0118872 Ga0495602_0118872_482_1360 292
684 3300048089 Ga0495614_0006832 Ga0495614_0006832_3676_4557 292
685 3300048091 Ga0495626_0055731 Ga0495626_0055731_425_1315 292
686 3300048903 Ga0496100_0006321 Ga0496100_0006321_4263_5141 292
687 3300048903 Ga0496100_0331609 Ga0496100_0331609_68_955 292
688 3300048904 Ga0496101_0018505 Ga0496101_0018505_678_1556 292
689 3300048905 Ga0496102_0001314 Ga0496102_0001314_10001_10879 292
690 3300048905 Ga0496102_0554459 Ga0496102_0554459_97_975 292
691 3300048906 Ga0496103_0047615 Ga0496103_0047615_126_1004 292
692 3300048907 Ga0496104_0007367 Ga0496104_0007367_4581_5459 292
693 3300048908 Ga0496105_0003051 Ga0496105_0003051_9305_10183 292
694 3300048908 Ga0496105_0040662 Ga0496105_0040662_874_1752 292
695 3300048909 Ga0496106_0014089 Ga0496106_0014089_4615_5493 292
696 3300048910 Ga0496107_0091750 Ga0496107_0091750_522_1409 292
697 3300048910 Ga0496107_0110889 Ga0496107_0110889_271_1149 292
698 3300048911 Ga0496108_0016993 Ga0496108_0016993_1333_2211 292
699 3300048911 Ga0496108_0304768 Ga0496108_0304768_21_899 292
700 3300048911 Ga0496108_0360185 Ga0496108_0360185_117_995 292
701 3300048912 Ga0496109_0010749 Ga0496109_0010749_3672_4550 292
702 3300048912 Ga0496109_0148771 Ga0496109_0148771_45_932 292
703 3300048913 Ga0496110_0027437 Ga0496110_0027437_88_966 292
704 3300048913 Ga0496110_0056327 Ga0496110_0056327_56_934 292
705 3300048913 Ga0496110_0132154 Ga0496110_0132154_1101_1979 292
706 3300048914 Ga0496111_0008238 Ga0496111_0008238_1425_2303 292
707 3300048915 Ga0496112_0014481 Ga0496112_0014481_2418_3296 292
708 3300048915 Ga0496112_0128611 Ga0496112_0128611_272_1150 292
709 3300048915 Ga0496112_0218018 Ga0496112_0218018_93_971 292
710 3300048915 Ga0496112_0462284 Ga0496112_0462284_283_1161 292
711 3300048916 Ga0496113_0037992 Ga0496113_0037992_61_939 292
712 3300048916 Ga0496113_0059445 Ga0496113_0059445_965_1843 292
713 3300048917 Ga0496114_0009847 Ga0496114_0009847_4481_5359 292
714 3300048918 Ga0496115_0023846 Ga0496115_0023846_1634_2512 292
715 3300048918 Ga0496115_0087298 Ga0496115_0087298_810_1688 292
716 3300048918 Ga0496115_0372611 Ga0496115_0372611_34_912 292
717 3300048920 Ga0496117_0021089 Ga0496117_0021089_2928_3806 292
718 3300048920 Ga0496117_0153817 Ga0496117_0153817_363_1256 292
719 3300048921 Ga0496118_0003026 Ga0496118_0003026_5012_5890 292
720 3300048921 Ga0496118_0027995 Ga0496118_0027995_1842_2735 292
721 3300048922 Ga0496119_0038888 Ga0496119_0038888_253_1146 292
722 3300048924 Ga0496121_0000203 Ga0496121_0000203_126307_127185 292
723 3300048924 Ga0496121_0000270 Ga0496121_0000270_114_992 292
724 3300048924 Ga0496121_0042502 Ga0496121_0042502_1413_2306 292
725 3300048925 Ga0496122_0052331 Ga0496122_0052331_1880_2761 292
726 3300048927 Ga0496124_0011952 Ga0496124_0011952_3805_4683 292
727 3300048927 Ga0496124_0048269 Ga0496124_0048269_1028_1921 292
728 3300048928 Ga0496125_0000328 Ga0496125_0000328_46152_47039 292
729 3300048928 Ga0496125_0024628 Ga0496125_0024628_1024_1902 292
730 3300048928 Ga0496125_0087175 Ga0496125_0087175_680_1573 292
731 3300048929 Ga0496126_0010158 Ga0496126_0010158_3761_4639 292
732 3300048929 Ga0496126_0086523 Ga0496126_0086523_1647_2525 292
733 3300048929 Ga0496126_0088126 Ga0496126_0088126_637_1515 292
734 3300049569 Ga0501032_0042704 Ga0501032_0042704_291_1175 292
735 3300049573 Ga0501037_0105558 Ga0501037_0105558_619_1503 292
736 3300049574 Ga0501038_0000626 Ga0501038_0000626_45_929 292
737 3300049575 Ga0501039_0021665 Ga0501039_0021665_2003_2887 292
738 3300049579 Ga0501043_0011678 Ga0501043_0011678_2044_2928 292
739 3300049581 Ga0501047_0142285 Ga0501047_0142285_774_1658 292
740 3300049823 Ga0501044_0009154 Ga0501044_0009154_7907_8791 292
741 3300050491 nmdc:mga00v17_162020_c1 nmdc:mga00v17_162020_c1_151_1032 292
742 3300050494 nmdc:mga06z11_255013_c1 nmdc:mga06z11_255013_c1_39_920 292
743 3300053077 Ga0495601_0086261 Ga0495601_0086261_622_1500 292
744 3300053077 Ga0495601_0233021 Ga0495601_0233021_271_1149 292
745 3300053080 Ga0500635_0055968 Ga0500635_0055968_337_1215 292
746 3300053084 Ga0495595_0000445 Ga0495595_0000445_849_1727 292
747 3300053084 Ga0495595_0005883 Ga0495595_0005883_3488_4366 292
748 3300053085 Ga0495619_0000330 Ga0495619_0000330_610_1488 292
749 3300053094 Ga0500566_0000247 Ga0500566_0000247_14899_15789 292
750 3300053121 Ga0500607_020092 Ga0500607_020092_1381_2271 292
751 3300053125 Ga0500618_004575 Ga0500618_004575_1578_2468 292
752 3300053125 Ga0500618_017251 Ga0500618_017251_814_1704 292
753 3300053136 Ga0500559_0000398 Ga0500559_0000398_4730_5620 292
754 3300053136 Ga0500559_0139060 Ga0500559_0139060_120_998 292
755 3300053140 Ga0500573_0232028 Ga0500573_0232028_31_909 292
756 3300053178 Ga0500637_0215510 Ga0500637_0215510_177_1055 292
757 3300053735 Ga0500596_007212 Ga0500596_007212_871_1749 292
758 3300003203 JGI25406J46586_10002779 JGI25406J46586_100027793 293
759 3300003215 JGI25153J46596_10003450 JGI25153J46596_100034506 293
760 3300005327 Ga0070658_10068227 Ga0070658_100682274 293
761 3300005327 Ga0070658_10084002 Ga0070658_100840022 293
762 3300005329 Ga0070683_100005996 Ga0070683_1000059965 293
763 3300005356 Ga0070674_100234639 Ga0070674_1002346391 293
764 3300005434 Ga0070709_10013026 Ga0070709_100130264 293
765 3300005436 Ga0070713_100415359 Ga0070713_1004153592 293
766 3300005439 Ga0070711_100004456 Ga0070711_1000044566 293
767 3300005458 Ga0070681_10014969 Ga0070681_100149693 293
768 3300005458 Ga0070681_10051117 Ga0070681_100511173 293
769 3300005458 Ga0070681_10089577 Ga0070681_100895772 293
770 3300005530 Ga0070679_100039226 Ga0070679_1000392262 293
771 3300005530 Ga0070679_100066868 Ga0070679_1000668682 293
772 3300005535 Ga0070684_100007764 Ga0070684_1000077644 293
773 3300005539 Ga0068853_100279593 Ga0068853_1002795932 293
774 3300005548 Ga0070665_100250510 Ga0070665_1002505102 293
775 3300005577 Ga0068857_100041204 Ga0068857_1000412044 293
776 3300005614 Ga0068856_100129808 Ga0068856_1001298083 293
777 3300005937 Ga0081455_10037390 Ga0081455_100373905 293
778 3300005983 Ga0081540_1011061 Ga0081540_10110612 293
779 3300005983 Ga0081540_1021192 Ga0081540_10211921 293
780 3300005985 Ga0081539_10004737 Ga0081539_100047374 293
781 3300006846 Ga0075430_100389813 Ga0075430_1003898132 293
782 3300009098 Ga0105245_10197939 Ga0105245_101979392 293
783 3300009545 Ga0105237_10168546 Ga0105237_101685462 293
784 3300009545 Ga0105237_10304187 Ga0105237_103041872 293
785 3300009545 Ga0105237_10789028 Ga0105237_107890281 293
786 3300009553 Ga0105249_10269902 Ga0105249_102699022 293
787 3300010375 Ga0105239_10356811 Ga0105239_103568112 293
788 3300013105 Ga0157369_10071197 Ga0157369_100711971 293
789 3300013105 Ga0157369_10684080 Ga0157369_106840801 293
790 3300013306 Ga0163162_10277441 Ga0163162_102774412 293
791 3300020082 Ga0206353_10567907 Ga0206353_105679072 293
792 3300025297 Ga0209758_1011302 Ga0209758_10113024 293
793 3300025906 Ga0207699_10245906 Ga0207699_102459061 293
794 3300025912 Ga0207707_10004700 Ga0207707_100047004 293
795 3300025912 Ga0207707_10104173 Ga0207707_101041732 293
796 3300025912 Ga0207707_10158480 Ga0207707_101584802 293
797 3300025913 Ga0207695_10318707 Ga0207695_103187072 293
798 3300025915 Ga0207693_10021450 Ga0207693_100214505 293
799 3300025915 Ga0207693_10034078 Ga0207693_100340784 293
800 3300025919 Ga0207657_10073517 Ga0207657_100735172 293
801 3300025921 Ga0207652_10079219 Ga0207652_100792192 293
802 3300025921 Ga0207652_10136044 Ga0207652_101360442 293
803 3300025927 Ga0207687_10330306 Ga0207687_103303061 293
804 3300025944 Ga0207661_10056040 Ga0207661_100560403 293
805 3300025944 Ga0207661_10670737 Ga0207661_106707371 293
806 3300025949 Ga0207667_10109852 Ga0207667_101098521 293
807 3300026078 Ga0207702_10337936 Ga0207702_103379361 293
808 3300026089 Ga0207648_10060413 Ga0207648_100604133 293
809 3300026116 Ga0207674_10052673 Ga0207674_100526734 293
810 3300026118 Ga0207675_100389764 Ga0207675_1003897641 293
811 3300028379 Ga0268266_10410158 Ga0268266_104101582 293
812 3300028794 Ga0307515_10125511 Ga0307515_101255112 293
813 3300031238 Ga0265332_10016039 Ga0265332_100160393 293
814 3300031239 Ga0265328_10044554 Ga0265328_100445542 293
815 3300031241 Ga0265325_10009157 Ga0265325_100091574 293
816 3300031249 Ga0265339_10007110 Ga0265339_100071104 293
817 3300031250 Ga0265331_10027874 Ga0265331_100278742 293
818 3300031456 Ga0307513_10105188 Ga0307513_101051883 293
819 3300031595 Ga0265313_10041739 Ga0265313_100417392 293
820 3300031711 Ga0265314_10147464 Ga0265314_101474641 293
821 3300031712 Ga0265342_10005853 Ga0265342_100058535 293
822 3300033180 Ga0307510_10025056 Ga0307510_100250566 293
823 3300035113 Ga0373936_0070087 Ga0373936_0070087_226_1122 293
824 3300035695 Ga0373927_0027049 Ga0373927_0027049_1433_2317 293
825 3300035725 Ga0373947_0151339 Ga0373947_0151339_255_1148 293
826 3300037068 Ga0373925_0110804 Ga0373925_0110804_301_1185 293
827 3300037418 Ga0395900_0080281 Ga0395900_0080281_2252_3136 293
828 3300037466 Ga0395898_0099077 Ga0395898_0099077_1373_2257 293
829 3300037471 Ga0395905_0165060 Ga0395905_0165060_59_943 293
830 3300039437 Ga0436365_0076766 Ga0436365_0076766_263_1144 293
831 3300039447 Ga0436361_0336324 Ga0436361_0336324_598_1479 293
832 3300039447 Ga0436361_0937863 Ga0436361_0937863_450_1331 293
833 3300039450 Ga0436363_0697337 Ga0436363_0697337_224_1105 293
834 3300044694 Ga0466963_0080797 Ga0466963_0080797_1222_2103 293
835 3300045049 Ga0466959_0053472 Ga0466959_0053472_1225_2106 293
836 3300045049 Ga0466959_0361912 Ga0466959_0361912_37_918 293
837 3300045976 Ga0466967_0011512 Ga0466967_0011512_4411_5292 293
838 3300046455 Ga0495603_0070506 Ga0495603_0070506_678_1571 293
839 3300046477 Ga0495664_0016934 Ga0495664_0016934_1831_2712 293
840 3300046499 Ga0495594_0137115 Ga0495594_0137115_218_1111 293
841 3300046507 Ga0495606_0048505 Ga0495606_0048505_1746_2630 293
842 3300046524 Ga0495648_0000286 Ga0495648_0000286_33671_34552 293
843 3300047315 Ga0495581_0114111 Ga0495581_0114111_114_998 293
844 3300047321 Ga0495676_0087102 Ga0495676_0087102_1352_2236 293
845 3300048906 Ga0496103_0250773 Ga0496103_0250773_194_1075 293
846 3300048907 Ga0496104_0272046 Ga0496104_0272046_244_1128 293
847 3300048910 Ga0496107_0130670 Ga0496107_0130670_538_1431 293
848 3300048910 Ga0496107_0239906 Ga0496107_0239906_205_1092 293
849 3300048915 Ga0496112_0036502 Ga0496112_0036502_644_1525 293
850 3300048924 Ga0496121_0267653 Ga0496121_0267653_231_1112 293
851 3300048929 Ga0496126_0035866 Ga0496126_0035866_3340_4221 293
852 3300048929 Ga0496126_0208070 Ga0496126_0208070_197_1078 293
853 3300048929 Ga0496126_0286373 Ga0496126_0286373_109_990 293
854 3300049580 Ga0501046_0028766 Ga0501046_0028766_1751_2632 293
855 3300049581 Ga0501047_0010976 Ga0501047_0010976_4552_5433 293
856 3300049581 Ga0501047_0428330 Ga0501047_0428330_65_949 293
857 3300049586 Ga0501070_0062656 Ga0501070_0062656_73_954 293
858 3300049590 Ga0501074_0100957 Ga0501074_0100957_117_998 293
859 3300049742 Ga0501080_0031118 Ga0501080_0031118_458_1339 293
860 3300050513 nmdc:mga0rr50_314731_c1 nmdc:mga0rr50_314731_c1_194_1084 293
861 3300053077 Ga0495601_0049218 Ga0495601_0049218_806_1687 293
862 3300053080 Ga0500635_0048938 Ga0500635_0048938_123_1004 293
863 3300053083 Ga0495655_0003764 Ga0495655_0003764_820_1704 293
864 3300053094 Ga0500566_0005190 Ga0500566_0005190_994_1878 293
865 3300053094 Ga0500566_0202460 Ga0500566_0202460_45_929 293
866 3300053095 Ga0500640_068405 Ga0500640_068405_194_1078 293
867 3300053096 Ga0500641_0035557 Ga0500641_0035557_55_939 293
868 3300053102 Ga0500554_003943 Ga0500554_003943_373_1254 293
869 3300053111 Ga0500572_019537 Ga0500572_019537_196_1080 293
870 3300053122 Ga0500608_051127 Ga0500608_051127_566_1450 293
871 3300053123 Ga0500614_019160 Ga0500614_019160_194_1078 293
872 3300053136 Ga0500559_0042227 Ga0500559_0042227_554_1438 293
873 3300053150 Ga0500603_001290 Ga0500603_001290_2027_2908 293
874 3300053150 Ga0500603_007487 Ga0500603_007487_913_1797 293
875 3300053159 Ga0500630_065807 Ga0500630_065807_553_1437 293
876 3300053163 Ga0500639_013853 Ga0500639_013853_2169_3053 293
877 3300053178 Ga0500637_0017723 Ga0500637_0017723_2810_3691 293
878 3300002075 JGI24738J21930_10006735 JGI24738J21930_100067352 294
879 3300003215 JGI25153J46596_10011834 JGI25153J46596_100118344 294
880 3300003771 Ga0055526_1043009 Ga0055526_10430091 294
881 3300003794 Ga0055531_10014489 Ga0055531_100144893 294
882 3300005262 Ga0065165_1000365 Ga0065165_100036520 294
883 3300005262 Ga0065165_1001495 Ga0065165_100149521 294
884 3300005262 Ga0065165_1019115 Ga0065165_10191151 294
885 3300005353 Ga0070669_100066355 Ga0070669_1000663552 294
886 3300005355 Ga0070671_100129955 Ga0070671_1001299552 294
887 3300005539 Ga0068853_100196525 Ga0068853_1001965251 294
888 3300005563 Ga0068855_100526603 Ga0068855_1005266032 294
889 3300005577 Ga0068857_100227058 Ga0068857_1002270581 294
890 3300005616 Ga0068852_100042806 Ga0068852_1000428064 294
891 3300005937 Ga0081455_10009536 Ga0081455_100095367 294
892 3300005983 Ga0081540_1012813 Ga0081540_10128135 294
893 3300006042 Ga0075368_10003158 Ga0075368_100031584 294
894 3300006048 Ga0075363_100016306 Ga0075363_1000163062 294
895 3300006186 Ga0075369_10076719 Ga0075369_100767192 294
896 3300006195 Ga0075366_10061029 Ga0075366_100610291 294
897 3300006353 Ga0075370_10156285 Ga0075370_101562852 294
898 3300006944 Ga0099823_1022515 Ga0099823_10225152 294
899 3300009093 Ga0105240_10031181 Ga0105240_100311814 294
900 3300009174 Ga0105241_10072988 Ga0105241_100729882 294
901 3300009174 Ga0105241_10082572 Ga0105241_100825723 294
902 3300009545 Ga0105237_10010095 Ga0105237_100100954 294
903 3300009551 Ga0105238_10597241 Ga0105238_105972411 294
904 3300009553 Ga0105249_10164867 Ga0105249_101648671 294
905 3300010375 Ga0105239_10080757 Ga0105239_100807572 294
906 3300013308 Ga0157375_10293938 Ga0157375_102939381 294
907 3300014745 Ga0157377_10178578 Ga0157377_101785781 294
908 3300021320 Ga0214544_1000016 Ga0214544_1000016169 294
909 3300021321 Ga0214542_1000016 Ga0214542_100001633 294
910 3300021324 Ga0214545_1000008 Ga0214545_100000839 294
911 3300021327 Ga0214543_1001466 Ga0214543_100146633 294
912 3300025230 Ga0209563_108642 Ga0209563_1086421 294
913 3300025253 Ga0209677_105633 Ga0209677_1056333 294
914 3300025254 Ga0209148_1000282 Ga0209148_100028222 294
915 3300025261 Ga0209233_1005872 Ga0209233_10058723 294
916 3300025295 Ga0209564_1003702 Ga0209564_10037025 294
917 3300025297 Ga0209758_1000069 Ga0209758_100006953 294
918 3300025297 Ga0209758_1000635 Ga0209758_100063541 294
919 3300025297 Ga0209758_1001996 Ga0209758_100199617 294
920 3300025297 Ga0209758_1017490 Ga0209758_10174903 294
921 3300025299 Ga0209256_1015129 Ga0209256_10151293 294
922 3300025299 Ga0209256_1032713 Ga0209256_10327131 294
923 3300025302 Ga0207426_1002082 Ga0207426_10020822 294
924 3300025302 Ga0207426_1020494 Ga0207426_10204941 294
925 3300025302 Ga0207426_1024931 Ga0207426_10249312 294
926 3300025304 Ga0209257_1000473 Ga0209257_100047342 294
927 3300025304 Ga0209257_1017693 Ga0209257_10176931 294
928 3300025315 Ga0207697_10065589 Ga0207697_100655892 294
929 3300025904 Ga0207647_10014195 Ga0207647_100141954 294
930 3300025911 Ga0207654_10006549 Ga0207654_100065494 294
931 3300025911 Ga0207654_10011597 Ga0207654_100115972 294
932 3300025911 Ga0207654_10089954 Ga0207654_100899543 294
933 3300025913 Ga0207695_10000107 Ga0207695_10000107224 294
934 3300025914 Ga0207671_10018412 Ga0207671_100184122 294
935 3300025923 Ga0207681_10066644 Ga0207681_100666442 294
936 3300025931 Ga0207644_10066408 Ga0207644_100664082 294
937 3300025933 Ga0207706_10203009 Ga0207706_102030092 294
938 3300025935 Ga0207709_10250155 Ga0207709_102501552 294
939 3300025940 Ga0207691_10203813 Ga0207691_102038133 294
940 3300025986 Ga0207658_10306396 Ga0207658_103063961 294
941 3300026023 Ga0207677_10198955 Ga0207677_101989551 294
942 3300026067 Ga0207678_10046674 Ga0207678_100466744 294
943 3300026116 Ga0207674_10299290 Ga0207674_102992901 294
944 3300026118 Ga0207675_100122516 Ga0207675_1001225161 294
945 3300026142 Ga0207698_10183463 Ga0207698_101834631 294
946 3300026142 Ga0207698_10350202 Ga0207698_103502021 294
947 3300027296 Ga0209389_1000033 Ga0209389_100003331 294
948 3300027296 Ga0209389_1000182 Ga0209389_100018247 294
949 3300027357 Ga0209589_1000040 Ga0209589_100004031 294
950 3300027361 Ga0209489_100045 Ga0209489_10004543 294
951 3300027361 Ga0209489_100209 Ga0209489_10020947 294
952 3300027363 Ga0209700_100011 Ga0209700_100011199 294
953 3300028379 Ga0268266_10184329 Ga0268266_101843292 294
954 3300033180 Ga0307510_10024755 Ga0307510_100247555 294
955 3300035113 Ga0373936_0133190 Ga0373936_0133190_137_1039 294
956 3300037471 Ga0395905_0005856 Ga0395905_0005856_409_1296 294
957 3300037471 Ga0395905_0060606 Ga0395905_0060606_2623_3507 294
958 3300039437 Ga0436365_0958057 Ga0436365_0958057_67_954 294
959 3300044656 Ga0466969_0128100 Ga0466969_0128100_158_1045 294
960 3300044658 Ga0466972_0000119 Ga0466972_0000119_48498_49385 294
961 3300044658 Ga0466972_0010560 Ga0466972_0010560_2640_3527 294
962 3300044693 Ga0466961_0000139 Ga0466961_0000139_21025_21912 294
963 3300044694 Ga0466963_0117349 Ga0466963_0117349_522_1409 294
964 3300044719 Ga0466971_0174557 Ga0466971_0174557_103_990 294
965 3300044735 Ga0466968_0017207 Ga0466968_0017207_138_1025 294
966 3300044765 Ga0466970_0045604 Ga0466970_0045604_1192_2079 294
967 3300044765 Ga0466970_0185989 Ga0466970_0185989_255_1142 294
968 3300044842 Ga0466957_0035033 Ga0466957_0035033_2043_2930 294
969 3300044901 Ga0466960_0000848 Ga0466960_0000848_2350_3237 294
970 3300045049 Ga0466959_0034008 Ga0466959_0034008_1556_2443 294
971 3300045976 Ga0466967_0160685 Ga0466967_0160685_1069_1956 294
972 3300046459 Ga0495629_0005536 Ga0495629_0005536_2361_3248 294
973 3300046460 Ga0495638_0001094 Ga0495638_0001094_17801_18688 294
974 3300046462 Ga0495651_0017530 Ga0495651_0017530_1898_2785 294
975 3300046474 Ga0495605_0092896 Ga0495605_0092896_333_1220 294
976 3300046477 Ga0495664_0009771 Ga0495664_0009771_3029_3916 294
977 3300046491 Ga0495584_0036022 Ga0495584_0036022_897_1784 294
978 3300046500 Ga0495596_0056530 Ga0495596_0056530_141_1028 294
979 3300046507 Ga0495606_0037168 Ga0495606_0037168_1194_2081 294
980 3300046511 Ga0495608_0017766 Ga0495608_0017766_3156_4043 294
981 3300046513 Ga0495616_0134523 Ga0495616_0134523_55_942 294
982 3300046516 Ga0495628_0057540 Ga0495628_0057540_1276_2163 294
983 3300046516 Ga0495628_0314815 Ga0495628_0314815_75_962 294
984 3300046524 Ga0495648_0072499 Ga0495648_0072499_276_1163 294
985 3300046524 Ga0495648_0125545 Ga0495648_0125545_345_1232 294
986 3300046526 Ga0495666_0192723 Ga0495666_0192723_16_903 294
987 3300046529 Ga0495652_0034268 Ga0495652_0034268_3256_4143 294
988 3300046533 Ga0495640_0018565 Ga0495640_0018565_1227_2114 294
989 3300046533 Ga0495640_0112835 Ga0495640_0112835_839_1726 294
990 3300046559 Ga0495667_0006502 Ga0495667_0006502_1951_2838 294
991 3300046616 Ga0495668_0029459 Ga0495668_0029459_1637_2524 294
992 3300046642 Ga0495634_0044581 Ga0495634_0044581_447_1334 294
993 3300046660 Ga0495625_0104162 Ga0495625_0104162_959_1846 294
994 3300046663 Ga0495635_0004059 Ga0495635_0004059_7363_8250 294
995 3300046663 Ga0495635_0043268 Ga0495635_0043268_245_1132 294
996 3300046675 Ga0495657_0006604 Ga0495657_0006604_5415_6302 294
997 3300046675 Ga0495657_0030794 Ga0495657_0030794_1084_1971 294
998 3300046679 Ga0495623_0012518 Ga0495623_0012518_1251_2138 294
999 3300046689 Ga0495613_0008984 Ga0495613_0008984_3872_4759 294
1000 3300046690 Ga0495624_0021704 Ga0495624_0021704_2137_3024 294
1001 3300046694 Ga0495649_0012129 Ga0495649_0012129_342_1229 294
1002 3300046809 Ga0495600_0011578 Ga0495600_0011578_1505_2392 294
1003 3300046809 Ga0495600_0013331 Ga0495600_0013331_4081_4968 294
1004 3300047317 Ga0495604_0010785 Ga0495604_0010785_5397_6284 294
1005 3300047317 Ga0495604_0023859 Ga0495604_0023859_2653_3540 294
1006 3300047321 Ga0495676_0114727 Ga0495676_0114727_403_1290 294
1007 3300047322 Ga0495680_0000689 Ga0495680_0000689_11621_12508 294
1008 3300047323 Ga0495683_0044814 Ga0495683_0044814_351_1238 294
1009 3300047323 Ga0495683_0073135 Ga0495683_0073135_712_1599 294
1010 3300047443 Ga0495687_008047 Ga0495687_008047_1201_2088 294
1011 3300047444 Ga0495675_0008329 Ga0495675_0008329_3219_4106 294
1012 3300047471 Ga0495684_0145236 Ga0495684_0145236_343_1230 294
1013 3300047673 Ga0495593_0063063 Ga0495593_0063063_225_1112 294
1014 3300048088 Ga0495602_0015257 Ga0495602_0015257_3624_4511 294
1015 3300048088 Ga0495602_0095535 Ga0495602_0095535_1521_2408 294
1016 3300048091 Ga0495626_0025505 Ga0495626_0025505_1017_1904 294
1017 3300048091 Ga0495626_0079507 Ga0495626_0079507_69_956 294
1018 3300048903 Ga0496100_0093302 Ga0496100_0093302_45_932 294
1019 3300048904 Ga0496101_0496314 Ga0496101_0496314_14_901 294
1020 3300048905 Ga0496102_0009090 Ga0496102_0009090_1865_2752 294
1021 3300048906 Ga0496103_0025364 Ga0496103_0025364_2376_3263 294
1022 3300048907 Ga0496104_0159295 Ga0496104_0159295_667_1554 294
1023 3300048908 Ga0496105_0000935 Ga0496105_0000935_18112_18999 294
1024 3300048908 Ga0496105_0126887 Ga0496105_0126887_387_1274 294
1025 3300048910 Ga0496107_0152209 Ga0496107_0152209_456_1343 294
1026 3300048911 Ga0496108_0047577 Ga0496108_0047577_437_1324 294
1027 3300048913 Ga0496110_0151081 Ga0496110_0151081_72_959 294
1028 3300048914 Ga0496111_0043391 Ga0496111_0043391_992_1879 294
1029 3300048914 Ga0496111_0057197 Ga0496111_0057197_451_1338 294
1030 3300048916 Ga0496113_0043787 Ga0496113_0043787_2359_3246 294
1031 3300048916 Ga0496113_0051297 Ga0496113_0051297_397_1284 294
1032 3300048917 Ga0496114_0079878 Ga0496114_0079878_1808_2695 294
1033 3300048918 Ga0496115_0029319 Ga0496115_0029319_1569_2456 294
1034 3300048918 Ga0496115_0286279 Ga0496115_0286279_427_1314 294
1035 3300048921 Ga0496118_0154936 Ga0496118_0154936_96_983 294
1036 3300048922 Ga0496119_0006376 Ga0496119_0006376_2603_3490 294
1037 3300048922 Ga0496119_0072987 Ga0496119_0072987_44_931 294
1038 3300048924 Ga0496121_0130068 Ga0496121_0130068_94_981 294
1039 3300048924 Ga0496121_0171645 Ga0496121_0171645_508_1395 294
1040 3300048927 Ga0496124_0114620 Ga0496124_0114620_491_1378 294
1041 3300048928 Ga0496125_0000407 Ga0496125_0000407_63917_64810 294
1042 3300048928 Ga0496125_0043717 Ga0496125_0043717_250_1137 294
1043 3300048929 Ga0496126_0027806 Ga0496126_0027806_3781_4668 294
1044 3300048929 Ga0496126_0065855 Ga0496126_0065855_418_1311 294
1045 3300049460 Ga0495682_0011296 Ga0495682_0011296_1352_2239 294
1046 3300049460 Ga0495682_0055980 Ga0495682_0055980_101_988 294
1047 3300050490 nmdc:mga03n38_4895_c1 nmdc:mga03n38_4895_c1_1976_2863 294
1048 3300050491 nmdc:mga00v17_55279_c1 nmdc:mga00v17_55279_c1_981_1868 294
1049 3300050492 nmdc:mga0yw44_47348_c1 nmdc:mga0yw44_47348_c1_1599_2486 294
1050 3300050493 nmdc:mga0k408_58486_c1 nmdc:mga0k408_58486_c1_38_925 294
1051 3300050494 nmdc:mga06z11_120949_c1 nmdc:mga06z11_120949_c1_363_1250 294
1052 3300050495 nmdc:mga04h51_4727_c1 nmdc:mga04h51_4727_c1_369_1256 294
1053 3300050496 nmdc:mga07m45_112215_c1 nmdc:mga07m45_112215_c1_456_1343 294
1054 3300050496 nmdc:mga07m45_113485_c1 nmdc:mga07m45_113485_c1_118_1005 294
1055 3300050496 nmdc:mga07m45_226957_c1 nmdc:mga07m45_226957_c1_52_939 294
1056 3300050516 nmdc:mga0sz30_40195_c1 nmdc:mga0sz30_40195_c1_977_1864 294
1057 3300053083 Ga0495655_0012771 Ga0495655_0012771_70_957 294
1058 3300053086 Ga0500578_0079113 Ga0500578_0079113_1095_1982 294
1059 3300053086 Ga0500578_0118280 Ga0500578_0118280_770_1657 294
1060 3300053087 Ga0500643_000063 Ga0500643_000063_52605_53492 294
1061 3300053094 Ga0500566_0003076 Ga0500566_0003076_2467_3354 294
1062 3300053105 Ga0500557_000037 Ga0500557_000037_47621_48505 294
1063 3300053109 Ga0500569_001553 Ga0500569_001553_1831_2718 294
1064 3300053130 Ga0500642_0000062 Ga0500642_0000062_47581_48465 294
1065 3300053134 Ga0500658_0075077 Ga0500658_0075077_113_1000 294
1066 3300053138 Ga0500564_110823 Ga0500564_110823_20_907 294
1067 3300053142 Ga0500577_0000399 Ga0500577_0000399_6211_7107 294
1068 3300053153 Ga0500616_0018659 Ga0500616_0018659_2953_3840 294
1069 3300053155 Ga0500620_001178 Ga0500620_001178_1341_2228 294
1070 3300053156 Ga0500622_0026331 Ga0500622_0026331_2082_2969 294
1071 3300053177 Ga0500636_0000349 Ga0500636_0000349_18922_19809 294
1072 3300053729 Ga0500625_024838 Ga0500625_024838_78_962 294
1073 3300053737 Ga0500601_000064 Ga0500601_000064_14694_15581 294
1074 3300055283 Ga0500661_021525 Ga0500661_021525_188_1075 294
1075 3300009093 Ga0105240_10004955 Ga0105240_100049554 295
1076 3300009174 Ga0105241_10002286 Ga0105241_100022868 295
1077 3300009551 Ga0105238_10000905 Ga0105238_1000090527 295
1078 3300010375 Ga0105239_10002519 Ga0105239_100025198 295
1079 3300025981 Ga0207640_10186435 Ga0207640_101864352 295
1080 3300060353 Ga0501082_0000028 Ga0501082_0000028_77288_78187 295
1081 iso_pu_bacteria 2602042107 2603858527 295
1082 iso_pu_bacteria 2857524615 2857526351 295
1083 iso_pu_bacteria 2919073203 2919073802 295
1084 3300047317 Ga0495604_0145351 Ga0495604_0145351_692_1585 296
1085 3300048904 Ga0496101_0041241 Ga0496101_0041241_208_1107 296
1086 3300048909 Ga0496106_0060156 Ga0496106_0060156_1759_2658 296
1087 3300003203 JGI25406J46586_10000066 JGI25406J46586_1000006626 297
1088 3300005330 Ga0070690_100211041 Ga0070690_1002110412 297
1089 3300005985 Ga0081539_10000064 Ga0081539_1000006452 297
1090 3300006175 Ga0070712_100240873 Ga0070712_1002408732 297
1091 3300025295 Ga0209564_1000321 Ga0209564_100032156 297
1092 3300026067 Ga0207678_10422037 Ga0207678_104220371 297
1093 3300026095 Ga0207676_10114523 Ga0207676_101145233 297
1094 3300053724 Ga0500570_018767 Ga0500570_018767_581_1561 297
1095 iso_pu_bacteria 3005587118 3005592211 297
1096 3300009098 Ga0105245_10231917 Ga0105245_102319172 298
1097 3300009177 Ga0105248_10549277 Ga0105248_105492771 298
1098 3300025927 Ga0207687_10350902 Ga0207687_103509022 298
1099 3300047472 Ga0495686_0063919 Ga0495686_0063919_1222_2130 298
1100 3300049572 Ga0501036_0061519 Ga0501036_0061519_1950_2852 298
1101 3300005329 Ga0070683_100421203 Ga0070683_1004212032 299
1102 3300005339 Ga0070660_100038981 Ga0070660_1000389812 299
1103 3300005341 Ga0070691_10133269 Ga0070691_101332692 299
1104 3300005366 Ga0070659_100118955 Ga0070659_1001189552 299
1105 3300005434 Ga0070709_10105903 Ga0070709_101059031 299
1106 3300005471 Ga0070698_100068842 Ga0070698_1000688423 299
1107 3300005535 Ga0070684_100058502 Ga0070684_1000585022 299
1108 3300005539 Ga0068853_100029265 Ga0068853_1000292654 299
1109 3300005614 Ga0068856_100065061 Ga0068856_1000650614 299
1110 3300005616 Ga0068852_100104346 Ga0068852_1001043463 299
1111 3300006038 Ga0075365_10066092 Ga0075365_100660922 299
1112 3300006178 Ga0075367_10092235 Ga0075367_100922352 299
1113 3300006186 Ga0075369_10043758 Ga0075369_100437582 299
1114 3300009551 Ga0105238_10030039 Ga0105238_100300393 299
1115 3300020082 Ga0206353_10148081 Ga0206353_101480811 299
1116 3300025253 Ga0209677_100672 Ga0209677_1006725 299
1117 3300025912 Ga0207707_10054133 Ga0207707_100541333 299
1118 3300025913 Ga0207695_10115822 Ga0207695_101158221 299
1119 3300025914 Ga0207671_10069130 Ga0207671_100691302 299
1120 3300025917 Ga0207660_10081275 Ga0207660_100812751 299
1121 3300025919 Ga0207657_10029294 Ga0207657_100292944 299
1122 3300025921 Ga0207652_10076915 Ga0207652_100769152 299
1123 3300025924 Ga0207694_10034117 Ga0207694_100341172 299
1124 3300025944 Ga0207661_10175645 Ga0207661_101756451 299
1125 3300025945 Ga0207679_10390674 Ga0207679_103906741 299
1126 3300025949 Ga0207667_10160793 Ga0207667_101607932 299
1127 3300026041 Ga0207639_10013217 Ga0207639_100132174 299
1128 3300026116 Ga0207674_10007766 Ga0207674_100077664 299
1129 3300028794 Ga0307515_10140350 Ga0307515_101403503 299
1130 3300031238 Ga0265332_10072613 Ga0265332_100726132 299
1131 3300031247 Ga0265340_10042492 Ga0265340_100424922 299
1132 3300031249 Ga0265339_10099122 Ga0265339_100991222 299
1133 3300031456 Ga0307513_10169966 Ga0307513_101699662 299
1134 3300031730 Ga0307516_10010553 Ga0307516_100105533 299
1135 3300031730 Ga0307516_10104788 Ga0307516_101047883 299
1136 3300031901 Ga0307406_10168105 Ga0307406_101681052 299
1137 3300033179 Ga0307507_10027443 Ga0307507_100274434 299
1138 3300035170 Ga0373943_0056690 Ga0373943_0056690_535_1503 299
1139 3300046460 Ga0495638_0053016 Ga0495638_0053016_1098_2009 299
1140 3300046462 Ga0495651_0086113 Ga0495651_0086113_973_1881 299
1141 3300046501 Ga0495607_0012073 Ga0495607_0012073_321_1232 299
1142 3300046506 Ga0495583_0020205 Ga0495583_0020205_1215_2126 299
1143 3300046507 Ga0495606_0082443 Ga0495606_0082443_119_1030 299
1144 3300046512 Ga0495610_0055708 Ga0495610_0055708_157_1068 299
1145 3300046513 Ga0495616_0025586 Ga0495616_0025586_1191_2102 299
1146 3300046515 Ga0495620_0014398 Ga0495620_0014398_2578_3489 299
1147 3300046518 Ga0495631_0025195 Ga0495631_0025195_917_1828 299
1148 3300046520 Ga0495637_0028566 Ga0495637_0028566_1258_2169 299
1149 3300046522 Ga0495643_0063715 Ga0495643_0063715_707_1618 299
1150 3300046524 Ga0495648_0044368 Ga0495648_0044368_959_1870 299
1151 3300046660 Ga0495625_0017905 Ga0495625_0017905_3532_4443 299
1152 3300046665 Ga0495661_0019545 Ga0495661_0019545_3279_4190 299
1153 3300046679 Ga0495623_0213500 Ga0495623_0213500_21_929 299
1154 3300046691 Ga0495670_0001762 Ga0495670_0001762_8049_8960 299
1155 3300046692 Ga0495671_0161834 Ga0495671_0161834_132_1043 299
1156 3300046794 Ga0495589_0051700 Ga0495589_0051700_710_1621 299
1157 3300047470 Ga0495681_0100394 Ga0495681_0100394_60_971 299
1158 3300048920 Ga0496117_0036072 Ga0496117_0036072_2402_3313 299
1159 3300048921 Ga0496118_0048029 Ga0496118_0048029_1207_2118 299
1160 3300048921 Ga0496118_0064926 Ga0496118_0064926_1107_2018 299
1161 3300048921 Ga0496118_0090666 Ga0496118_0090666_1003_1914 299
1162 3300048924 Ga0496121_0015121 Ga0496121_0015121_2457_3368 299
1163 3300048925 Ga0496122_0032788 Ga0496122_0032788_2336_3247 299
1164 3300048926 Ga0496123_0010648 Ga0496123_0010648_1037_1948 299
1165 3300048928 Ga0496125_0003549 Ga0496125_0003549_1098_2009 299
1166 3300048928 Ga0496125_0059052 Ga0496125_0059052_1062_1973 299
1167 3300048929 Ga0496126_0142503 Ga0496126_0142503_929_1840 299
1168 3300050492 nmdc:mga0yw44_83620_c1 nmdc:mga0yw44_83620_c1_1082_1993 299
1169 3300053087 Ga0500643_034093 Ga0500643_034093_431_1342 299
1170 3300053090 Ga0500646_0000839 Ga0500646_0000839_6910_7821 299
1171 3300053093 Ga0500651_0006769 Ga0500651_0006769_5085_5996 299
1172 3300053104 Ga0500556_0000006 Ga0500556_0000006_333811_334722 299
1173 3300053109 Ga0500569_002673 Ga0500569_002673_1929_2840 299
1174 3300053117 Ga0500593_065397 Ga0500593_065397_663_1574 299
1175 3300053122 Ga0500608_000959 Ga0500608_000959_9055_9966 299
1176 3300053130 Ga0500642_0000004 Ga0500642_0000004_152564_153475 299
1177 3300053131 Ga0500652_000555 Ga0500652_000555_11187_12098 299
1178 3300053134 Ga0500658_0074733 Ga0500658_0074733_192_1103 299
1179 3300053139 Ga0500568_0000790 Ga0500568_0000790_13008_13919 299
1180 3300053145 Ga0500586_007140 Ga0500586_007140_985_1896 299
1181 3300053146 Ga0500588_0031491 Ga0500588_0031491_289_1200 299
1182 3300053151 Ga0500604_0001375 Ga0500604_0001375_5779_6690 299
1183 3300053153 Ga0500616_0000022 Ga0500616_0000022_329652_330563 299
1184 3300053156 Ga0500622_0044474 Ga0500622_0044474_105_1016 299
1185 3300005434 Ga0070709_10004682 Ga0070709_100046824 300
1186 3300005435 Ga0070714_100004568 Ga0070714_1000045682 300
1187 3300005436 Ga0070713_100005959 Ga0070713_1000059596 300
1188 3300005437 Ga0070710_10004995 Ga0070710_100049955 300
1189 3300005439 Ga0070711_100000660 Ga0070711_1000006605 300
1190 3300006028 Ga0070717_10043262 Ga0070717_100432624 300
1191 3300006163 Ga0070715_10000108 Ga0070715_100001082 300
1192 3300006173 Ga0070716_100002138 Ga0070716_1000021382 300
1193 3300006175 Ga0070712_100047535 Ga0070712_1000475353 300
1194 3300021361 Ga0213872_10015515 Ga0213872_100155151 300
1195 3300025898 Ga0207692_10002026 Ga0207692_100020264 300
1196 3300025905 Ga0207685_10035616 Ga0207685_100356162 300
1197 3300025906 Ga0207699_10003043 Ga0207699_100030436 300
1198 3300025914 Ga0207671_10282289 Ga0207671_102822891 300
1199 3300025915 Ga0207693_10000310 Ga0207693_1000031035 300
1200 3300025916 Ga0207663_10019867 Ga0207663_100198673 300
1201 3300025917 Ga0207660_10189160 Ga0207660_101891602 300
1202 3300025928 Ga0207700_10154584 Ga0207700_101545842 300
1203 3300025939 Ga0207665_10001734 Ga0207665_1000173410 300
1204 3300028786 Ga0307517_10001338 Ga0307517_1000133834 300
1205 3300044684 Ga0466966_0041766 Ga0466966_0041766_861_1781 300
1206 iso_pu_bacteria 2513237141 2513888766 300
1207 3300003354 JGI25160J50197_1003294 JGI25160J50197_10032941 301
1208 3300025302 Ga0207426_1004116 Ga0207426_10041166 301
1209 3300025914 Ga0207671_10461891 Ga0207671_104618911 301
1210 3300037418 Ga0395900_0003383 Ga0395900_0003383_15959_16999 301
1211 3300037466 Ga0395898_0013386 Ga0395898_0013386_229_1269 301
1212 3300038443 Ga0395901_0161395 Ga0395901_0161395_1161_2201 301
1213 3300001979 JGI24740J21852_10000946 JGI24740J21852_100009469 302
1214 3300005539 Ga0068853_100001705 Ga0068853_10000170512 302
1215 3300005563 Ga0068855_100034493 Ga0068855_1000344934 302
1216 3300005577 Ga0068857_100021030 Ga0068857_1000210304 302
1217 3300005834 Ga0068851_10002645 Ga0068851_100026454 302
1218 3300025321 Ga0207656_10008173 Ga0207656_100081732 302
1219 3300025911 Ga0207654_10000058 Ga0207654_1000005857 302
1220 3300025913 Ga0207695_10000453 Ga0207695_1000045342 302
1221 3300025914 Ga0207671_10042434 Ga0207671_100424342 302
1222 3300025924 Ga0207694_10001009 Ga0207694_100010098 302
1223 3300025949 Ga0207667_10006596 Ga0207667_1000659611 302
1224 3300026078 Ga0207702_10000004 Ga0207702_10000004240 302
1225 3300026116 Ga0207674_10002298 Ga0207674_1000229810 302
1226 3300026142 Ga0207698_10031595 Ga0207698_100315952 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02195

ParBc

ParB/Sulfiredoxin domain

34

126

0.98

PF17762

HTH_ParB

HTH domain found in ParB protein

165

212

0.97

PF23552

230

278

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y93-assembly1.cif.gz_A crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.9508 137 231
6y93-assembly1.cif.gz_B crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.9249 128 231
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.8998 144 180
6t1f-assembly2.cif.gz_D crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site 0.893 41 231
6t1f-assembly2.cif.gz_D crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site 0.8799 41 231
ID Description Score Start End Superfamily
af_Q2G118_97_208_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9468 120 227 1.10.10.2830
af_Q2FUQ5_107_218_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9464 120 228 1.10.10.2830
af_Q2FUQ5_43_106_3.90.1530.30 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9392 55 119 3.90.1530.30
af_P9WIJ9_142_255_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9322 120 228 1.10.10.2830
1vz0A01 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9192 61 119 3.90.1530.30
ID Description Score Start End GO Terms
AF-A0A2T4RMR3-F1-model_v4 deleted 0.955 123 231
AF-A0A838M0W9-F1-model_v4 ParB/RepB/Spo0J family partition protein 0.8631 117 231 GO:0003677
GO:0005694
GO:0007059
AF-A0A2R7S9F1-F1-model_v4 ParB/Sulfiredoxin domain-containing protein 0.8614 41 232 GO:0003677
GO:0005694
GO:0007059
GO:0045881
AF-N6Y954-F1-model_v4 ParB family protein 0.8519 41 227 GO:0003677
GO:0005694
GO:0007059
AF-A0A1F8VSX0-F1-model_v4 ParB/Sulfiredoxin domain-containing protein 0.8478 41 231 GO:0003677
GO:0005694
GO:0007059

Feature Viewer

pLDDT pTM Quality
81.3 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map