F491876

General Info

Members Datasets Scaffolds Average Seq Length
1222 565 1150 250

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0011700|Ga0501036_0011700_163_1041
Length 292
Sequence MFANLTALITILVIVLFTAFRILREYERGVVFTLGRFDKVKGPGLIIIIPGIQKMVRVDLRTVVMDVPSQDVISRDNVSVKVNAVVYFRVVDPQKSIIQVENFLSATSQFAQTTLRSVLGKHELDEMLAEREKLNLDIQKALDVQTDAWGIKVSNVEIKHVDIDESMIRAIARQAEAERERRAKVIHAEGELQASHKLMQAAQTLSRQNGAMQLRYLQTLTSIASDKSNTIIFPVSMDLMSTLTNVLKMQNRRGPDEAGSADEPGGPDATDETTLGSSRMEETATDQANSSA

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2511231024 Pseudomonas sp. GM84 Isolate Nodule
4 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
5 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
6 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
7 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
8 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
9 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
10 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
11 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
12 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
13 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
14 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
15 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
16 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
17 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
18 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
19 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
20 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
21 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
22 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
23 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
24 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
25 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
26 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
27 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
28 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
29 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
30 2765235841 Pseudomonas putida AA7 Isolate Unclassified
31 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
32 2818991450 Burkholderia sp. 604 Isolate Unclassified
33 2818991452 Burkholderia cepacia 561 Isolate Unclassified
34 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
35 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
36 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
37 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
38 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
39 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
40 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
41 2885266251 Ralstonia sp. SET104 Isolate Nodule
42 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
43 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
44 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
45 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
46 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
47 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
48 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
49 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
50 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
51 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
52 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
53 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
54 2928170801 Burkholderia sp. 572 Isolate Unclassified
55 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
56 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
57 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
58 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
59 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
60 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
66 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
67 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
68 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
69 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
70 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
71 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
72 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
73 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
74 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
75 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
76 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
77 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
78 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
79 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
85 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
86 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
87 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
88 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
89 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
90 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
91 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
92 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
93 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
94 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
95 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
96 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
109 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
112 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
113 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
114 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
115 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
116 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
117 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
118 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
119 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
120 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
121 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
122 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
123 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
124 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
125 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
126 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
127 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
128 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
129 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
135 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
136 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
137 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
138 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
139 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
140 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
141 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
142 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
143 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
144 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
145 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
146 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
147 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
148 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
151 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
152 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
153 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
154 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
155 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
157 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
158 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
159 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
160 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
161 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
162 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
163 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
164 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
165 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
166 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
167 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
168 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
169 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
170 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
171 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
176 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
179 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
180 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
181 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
182 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
185 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
186 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
187 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
188 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
189 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
190 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
191 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
192 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
193 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
194 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
195 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
196 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
197 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
198 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
199 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
200 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
201 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
202 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
205 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
214 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
216 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
217 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
220 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
221 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
225 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
230 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
232 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
289 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
294 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
298 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
299 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
300 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
301 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
302 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
303 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
304 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
305 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
306 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
307 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
308 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
309 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
310 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
311 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
312 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
313 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
314 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
315 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
316 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
317 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
318 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
319 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
320 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
321 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
322 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
323 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
324 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
325 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
326 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
327 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
328 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
329 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
330 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
332 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
337 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
338 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
339 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
340 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
341 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
342 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
343 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
344 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
345 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
346 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
347 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
348 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
349 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
350 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
351 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
352 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
353 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
354 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
355 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
356 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
357 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
358 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
359 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
360 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
361 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
362 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
363 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
364 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
365 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
366 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
367 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
368 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
369 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
370 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
371 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
372 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
373 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
374 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
375 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
376 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
377 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
378 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
379 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
380 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
381 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
382 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
383 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
384 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
385 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
386 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
387 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
388 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
389 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
390 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
391 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
392 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
393 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
394 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
395 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
396 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
397 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
398 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
401 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
402 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
403 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
404 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
405 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
406 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
407 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
408 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
409 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
410 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
411 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
412 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
413 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
414 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
415 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
416 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
417 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
418 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
419 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
420 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
421 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
422 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
423 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
424 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
425 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
426 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
427 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
428 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
429 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
430 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
431 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
432 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
433 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
434 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
435 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
436 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
437 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
438 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
439 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
440 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
441 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
442 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
443 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
444 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
445 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
446 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
447 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
448 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
449 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
450 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
451 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
452 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
453 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
454 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
455 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
456 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
457 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
458 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
459 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
460 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
461 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
462 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
463 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
464 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
465 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
466 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
467 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
468 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
469 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
470 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
471 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
472 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
473 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
474 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
475 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
476 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
477 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
478 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
479 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
480 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
481 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
482 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
483 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
484 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
485 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
486 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
487 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
488 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
489 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
490 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
491 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
492 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
493 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
494 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
495 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
496 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
497 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
498 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
499 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
500 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
501 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
502 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
503 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
504 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
505 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
508 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
516 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
520 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
521 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
522 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
523 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
524 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
525 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
526 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
527 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
528 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
529 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
532 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
533 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
534 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
535 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
536 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
537 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
538 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
539 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
540 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
541 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
542 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
543 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
544 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
545 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
546 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
547 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
548 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
551 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
552 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
553 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
554 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
555 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
556 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
557 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
558 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
559 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
560 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
561 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
562 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
563 8052494512 Pseudomonas putida LD6 Isolate Unclassified
564 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
565 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.04
Metatranscriptomes 1.06
Isolates 5.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.82
Nodule 1.8
Rhizoplane 2.13
Rhizosphere 79.13
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001446 3300001915 Bacteria 6801
2 JGI24740J21852_10000162 3300001979 Bacteria 26509
3 JGI24740J21852_10001865 3300001979 Bacteria 9647
4 JGI24740J21852_10003113 3300001979 Bacteria 7318
5 JGI24739J22299_10001944 3300001989 Bacteria 7904
6 JGI24739J22299_10009203 3300001989 Bacteria 3686
7 JGI24735J21928_10002340 3300002067 Bacteria 6607
8 JGI24735J21928_10051138 3300002067 Bacteria 1193
9 JGI25156J39149_1000123 3300002705 Bacteria 56592
10 JGI25156J39149_1000132 3300002705 Bacteria 54288
11 JGI25156J39149_1001682 3300002705 Bacteria 8913
12 JGI25156J39149_1009142 3300002705 Bacteria 2433
13 JGI25156J39149_1011294 3300002705 Bacteria 2028
14 JGI25156J39149_1011629 3300002705 Bacteria 1979
15 JGI25156J39149_1013888 3300002705 Bacteria 1688
16 JGI25162J39368_1001279 3300002737 Bacteria 14280
17 JGI25154J39366_1002536 3300002738 Bacteria 4633
18 JGI25154J39366_1003951 3300002738 Bacteria 2848
19 JGI25157J39369_1000157 3300002741 Bacteria 56576
20 JGI25157J39369_1001321 3300002741 Bacteria 9862
21 JGI25164J39214_1000716 3300002772 Bacteria 12630
22 JGI25151J46595_10003421 3300003187 Bacteria 8779
23 JGI25151J46595_10009112 3300003187 Bacteria 4727
24 JGI25151J46595_10010145 3300003187 Bacteria 4399
25 JGI25165J46597_1000335 3300003214 Bacteria 55465
26 JGI25165J46597_1001596 3300003214 Bacteria 10971
27 JGI25160J50197_1001515 3300003354 Bacteria 11522
28 Ga0055539_1000038 3300003752 Bacteria 205053
29 Ga0055539_1000409 3300003752 Bacteria 16463
30 Ga0055539_1002822 3300003752 Bacteria 2540
31 Ga0055533_1000011 3300003756 Bacteria 467893
32 Ga0055533_1000232 3300003756 Bacteria 36511
33 Ga0055533_1004567 3300003756 Bacteria 2450
34 Ga0055533_1007945 3300003756 Bacteria 1391
35 Ga0055532_1000002 3300003758 Bacteria 576000
36 Ga0055532_1000011 3300003758 Bacteria 385294
37 Ga0055525_1000324 3300003759 Bacteria 37106
38 Ga0055525_1002837 3300003759 Bacteria 1645
39 Ga0055527_1000009 3300003760 Bacteria 385294
40 Ga0055535_1000008 3300003761 Bacteria 385294
41 Ga0055542_1000014 3300003762 Bacteria 385294
42 Ga0055542_1001112 3300003762 Bacteria 16082
43 Ga0055529_1000010 3300003763 Bacteria 385294
44 Ga0055529_1000113 3300003763 Bacteria 118574
45 Ga0055526_1003201 3300003771 Bacteria 10586
46 Ga0055526_1003737 3300003771 Bacteria 9503
47 Ga0055526_1007580 3300003771 Bacteria 5604
48 Ga0055526_1019863 3300003771 Bacteria 2425
49 Ga0055526_1038702 3300003771 Bacteria 1225
50 Ga0055537_1008344 3300003773 Bacteria 2399
51 Ga0055524_1000290 3300003775 Bacteria 48740
52 Ga0055524_1001717 3300003775 Bacteria 12165
53 Ga0055536_1000074 3300003781 Bacteria 84660
54 Ga0055534_1000761 3300003784 Bacteria 15311
55 Ga0055534_1003807 3300003784 Bacteria 4623
56 Ga0055541_1000608 3300003841 Bacteria 9546
57 Ga0065165_1003184 3300005262 Bacteria 12011
58 Ga0065704_10082103 3300005289 Bacteria 3653
59 Ga0065707_10091191 3300005295 Bacteria 3989
60 Ga0070676_10005402 3300005328 Bacteria 6807
61 Ga0070676_10170965 3300005328 Bacteria 1406
62 Ga0070683_100006705 3300005329 Bacteria 9670
63 Ga0070683_100010268 3300005329 Bacteria 8048
64 Ga0070683_100269010 3300005329 Bacteria 1621
65 Ga0070683_100324701 3300005329 Bacteria 1465
66 Ga0070690_100081864 3300005330 Bacteria 2113
67 Ga0070690_100129343 3300005330 Bacteria 1704
68 Ga0068869_100091614 3300005334 Bacteria 2287
69 Ga0068869_100165480 3300005334 Bacteria 1724
70 Ga0070666_10157751 3300005335 Bacteria 1585
71 Ga0070682_100037222 3300005337 Bacteria 2977
72 Ga0068868_100009165 3300005338 Bacteria 7107
73 Ga0070660_100004427 3300005339 Bacteria 9703
74 Ga0070661_100000321 3300005344 Bacteria 38500
75 Ga0070661_100001057 3300005344 Bacteria 19514
76 Ga0070661_100033808 3300005344 Bacteria 3706
77 Ga0070692_10017162 3300005345 Bacteria 3457
78 Ga0070692_10028839 3300005345 Bacteria 2762
79 Ga0070668_100042413 3300005347 Bacteria 3488
80 Ga0070668_100096777 3300005347 Bacteria 2333
81 Ga0070669_100072454 3300005353 Bacteria 2551
82 Ga0070669_100396902 3300005353 Bacteria 1128
83 Ga0070675_100015743 3300005354 Bacteria 5985
84 Ga0070671_100022023 3300005355 Bacteria 5206
85 Ga0070671_100034291 3300005355 Bacteria 4202
86 Ga0070671_100104434 3300005355 Bacteria 2378
87 Ga0070688_100201785 3300005365 Bacteria 1392
88 Ga0070659_100000764 3300005366 Bacteria 23367
89 Ga0070659_100005447 3300005366 Bacteria 9142
90 Ga0070659_100005466 3300005366 Bacteria 9129
91 Ga0070659_100006279 3300005366 Bacteria 8589
92 Ga0070659_100022346 3300005366 Bacteria 4828
93 Ga0070659_100182602 3300005366 Bacteria 1722
94 Ga0070659_100254299 3300005366 Bacteria 1456
95 Ga0070667_100070375 3300005367 Bacteria 2978
96 Ga0070667_100106175 3300005367 Bacteria 2431
97 Ga0070709_10023561 3300005434 Bacteria 3617
98 Ga0070714_100002126 3300005435 Bacteria 14555
99 Ga0070714_100002778 3300005435 Bacteria 12903
100 Ga0070714_100003909 3300005435 Bacteria 11196
101 Ga0070713_100009976 3300005436 Bacteria 6841
102 Ga0070701_10008863 3300005438 Bacteria 4376
103 Ga0070711_100265857 3300005439 Bacteria 1352
104 Ga0070705_100042616 3300005440 Bacteria 2596
105 Ga0070700_100012720 3300005441 Bacteria 4708
106 Ga0070700_100117399 3300005441 Bacteria 1778
107 Ga0070708_100062109 3300005445 Bacteria 3340
108 Ga0070708_100112961 3300005445 Bacteria 2498
109 Ga0070663_100000046 3300005455 Bacteria 55505
110 Ga0070663_100212152 3300005455 Bacteria 1516
111 Ga0070678_100043287 3300005456 Bacteria 3206
112 Ga0070678_100078851 3300005456 Bacteria 2489
113 Ga0070678_100307853 3300005456 Bacteria 1348
114 Ga0070662_100369930 3300005457 Bacteria 1178
115 Ga0070681_10016085 3300005458 Bacteria 7456
116 Ga0070681_10026657 3300005458 Bacteria 5809
117 Ga0070681_10104560 3300005458 Bacteria 2774
118 Ga0068867_100000291 3300005459 Bacteria 32948
119 Ga0068867_100006929 3300005459 Bacteria 8022
120 Ga0068867_100010772 3300005459 Bacteria 6449
121 Ga0068867_100286504 3300005459 Bacteria 1353
122 Ga0070706_100002204 3300005467 Bacteria 19824
123 Ga0070706_100015220 3300005467 Bacteria 7101
124 Ga0070707_100047358 3300005468 Bacteria 4116
125 Ga0070707_100150960 3300005468 Bacteria 2262
126 Ga0070698_100013449 3300005471 Bacteria 8662
127 Ga0070698_100225729 3300005471 Bacteria 1806
128 Ga0070698_100253725 3300005471 Bacteria 1691
129 Ga0070699_100054408 3300005518 Bacteria 3464
130 Ga0070699_100074489 3300005518 Bacteria 2954
131 Ga0070699_100082153 3300005518 Bacteria 2808
132 Ga0070679_100180715 3300005530 Bacteria 2082
133 Ga0070679_100203186 3300005530 Bacteria 1946
134 Ga0070684_100440532 3300005535 Bacteria 1203
135 Ga0070697_100006211 3300005536 Bacteria 9246
136 Ga0070697_100012186 3300005536 Bacteria 6735
137 Ga0070697_100034838 3300005536 Bacteria 4060
138 Ga0068853_100021180 3300005539 Bacteria 5415
139 Ga0068853_100471377 3300005539 Bacteria 1183
140 Ga0068853_100496768 3300005539 Bacteria 1151
141 Ga0070672_100183856 3300005543 Bacteria 1743
142 Ga0070672_100189519 3300005543 Bacteria 1716
143 Ga0070686_100099974 3300005544 Bacteria 1957
144 Ga0070696_100043412 3300005546 Bacteria 3110
145 Ga0070696_100230408 3300005546 Bacteria 1393
146 Ga0070665_100054489 3300005548 Bacteria 4011
147 Ga0070704_100003831 3300005549 Bacteria 8657
148 Ga0070704_100005075 3300005549 Bacteria 7657
149 Ga0070704_100334656 3300005549 Bacteria 1273
150 Ga0068855_100008331 3300005563 Bacteria 12532
151 Ga0068855_100016866 3300005563 Bacteria 8783
152 Ga0068855_100120552 3300005563 Bacteria 3002
153 Ga0068855_100185221 3300005563 Bacteria 2352
154 Ga0068855_100587132 3300005563 Bacteria 1203
155 Ga0070664_100000002 3300005564 Bacteria 458815
156 Ga0070664_100016169 3300005564 Bacteria 6115
157 Ga0070664_100194403 3300005564 Bacteria 1808
158 Ga0068857_100001821 3300005577 Bacteria 17131
159 Ga0068857_100003368 3300005577 Bacteria 13304
160 Ga0068857_100114120 3300005577 Bacteria 2429
161 Ga0068857_100177000 3300005577 Bacteria 1941
162 Ga0068857_100193952 3300005577 Bacteria 1850
163 Ga0068857_100337506 3300005577 Bacteria 1394
164 Ga0068854_100000004 3300005578 Bacteria 216381
165 Ga0068854_100006533 3300005578 Bacteria 7421
166 Ga0068854_100023192 3300005578 Bacteria 4237
167 Ga0068854_100035415 3300005578 Bacteria 3493
168 Ga0068854_100188374 3300005578 Bacteria 1615
169 Ga0068856_100000035 3300005614 Bacteria 124192
170 Ga0068856_100000168 3300005614 Bacteria 67710
171 Ga0068856_100002803 3300005614 Bacteria 17848
172 Ga0070702_100044723 3300005615 Bacteria 2501
173 Ga0070702_100098930 3300005615 Bacteria 1785
174 Ga0068852_100006363 3300005616 Bacteria 8529
175 Ga0068852_100032440 3300005616 Bacteria 4325
176 Ga0068852_100163555 3300005616 Bacteria 2080
177 Ga0068852_100368546 3300005616 Bacteria 1406
178 Ga0068852_100555327 3300005616 Bacteria 1149
179 Ga0068859_100008147 3300005617 Bacteria 10627
180 Ga0068859_100145483 3300005617 Bacteria 2445
181 Ga0068859_100191621 3300005617 Bacteria 2129
182 Ga0068859_100434549 3300005617 Bacteria 1409
183 Ga0068859_100749607 3300005617 Bacteria 1065
184 Ga0068864_100039632 3300005618 Bacteria 4026
185 Ga0068864_100487944 3300005618 Bacteria 1183
186 Ga0068866_10010197 3300005718 Bacteria 4020
187 Ga0068861_100000224 3300005719 Bacteria 30748
188 Ga0068861_100000917 3300005719 Bacteria 17885
189 Ga0068861_100004912 3300005719 Bacteria 9003
190 Ga0068861_100128260 3300005719 Bacteria 2055
191 Ga0068870_10012608 3300005840 Bacteria 3954
192 Ga0068863_100017730 3300005841 Bacteria 6815
193 Ga0068863_100111484 3300005841 Bacteria 2606
194 Ga0068863_100173214 3300005841 Bacteria 2070
195 Ga0068858_100210712 3300005842 Bacteria 1839
196 Ga0068860_100001311 3300005843 Bacteria 27032
197 Ga0068860_100044758 3300005843 Bacteria 4218
198 Ga0068862_100017386 3300005844 Bacteria 5989
199 Ga0068862_100094296 3300005844 Bacteria 2611
200 Ga0070717_10458914 3300006028 Bacteria 1149
201 Ga0075365_10156982 3300006038 Bacteria 1584
202 Ga0075368_10071645 3300006042 Bacteria 1400
203 Ga0075363_100026916 3300006048 Bacteria 2945
204 Ga0075363_100087501 3300006048 Bacteria 1711
205 Ga0070712_100017367 3300006175 Bacteria 4658
206 Ga0075367_10076049 3300006178 Bacteria 2025
207 Ga0075367_10269397 3300006178 Bacteria 1070
208 Ga0075366_10001785 3300006195 Bacteria 10865
209 Ga0075366_10169780 3300006195 Bacteria 1323
210 Ga0075366_10232807 3300006195 Bacteria 1122
211 Ga0097621_100572535 3300006237 Bacteria 1030
212 Ga0075370_10003699 3300006353 Bacteria 7326
213 Ga0075370_10097382 3300006353 Bacteria 1701
214 Ga0075370_10137923 3300006353 Bacteria 1425
215 Ga0068871_100161649 3300006358 Bacteria 1916
216 Ga0068871_100460791 3300006358 Bacteria 1141
217 Ga0075428_100004649 3300006844 Bacteria 15195
218 Ga0075430_100040344 3300006846 Bacteria 3952
219 Ga0075431_100009945 3300006847 Bacteria 9554
220 Ga0075433_10010730 3300006852 Bacteria 7369
221 Ga0075433_10245977 3300006852 Bacteria 1587
222 Ga0075433_10522911 3300006852 Bacteria 1044
223 Ga0075434_100000017 3300006871 Bacteria 74154
224 Ga0075429_100001537 3300006880 Bacteria 18914
225 Ga0068865_100001581 3300006881 Bacteria 13309
226 Ga0068865_100003985 3300006881 Bacteria 8858
227 Ga0075436_100002716 3300006914 Bacteria 12165
228 Ga0075436_100048271 3300006914 Bacteria 2937
229 Ga0075436_100071738 3300006914 Bacteria 2395
230 Ga0097620_100008146 3300006931 Bacteria 10627
231 Ga0097620_100145492 3300006931 Bacteria 2445
232 Ga0097620_100191627 3300006931 Bacteria 2129
233 Ga0097620_100434516 3300006931 Bacteria 1409
234 Ga0097620_100749613 3300006931 Bacteria 1065
235 Ga0099823_1009149 3300006944 Bacteria 10057
236 Ga0099823_1054043 3300006944 Bacteria 2331
237 Ga0075435_100005231 3300007076 Bacteria 9030
238 Ga0075435_100007948 3300007076 Bacteria 7591
239 Ga0075435_100173911 3300007076 Bacteria 1817
240 Ga0075435_100206953 3300007076 Bacteria 1663
241 Ga0075435_100364013 3300007076 Bacteria 1241
242 Ga0105251_10000310 3300009011 Bacteria 48788
243 Ga0105251_10000535 3300009011 Bacteria 35838
244 Ga0105251_10073933 3300009011 Bacteria 1583
245 Ga0105244_10002031 3300009036 Bacteria 15588
246 Ga0105244_10019804 3300009036 Bacteria 3747
247 Ga0105250_10010698 3300009092 Bacteria 3820
248 Ga0105240_10003948 3300009093 Bacteria 22904
249 Ga0105240_10058761 3300009093 Bacteria 4800
250 Ga0105240_10080994 3300009093 Bacteria 3991
251 Ga0105240_10130020 3300009093 Bacteria 3021
252 Ga0105240_10144619 3300009093 Bacteria 2838
253 Ga0105240_10932282 3300009093 Bacteria 932
254 Ga0111539_10506858 3300009094 Bacteria 1406
255 Ga0105245_10004840 3300009098 Bacteria 11863
256 Ga0105245_10027174 3300009098 Bacteria 5041
257 Ga0105245_10254667 3300009098 Bacteria 1707
258 Ga0105245_10455132 3300009098 Bacteria 1289
259 Ga0105247_10343731 3300009101 Bacteria 1047
260 Ga0114129_10021382 3300009147 Bacteria 9183
261 Ga0114129_11225673 3300009147 Bacteria 933
262 Ga0105243_10130720 3300009148 Bacteria 2129
263 Ga0105243_10344451 3300009148 Bacteria 1366
264 Ga0105241_10099145 3300009174 Bacteria 2313
265 Ga0105241_10184882 3300009174 Bacteria 1731
266 Ga0105241_10357678 3300009174 Bacteria 1270
267 Ga0105242_10396610 3300009176 Bacteria 1286
268 Ga0105248_10010268 3300009177 Bacteria 10307
269 Ga0105248_10281918 3300009177 Bacteria 1871
270 Ga0105248_10378403 3300009177 Bacteria 1594
271 Ga0105248_10398929 3300009177 Bacteria 1549
272 Ga0105237_10004557 3300009545 Bacteria 16011
273 Ga0105237_10161966 3300009545 Bacteria 2236
274 Ga0105238_10003338 3300009551 Bacteria 16016
275 Ga0105238_10045962 3300009551 Bacteria 4409
276 Ga0105238_10053683 3300009551 Bacteria 4049
277 Ga0105238_10140446 3300009551 Bacteria 2392
278 Ga0105238_10247396 3300009551 Bacteria 1761
279 Ga0105238_10432097 3300009551 Bacteria 1312
280 Ga0105239_10009841 3300010375 Bacteria 10740
281 Ga0105239_10101564 3300010375 Bacteria 3182
282 Ga0105246_10101503 3300011119 Bacteria 2096
283 Ga0157373_10000343 3300013100 Bacteria 37673
284 Ga0157373_10001190 3300013100 Bacteria 19903
285 Ga0157373_10071969 3300013100 Bacteria 2441
286 Ga0157371_10000581 3300013102 Bacteria 43290
287 Ga0157371_10007374 3300013102 Bacteria 8910
288 Ga0157371_10070486 3300013102 Bacteria 2475
289 Ga0157371_10080221 3300013102 Bacteria 2311
290 Ga0157370_10000231 3300013104 Bacteria 71321
291 Ga0157370_10000793 3300013104 Bacteria 39742
292 Ga0157370_10001148 3300013104 Bacteria 33003
293 Ga0157370_10001426 3300013104 Bacteria 29655
294 Ga0157370_10005802 3300013104 Bacteria 13800
295 Ga0157370_10113103 3300013104 Bacteria 2537
296 Ga0157369_10003285 3300013105 Bacteria 19261
297 Ga0157369_10010253 3300013105 Bacteria 10693
298 Ga0157369_10021806 3300013105 Bacteria 7163
299 Ga0157369_10134559 3300013105 Bacteria 2617
300 Ga0157374_10117758 3300013296 Bacteria 2561
301 Ga0157378_10027353 3300013297 Bacteria 5033
302 Ga0163162_10018531 3300013306 Bacteria 6821
303 Ga0163162_10039730 3300013306 Bacteria 4703
304 Ga0157372_10000786 3300013307 Bacteria 34433
305 Ga0157372_10003322 3300013307 Bacteria 17379
306 Ga0157372_10017103 3300013307 Bacteria 7784
307 Ga0157372_10019438 3300013307 Bacteria 7322
308 Ga0157375_10004064 3300013308 Bacteria 12688
309 Ga0157375_10167475 3300013308 Bacteria 2343
310 Ga0163163_10186771 3300014325 Bacteria 2120
311 Ga0182008_10021992 3300014497 Bacteria 3269
312 Ga0157377_10259661 3300014745 Bacteria 1130
313 Ga0157376_10000749 3300014969 Bacteria 21105
314 Ga0182006_1034035 3300015261 Bacteria 2040
315 Ga0182006_1045425 3300015261 Bacteria 1709
316 Ga0182007_10004662 3300015262 Bacteria 6184
317 Ga0182007_10004882 3300015262 Bacteria 5989
318 Ga0183362_10003 3300015683 Bacteria 977584
319 Ga0163161_10027704 3300017792 Bacteria 4020
320 Ga0163161_10120022 3300017792 Bacteria 1975
321 Ga0163161_10514128 3300017792 Bacteria 977
322 Ga0206351_10768670 3300020077 Bacteria 4241
323 Ga0154015_1087227 3300020610 Bacteria 10496
324 Ga0213872_10036729 3300021361 Bacteria 2238
325 Ga0224712_10088843 3300022467 Bacteria 1291
326 Ga0209784_100003 3300025224 Bacteria 1379451
327 Ga0209784_100778 3300025224 Bacteria 7729
328 Ga0209566_100002 3300025225 Bacteria 2614868
329 Ga0209566_100519 3300025225 Bacteria 26446
330 Ga0209674_100003 3300025226 Bacteria 2196646
331 Ga0209674_100008 3300025226 Bacteria 1076909
332 Ga0209674_100011 3300025226 Bacteria 997175
333 Ga0209674_100093 3300025226 Bacteria 170423
334 Ga0209674_100384 3300025226 Bacteria 23329
335 Ga0209674_105494 3300025226 Bacteria 1862
336 Ga0209672_100002 3300025228 Bacteria 1733325
337 Ga0209147_100002 3300025229 Bacteria 2158988
338 Ga0209147_100003 3300025229 Bacteria 1733325
339 Ga0209563_100004 3300025230 Bacteria 1814108
340 Ga0209563_100010 3300025230 Bacteria 1337457
341 Ga0209563_100026 3300025230 Bacteria 559453
342 Ga0209563_101409 3300025230 Bacteria 6421
343 Ga0209563_116549 3300025230 Bacteria 904
344 Ga0207427_100178 3300025231 Bacteria 67956
345 Ga0207427_102330 3300025231 Bacteria 5233
346 Ga0209437_100304 3300025233 Bacteria 67955
347 Ga0209258_100002 3300025242 Bacteria 2158988
348 Ga0209258_100005 3300025242 Bacteria 1087938
349 Ga0209646_1000022 3300025246 Bacteria 446621
350 Ga0209646_1000053 3300025246 Bacteria 284737
351 Ga0209026_1000020 3300025250 Bacteria 376211
352 Ga0209026_1002986 3300025250 Bacteria 5852
353 Ga0209677_100013 3300025253 Bacteria 548200
354 Ga0209677_100068 3300025253 Bacteria 146135
355 Ga0209677_100182 3300025253 Bacteria 52054
356 Ga0209677_102011 3300025253 Bacteria 8080
357 Ga0209677_113567 3300025253 Bacteria 1153
358 Ga0209148_1000006 3300025254 Bacteria 1733325
359 Ga0209148_1000158 3300025254 Bacteria 140830
360 Ga0209148_1006086 3300025254 Bacteria 2658
361 Ga0209759_1000002 3300025256 Bacteria 1027596
362 Ga0209759_1000006 3300025256 Bacteria 492407
363 Ga0209759_1000017 3300025256 Bacteria 376232
364 Ga0209759_1000039 3300025256 Bacteria 256444
365 Ga0209759_1005927 3300025256 Bacteria 4178
366 Ga0209759_1006257 3300025256 Bacteria 4030
367 Ga0209759_1014699 3300025256 Bacteria 2056
368 Ga0209759_1017556 3300025256 Bacteria 1760
369 Ga0209233_1000018 3300025261 Bacteria 886857
370 Ga0209233_1000287 3300025261 Bacteria 67956
371 Ga0209565_1000329 3300025263 Bacteria 42233
372 Ga0209455_1000003 3300025272 Bacteria 1471893
373 Ga0209455_1000021 3300025272 Bacteria 699993
374 Ga0209673_1037191 3300025273 Bacteria 1434
375 Ga0209130_1006725 3300025284 Bacteria 3681
376 Ga0209675_1000070 3300025291 Bacteria 169161
377 Ga0209675_1000432 3300025291 Bacteria 33519
378 Ga0209676_1000012 3300025292 Bacteria 841431
379 Ga0209676_1000510 3300025292 Bacteria 61272
380 Ga0209025_1000497 3300025294 Bacteria 75587
381 Ga0209025_1000523 3300025294 Bacteria 73071
382 Ga0209025_1001621 3300025294 Bacteria 28120
383 Ga0209025_1006383 3300025294 Bacteria 9177
384 Ga0209025_1038722 3300025294 Bacteria 2091
385 Ga0209564_1000359 3300025295 Bacteria 84631
386 Ga0209564_1003269 3300025295 Bacteria 11306
387 Ga0209564_1003406 3300025295 Bacteria 10930
388 Ga0209564_1006995 3300025295 Bacteria 5916
389 Ga0209758_1085559 3300025297 Bacteria 939
390 Ga0209256_1000059 3300025299 Bacteria 272170
391 Ga0207426_1000014 3300025302 Bacteria 649413
392 Ga0207696_1004029 3300025711 Bacteria 6447
393 Ga0207655_1000929 3300025728 Bacteria 30419
394 Ga0207713_1000645 3300025735 Bacteria 33444
395 Ga0207713_1000683 3300025735 Bacteria 31813
396 Ga0207713_1005141 3300025735 Bacteria 8279
397 Ga0207692_10066922 3300025898 Bacteria 1879
398 Ga0207642_10009346 3300025899 Bacteria 3407
399 Ga0207642_10032057 3300025899 Bacteria 2208
400 Ga0207642_10102127 3300025899 Bacteria 1442
401 Ga0207647_10068057 3300025904 Bacteria 2156
402 Ga0207647_10071271 3300025904 Bacteria 2097
403 Ga0207647_10158916 3300025904 Bacteria 1319
404 Ga0207647_10271800 3300025904 Bacteria 969
405 Ga0207699_10040819 3300025906 Bacteria 2676
406 Ga0207645_10008797 3300025907 Bacteria 7020
407 Ga0207645_10052005 3300025907 Bacteria 2617
408 Ga0207643_10008707 3300025908 Bacteria 5443
409 Ga0207705_10238247 3300025909 Bacteria 1385
410 Ga0207705_10293620 3300025909 Bacteria 1246
411 Ga0207684_10004348 3300025910 Bacteria 13380
412 Ga0207684_10045442 3300025910 Bacteria 3725
413 Ga0207684_10190386 3300025910 Bacteria 1769
414 Ga0207654_10028858 3300025911 Bacteria 3029
415 Ga0207707_10003189 3300025912 Bacteria 14562
416 Ga0207707_10013605 3300025912 Bacteria 7095
417 Ga0207695_10003684 3300025913 Bacteria 21345
418 Ga0207695_10003938 3300025913 Bacteria 20542
419 Ga0207695_10021676 3300025913 Bacteria 7324
420 Ga0207671_10009421 3300025914 Bacteria 8166
421 Ga0207671_10072048 3300025914 Bacteria 2578
422 Ga0207671_10104147 3300025914 Bacteria 2152
423 Ga0207671_10481882 3300025914 Bacteria 989
424 Ga0207693_10027941 3300025915 Bacteria 4459
425 Ga0207660_10066257 3300025917 Bacteria 2612
426 Ga0207660_10652275 3300025917 Bacteria 858
427 Ga0207657_10005082 3300025919 Bacteria 13794
428 Ga0207657_10017667 3300025919 Bacteria 6835
429 Ga0207657_10055701 3300025919 Bacteria 3414
430 Ga0207657_10111763 3300025919 Bacteria 2255
431 Ga0207657_10247656 3300025919 Bacteria 1421
432 Ga0207649_10000019 3300025920 Bacteria 212682
433 Ga0207649_10050514 3300025920 Bacteria 2572
434 Ga0207652_10122396 3300025921 Bacteria 2315
435 Ga0207652_10366994 3300025921 Bacteria 1299
436 Ga0207646_10037315 3300025922 Bacteria 4382
437 Ga0207681_10040191 3300025923 Bacteria 3111
438 Ga0207681_10087007 3300025923 Bacteria 2222
439 Ga0207694_10006699 3300025924 Bacteria 8755
440 Ga0207694_10006875 3300025924 Bacteria 8642
441 Ga0207694_10057876 3300025924 Bacteria 3015
442 Ga0207694_10147202 3300025924 Bacteria 1896
443 Ga0207659_10073745 3300025926 Bacteria 2500
444 Ga0207659_10082794 3300025926 Bacteria 2377
445 Ga0207659_10308861 3300025926 Bacteria 1301
446 Ga0207687_10017964 3300025927 Bacteria 4666
447 Ga0207700_10082586 3300025928 Bacteria 2513
448 Ga0207664_10000623 3300025929 Bacteria 24532
449 Ga0207664_10021689 3300025929 Bacteria 4783
450 Ga0207664_10122269 3300025929 Bacteria 2180
451 Ga0207644_10050002 3300025931 Bacteria 2995
452 Ga0207644_10097307 3300025931 Bacteria 2204
453 Ga0207644_10114059 3300025931 Bacteria 2047
454 Ga0207690_10002850 3300025932 Bacteria 10427
455 Ga0207690_10005091 3300025932 Bacteria 7763
456 Ga0207690_10025068 3300025932 Bacteria 3741
457 Ga0207690_10041312 3300025932 Bacteria 3021
458 Ga0207690_10109325 3300025932 Bacteria 1989
459 Ga0207706_10264824 3300025933 Bacteria 1500
460 Ga0207686_10444501 3300025934 Bacteria 996
461 Ga0207709_10079700 3300025935 Bacteria 2106
462 Ga0207709_10155749 3300025935 Bacteria 1588
463 Ga0207709_10158805 3300025935 Bacteria 1574
464 Ga0207669_10188141 3300025937 Bacteria 1487
465 Ga0207669_10233431 3300025937 Bacteria 1359
466 Ga0207704_10001999 3300025938 Bacteria 9144
467 Ga0207704_10064958 3300025938 Bacteria 2283
468 Ga0207704_10189078 3300025938 Bacteria 1496
469 Ga0207665_10085295 3300025939 Bacteria 2180
470 Ga0207665_10177530 3300025939 Bacteria 1541
471 Ga0207691_10012480 3300025940 Bacteria 8146
472 Ga0207691_10019512 3300025940 Bacteria 6415
473 Ga0207691_10038079 3300025940 Bacteria 4449
474 Ga0207691_10263627 3300025940 Bacteria 1485
475 Ga0207711_10033488 3300025941 Bacteria 4347
476 Ga0207711_10068436 3300025941 Bacteria 3075
477 Ga0207689_10002136 3300025942 Bacteria 18609
478 Ga0207689_10008782 3300025942 Bacteria 8784
479 Ga0207689_10035448 3300025942 Bacteria 4145
480 Ga0207689_10068994 3300025942 Bacteria 2905
481 Ga0207689_10142432 3300025942 Bacteria 1975
482 Ga0207689_10542224 3300025942 Bacteria 977
483 Ga0207661_10076842 3300025944 Bacteria 2744
484 Ga0207661_10186039 3300025944 Bacteria 1818
485 Ga0207661_10221943 3300025944 Bacteria 1671
486 Ga0207679_10000001 3300025945 Bacteria 777444
487 Ga0207667_10001689 3300025949 Bacteria 27781
488 Ga0207667_10016473 3300025949 Bacteria 8352
489 Ga0207667_10073979 3300025949 Bacteria 3539
490 Ga0207667_10141834 3300025949 Bacteria 2474
491 Ga0207651_10143199 3300025960 Bacteria 1849
492 Ga0207668_10184148 3300025972 Bacteria 1650
493 Ga0207640_10000075 3300025981 Bacteria 77684
494 Ga0207640_10014541 3300025981 Bacteria 4534
495 Ga0207640_10037321 3300025981 Bacteria 3056
496 Ga0207640_10064746 3300025981 Bacteria 2436
497 Ga0207658_10127376 3300025986 Bacteria 2040
498 Ga0207639_10031041 3300026041 Bacteria 3924
499 Ga0207678_10000004 3300026067 Bacteria 196743
500 Ga0207678_10043149 3300026067 Bacteria 3904
501 Ga0207708_10004997 3300026075 Bacteria 9769
502 Ga0207708_10022743 3300026075 Bacteria 4734
503 Ga0207708_10180002 3300026075 Bacteria 1678
504 Ga0207702_10000029 3300026078 Bacteria 181652
505 Ga0207702_10000329 3300026078 Bacteria 54291
506 Ga0207702_10000372 3300026078 Bacteria 51212
507 Ga0207702_10006444 3300026078 Bacteria 10119
508 Ga0207702_10137731 3300026078 Bacteria 2205
509 Ga0207641_10108372 3300026088 Bacteria 2458
510 Ga0207641_10114442 3300026088 Bacteria 2397
511 Ga0207641_10172380 3300026088 Bacteria 1976
512 Ga0207641_10502809 3300026088 Bacteria 1177
513 Ga0207648_10000182 3300026089 Bacteria 66368
514 Ga0207648_10010471 3300026089 Bacteria 8785
515 Ga0207648_10034900 3300026089 Bacteria 4434
516 Ga0207648_10038420 3300026089 Bacteria 4212
517 Ga0207648_10352453 3300026089 Bacteria 1327
518 Ga0207676_10036715 3300026095 Bacteria 3730
519 Ga0207676_10046087 3300026095 Bacteria 3372
520 Ga0207676_10078051 3300026095 Bacteria 2681
521 Ga0207674_10000039 3300026116 Bacteria 131096
522 Ga0207674_10005988 3300026116 Bacteria 14395
523 Ga0207674_10021683 3300026116 Bacteria 6916
524 Ga0207674_10051345 3300026116 Bacteria 4208
525 Ga0207674_10086467 3300026116 Bacteria 3130
526 Ga0207674_10231818 3300026116 Bacteria 1794
527 Ga0207674_10303224 3300026116 Bacteria 1546
528 Ga0207674_10431512 3300026116 Bacteria 1273
529 Ga0207674_10434343 3300026116 Bacteria 1269
530 Ga0207675_100000551 3300026118 Bacteria 36576
531 Ga0207675_100004383 3300026118 Bacteria 13642
532 Ga0207675_100013693 3300026118 Bacteria 7570
533 Ga0207675_100121252 3300026118 Bacteria 2474
534 Ga0207683_10070861 3300026121 Bacteria 3080
535 Ga0207683_10145182 3300026121 Bacteria 2139
536 Ga0207683_10151342 3300026121 Bacteria 2094
537 Ga0207683_10190368 3300026121 Bacteria 1862
538 Ga0207683_10341837 3300026121 Bacteria 1373
539 Ga0207698_10013356 3300026142 Bacteria 5415
540 Ga0207698_10067203 3300026142 Bacteria 2826
541 Ga0207698_10253432 3300026142 Bacteria 1612
542 Ga0209389_1000049 3300027296 Bacteria 114702
543 Ga0209389_1061539 3300027296 Bacteria 2299
544 Ga0209371_1004494 3300027312 Bacteria 6024
545 Ga0209967_1013142 3300027364 Bacteria 1173
546 Ga0210000_1007935 3300027462 Bacteria 1556
547 Ga0209999_1011598 3300027543 Bacteria 1596
548 Ga0209999_1049948 3300027543 Bacteria 789
549 Ga0209813_10005511 3300027866 Bacteria 3074
550 Ga0268266_10135471 3300028379 Bacteria 2205
551 Ga0268265_10149376 3300028380 Bacteria 1969
552 Ga0268265_10236792 3300028380 Bacteria 1608
553 Ga0268265_10493721 3300028380 Bacteria 1152
554 Ga0268264_10002391 3300028381 Bacteria 16541
555 Ga0265322_10007930 3300028654 Bacteria 3096
556 Ga0307517_10002408 3300028786 Bacteria 29985
557 Ga0307515_10000064 3300028794 Bacteria 245452
558 Ga0307515_10127990 3300028794 Bacteria 2820
559 Ga0265338_10232933 3300028800 Bacteria 1368
560 Ga0268256_1004255 3300030500 Bacteria 6024
561 Ga0307512_10238470 3300030522 Bacteria 924
562 Ga0316178_1108561 3300030735 Bacteria 985
563 Ga0265320_10090829 3300031240 Bacteria 1415
564 Ga0265339_10073221 3300031249 Bacteria 1822
565 Ga0307513_10010724 3300031456 Bacteria 11459
566 Ga0307513_10114676 3300031456 Bacteria 2679
567 Ga0307513_10197551 3300031456 Bacteria 1856
568 Ga0307509_10000006 3300031507 Bacteria 421538
569 Ga0307408_100013852 3300031548 Bacteria 5354
570 Ga0307408_100184017 3300031548 Bacteria 1678
571 Ga0307408_100555674 3300031548 Bacteria 1013
572 Ga0307508_10002237 3300031616 Bacteria 20629
573 Ga0307508_10006263 3300031616 Bacteria 11207
574 Ga0316575_10023346 3300031665 Bacteria 2391
575 Ga0316575_10070842 3300031665 Bacteria 1400
576 Ga0316575_10083207 3300031665 Bacteria 1292
577 Ga0316579_10005579 3300031691 Bacteria 5090
578 Ga0316579_10009237 3300031691 Bacteria 4142
579 Ga0316579_10050038 3300031691 Bacteria 1953
580 Ga0316579_10171275 3300031691 Bacteria 1049
581 Ga0316576_10002913 3300031727 Bacteria 9895
582 Ga0316576_10013079 3300031727 Bacteria 5504
583 Ga0316576_10125768 3300031727 Bacteria 1926
584 Ga0316576_10180663 3300031727 Bacteria 1591
585 Ga0316578_10032042 3300031728 Bacteria 2999
586 Ga0316578_10106809 3300031728 Bacteria 1680
587 Ga0316578_10254800 3300031728 Bacteria 1052
588 Ga0307516_10007080 3300031730 Bacteria 12966
589 Ga0307405_10013627 3300031731 Bacteria 4342
590 Ga0307405_10310766 3300031731 Bacteria 1200
591 Ga0316577_10004863 3300031733 Bacteria 6991
592 Ga0307413_10237804 3300031824 Bacteria 1342
593 Ga0307410_10043289 3300031852 Bacteria 2982
594 Ga0307410_10637176 3300031852 Bacteria 893
595 Ga0307406_10021397 3300031901 Bacteria 3824
596 Ga0307407_10060527 3300031903 Bacteria 2210
597 Ga0307412_10000002 3300031911 Bacteria 743446
598 Ga0307412_10010556 3300031911 Bacteria 5321
599 Ga0307412_10587633 3300031911 Bacteria 941
600 Ga0307409_100000809 3300031995 Bacteria 14331
601 Ga0307416_100088614 3300032002 Bacteria 2646
602 Ga0307416_100324319 3300032002 Bacteria 1544
603 Ga0307416_100674810 3300032002 Bacteria 1120
604 Ga0307414_10012037 3300032004 Bacteria 5102
605 Ga0307414_10648893 3300032004 Bacteria 951
606 Ga0307411_10031177 3300032005 Bacteria 3276
607 Ga0307415_100041952 3300032126 Bacteria 3041
608 Ga0316583_10001362 3300032133 Bacteria 8106
609 Ga0316583_10014049 3300032133 Bacteria 2888
610 Ga0316583_10016175 3300032133 Bacteria 2685
611 Ga0316583_10021236 3300032133 Bacteria 2328
612 Ga0316583_10043530 3300032133 Bacteria 1586
613 Ga0316583_10094751 3300032133 Bacteria 1041
614 Ga0316583_10099391 3300032133 Bacteria 1014
615 Ga0316585_10000290 3300032137 Bacteria 11116
616 Ga0316585_10011720 3300032137 Bacteria 2588
617 Ga0316585_10117627 3300032137 Bacteria 874
618 Ga0316585_10135490 3300032137 Bacteria 812
619 Ga0316580_10000157 3300032139 Bacteria 13310
620 Ga0316580_10044320 3300032139 Bacteria 1372
621 Ga0316580_10047899 3300032139 Bacteria 1317
622 Ga0316593_10068839 3300032168 Bacteria 1222
623 Ga0307510_10151238 3300033180 Bacteria 1939
624 Ga0316592_1006013 3300033524 Bacteria 2325
625 Ga0316586_1006816 3300033527 Bacteria 1650
626 Ga0316586_1007859 3300033527 Bacteria 1565
627 Ga0316588_1020477 3300033528 Bacteria 1498
628 Ga0316588_1027539 3300033528 Bacteria 1321
629 Ga0316587_1000057 3300033529 Bacteria 7359
630 Ga0316587_1024685 3300033529 Bacteria 1041
631 Ga0373928_0003096 3300035084 Bacteria 3191
632 Ga0373934_0009488 3300035086 Bacteria 3644
633 Ga0373952_0038233 3300035092 Bacteria 1098
634 Ga0373932_0025572 3300035112 Bacteria 1599
635 Ga0373960_0027298 3300035121 Bacteria 1566
636 Ga0316574_0000225 3300035398 Bacteria 20257
637 Ga0316574_0003552 3300035398 Bacteria 8054
638 Ga0316574_0009834 3300035398 Bacteria 5376
639 Ga0316574_0062328 3300035398 Bacteria 2343
640 Ga0316574_0091683 3300035398 Bacteria 1938
641 Ga0316574_0126052 3300035398 Bacteria 1646
642 Ga0316574_0236375 3300035398 Bacteria 1169
643 Ga0373931_0029715 3300035691 Bacteria 2808
644 Ga0373927_0080785 3300035695 Bacteria 2107
645 Ga0373947_0212444 3300035725 Bacteria 1269
646 Ga0373937_0208968 3300036401 Bacteria 1836
647 Ga0316582_0001690 3300036647 Bacteria 9909
648 Ga0316582_0017225 3300036647 Bacteria 4175
649 Ga0316582_0024606 3300036647 Bacteria 3605
650 Ga0316582_0046102 3300036647 Bacteria 2747
651 Ga0316582_0086998 3300036647 Bacteria 2050
652 Ga0316582_0150293 3300036647 Bacteria 1574
653 Ga0316582_0217018 3300036647 Bacteria 1307
654 Ga0316584_0007976 3300036712 Bacteria 7268
655 Ga0316584_0017393 3300036712 Bacteria 5167
656 Ga0316584_0017889 3300036712 Bacteria 5105
657 Ga0316584_0071470 3300036712 Bacteria 2600
658 Ga0373925_0041188 3300037068 Bacteria 3423
659 Ga0373925_0065704 3300037068 Bacteria 2733
660 Ga0395899_0100586 3300037312 Bacteria 2088
661 Ga0395899_0217452 3300037312 Bacteria 1325
662 Ga0395900_0024931 3300037418 Bacteria 6121
663 Ga0395900_0249370 3300037418 Bacteria 1777
664 Ga0395898_0023842 3300037466 Bacteria 6177
665 Ga0395898_0043495 3300037466 Bacteria 4425
666 Ga0395905_0000138 3300037471 Bacteria 120373
667 Ga0395905_0003472 3300037471 Bacteria 16849
668 Ga0395905_0159089 3300037471 Bacteria 2123
669 Ga0395905_0363120 3300037471 Bacteria 1341
670 Ga0316581_0001652 3300037588 Bacteria 5115
671 Ga0316581_0031622 3300037588 Bacteria 1595
672 Ga0316581_0059572 3300037588 Bacteria 1171
673 Ga0395901_0006496 3300038443 Bacteria 11832
674 Ga0395901_0015232 3300038443 Bacteria 7824
675 Ga0395901_0020917 3300038443 Bacteria 6703
676 Ga0400488_40734 3300038741 Bacteria 3880
677 Ga0400486_17590 3300038742 Bacteria 2824
678 Ga0436361_0708871 3300039447 Bacteria 7065
679 Ga0436361_0763281 3300039447 Bacteria 9370
680 Ga0439436_0001760 3300041404 Bacteria 6358
681 Ga0439436_0003056 3300041404 Bacteria 5078
682 Ga0451793_0511053 3300041452 Bacteria 1982
683 Ga0451853_3433684 3300041512 Bacteria 1759
684 Ga0439431_0000936 3300041997 Bacteria 6335
685 Ga0439442_024145 3300042002 Bacteria 1264
686 Ga0439445_0004691 3300042004 Bacteria 3099
687 Ga0439432_000932 3300042006 Bacteria 11004
688 Ga0439432_031900 3300042006 Bacteria 1702
689 Ga0439449_0006682 3300042007 Bacteria 4405
690 Ga0439449_0031638 3300042007 Bacteria 1972
691 Ga0439452_023416 3300042010 Bacteria 1590
692 Ga0439456_000104 3300042013 Bacteria 28208
693 Ga0439462_0039943 3300042015 Bacteria 1251
694 Ga0450900_001178 3300042136 Bacteria 2458
695 Ga0450902_001457 3300042137 Bacteria 3227
696 Ga0450905_000527 3300042142 Bacteria 4692
697 Ga0450909_020936 3300042185 Bacteria 976
698 Ga0439434_0000294 3300042435 Bacteria 14301
699 Ga0439434_0009557 3300042435 Bacteria 2853
700 Ga0439435_0000060 3300042436 Bacteria 12857
701 Ga0439459_0002959 3300042438 Bacteria 2660
702 Ga0450901_000469 3300042533 Bacteria 4800
703 Ga0451577_0004111 3300042876 Bacteria 15600
704 Ga0451577_0004145 3300042876 Bacteria 15530
705 Ga0451577_0243287 3300042876 Bacteria 1628
706 Ga0451577_0270863 3300042876 Bacteria 1538
707 Ga0451577_0329272 3300042876 Bacteria 1385
708 Ga0451577_0359880 3300042876 Bacteria 1320
709 Ga0466969_0032581 3300044656 Bacteria 2649
710 Ga0466972_0000094 3300044658 Bacteria 78156
711 Ga0466972_0013727 3300044658 Bacteria 4064
712 Ga0466972_0175521 3300044658 Bacteria 1005
713 Ga0466978_0021228 3300044671 Bacteria 3839
714 Ga0466982_0194935 3300044672 Bacteria 1217
715 Ga0453683_0005236 3300044673 Bacteria 9081
716 Ga0453683_0077912 3300044673 Bacteria 2076
717 Ga0466966_0366941 3300044684 Bacteria 865
718 Ga0466961_0002119 3300044693 Bacteria 12342
719 Ga0466963_0133434 3300044694 Bacteria 1717
720 Ga0466964_0011262 3300044706 Bacteria 3378
721 Ga0453684_0000039 3300044712 Bacteria 697730
722 Ga0453684_0000209 3300044712 Bacteria 255543
723 Ga0453684_0003587 3300044712 Bacteria 34638
724 Ga0453684_0005764 3300044712 Bacteria 24186
725 Ga0453684_0023208 3300044712 Bacteria 9152
726 Ga0453684_0037047 3300044712 Bacteria 6702
727 Ga0453684_0038797 3300044712 Bacteria 6501
728 Ga0453684_0047956 3300044712 Bacteria 5656
729 Ga0453684_0100394 3300044712 Bacteria 3542
730 Ga0453684_0141098 3300044712 Bacteria 2877
731 Ga0453684_0258833 3300044712 Bacteria 1994
732 Ga0453684_0263642 3300044712 Bacteria 1972
733 Ga0453684_0746219 3300044712 Bacteria 1060
734 Ga0466968_0139078 3300044735 Bacteria 1109
735 Ga0466957_0066210 3300044842 Bacteria 2226
736 Ga0466957_0129625 3300044842 Bacteria 1615
737 Ga0466959_0000328 3300045049 Bacteria 28046
738 Ga0451576_0069652 3300045051 Bacteria 3661
739 Ga0451576_0077326 3300045051 Bacteria 3463
740 Ga0451576_0188454 3300045051 Bacteria 2154
741 Ga0451576_0362614 3300045051 Bacteria 1518
742 Ga0451576_0497406 3300045051 Bacteria 1281
743 Ga0451576_0525702 3300045051 Bacteria 1243
744 Ga0466967_0041666 3300045976 Bacteria 3961
745 Ga0495617_000539 3300046452 Bacteria 19621
746 Ga0495592_0005128 3300046454 Bacteria 9649
747 Ga0495603_0072371 3300046455 Bacteria 2025
748 Ga0495590_0000008 3300046457 Bacteria 330520
749 Ga0495590_0000564 3300046457 Bacteria 17568
750 Ga0495590_0001807 3300046457 Bacteria 9062
751 Ga0495590_0022344 3300046457 Bacteria 2237
752 Ga0495590_0039449 3300046457 Bacteria 1647
753 Ga0495590_0099089 3300046457 Bacteria 1035
754 Ga0495591_000043 3300046458 Bacteria 148885
755 Ga0495591_006006 3300046458 Bacteria 5476
756 Ga0495629_0000068 3300046459 Bacteria 92619
757 Ga0495629_0002001 3300046459 Bacteria 15835
758 Ga0495629_0008667 3300046459 Bacteria 7490
759 Ga0495629_0010808 3300046459 Bacteria 6640
760 Ga0495638_0000142 3300046460 Bacteria 113893
761 Ga0495638_0006804 3300046460 Bacteria 8256
762 Ga0495638_0015524 3300046460 Bacteria 5113
763 Ga0495641_0029655 3300046461 Bacteria 2634
764 Ga0495651_0002428 3300046462 Bacteria 14382
765 Ga0495651_0033735 3300046462 Bacteria 3992
766 Ga0495651_0100947 3300046462 Bacteria 2149
767 Ga0495653_0000106 3300046463 Bacteria 69465
768 Ga0495653_0028519 3300046463 Bacteria 4463
769 Ga0495653_0038059 3300046463 Bacteria 3776
770 Ga0495653_0110105 3300046463 Bacteria 1980
771 Ga0495653_0150697 3300046463 Bacteria 1625
772 Ga0495650_0002257 3300046471 Bacteria 16099
773 Ga0495650_0029397 3300046471 Bacteria 2505
774 Ga0495580_0000062 3300046472 Bacteria 63605
775 Ga0495580_0003904 3300046472 Bacteria 12596
776 Ga0495580_0004329 3300046472 Bacteria 11920
777 Ga0495580_0025177 3300046472 Bacteria 4349
778 Ga0495580_0027318 3300046472 Bacteria 4153
779 Ga0495580_0068274 3300046472 Bacteria 2486
780 Ga0495580_0115496 3300046472 Bacteria 1864
781 Ga0495580_0179619 3300046472 Bacteria 1461
782 Ga0495582_0007318 3300046473 Bacteria 6117
783 Ga0495582_0021578 3300046473 Bacteria 3523
784 Ga0495582_0070828 3300046473 Bacteria 1929
785 Ga0495605_0004132 3300046474 Bacteria 8554
786 Ga0495605_0017063 3300046474 Bacteria 3919
787 Ga0495605_0103072 3300046474 Bacteria 1309
788 Ga0495639_0023188 3300046475 Bacteria 2726
789 Ga0495664_0029571 3300046477 Bacteria 3205
790 Ga0495584_0000017 3300046491 Bacteria 149686
791 Ga0495584_0000025 3300046491 Bacteria 116731
792 Ga0495584_0001098 3300046491 Bacteria 16805
793 Ga0495584_0002329 3300046491 Bacteria 10825
794 Ga0495584_0027660 3300046491 Bacteria 2873
795 Ga0495584_0200006 3300046491 Bacteria 1016
796 Ga0495585_0000064 3300046492 Bacteria 109302
797 Ga0495585_0000254 3300046492 Bacteria 54984
798 Ga0495585_0002313 3300046492 Bacteria 13727
799 Ga0495585_0010392 3300046492 Bacteria 5542
800 Ga0495585_0011365 3300046492 Bacteria 5268
801 Ga0495585_0065670 3300046492 Bacteria 1987
802 Ga0495594_0056756 3300046499 Bacteria 2162
803 Ga0495596_0002354 3300046500 Bacteria 10230
804 Ga0495596_0019412 3300046500 Bacteria 2792
805 Ga0495596_0042249 3300046500 Bacteria 1796
806 Ga0495607_0009729 3300046501 Bacteria 6489
807 Ga0495583_0000160 3300046506 Bacteria 113560
808 Ga0495583_0000512 3300046506 Bacteria 55428
809 Ga0495583_0009872 3300046506 Bacteria 5647
810 Ga0495606_0003064 3300046507 Bacteria 18209
811 Ga0495606_0009929 3300046507 Bacteria 7970
812 Ga0495606_0059816 3300046507 Bacteria 2443
813 Ga0495606_0082712 3300046507 Bacteria 1992
814 Ga0495606_0175631 3300046507 Bacteria 1239
815 Ga0495606_0261742 3300046507 Bacteria 954
816 Ga0495608_0002682 3300046511 Bacteria 12786
817 Ga0495610_0000364 3300046512 Bacteria 47361
818 Ga0495610_0000809 3300046512 Bacteria 29337
819 Ga0495616_0004568 3300046513 Bacteria 8713
820 Ga0495616_0022287 3300046513 Bacteria 3420
821 Ga0495616_0092297 3300046513 Bacteria 1431
822 Ga0495618_0012154 3300046514 Bacteria 5226
823 Ga0495618_0034021 3300046514 Bacteria 3194
824 Ga0495620_0011969 3300046515 Bacteria 4506
825 Ga0495628_0056824 3300046516 Bacteria 3079
826 Ga0495628_0126295 3300046516 Bacteria 1959
827 Ga0495628_0261871 3300046516 Bacteria 1288
828 Ga0495630_0011461 3300046517 Bacteria 6419
829 Ga0495630_0054506 3300046517 Bacteria 2996
830 Ga0495630_0072540 3300046517 Bacteria 2591
831 Ga0495630_0079545 3300046517 Bacteria 2472
832 Ga0495631_0000113 3300046518 Bacteria 54471
833 Ga0495631_0019345 3300046518 Bacteria 3194
834 Ga0495631_0026301 3300046518 Bacteria 2674
835 Ga0495631_0033090 3300046518 Bacteria 2324
836 Ga0495632_0010626 3300046519 Bacteria 5432
837 Ga0495632_0025004 3300046519 Bacteria 3164
838 Ga0495637_0000009 3300046520 Bacteria 402028
839 Ga0495637_0037169 3300046520 Bacteria 2116
840 Ga0495643_0069400 3300046522 Bacteria 1852
841 Ga0495644_0002495 3300046523 Bacteria 7342
842 Ga0495644_0041412 3300046523 Bacteria 1734
843 Ga0495648_0000007 3300046524 Bacteria 347305
844 Ga0495648_0000856 3300046524 Bacteria 32108
845 Ga0495648_0001462 3300046524 Bacteria 23121
846 Ga0495648_0005631 3300046524 Bacteria 10371
847 Ga0495648_0013118 3300046524 Bacteria 6143
848 Ga0495648_0106806 3300046524 Bacteria 1531
849 Ga0495666_0001428 3300046526 Bacteria 11597
850 Ga0495666_0007370 3300046526 Bacteria 5515
851 Ga0495666_0014337 3300046526 Bacteria 3947
852 Ga0495666_0014921 3300046526 Bacteria 3867
853 Ga0495666_0029789 3300046526 Bacteria 2684
854 Ga0495642_0033608 3300046528 Bacteria 2062
855 Ga0495642_0069831 3300046528 Bacteria 1468
856 Ga0495642_0144332 3300046528 Bacteria 1028
857 Ga0495652_0077689 3300046529 Bacteria 2750
858 Ga0495652_0166659 3300046529 Bacteria 1704
859 Ga0495652_0207008 3300046529 Bacteria 1484
860 Ga0495665_0021697 3300046531 Bacteria 3452
861 Ga0495665_0040356 3300046531 Bacteria 2485
862 Ga0495665_0052825 3300046531 Bacteria 2150
863 Ga0495665_0068412 3300046531 Bacteria 1872
864 Ga0495640_0002419 3300046533 Bacteria 14983
865 Ga0495640_0012920 3300046533 Bacteria 6365
866 Ga0495640_0049451 3300046533 Bacteria 2899
867 Ga0495586_0022459 3300046535 Bacteria 3367
868 Ga0495586_0064202 3300046535 Bacteria 2000
869 Ga0495586_0082798 3300046535 Bacteria 1765
870 Ga0495586_0087580 3300046535 Bacteria 1717
871 Ga0495587_0001498 3300046536 Bacteria 15536
872 Ga0495598_0051159 3300046537 Bacteria 1244
873 Ga0495609_0079327 3300046538 Bacteria 1436
874 Ga0495621_0025804 3300046539 Bacteria 1977
875 Ga0495597_0000958 3300046542 Bacteria 22301
876 Ga0495597_0090184 3300046542 Bacteria 1302
877 Ga0495645_0049738 3300046543 Bacteria 3052
878 Ga0495645_0095348 3300046543 Bacteria 2121
879 Ga0495622_0000005 3300046557 Bacteria 254434
880 Ga0495633_0001467 3300046558 Bacteria 18303
881 Ga0495633_0002408 3300046558 Bacteria 13218
882 Ga0495633_0008090 3300046558 Bacteria 5969
883 Ga0495633_0013815 3300046558 Bacteria 4239
884 Ga0495633_0015441 3300046558 Bacteria 3962
885 Ga0495633_0038594 3300046558 Bacteria 2280
886 Ga0495656_0035858 3300046615 Bacteria 2040
887 Ga0495668_0021800 3300046616 Bacteria 3667
888 Ga0495668_0030352 3300046616 Bacteria 3052
889 Ga0495668_0078425 3300046616 Bacteria 1813
890 Ga0495634_0001826 3300046642 Bacteria 18400
891 Ga0495634_0014590 3300046642 Bacteria 5660
892 Ga0495634_0123621 3300046642 Bacteria 1655
893 Ga0495611_0000361 3300046648 Bacteria 29629
894 Ga0495611_0002708 3300046648 Bacteria 7988
895 Ga0495611_0055084 3300046648 Bacteria 1798
896 Ga0495611_0090398 3300046648 Bacteria 1415
897 Ga0495625_0050710 3300046660 Bacteria 2977
898 Ga0495625_0054646 3300046660 Bacteria 2851
899 Ga0495635_0006638 3300046663 Bacteria 8079
900 Ga0495635_0038217 3300046663 Bacteria 3323
901 Ga0495661_0000725 3300046665 Bacteria 32331
902 Ga0495661_0004554 3300046665 Bacteria 9986
903 Ga0495661_0008840 3300046665 Bacteria 6945
904 Ga0495661_0009821 3300046665 Bacteria 6546
905 Ga0495661_0018782 3300046665 Bacteria 4540
906 Ga0495661_0037601 3300046665 Bacteria 3020
907 Ga0495661_0043099 3300046665 Bacteria 2776
908 Ga0495661_0045031 3300046665 Bacteria 2700
909 Ga0495661_0076162 3300046665 Bacteria 1947
910 Ga0495588_0111560 3300046674 Bacteria 1440
911 Ga0495657_0053248 3300046675 Bacteria 2709
912 Ga0495599_0009080 3300046678 Bacteria 6059
913 Ga0495599_0016433 3300046678 Bacteria 4593
914 Ga0495599_0032937 3300046678 Bacteria 3254
915 Ga0495623_0019454 3300046679 Bacteria 4388
916 Ga0495623_0036214 3300046679 Bacteria 3162
917 Ga0495623_0070802 3300046679 Bacteria 2171
918 Ga0495646_0024982 3300046680 Bacteria 3759
919 Ga0495646_0038413 3300046680 Bacteria 2956
920 Ga0495646_0038578 3300046680 Bacteria 2948
921 Ga0495646_0053415 3300046680 Bacteria 2436
922 Ga0495647_0057608 3300046681 Bacteria 1526
923 Ga0495613_0007287 3300046689 Bacteria 8236
924 Ga0495613_0010933 3300046689 Bacteria 6737
925 Ga0495624_0002899 3300046690 Bacteria 12825
926 Ga0495624_0009904 3300046690 Bacteria 6587
927 Ga0495624_0014833 3300046690 Bacteria 5277
928 Ga0495624_0015212 3300046690 Bacteria 5203
929 Ga0495624_0026356 3300046690 Bacteria 3810
930 Ga0495624_0101477 3300046690 Bacteria 1771
931 Ga0495670_0000157 3300046691 Bacteria 29533
932 Ga0495670_0000977 3300046691 Bacteria 13866
933 Ga0495670_0118806 3300046691 Bacteria 1372
934 Ga0495671_0012253 3300046692 Bacteria 4688
935 Ga0495671_0230959 3300046692 Bacteria 895
936 Ga0495649_0000028 3300046694 Bacteria 163229
937 Ga0495649_0004750 3300046694 Bacteria 8809
938 Ga0495649_0004753 3300046694 Bacteria 8808
939 Ga0495649_0037773 3300046694 Bacteria 2650
940 Ga0495649_0044469 3300046694 Bacteria 2424
941 Ga0495589_0003956 3300046794 Bacteria 7952
942 Ga0495589_0014700 3300046794 Bacteria 4027
943 Ga0495600_0039056 3300046809 Bacteria 3090
944 Ga0495660_0039201 3300046810 Bacteria 2631
945 Ga0495660_0045872 3300046810 Bacteria 2398
946 Ga0495581_0000974 3300047315 Bacteria 15397
947 Ga0495581_0037611 3300047315 Bacteria 2801
948 Ga0495581_0084374 3300047315 Bacteria 1840
949 Ga0495604_0009687 3300047317 Bacteria 7618
950 Ga0495604_0012629 3300047317 Bacteria 6718
951 Ga0495604_0028630 3300047317 Bacteria 4432
952 Ga0495604_0135107 3300047317 Bacteria 1768
953 Ga0495674_0050129 3300047319 Bacteria 3684
954 Ga0495674_0051499 3300047319 Bacteria 3629
955 Ga0495674_0079072 3300047319 Bacteria 2824
956 Ga0495674_0108638 3300047319 Bacteria 2353
957 Ga0495672_0000055 3300047320 Bacteria 229428
958 Ga0495676_0033008 3300047321 Bacteria 4364
959 Ga0495676_0058821 3300047321 Bacteria 3022
960 Ga0495676_0068060 3300047321 Bacteria 2752
961 Ga0495676_0074321 3300047321 Bacteria 2603
962 Ga0495680_0009459 3300047322 Bacteria 8764
963 Ga0495680_0014461 3300047322 Bacteria 6833
964 Ga0495680_0041629 3300047322 Bacteria 3651
965 Ga0495680_0105528 3300047322 Bacteria 2095
966 Ga0495680_0128226 3300047322 Bacteria 1866
967 Ga0495683_0000047 3300047323 Bacteria 126770
968 Ga0495683_0000179 3300047323 Bacteria 62241
969 Ga0495683_0002007 3300047323 Bacteria 12647
970 Ga0495683_0002296 3300047323 Bacteria 11659
971 Ga0495683_0008170 3300047323 Bacteria 5614
972 Ga0495683_0128263 3300047323 Bacteria 1198
973 Ga0495683_0142726 3300047323 Bacteria 1121
974 Ga0495687_003337 3300047443 Bacteria 11742
975 Ga0495687_016328 3300047443 Bacteria 3735
976 Ga0495687_054667 3300047443 Bacteria 1674
977 Ga0495675_0001779 3300047444 Bacteria 12842
978 Ga0495675_0002004 3300047444 Bacteria 12163
979 Ga0495675_0002575 3300047444 Bacteria 10866
980 Ga0495675_0220366 3300047444 Bacteria 1148
981 Ga0495677_0000105 3300047445 Bacteria 41592
982 Ga0495677_0000234 3300047445 Bacteria 25123
983 Ga0495679_000009 3300047446 Bacteria 343637
984 Ga0495679_000272 3300047446 Bacteria 43249
985 Ga0495679_005087 3300047446 Bacteria 5901
986 Ga0495679_033950 3300047446 Bacteria 1626
987 Ga0495685_001131 3300047447 Bacteria 8166
988 Ga0495673_0003578 3300047469 Bacteria 10194
989 Ga0495681_0001995 3300047470 Bacteria 14918
990 Ga0495681_0010188 3300047470 Bacteria 5708
991 Ga0495686_0003031 3300047472 Bacteria 14902
992 Ga0495686_0046261 3300047472 Bacteria 2751
993 Ga0495593_0006303 3300047673 Bacteria 6958
994 Ga0495593_0012286 3300047673 Bacteria 4894
995 Ga0495593_0057511 3300047673 Bacteria 2041
996 Ga0495602_0017169 3300048088 Bacteria 7257
997 Ga0495602_0033154 3300048088 Bacteria 4849
998 Ga0495602_0052347 3300048088 Bacteria 3627
999 Ga0495602_0084640 3300048088 Bacteria 2652
1000 Ga0495602_0195233 3300048088 Bacteria 1549
1001 Ga0495602_0274886 3300048088 Bacteria 1243
1002 Ga0495614_0000338 3300048089 Bacteria 18550
1003 Ga0495614_0002659 3300048089 Bacteria 7947
1004 Ga0495614_0026652 3300048089 Bacteria 2492
1005 Ga0495626_0003089 3300048091 Bacteria 10917
1006 Ga0495626_0015187 3300048091 Bacteria 3947
1007 Ga0495626_0034022 3300048091 Bacteria 2439
1008 Ga0496101_0000892 3300048904 Bacteria 17545
1009 Ga0496101_0005306 3300048904 Bacteria 8210
1010 Ga0496102_0001422 3300048905 Bacteria 21227
1011 Ga0496102_0442022 3300048905 Bacteria 1220
1012 Ga0496103_0001280 3300048906 Bacteria 17150
1013 Ga0496103_0004541 3300048906 Bacteria 8404
1014 Ga0496103_0010012 3300048906 Bacteria 5607
1015 Ga0496104_0000057 3300048907 Bacteria 119211
1016 Ga0496104_0002714 3300048907 Bacteria 15233
1017 Ga0496105_0000037 3300048908 Bacteria 119355
1018 Ga0496106_0008360 3300048909 Bacteria 7664
1019 Ga0496107_0379385 3300048910 Bacteria 1052
1020 Ga0496108_0022485 3300048911 Bacteria 5185
1021 Ga0496108_0066056 3300048911 Bacteria 3050
1022 Ga0496108_0237639 3300048911 Bacteria 1585
1023 Ga0496109_0020897 3300048912 Bacteria 5786
1024 Ga0496109_0156332 3300048912 Bacteria 2136
1025 Ga0496112_0013244 3300048915 Bacteria 7611
1026 Ga0496112_0061620 3300048915 Bacteria 3699
1027 Ga0496114_0010230 3300048917 Bacteria 7463
1028 Ga0496115_0043109 3300048918 Bacteria 3597
1029 Ga0496116_0003464 3300048919 Bacteria 15558
1030 Ga0496116_0037342 3300048919 Bacteria 3389
1031 Ga0496117_0000134 3300048920 Bacteria 161270
1032 Ga0496117_0065945 3300048920 Bacteria 2458
1033 Ga0496118_0000139 3300048921 Bacteria 128723
1034 Ga0496118_0001543 3300048921 Bacteria 34234
1035 Ga0496118_0004355 3300048921 Bacteria 16849
1036 Ga0496118_0049673 3300048921 Bacteria 3228
1037 Ga0496118_0085780 3300048921 Bacteria 2191
1038 Ga0496121_0004590 3300048924 Bacteria 18409
1039 Ga0496121_0167815 3300048924 Bacteria 1598
1040 Ga0496123_0041920 3300048926 Bacteria 3167
1041 Ga0496124_0001295 3300048927 Bacteria 37945
1042 Ga0496124_0062550 3300048927 Bacteria 3114
1043 Ga0496125_0008926 3300048928 Bacteria 10409
1044 Ga0496125_0018966 3300048928 Bacteria 6510
1045 Ga0496126_0000475 3300048929 Bacteria 79715
1046 Ga0496126_0001848 3300048929 Bacteria 30899
1047 Ga0495678_000025 3300049459 Bacteria 227891
1048 Ga0495678_000041 3300049459 Bacteria 185715
1049 Ga0495682_0018505 3300049460 Bacteria 2623
1050 Ga0495682_0027619 3300049460 Bacteria 2104
1051 Ga0501031_0039495 3300049568 Bacteria 3080
1052 Ga0501032_0004457 3300049569 Bacteria 10558
1053 Ga0501033_0001295 3300049570 Bacteria 22237
1054 Ga0501033_0001924 3300049570 Bacteria 18083
1055 Ga0501033_0375130 3300049570 Bacteria 994
1056 Ga0501034_0000056 3300049571 Bacteria 202540
1057 Ga0501034_0000101 3300049571 Bacteria 158656
1058 Ga0501034_0000188 3300049571 Bacteria 115935
1059 Ga0501034_0000578 3300049571 Bacteria 57983
1060 Ga0501034_0003555 3300049571 Bacteria 17715
1061 Ga0501036_0009459 3300049572 Bacteria 8018
1062 Ga0501036_0011700 3300049572 Bacteria 7271
1063 Ga0501036_0073760 3300049572 Bacteria 2885
1064 Ga0501037_0000731 3300049573 Bacteria 24929
1065 Ga0501037_0196298 3300049573 Bacteria 1427
1066 Ga0501038_0002549 3300049574 Bacteria 16982
1067 Ga0501038_0018992 3300049574 Bacteria 6203
1068 Ga0501038_0048173 3300049574 Bacteria 3689
1069 Ga0501038_0051855 3300049574 Bacteria 3538
1070 Ga0501038_0108162 3300049574 Bacteria 2306
1071 Ga0501039_0000137 3300049575 Bacteria 50348
1072 Ga0501040_0004113 3300049576 Bacteria 9462
1073 Ga0501040_0006389 3300049576 Bacteria 7651
1074 Ga0501041_0000864 3300049577 Bacteria 16341
1075 Ga0501042_0001236 3300049578 Bacteria 14879
1076 Ga0501042_0021847 3300049578 Bacteria 4465
1077 Ga0501042_0099048 3300049578 Bacteria 2096
1078 Ga0501043_0000425 3300049579 Bacteria 37892
1079 Ga0501043_0001029 3300049579 Bacteria 24505
1080 Ga0501043_0002650 3300049579 Bacteria 15049
1081 Ga0501043_0003618 3300049579 Bacteria 12698
1082 Ga0501046_0001373 3300049580 Bacteria 23444
1083 Ga0501046_0010156 3300049580 Bacteria 8101
1084 Ga0501046_0023253 3300049580 Bacteria 5099
1085 Ga0501046_0129231 3300049580 Bacteria 1917
1086 Ga0501046_0135565 3300049580 Bacteria 1865
1087 Ga0501046_0224792 3300049580 Bacteria 1389
1088 Ga0501047_0030244 3300049581 Bacteria 5221
1089 Ga0501047_0106731 3300049581 Bacteria 2681
1090 Ga0501068_0194766 3300049584 Bacteria 1285
1091 Ga0501071_0001821 3300049587 Bacteria 12629
1092 Ga0501071_0008369 3300049587 Bacteria 6835
1093 Ga0501072_0005280 3300049588 Bacteria 9840
1094 Ga0501072_0015941 3300049588 Bacteria 5762
1095 Ga0501075_0001079 3300049591 Bacteria 17539
1096 Ga0501075_0032348 3300049591 Bacteria 3884
1097 Ga0501076_0012583 3300049592 Bacteria 6329
1098 Ga0501076_0106754 3300049592 Bacteria 2260
1099 Ga0501077_0002690 3300049593 Bacteria 10658
1100 Ga0501077_0024917 3300049593 Bacteria 3799
1101 Ga0501077_0111073 3300049593 Bacteria 1737
1102 Ga0501230_034663 3300049667 Bacteria 956
1103 Ga0501079_0000543 3300049741 Bacteria 24597
1104 Ga0501079_0027245 3300049741 Bacteria 4381
1105 Ga0501080_0003928 3300049742 Bacteria 13162
1106 Ga0501081_0005581 3300049743 Bacteria 8124
1107 Ga0501035_0015479 3300049822 Bacteria 7036
1108 Ga0501035_0039070 3300049822 Bacteria 4296
1109 Ga0501035_0347314 3300049822 Bacteria 1242
1110 Ga0501044_0000353 3300049823 Bacteria 57639
1111 Ga0501044_0000688 3300049823 Bacteria 40885
1112 Ga0501044_0166430 3300049823 Bacteria 2179
1113 Ga0501044_0264296 3300049823 Bacteria 1658
1114 Ga0501045_0004427 3300049824 Bacteria 9694
1115 Ga0501045_0038705 3300049824 Bacteria 3469
1116 nmdc:mga03683_15387_c1 3300050489 Bacteria 2854
1117 nmdc:mga03683_88033_c1 3300050489 Bacteria 1350
1118 nmdc:mga03683_8977_c1 3300050489 Bacteria 3537
1119 nmdc:mga0k408_152543_c1 3300050493 Bacteria 1376
1120 nmdc:mga0k408_2021_c1 3300050493 Bacteria 10865
1121 nmdc:mga0k408_225564_c1 3300050493 Bacteria 1119
1122 nmdc:mga0k408_77544_c1 3300050493 Bacteria 1943
1123 nmdc:mga07m45_150706_c1 3300050496 Bacteria 1349
1124 nmdc:mga07m45_49256_c1 3300050496 Bacteria 2371
1125 nmdc:mga07m45_5308_c1 3300050496 Bacteria 6407
1126 nmdc:mga07m45_94739_c1 3300050496 Bacteria 1712
1127 nmdc:mga05p37_6731_c1 3300050507 Bacteria 13547
1128 nmdc:mga09592_28641_c1 3300050508 Bacteria 4629
1129 nmdc:mga0qj67_39632_c1 3300050509 Bacteria 3700
1130 nmdc:mga06r32_43800_c1 3300050510 Bacteria 4259
1131 nmdc:mga0n895_31172_c1 3300050512 Bacteria 5102
1132 nmdc:mga0rr50_323833_c1 3300050513 Bacteria 1292
1133 nmdc:mga08x19_112014_c1 3300050514 Bacteria 1821
1134 nmdc:mga08x19_2639_c1 3300050514 Bacteria 10842
1135 nmdc:mga0a205_123975_c1 3300050515 Bacteria 2483
1136 nmdc:mga0a205_433982_c1 3300050515 Bacteria 1175
1137 nmdc:mga0a205_6123_c1 3300050515 Bacteria 10854
1138 nmdc:mga0sz30_109167_c1 3300050516 Bacteria 1212
1139 nmdc:mga0sz30_16840_c1 3300050516 Bacteria 2908
1140 Ga0495612_0003346 3300053078 Bacteria 6642
1141 Ga0500659_0002495 3300053135 Bacteria 11077
1142 Ga0500559_0035106 3300053136 Bacteria 2164
1143 Ga0501084_0071881 3300054114 Bacteria 2897
1144 Ga0587091_022750 3300059511 Bacteria 1110
1145 Ga0587067_004181 3300059640 Bacteria 1861
1146 Ga0501082_0004675 3300060353 Bacteria 11939
1147 Ga0501082_0038427 3300060353 Bacteria 4130
1148 Ga0466962_0034846 3300061719 Bacteria 2410
1149 Ga0530510_0007252 3300061734 Bacteria 7712
1150 Ga0530510_0009274 3300061734 Bacteria 6904

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0029715 Ga0373931_0029715_1717_2517 207
2 3300002705 JGI25156J39149_1000123 JGI25156J39149_100012335 209
3 3300002705 JGI25156J39149_1000132 JGI25156J39149_100013214 209
4 3300002738 JGI25154J39366_1003951 JGI25154J39366_10039512 209
5 3300002741 JGI25157J39369_1000157 JGI25157J39369_100015734 209
6 3300003752 Ga0055539_1002822 Ga0055539_10028222 209
7 3300005328 Ga0070676_10005402 Ga0070676_100054027 209
8 3300005329 Ga0070683_100269010 Ga0070683_1002690102 209
9 3300005353 Ga0070669_100072454 Ga0070669_1000724543 209
10 3300005354 Ga0070675_100015743 Ga0070675_1000157436 209
11 3300005355 Ga0070671_100034291 Ga0070671_1000342916 209
12 3300005367 Ga0070667_100106175 Ga0070667_1001061753 209
13 3300005459 Ga0068867_100006929 Ga0068867_1000069296 209
14 3300005543 Ga0070672_100189519 Ga0070672_1001895192 209
15 3300005563 Ga0068855_100120552 Ga0068855_1001205523 209
16 3300005577 Ga0068857_100001821 Ga0068857_10000182111 209
17 3300005577 Ga0068857_100114120 Ga0068857_1001141202 209
18 3300005578 Ga0068854_100006533 Ga0068854_1000065336 209
19 3300005614 Ga0068856_100000168 Ga0068856_10000016831 209
20 3300005616 Ga0068852_100368546 Ga0068852_1003685462 209
21 3300005840 Ga0068870_10012608 Ga0068870_100126082 209
22 3300006353 Ga0075370_10097382 Ga0075370_100973822 209
23 3300009093 Ga0105240_10130020 Ga0105240_101300203 209
24 3300010375 Ga0105239_10101564 Ga0105239_101015643 209
25 3300013105 Ga0157369_10134559 Ga0157369_101345592 209
26 3300025246 Ga0209646_1000053 Ga0209646_1000053161 209
27 3300025250 Ga0209026_1000020 Ga0209026_1000020158 209
28 3300025253 Ga0209677_100182 Ga0209677_10018214 209
29 3300025256 Ga0209759_1000017 Ga0209759_1000017161 209
30 3300025907 Ga0207645_10008797 Ga0207645_100087974 209
31 3300025908 Ga0207643_10008707 Ga0207643_100087076 209
32 3300025911 Ga0207654_10028858 Ga0207654_100288582 209
33 3300025913 Ga0207695_10003938 Ga0207695_1000393814 209
34 3300025914 Ga0207671_10072048 Ga0207671_100720483 209
35 3300025924 Ga0207694_10057876 Ga0207694_100578763 209
36 3300025926 Ga0207659_10082794 Ga0207659_100827942 209
37 3300025931 Ga0207644_10114059 Ga0207644_101140594 209
38 3300025940 Ga0207691_10038079 Ga0207691_100380792 209
39 3300025942 Ga0207689_10008782 Ga0207689_100087827 209
40 3300025944 Ga0207661_10186039 Ga0207661_101860393 209
41 3300025949 Ga0207667_10073979 Ga0207667_100739792 209
42 3300025960 Ga0207651_10143199 Ga0207651_101431992 209
43 3300025981 Ga0207640_10064746 Ga0207640_100647463 209
44 3300025986 Ga0207658_10127376 Ga0207658_101273762 209
45 3300026078 Ga0207702_10000329 Ga0207702_1000032916 209
46 3300026078 Ga0207702_10000372 Ga0207702_1000037225 209
47 3300026089 Ga0207648_10010471 Ga0207648_100104718 209
48 3300026116 Ga0207674_10005988 Ga0207674_100059883 209
49 3300026116 Ga0207674_10021683 Ga0207674_100216835 209
50 3300026116 Ga0207674_10086467 Ga0207674_100864673 209
51 3300026121 Ga0207683_10070861 Ga0207683_100708613 209
52 3300026142 Ga0207698_10253432 Ga0207698_102534322 209
53 3300050496 nmdc:mga07m45_94739_c1 nmdc:mga07m45_94739_c1_313_1104 209
54 3300003752 Ga0055539_1000409 Ga0055539_100040913 210
55 3300003756 Ga0055533_1000011 Ga0055533_100001152 210
56 3300003759 Ga0055525_1002837 Ga0055525_10028371 210
57 3300025226 Ga0209674_100003 Ga0209674_100003353 210
58 3300025230 Ga0209563_100010 Ga0209563_10001082 210
59 3300025253 Ga0209677_100068 Ga0209677_10006840 210
60 3300005539 Ga0068853_100471377 Ga0068853_1004713772 211
61 3300035086 Ga0373934_0009488 Ga0373934_0009488_1224_2003 211
62 3300053136 Ga0500559_0035106 Ga0500559_0035106_1342_2121 211
63 3300031730 Ga0307516_10007080 Ga0307516_100070808 212
64 3300046462 Ga0495651_0100947 Ga0495651_0100947_506_1285 212
65 3300037312 Ga0395899_0100586 Ga0395899_0100586_1120_1902 213
66 3300037466 Ga0395898_0043495 Ga0395898_0043495_232_1014 213
67 3300038443 Ga0395901_0015232 Ga0395901_0015232_515_1297 213
68 3300025919 Ga0207657_10111763 Ga0207657_101117633 214
69 3300009093 Ga0105240_10932282 Ga0105240_109322821 219
70 3300009177 Ga0105248_10398929 Ga0105248_103989292 219
71 3300025256 Ga0209759_1005927 Ga0209759_10059273 219
72 3300039447 Ga0436361_0708871 Ga0436361_0708871_2609_3379 219
73 3300009148 Ga0105243_10344451 Ga0105243_103444512 220
74 3300025935 Ga0207709_10158805 Ga0207709_101588052 220
75 3300005339 Ga0070660_100004427 Ga0070660_1000044274 230
76 3300005434 Ga0070709_10023561 Ga0070709_100235612 230
77 3300005435 Ga0070714_100002778 Ga0070714_1000027787 230
78 3300005436 Ga0070713_100009976 Ga0070713_1000099764 230
79 3300005439 Ga0070711_100265857 Ga0070711_1002658572 230
80 3300005455 Ga0070663_100212152 Ga0070663_1002121521 230
81 3300005467 Ga0070706_100015220 Ga0070706_1000152202 230
82 3300005518 Ga0070699_100054408 Ga0070699_1000544083 230
83 3300005530 Ga0070679_100203186 Ga0070679_1002031862 230
84 3300005536 Ga0070697_100012186 Ga0070697_1000121864 230
85 3300005578 Ga0068854_100188374 Ga0068854_1001883741 230
86 3300006028 Ga0070717_10458914 Ga0070717_104589142 230
87 3300009098 Ga0105245_10004840 Ga0105245_100048407 230
88 3300009174 Ga0105241_10184882 Ga0105241_101848822 230
89 3300013100 Ga0157373_10071969 Ga0157373_100719692 230
90 3300025906 Ga0207699_10040819 Ga0207699_100408194 230
91 3300025910 Ga0207684_10190386 Ga0207684_101903862 230
92 3300025912 Ga0207707_10013605 Ga0207707_100136055 230
93 3300025915 Ga0207693_10027941 Ga0207693_100279413 230
94 3300025917 Ga0207660_10066257 Ga0207660_100662571 230
95 3300025919 Ga0207657_10005082 Ga0207657_100050825 230
96 3300025921 Ga0207652_10122396 Ga0207652_101223962 230
97 3300025928 Ga0207700_10082586 Ga0207700_100825863 230
98 3300025929 Ga0207664_10000623 Ga0207664_1000062312 230
99 3300025939 Ga0207665_10085295 Ga0207665_100852952 230
100 3300025942 Ga0207689_10068994 Ga0207689_100689942 230
101 3300025981 Ga0207640_10037321 Ga0207640_100373214 230
102 3300026067 Ga0207678_10043149 Ga0207678_100431493 230
103 3300026089 Ga0207648_10352453 Ga0207648_103524532 230
104 3300048910 Ga0496107_0379385 Ga0496107_0379385_94_861 230
105 3300050510 nmdc:mga06r32_43800_c1 nmdc:mga06r32_43800_c1_3536_4249 230
106 3300009551 Ga0105238_10432097 Ga0105238_104320971 231
107 3300050513 nmdc:mga0rr50_323833_c1 nmdc:mga0rr50_323833_c1_261_1025 231
108 3300005329 Ga0070683_100010268 Ga0070683_1000102684 232
109 3300005344 Ga0070661_100033808 Ga0070661_1000338084 232
110 3300005345 Ga0070692_10017162 Ga0070692_100171623 232
111 3300005457 Ga0070662_100369930 Ga0070662_1003699301 232
112 3300005471 Ga0070698_100225729 Ga0070698_1002257292 232
113 3300005535 Ga0070684_100440532 Ga0070684_1004405322 232
114 3300005536 Ga0070697_100034838 Ga0070697_1000348383 232
115 3300005546 Ga0070696_100043412 Ga0070696_1000434124 232
116 3300005564 Ga0070664_100194403 Ga0070664_1001944031 232
117 3300005616 Ga0068852_100163555 Ga0068852_1001635552 232
118 3300006175 Ga0070712_100017367 Ga0070712_1000173674 232
119 3300006852 Ga0075433_10010730 Ga0075433_100107302 232
120 3300006914 Ga0075436_100071738 Ga0075436_1000717382 232
121 3300007076 Ga0075435_100005231 Ga0075435_10000523110 232
122 3300009551 Ga0105238_10053683 Ga0105238_100536833 232
123 3300013102 Ga0157371_10070486 Ga0157371_100704863 232
124 3300025909 Ga0207705_10293620 Ga0207705_102936201 232
125 3300025914 Ga0207671_10481882 Ga0207671_104818822 232
126 3300025924 Ga0207694_10147202 Ga0207694_101472022 232
127 3300025933 Ga0207706_10264824 Ga0207706_102648242 232
128 3300025939 Ga0207665_10177530 Ga0207665_101775301 232
129 3300025944 Ga0207661_10076842 Ga0207661_100768422 232
130 3300026116 Ga0207674_10434343 Ga0207674_104343431 232
131 3300036401 Ga0373937_0208968 Ga0373937_0208968_221_994 232
132 3300046692 Ga0495671_0230959 Ga0495671_0230959_100_852 232
133 3300049572 Ga0501036_0009459 Ga0501036_0009459_5951_6706 232
134 3300049574 Ga0501038_0051855 Ga0501038_0051855_116_871 232
135 3300049575 Ga0501039_0000137 Ga0501039_0000137_5685_6440 232
136 3300049576 Ga0501040_0004113 Ga0501040_0004113_3966_4721 232
137 3300049577 Ga0501041_0000864 Ga0501041_0000864_10173_10928 232
138 3300049580 Ga0501046_0010156 Ga0501046_0010156_1624_2379 232
139 3300049587 Ga0501071_0001821 Ga0501071_0001821_3800_4555 232
140 3300049588 Ga0501072_0005280 Ga0501072_0005280_5724_6479 232
141 3300049591 Ga0501075_0001079 Ga0501075_0001079_7768_8523 232
142 3300049592 Ga0501076_0106754 Ga0501076_0106754_867_1622 232
143 3300049593 Ga0501077_0002690 Ga0501077_0002690_1833_2588 232
144 3300049741 Ga0501079_0000543 Ga0501079_0000543_7785_8540 232
145 3300049743 Ga0501081_0005581 Ga0501081_0005581_4583_5338 232
146 3300049824 Ga0501045_0004427 Ga0501045_0004427_7120_7875 232
147 3300050512 nmdc:mga0n895_31172_c1 nmdc:mga0n895_31172_c1_1879_2643 232
148 3300050514 nmdc:mga08x19_112014_c1 nmdc:mga08x19_112014_c1_500_1264 232
149 3300050515 nmdc:mga0a205_6123_c1 nmdc:mga0a205_6123_c1_8120_8884 232
150 3300054114 Ga0501084_0071881 Ga0501084_0071881_707_1462 232
151 3300060353 Ga0501082_0004675 Ga0501082_0004675_4216_4971 232
152 3300061734 Ga0530510_0009274 Ga0530510_0009274_5639_6394 232
153 3300005366 Ga0070659_100022346 Ga0070659_1000223464 233
154 3300005445 Ga0070708_100112961 Ga0070708_1001129611 233
155 3300005468 Ga0070707_100150960 Ga0070707_1001509602 233
156 3300005471 Ga0070698_100253725 Ga0070698_1002537252 233
157 3300005518 Ga0070699_100082153 Ga0070699_1000821532 233
158 3300006852 Ga0075433_10245977 Ga0075433_102459772 233
159 3300025922 Ga0207646_10037315 Ga0207646_100373152 233
160 3300035695 Ga0373927_0080785 Ga0373927_0080785_669_1433 233
161 3300046472 Ga0495580_0027318 Ga0495580_0027318_3064_3828 233
162 3300046531 Ga0495665_0052825 Ga0495665_0052825_1268_2047 233
163 3300046535 Ga0495586_0087580 Ga0495586_0087580_220_999 233
164 3300046542 Ga0495597_0000958 Ga0495597_0000958_8921_9721 233
165 3300046674 Ga0495588_0111560 Ga0495588_0111560_345_1124 233
166 3300047315 Ga0495581_0084374 Ga0495581_0084374_141_920 233
167 3300005365 Ga0070688_100201785 Ga0070688_1002017852 234
168 3300005440 Ga0070705_100042616 Ga0070705_1000426163 234
169 3300005459 Ga0068867_100286504 Ga0068867_1002865042 234
170 3300005549 Ga0070704_100005075 Ga0070704_1000050752 234
171 3300005615 Ga0070702_100044723 Ga0070702_1000447234 234
172 3300005617 Ga0068859_100749607 Ga0068859_1007496072 234
173 3300005719 Ga0068861_100128260 Ga0068861_1001282602 234
174 3300006931 Ga0097620_100749613 Ga0097620_1007496132 234
175 3300014745 Ga0157377_10259661 Ga0157377_102596611 234
176 3300025926 Ga0207659_10073745 Ga0207659_100737451 234
177 3300025935 Ga0207709_10155749 Ga0207709_101557492 234
178 3300026075 Ga0207708_10180002 Ga0207708_101800022 234
179 3300026118 Ga0207675_100121252 Ga0207675_1001212522 234
180 3300027364 Ga0209967_1013142 Ga0209967_10131422 234
181 3300027543 Ga0209999_1011598 Ga0209999_10115983 234
182 3300031731 Ga0307405_10310766 Ga0307405_103107662 234
183 3300031852 Ga0307410_10637176 Ga0307410_106371761 234
184 3300032002 Ga0307416_100324319 Ga0307416_1003243192 234
185 3300032002 Ga0307416_100674810 Ga0307416_1006748102 234
186 3300042185 Ga0450909_020936 Ga0450909_020936_33_794 234
187 3300045051 Ga0451576_0188454 Ga0451576_0188454_79_846 234
188 3300046491 Ga0495584_0027660 Ga0495584_0027660_407_1201 234
189 3300046518 Ga0495631_0019345 Ga0495631_0019345_1904_2698 234
190 3300046648 Ga0495611_0055084 Ga0495611_0055084_135_929 234
191 3300046691 Ga0495670_0118806 Ga0495670_0118806_419_1213 234
192 3300049667 Ga0501230_034663 Ga0501230_034663_183_932 234
193 3300035725 Ga0373947_0212444 Ga0373947_0212444_78_848 235
194 3300037068 Ga0373925_0041188 Ga0373925_0041188_1557_2327 235
195 3300037471 Ga0395905_0159089 Ga0395905_0159089_674_1444 235
196 3300044712 Ga0453684_0047956 Ga0453684_0047956_134_844 235
197 3300046507 Ga0495606_0059816 Ga0495606_0059816_1076_1858 235
198 3300053078 Ga0495612_0003346 Ga0495612_0003346_63_833 235
199 3300003354 JGI25160J50197_1001515 JGI25160J50197_10015154 236
200 3300003771 Ga0055526_1038702 Ga0055526_10387021 236
201 3300005262 Ga0065165_1003184 Ga0065165_10031847 236
202 3300005536 Ga0070697_100006211 Ga0070697_1000062113 236
203 3300005549 Ga0070704_100003831 Ga0070704_1000038316 236
204 3300009093 Ga0105240_10058761 Ga0105240_100587612 236
205 3300025295 Ga0209564_1006995 Ga0209564_10069955 236
206 3300025302 Ga0207426_1000014 Ga0207426_100001463 236
207 3300026116 Ga0207674_10431512 Ga0207674_104315122 236
208 3300031507 Ga0307509_10000006 Ga0307509_10000006282 236
209 3300035112 Ga0373932_0025572 Ga0373932_0025572_20_739 236
210 3300048904 Ga0496101_0000892 Ga0496101_0000892_2024_2803 236
211 3300048905 Ga0496102_0001422 Ga0496102_0001422_12435_13214 236
212 3300048906 Ga0496103_0001280 Ga0496103_0001280_8303_9082 236
213 3300048920 Ga0496117_0000134 Ga0496117_0000134_12435_13214 236
214 3300048921 Ga0496118_0000139 Ga0496118_0000139_115510_116289 236
215 3300048924 Ga0496121_0004590 Ga0496121_0004590_5196_5975 236
216 3300049580 Ga0501046_0129231 Ga0501046_0129231_75_866 236
217 iso_pu_bacteria 2901300506 2901305142 236
218 3300031548 Ga0307408_100013852 Ga0307408_1000138525 237
219 3300031731 Ga0307405_10013627 Ga0307405_100136272 237
220 3300031824 Ga0307413_10237804 Ga0307413_102378042 237
221 3300031852 Ga0307410_10043289 Ga0307410_100432894 237
222 3300031901 Ga0307406_10021397 Ga0307406_100213973 237
223 3300031903 Ga0307407_10060527 Ga0307407_100605272 237
224 3300031911 Ga0307412_10010556 Ga0307412_100105565 237
225 3300031995 Ga0307409_100000809 Ga0307409_1000008098 237
226 3300032002 Ga0307416_100088614 Ga0307416_1000886142 237
227 3300032004 Ga0307414_10012037 Ga0307414_100120372 237
228 3300032005 Ga0307411_10031177 Ga0307411_100311772 237
229 3300032126 Ga0307415_100041952 Ga0307415_1000419523 237
230 3300048088 Ga0495602_0195233 Ga0495602_0195233_352_1119 237
231 3300049576 Ga0501040_0006389 Ga0501040_0006389_2211_2987 237
232 3300049578 Ga0501042_0001236 Ga0501042_0001236_5349_6125 237
233 3300049578 Ga0501042_0021847 Ga0501042_0021847_2249_3025 237
234 3300059511 Ga0587091_022750 Ga0587091_022750_111_884 237
235 3300005549 Ga0070704_100334656 Ga0070704_1003346562 238
236 3300007076 Ga0075435_100364013 Ga0075435_1003640132 238
237 3300003187 JGI25151J46595_10009112 JGI25151J46595_100091122 239
238 3300025294 Ga0209025_1000497 Ga0209025_100049760 239
239 3300032004 Ga0307414_10648893 Ga0307414_106488931 239
240 3300037312 Ga0395899_0217452 Ga0395899_0217452_365_1141 239
241 3300037418 Ga0395900_0024931 Ga0395900_0024931_3647_4423 239
242 3300037466 Ga0395898_0023842 Ga0395898_0023842_555_1331 239
243 3300044658 Ga0466972_0000094 Ga0466972_0000094_17520_18269 239
244 3300046526 Ga0495666_0029789 Ga0495666_0029789_1655_2449 239
245 3300046690 Ga0495624_0009904 Ga0495624_0009904_5519_6313 239
246 3300015261 Ga0182006_1034035 Ga0182006_10340351 240
247 3300037068 Ga0373925_0065704 Ga0373925_0065704_578_1357 240
248 3300045051 Ga0451576_0525702 Ga0451576_0525702_495_1229 240
249 3300049579 Ga0501043_0003618 Ga0501043_0003618_11378_12166 240
250 3300049580 Ga0501046_0001373 Ga0501046_0001373_14283_15071 240
251 3300005577 Ga0068857_100337506 Ga0068857_1003375062 241
252 3300005617 Ga0068859_100008147 Ga0068859_1000081479 241
253 3300006931 Ga0097620_100008146 Ga0097620_1000081469 241
254 3300021361 Ga0213872_10036729 Ga0213872_100367292 241
255 3300025923 Ga0207681_10087007 Ga0207681_100870072 241
256 3300025937 Ga0207669_10188141 Ga0207669_101881412 241
257 3300026088 Ga0207641_10502809 Ga0207641_105028092 241
258 3300026089 Ga0207648_10034900 Ga0207648_100349004 241
259 3300028800 Ga0265338_10232933 Ga0265338_102329332 241
260 3300031665 Ga0316575_10023346 Ga0316575_100233462 241
261 3300031691 Ga0316579_10005579 Ga0316579_100055792 241
262 3300032133 Ga0316583_10001362 Ga0316583_100013622 241
263 3300032137 Ga0316585_10000290 Ga0316585_100002905 241
264 3300032139 Ga0316580_10000157 Ga0316580_100001575 241
265 3300036647 Ga0316582_0001690 Ga0316582_0001690_4991_5746 241
266 3300036712 Ga0316584_0017889 Ga0316584_0017889_1365_2120 241
267 3300037418 Ga0395900_0249370 Ga0395900_0249370_772_1530 241
268 3300038443 Ga0395901_0020917 Ga0395901_0020917_1260_2018 241
269 3300039447 Ga0436361_0763281 Ga0436361_0763281_7254_8027 241
270 3300046660 Ga0495625_0054646 Ga0495625_0054646_704_1486 241
271 iso_pu_bacteria 2571042365 2572255798 241
272 3300028786 Ga0307517_10002408 Ga0307517_100024087 242
273 3300031616 Ga0307508_10006263 Ga0307508_100062634 242
274 iso_pu_bacteria 2912963787 2912963932 242
275 iso_pu_bacteria 2939651529 2939656792 242
276 3300005445 Ga0070708_100062109 Ga0070708_1000621092 243
277 3300005467 Ga0070706_100002204 Ga0070706_10000220410 243
278 3300005468 Ga0070707_100047358 Ga0070707_1000473583 243
279 3300005518 Ga0070699_100074489 Ga0070699_1000744893 243
280 3300006178 Ga0075367_10076049 Ga0075367_100760491 243
281 3300006195 Ga0075366_10001785 Ga0075366_100017858 243
282 3300006237 Ga0097621_100572535 Ga0097621_1005725351 243
283 3300025910 Ga0207684_10045442 Ga0207684_100454423 243
284 3300028654 Ga0265322_10007930 Ga0265322_100079304 243
285 3300031548 Ga0307408_100555674 Ga0307408_1005556741 243
286 3300041404 Ga0439436_0003056 Ga0439436_0003056_3706_4482 243
287 3300042007 Ga0439449_0031638 Ga0439449_0031638_1036_1812 243
288 3300042435 Ga0439434_0000294 Ga0439434_0000294_750_1514 243
289 3300042435 Ga0439434_0009557 Ga0439434_0009557_98_874 243
290 3300042436 Ga0439435_0000060 Ga0439435_0000060_11991_12755 243
291 3300042876 Ga0451577_0329272 Ga0451577_0329272_331_1074 243
292 3300044712 Ga0453684_0258833 Ga0453684_0258833_1135_1878 243
293 3300046457 Ga0495590_0001807 Ga0495590_0001807_1426_2190 243
294 3300050493 nmdc:mga0k408_225564_c1 nmdc:mga0k408_225564_c1_246_1025 243
295 3300001979 JGI24740J21852_10001865 JGI24740J21852_100018652 244
296 3300001989 JGI24739J22299_10001944 JGI24739J22299_100019441 244
297 3300002067 JGI24735J21928_10002340 JGI24735J21928_100023404 244
298 3300002705 JGI25156J39149_1001682 JGI25156J39149_10016822 244
299 3300002705 JGI25156J39149_1009142 JGI25156J39149_10091422 244
300 3300003214 JGI25165J46597_1001596 JGI25165J46597_10015962 244
301 3300003756 Ga0055533_1000232 Ga0055533_100023234 244
302 3300003758 Ga0055532_1000011 Ga0055532_1000011216 244
303 3300003760 Ga0055527_1000009 Ga0055527_1000009215 244
304 3300003761 Ga0055535_1000008 Ga0055535_1000008153 244
305 3300003762 Ga0055542_1000014 Ga0055542_1000014153 244
306 3300003763 Ga0055529_1000010 Ga0055529_1000010153 244
307 3300006871 Ga0075434_100000017 Ga0075434_10000001759 244
308 3300007076 Ga0075435_100007948 Ga0075435_1000079483 244
309 3300009093 Ga0105240_10144619 Ga0105240_101446192 244
310 3300013105 Ga0157369_10021806 Ga0157369_100218064 244
311 3300025226 Ga0209674_100011 Ga0209674_100011699 244
312 3300025226 Ga0209674_100093 Ga0209674_100093103 244
313 3300025228 Ga0209672_100002 Ga0209672_100002692 244
314 3300025229 Ga0209147_100003 Ga0209147_100003692 244
315 3300025230 Ga0209563_101409 Ga0209563_1014095 244
316 3300025231 Ga0207427_102330 Ga0207427_1023305 244
317 3300025242 Ga0209258_100005 Ga0209258_100005334 244
318 3300025253 Ga0209677_113567 Ga0209677_1135671 244
319 3300025254 Ga0209148_1000006 Ga0209148_1000006692 244
320 3300025256 Ga0209759_1000006 Ga0209759_1000006306 244
321 3300025256 Ga0209759_1000039 Ga0209759_100003956 244
322 3300025261 Ga0209233_1000018 Ga0209233_1000018656 244
323 3300025272 Ga0209455_1000003 Ga0209455_1000003692 244
324 3300025904 Ga0207647_10071271 Ga0207647_100712712 244
325 3300031911 Ga0307412_10000002 Ga0307412_1000000248 244
326 3300032133 Ga0316583_10014049 Ga0316583_100140492 244
327 3300035398 Ga0316574_0091683 Ga0316574_0091683_668_1411 244
328 3300036647 Ga0316582_0046102 Ga0316582_0046102_94_840 244
329 3300036647 Ga0316582_0150293 Ga0316582_0150293_694_1437 244
330 3300037588 Ga0316581_0001652 Ga0316581_0001652_266_1012 244
331 3300046457 Ga0495590_0039449 Ga0495590_0039449_83_856 244
332 3300046474 Ga0495605_0103072 Ga0495605_0103072_235_1008 244
333 3300046507 Ga0495606_0009929 Ga0495606_0009929_3737_4510 244
334 3300046507 Ga0495606_0175631 Ga0495606_0175631_139_894 244
335 3300046512 Ga0495610_0000364 Ga0495610_0000364_11467_12240 244
336 3300046515 Ga0495620_0011969 Ga0495620_0011969_427_1200 244
337 3300046694 Ga0495649_0004753 Ga0495649_0004753_1054_1827 244
338 3300047323 Ga0495683_0002007 Ga0495683_0002007_5651_6424 244
339 3300047443 Ga0495687_003337 Ga0495687_003337_7898_8671 244
340 3300047443 Ga0495687_054667 Ga0495687_054667_633_1406 244
341 3300048920 Ga0496117_0065945 Ga0496117_0065945_417_1190 244
342 3300048928 Ga0496125_0008926 Ga0496125_0008926_7057_7791 244
343 iso_pu_bacteria 2554235231 2555245536 244
344 iso_pu_bacteria 2765235841 2765586606 244
345 iso_pu_bacteria 8052494512 8052499779 244
346 iso_pu_bacteria 8054929484 8054931169 244
347 3300005329 Ga0070683_100006705 Ga0070683_1000067052 245
348 3300005329 Ga0070683_100324701 Ga0070683_1003247012 245
349 3300005344 Ga0070661_100001057 Ga0070661_10000105719 245
350 3300005345 Ga0070692_10028839 Ga0070692_100288392 245
351 3300005366 Ga0070659_100005466 Ga0070659_1000054662 245
352 3300005366 Ga0070659_100182602 Ga0070659_1001826022 245
353 3300005435 Ga0070714_100002126 Ga0070714_10000212610 245
354 3300005458 Ga0070681_10016085 Ga0070681_100160857 245
355 3300005471 Ga0070698_100013449 Ga0070698_1000134492 245
356 3300005530 Ga0070679_100180715 Ga0070679_1001807152 245
357 3300005539 Ga0068853_100021180 Ga0068853_1000211804 245
358 3300005563 Ga0068855_100008331 Ga0068855_10000833110 245
359 3300005564 Ga0070664_100016169 Ga0070664_1000161696 245
360 3300005577 Ga0068857_100003368 Ga0068857_1000033682 245
361 3300005578 Ga0068854_100023192 Ga0068854_1000231922 245
362 3300005614 Ga0068856_100002803 Ga0068856_10000280314 245
363 3300005616 Ga0068852_100006363 Ga0068852_1000063634 245
364 3300005719 Ga0068861_100000917 Ga0068861_1000009178 245
365 3300006844 Ga0075428_100004649 Ga0075428_1000046496 245
366 3300006846 Ga0075430_100040344 Ga0075430_1000403442 245
367 3300006847 Ga0075431_100009945 Ga0075431_1000099455 245
368 3300006852 Ga0075433_10522911 Ga0075433_105229112 245
369 3300006880 Ga0075429_100001537 Ga0075429_10000153719 245
370 3300006914 Ga0075436_100002716 Ga0075436_10000271610 245
371 3300009093 Ga0105240_10003948 Ga0105240_100039484 245
372 3300009147 Ga0114129_10021382 Ga0114129_100213828 245
373 3300009174 Ga0105241_10099145 Ga0105241_100991452 245
374 3300009545 Ga0105237_10161966 Ga0105237_101619662 245
375 3300009551 Ga0105238_10003338 Ga0105238_100033387 245
376 3300013102 Ga0157371_10080221 Ga0157371_100802212 245
377 3300013104 Ga0157370_10005802 Ga0157370_100058026 245
378 3300013105 Ga0157369_10010253 Ga0157369_100102534 245
379 3300013307 Ga0157372_10017103 Ga0157372_100171036 245
380 3300015683 Ga0183362_10003 Ga0183362_10003914 245
381 3300025910 Ga0207684_10004348 Ga0207684_100043486 245
382 3300025913 Ga0207695_10021676 Ga0207695_100216763 245
383 3300025914 Ga0207671_10104147 Ga0207671_101041472 245
384 3300025919 Ga0207657_10017667 Ga0207657_100176673 245
385 3300025920 Ga0207649_10050514 Ga0207649_100505142 245
386 3300025923 Ga0207681_10040191 Ga0207681_100401912 245
387 3300025924 Ga0207694_10006699 Ga0207694_100066996 245
388 3300025929 Ga0207664_10021689 Ga0207664_100216892 245
389 3300025932 Ga0207690_10025068 Ga0207690_100250683 245
390 3300025944 Ga0207661_10221943 Ga0207661_102219432 245
391 3300025949 Ga0207667_10016473 Ga0207667_100164734 245
392 3300025981 Ga0207640_10014541 Ga0207640_100145412 245
393 3300026041 Ga0207639_10031041 Ga0207639_100310413 245
394 3300026078 Ga0207702_10006444 Ga0207702_100064446 245
395 3300026116 Ga0207674_10000039 Ga0207674_1000003947 245
396 3300026118 Ga0207675_100004383 Ga0207675_1000043839 245
397 3300026142 Ga0207698_10013356 Ga0207698_100133563 245
398 3300031727 Ga0316576_10002913 Ga0316576_100029134 245
399 3300031911 Ga0307412_10587633 Ga0307412_105876332 245
400 3300032139 Ga0316580_10047899 Ga0316580_100478992 245
401 3300035398 Ga0316574_0126052 Ga0316574_0126052_397_1143 245
402 3300036712 Ga0316584_0071470 Ga0316584_0071470_84_836 245
403 3300038443 Ga0395901_0006496 Ga0395901_0006496_3119_3883 245
404 3300038741 Ga0400488_40734 Ga0400488_40734_1237_1986 245
405 3300042013 Ga0439456_000104 Ga0439456_000104_14452_15198 245
406 3300042876 Ga0451577_0359880 Ga0451577_0359880_229_1023 245
407 3300044684 Ga0466966_0366941 Ga0466966_0366941_72_833 245
408 3300044842 Ga0466957_0129625 Ga0466957_0129625_454_1215 245
409 3300045051 Ga0451576_0069652 Ga0451576_0069652_1188_1958 245
410 3300047323 Ga0495683_0142726 Ga0495683_0142726_329_1096 245
411 3300049570 Ga0501033_0001295 Ga0501033_0001295_20774_21532 245
412 3300049571 Ga0501034_0000578 Ga0501034_0000578_39156_39914 245
413 3300049572 Ga0501036_0073760 Ga0501036_0073760_1382_2140 245
414 3300049573 Ga0501037_0000731 Ga0501037_0000731_12086_12844 245
415 3300049574 Ga0501038_0002549 Ga0501038_0002549_8995_9753 245
416 3300049579 Ga0501043_0001029 Ga0501043_0001029_20684_21442 245
417 3300049581 Ga0501047_0106731 Ga0501047_0106731_1897_2655 245
418 3300049584 Ga0501068_0194766 Ga0501068_0194766_381_1139 245
419 3300049742 Ga0501080_0003928 Ga0501080_0003928_11920_12678 245
420 3300049823 Ga0501044_0000688 Ga0501044_0000688_2420_3178 245
421 3300050507 nmdc:mga05p37_6731_c1 nmdc:mga05p37_6731_c1_5499_6272 245
422 3300050508 nmdc:mga09592_28641_c1 nmdc:mga09592_28641_c1_117_887 245
423 3300050509 nmdc:mga0qj67_39632_c1 nmdc:mga0qj67_39632_c1_2286_3056 245
424 3300050514 nmdc:mga08x19_2639_c1 nmdc:mga08x19_2639_c1_2450_3190 245
425 3300050515 nmdc:mga0a205_123975_c1 nmdc:mga0a205_123975_c1_850_1590 245
426 3300050515 nmdc:mga0a205_433982_c1 nmdc:mga0a205_433982_c1_280_1053 245
427 iso_pu_bacteria 2554235132 2554812822 245
428 iso_pu_bacteria 2606217733 2608383285 245
429 iso_pu_bacteria 2885266251 2885267684 245
430 iso_pu_bacteria 2904518522 2904519296 245
431 iso_pu_bacteria 8011350971 8011352513 245
432 3300002737 JGI25162J39368_1001279 JGI25162J39368_10012795 246
433 3300002741 JGI25157J39369_1001321 JGI25157J39369_10013215 246
434 3300002772 JGI25164J39214_1000716 JGI25164J39214_100071610 246
435 3300003214 JGI25165J46597_1000335 JGI25165J46597_100033560 246
436 3300005330 Ga0070690_100081864 Ga0070690_1000818642 246
437 3300005330 Ga0070690_100129343 Ga0070690_1001293431 246
438 3300005335 Ga0070666_10157751 Ga0070666_101577512 246
439 3300005353 Ga0070669_100396902 Ga0070669_1003969022 246
440 3300005366 Ga0070659_100000764 Ga0070659_10000076411 246
441 3300005366 Ga0070659_100006279 Ga0070659_1000062792 246
442 3300005366 Ga0070659_100254299 Ga0070659_1002542992 246
443 3300005435 Ga0070714_100003909 Ga0070714_1000039094 246
444 3300005438 Ga0070701_10008863 Ga0070701_100088634 246
445 3300005456 Ga0070678_100078851 Ga0070678_1000788512 246
446 3300005458 Ga0070681_10026657 Ga0070681_100266575 246
447 3300005459 Ga0068867_100010772 Ga0068867_1000107725 246
448 3300005544 Ga0070686_100099974 Ga0070686_1000999742 246
449 3300005563 Ga0068855_100016866 Ga0068855_1000168667 246
450 3300005563 Ga0068855_100185221 Ga0068855_1001852212 246
451 3300005563 Ga0068855_100587132 Ga0068855_1005871322 246
452 3300005577 Ga0068857_100177000 Ga0068857_1001770002 246
453 3300005615 Ga0070702_100098930 Ga0070702_1000989303 246
454 3300005719 Ga0068861_100004912 Ga0068861_1000049123 246
455 3300005841 Ga0068863_100111484 Ga0068863_1001114842 246
456 3300006358 Ga0068871_100161649 Ga0068871_1001616492 246
457 3300006881 Ga0068865_100001581 Ga0068865_10000158113 246
458 3300006914 Ga0075436_100048271 Ga0075436_1000482714 246
459 3300007076 Ga0075435_100206953 Ga0075435_1002069531 246
460 3300009098 Ga0105245_10455132 Ga0105245_104551322 246
461 3300009176 Ga0105242_10396610 Ga0105242_103966102 246
462 3300009177 Ga0105248_10378403 Ga0105248_103784032 246
463 3300009551 Ga0105238_10045962 Ga0105238_100459623 246
464 3300009551 Ga0105238_10247396 Ga0105238_102473962 246
465 3300013100 Ga0157373_10001190 Ga0157373_1000119017 246
466 3300013102 Ga0157371_10007374 Ga0157371_100073747 246
467 3300013104 Ga0157370_10000793 Ga0157370_1000079332 246
468 3300013104 Ga0157370_10001148 Ga0157370_1000114816 246
469 3300013296 Ga0157374_10117758 Ga0157374_101177582 246
470 3300013306 Ga0163162_10018531 Ga0163162_100185311 246
471 3300013307 Ga0157372_10003322 Ga0157372_100033222 246
472 3300013308 Ga0157375_10004064 Ga0157375_100040644 246
473 3300013308 Ga0157375_10167475 Ga0157375_101674752 246
474 3300014969 Ga0157376_10000749 Ga0157376_1000074916 246
475 3300017792 Ga0163161_10514128 Ga0163161_105141282 246
476 3300025231 Ga0207427_100178 Ga0207427_10017873 246
477 3300025233 Ga0209437_100304 Ga0209437_10030473 246
478 3300025261 Ga0209233_1000287 Ga0209233_10002875 246
479 3300025297 Ga0209758_1085559 Ga0209758_10855592 246
480 3300025899 Ga0207642_10032057 Ga0207642_100320571 246
481 3300025899 Ga0207642_10102127 Ga0207642_101021272 246
482 3300025909 Ga0207705_10238247 Ga0207705_102382471 246
483 3300025912 Ga0207707_10003189 Ga0207707_100031893 246
484 3300025917 Ga0207660_10652275 Ga0207660_106522751 246
485 3300025919 Ga0207657_10055701 Ga0207657_100557012 246
486 3300025919 Ga0207657_10247656 Ga0207657_102476561 246
487 3300025921 Ga0207652_10366994 Ga0207652_103669942 246
488 3300025924 Ga0207694_10006875 Ga0207694_100068757 246
489 3300025926 Ga0207659_10308861 Ga0207659_103088612 246
490 3300025932 Ga0207690_10002850 Ga0207690_100028505 246
491 3300025932 Ga0207690_10041312 Ga0207690_100413123 246
492 3300025932 Ga0207690_10109325 Ga0207690_101093252 246
493 3300025934 Ga0207686_10444501 Ga0207686_104445012 246
494 3300025938 Ga0207704_10064958 Ga0207704_100649582 246
495 3300025938 Ga0207704_10189078 Ga0207704_101890781 246
496 3300025942 Ga0207689_10002136 Ga0207689_100021364 246
497 3300025949 Ga0207667_10001689 Ga0207667_100016894 246
498 3300025949 Ga0207667_10141834 Ga0207667_101418342 246
499 3300025972 Ga0207668_10184148 Ga0207668_101841482 246
500 3300026075 Ga0207708_10004997 Ga0207708_100049976 246
501 3300026078 Ga0207702_10137731 Ga0207702_101377312 246
502 3300026088 Ga0207641_10108372 Ga0207641_101083722 246
503 3300026089 Ga0207648_10038420 Ga0207648_100384204 246
504 3300026095 Ga0207676_10046087 Ga0207676_100460872 246
505 3300026116 Ga0207674_10231818 Ga0207674_102318182 246
506 3300026118 Ga0207675_100013693 Ga0207675_1000136937 246
507 3300026121 Ga0207683_10145182 Ga0207683_101451822 246
508 3300026121 Ga0207683_10190368 Ga0207683_101903682 246
509 3300031240 Ga0265320_10090829 Ga0265320_100908292 246
510 3300031249 Ga0265339_10073221 Ga0265339_100732212 246
511 3300031727 Ga0316576_10013079 Ga0316576_100130793 246
512 3300031728 Ga0316578_10106809 Ga0316578_101068093 246
513 3300032137 Ga0316585_10011720 Ga0316585_100117202 246
514 3300035398 Ga0316574_0000225 Ga0316574_0000225_15046_15798 246
515 3300035398 Ga0316574_0003552 Ga0316574_0003552_5524_6288 246
516 3300036647 Ga0316582_0217018 Ga0316582_0217018_201_953 246
517 3300036712 Ga0316584_0007976 Ga0316584_0007976_5541_6293 246
518 3300037471 Ga0395905_0003472 Ga0395905_0003472_1395_2147 246
519 3300038742 Ga0400486_17590 Ga0400486_17590_1479_2231 246
520 3300041452 Ga0451793_0511053 Ga0451793_0511053_1110_1886 246
521 3300042010 Ga0439452_023416 Ga0439452_023416_185_928 246
522 3300044712 Ga0453684_0003587 Ga0453684_0003587_21849_22601 246
523 3300044712 Ga0453684_0746219 Ga0453684_0746219_122_877 246
524 3300046457 Ga0495590_0000008 Ga0495590_0000008_20588_21349 246
525 3300046458 Ga0495591_000043 Ga0495591_000043_90427_91188 246
526 3300046491 Ga0495584_0000025 Ga0495584_0000025_20511_21272 246
527 3300046492 Ga0495585_0065670 Ga0495585_0065670_1096_1857 246
528 3300046500 Ga0495596_0019412 Ga0495596_0019412_1122_1883 246
529 3300046501 Ga0495607_0009729 Ga0495607_0009729_1530_2291 246
530 3300046506 Ga0495583_0000512 Ga0495583_0000512_34073_34834 246
531 3300046512 Ga0495610_0000809 Ga0495610_0000809_1796_2557 246
532 3300046519 Ga0495632_0010626 Ga0495632_0010626_3222_3983 246
533 3300046520 Ga0495637_0000009 Ga0495637_0000009_318986_319747 246
534 3300046523 Ga0495644_0041412 Ga0495644_0041412_715_1476 246
535 3300046528 Ga0495642_0144332 Ga0495642_0144332_86_847 246
536 3300046537 Ga0495598_0051159 Ga0495598_0051159_28_783 246
537 3300046538 Ga0495609_0079327 Ga0495609_0079327_89_850 246
538 3300046558 Ga0495633_0001467 Ga0495633_0001467_7205_7966 246
539 3300046616 Ga0495668_0030352 Ga0495668_0030352_1648_2409 246
540 3300046648 Ga0495611_0000361 Ga0495611_0000361_10323_11084 246
541 3300046665 Ga0495661_0004554 Ga0495661_0004554_2642_3403 246
542 3300046665 Ga0495661_0076162 Ga0495661_0076162_149_910 246
543 3300046675 Ga0495657_0053248 Ga0495657_0053248_627_1394 246
544 3300046681 Ga0495647_0057608 Ga0495647_0057608_712_1479 246
545 3300046694 Ga0495649_0000028 Ga0495649_0000028_121704_122465 246
546 3300046810 Ga0495660_0039201 Ga0495660_0039201_83_844 246
547 3300047320 Ga0495672_0000055 Ga0495672_0000055_90379_91140 246
548 3300047323 Ga0495683_0000047 Ga0495683_0000047_103103_103864 246
549 3300047445 Ga0495677_0000234 Ga0495677_0000234_8049_8810 246
550 3300047470 Ga0495681_0010188 Ga0495681_0010188_1450_2211 246
551 3300047472 Ga0495686_0046261 Ga0495686_0046261_866_1627 246
552 3300048907 Ga0496104_0000057 Ga0496104_0000057_80714_81481 246
553 3300048908 Ga0496105_0000037 Ga0496105_0000037_80854_81621 246
554 3300048911 Ga0496108_0022485 Ga0496108_0022485_3796_4554 246
555 3300048912 Ga0496109_0020897 Ga0496109_0020897_2327_3085 246
556 3300048915 Ga0496112_0061620 Ga0496112_0061620_702_1460 246
557 3300049459 Ga0495678_000025 Ga0495678_000025_91257_92018 246
558 3300049460 Ga0495682_0018505 Ga0495682_0018505_413_1174 246
559 3300049580 Ga0501046_0224792 Ga0501046_0224792_457_1233 246
560 iso_pu_bacteria 2511231024 2511377438 246
561 3300005347 Ga0070668_100096777 Ga0070668_1000967771 247
562 3300005456 Ga0070678_100043287 Ga0070678_1000432871 247
563 3300005458 Ga0070681_10104560 Ga0070681_101045602 247
564 3300005543 Ga0070672_100183856 Ga0070672_1001838562 247
565 3300005546 Ga0070696_100230408 Ga0070696_1002304082 247
566 3300005841 Ga0068863_100017730 Ga0068863_1000177303 247
567 3300005844 Ga0068862_100094296 Ga0068862_1000942963 247
568 3300006944 Ga0099823_1054043 Ga0099823_10540432 247
569 3300007076 Ga0075435_100173911 Ga0075435_1001739112 247
570 3300009011 Ga0105251_10000535 Ga0105251_1000053512 247
571 3300009174 Ga0105241_10357678 Ga0105241_103576782 247
572 3300009551 Ga0105238_10140446 Ga0105238_101404463 247
573 3300013104 Ga0157370_10113103 Ga0157370_101131032 247
574 3300013307 Ga0157372_10019438 Ga0157372_100194383 247
575 3300025292 Ga0209676_1000510 Ga0209676_100051056 247
576 3300025711 Ga0207696_1004029 Ga0207696_10040292 247
577 3300025735 Ga0207713_1000645 Ga0207713_100064510 247
578 3300025735 Ga0207713_1005141 Ga0207713_10051413 247
579 3300025898 Ga0207692_10066922 Ga0207692_100669221 247
580 3300025929 Ga0207664_10122269 Ga0207664_101222692 247
581 3300025935 Ga0207709_10079700 Ga0207709_100797002 247
582 3300025940 Ga0207691_10019512 Ga0207691_100195128 247
583 3300026088 Ga0207641_10172380 Ga0207641_101723802 247
584 3300026121 Ga0207683_10341837 Ga0207683_103418372 247
585 3300027296 Ga0209389_1061539 Ga0209389_10615392 247
586 3300027462 Ga0210000_1007935 Ga0210000_10079353 247
587 3300027543 Ga0209999_1049948 Ga0209999_10499481 247
588 3300028380 Ga0268265_10149376 Ga0268265_101493761 247
589 3300031548 Ga0307408_100184017 Ga0307408_1001840172 247
590 3300031665 Ga0316575_10070842 Ga0316575_100708422 247
591 3300031665 Ga0316575_10083207 Ga0316575_100832072 247
592 3300031691 Ga0316579_10009237 Ga0316579_100092373 247
593 3300031691 Ga0316579_10050038 Ga0316579_100500382 247
594 3300031691 Ga0316579_10171275 Ga0316579_101712752 247
595 3300031727 Ga0316576_10125768 Ga0316576_101257682 247
596 3300031727 Ga0316576_10180663 Ga0316576_101806632 247
597 3300031728 Ga0316578_10032042 Ga0316578_100320423 247
598 3300031728 Ga0316578_10254800 Ga0316578_102548002 247
599 3300031733 Ga0316577_10004863 Ga0316577_100048635 247
600 3300032133 Ga0316583_10016175 Ga0316583_100161752 247
601 3300032133 Ga0316583_10021236 Ga0316583_100212362 247
602 3300032133 Ga0316583_10043530 Ga0316583_100435302 247
603 3300032133 Ga0316583_10094751 Ga0316583_100947511 247
604 3300032133 Ga0316583_10099391 Ga0316583_100993912 247
605 3300032137 Ga0316585_10117627 Ga0316585_101176271 247
606 3300032137 Ga0316585_10135490 Ga0316585_101354901 247
607 3300032139 Ga0316580_10044320 Ga0316580_100443202 247
608 3300032168 Ga0316593_10068839 Ga0316593_100688392 247
609 3300033524 Ga0316592_1006013 Ga0316592_10060132 247
610 3300033527 Ga0316586_1006816 Ga0316586_10068162 247
611 3300033527 Ga0316586_1007859 Ga0316586_10078591 247
612 3300033528 Ga0316588_1020477 Ga0316588_10204771 247
613 3300033528 Ga0316588_1027539 Ga0316588_10275392 247
614 3300033529 Ga0316587_1000057 Ga0316587_10000574 247
615 3300033529 Ga0316587_1024685 Ga0316587_10246852 247
616 3300035398 Ga0316574_0009834 Ga0316574_0009834_1428_2186 247
617 3300035398 Ga0316574_0062328 Ga0316574_0062328_530_1291 247
618 3300035398 Ga0316574_0236375 Ga0316574_0236375_91_846 247
619 3300036647 Ga0316582_0017225 Ga0316582_0017225_328_1089 247
620 3300036647 Ga0316582_0024606 Ga0316582_0024606_2349_3107 247
621 3300036647 Ga0316582_0086998 Ga0316582_0086998_47_802 247
622 3300036712 Ga0316584_0017393 Ga0316584_0017393_2440_3201 247
623 3300037471 Ga0395905_0000138 Ga0395905_0000138_77391_78149 247
624 3300037588 Ga0316581_0031622 Ga0316581_0031622_16_774 247
625 3300037588 Ga0316581_0059572 Ga0316581_0059572_127_882 247
626 3300042438 Ga0439459_0002959 Ga0439459_0002959_46_834 247
627 3300042876 Ga0451577_0004145 Ga0451577_0004145_5215_5997 247
628 3300044658 Ga0466972_0175521 Ga0466972_0175521_225_992 247
629 3300044712 Ga0453684_0000039 Ga0453684_0000039_559319_560104 247
630 3300046457 Ga0495590_0000564 Ga0495590_0000564_14561_15334 247
631 3300046460 Ga0495638_0000142 Ga0495638_0000142_50922_51704 247
632 3300046460 Ga0495638_0015524 Ga0495638_0015524_2323_3096 247
633 3300046474 Ga0495605_0017063 Ga0495605_0017063_560_1333 247
634 3300046491 Ga0495584_0200006 Ga0495584_0200006_182_940 247
635 3300046506 Ga0495583_0009872 Ga0495583_0009872_2038_2811 247
636 3300046513 Ga0495616_0092297 Ga0495616_0092297_645_1418 247
637 3300046518 Ga0495631_0000113 Ga0495631_0000113_25583_26356 247
638 3300046519 Ga0495632_0025004 Ga0495632_0025004_259_1032 247
639 3300046520 Ga0495637_0037169 Ga0495637_0037169_58_831 247
640 3300046524 Ga0495648_0000856 Ga0495648_0000856_2194_2967 247
641 3300046524 Ga0495648_0001462 Ga0495648_0001462_641_1414 247
642 3300046558 Ga0495633_0008090 Ga0495633_0008090_3004_3777 247
643 3300046615 Ga0495656_0035858 Ga0495656_0035858_912_1688 247
644 3300046616 Ga0495668_0078425 Ga0495668_0078425_786_1559 247
645 3300046660 Ga0495625_0050710 Ga0495625_0050710_748_1521 247
646 3300046665 Ga0495661_0037601 Ga0495661_0037601_2194_2967 247
647 3300046665 Ga0495661_0045031 Ga0495661_0045031_1142_1915 247
648 3300047447 Ga0495685_001131 Ga0495685_001131_4496_5269 247
649 3300048091 Ga0495626_0015187 Ga0495626_0015187_2690_3463 247
650 3300049459 Ga0495678_000041 Ga0495678_000041_111429_112202 247
651 3300049570 Ga0501033_0001924 Ga0501033_0001924_8341_9171 247
652 3300049572 Ga0501036_0011700 Ga0501036_0011700_163_1041 247
653 3300049573 Ga0501037_0196298 Ga0501037_0196298_229_1059 247
654 3300049574 Ga0501038_0108162 Ga0501038_0108162_25_855 247
655 3300049579 Ga0501043_0000425 Ga0501043_0000425_1193_1960 247
656 3300049579 Ga0501043_0002650 Ga0501043_0002650_3232_4110 247
657 3300049580 Ga0501046_0023253 Ga0501046_0023253_1193_1960 247
658 3300049580 Ga0501046_0135565 Ga0501046_0135565_119_949 247
659 3300049581 Ga0501047_0030244 Ga0501047_0030244_1181_1948 247
660 3300049822 Ga0501035_0015479 Ga0501035_0015479_3530_4399 247
661 3300049822 Ga0501035_0039070 Ga0501035_0039070_1468_2346 247
662 3300049823 Ga0501044_0000353 Ga0501044_0000353_38492_39370 247
663 3300049823 Ga0501044_0264296 Ga0501044_0264296_200_982 247
664 iso_pu_bacteria 2508501125 2509129637 247
665 iso_pu_bacteria 2510065045 2510249179 247
666 iso_pu_bacteria 2512047030 2512352347 247
667 iso_pu_bacteria 2513237150 2513955863 247
668 iso_pu_bacteria 2513237151 2513958738 247
669 iso_pu_bacteria 2513237165 2514045658 247
670 iso_pu_bacteria 2513237166 2514047701 247
671 iso_pu_bacteria 2515154122 2515680538 247
672 iso_pu_bacteria 2526164713 2527076041 247
673 iso_pu_bacteria 2562617112 2563063421 247
674 iso_pu_bacteria 2599185239 2599739816 247
675 iso_pu_bacteria 2600255067 2600814175 247
676 iso_pu_bacteria 2711768613 2713474296 247
677 iso_pu_bacteria 2718217991 2719642412 247
678 iso_pu_bacteria 2738541296 2738820342 247
679 iso_pu_bacteria 2738541298 2738832822 247
680 iso_pu_bacteria 2738541306 2738874349 247
681 iso_pu_bacteria 2738543002 2739185979 247
682 iso_pu_bacteria 2738543008 2739220947 247
683 iso_pu_bacteria 2744054900 2746090604 247
684 iso_pu_bacteria 2744054901 2746099098 247
685 iso_pu_bacteria 2751185846 2753570711 247
686 iso_pu_bacteria 2791355137 2792840968 247
687 iso_pu_bacteria 2818991450 2819620633 247
688 iso_pu_bacteria 2818991452 2819636429 247
689 iso_pu_bacteria 2842324504 2842329352 247
690 iso_pu_bacteria 2842348783 2842354549 247
691 iso_pu_bacteria 2842454564 2842456436 247
692 iso_pu_bacteria 2857357740 2857357903 247
693 iso_pu_bacteria 2858688981 2858699015 247
694 iso_pu_bacteria 2863421361 2863424256 247
695 iso_pu_bacteria 2885192300 2885196664 247
696 iso_pu_bacteria 2885270888 2885277442 247
697 iso_pu_bacteria 2900634093 2900640641 247
698 iso_pu_bacteria 2902682994 2902687729 247
699 iso_pu_bacteria 2904483920 2904486444 247
700 iso_pu_bacteria 2904615490 2904622357 247
701 iso_pu_bacteria 2919527303 2919527789 247
702 iso_pu_bacteria 2928108538 2928108765 247
703 iso_pu_bacteria 2928135762 2928135989 247
704 iso_pu_bacteria 2928157003 2928158481 247
705 iso_pu_bacteria 2928170801 2928174705 247
706 iso_pu_bacteria 2928503688 2928504245 247
707 iso_pu_bacteria 2945934425 2945938877 247
708 iso_pu_bacteria 2981990288 2981991948 247
709 iso_pu_bacteria 2990703756 2990708877 247
710 iso_pu_bacteria 641736151 642421024 247
711 iso_pu_bacteria 642555112 642596853 247
712 iso_pu_bacteria 642555113 642616727 247
713 iso_pu_bacteria 644736347 644748576 247
714 iso_pu_bacteria 8003400568 8003404375 247
715 iso_pu_bacteria 8018845410 8018852712 247
716 iso_pu_bacteria 8020938398 8020942892 247
717 iso_pu_bacteria 8020945358 8020953222 247
718 iso_pu_bacteria 8020953355 8020959572 247
719 iso_pu_bacteria 8055301274 8055304442 247
720 3300005334 Ga0068869_100091614 Ga0068869_1000916142 248
721 3300005347 Ga0070668_100042413 Ga0070668_1000424131 248
722 3300005441 Ga0070700_100012720 Ga0070700_1000127201 248
723 3300005459 Ga0068867_100000291 Ga0068867_10000029120 248
724 3300005617 Ga0068859_100145483 Ga0068859_1001454832 248
725 3300005718 Ga0068866_10010197 Ga0068866_100101974 248
726 3300005719 Ga0068861_100000224 Ga0068861_10000022429 248
727 3300005843 Ga0068860_100001311 Ga0068860_1000013119 248
728 3300006881 Ga0068865_100003985 Ga0068865_1000039859 248
729 3300006931 Ga0097620_100145492 Ga0097620_1001454922 248
730 3300006944 Ga0099823_1009149 Ga0099823_10091494 248
731 3300009147 Ga0114129_11225673 Ga0114129_112256732 248
732 3300011119 Ga0105246_10101503 Ga0105246_101015032 248
733 3300013104 Ga0157370_10001426 Ga0157370_100014267 248
734 3300013297 Ga0157378_10027353 Ga0157378_100273535 248
735 3300013306 Ga0163162_10039730 Ga0163162_100397303 248
736 3300025728 Ga0207655_1000929 Ga0207655_100092916 248
737 3300025899 Ga0207642_10009346 Ga0207642_100093465 248
738 3300025938 Ga0207704_10001999 Ga0207704_100019994 248
739 3300025940 Ga0207691_10012480 Ga0207691_100124804 248
740 3300025942 Ga0207689_10035448 Ga0207689_100354484 248
741 3300026075 Ga0207708_10022743 Ga0207708_100227436 248
742 3300026089 Ga0207648_10000182 Ga0207648_1000018253 248
743 3300026118 Ga0207675_100000551 Ga0207675_10000055132 248
744 3300027296 Ga0209389_1000049 Ga0209389_100004977 248
745 3300028381 Ga0268264_10002391 Ga0268264_100023914 248
746 3300046558 Ga0495633_0013815 Ga0495633_0013815_235_1002 248
747 3300046694 Ga0495649_0004750 Ga0495649_0004750_2254_3021 248
748 3300047472 Ga0495686_0003031 Ga0495686_0003031_10301_11074 248
749 3300048912 Ga0496109_0156332 Ga0496109_0156332_204_965 248
750 3300048926 Ga0496123_0041920 Ga0496123_0041920_2193_2948 248
751 3300048927 Ga0496124_0001295 Ga0496124_0001295_24873_25628 248
752 3300048928 Ga0496125_0018966 Ga0496125_0018966_1453_2208 248
753 3300049571 Ga0501034_0000056 Ga0501034_0000056_99151_99909 248
754 3300049593 Ga0501077_0111073 Ga0501077_0111073_301_1107 248
755 3300049822 Ga0501035_0347314 Ga0501035_0347314_399_1205 248
756 iso_pu_bacteria 2596583598 2597029091 248
757 iso_pu_bacteria 2599185178 2599445708 248
758 3300001979 JGI24740J21852_10003113 JGI24740J21852_100031138 249
759 3300002705 JGI25156J39149_1011294 JGI25156J39149_10112942 249
760 3300002738 JGI25154J39366_1002536 JGI25154J39366_10025364 249
761 3300003756 Ga0055533_1007945 Ga0055533_10079451 249
762 3300003762 Ga0055542_1001112 Ga0055542_10011122 249
763 3300003841 Ga0055541_1000608 Ga0055541_10006085 249
764 3300005366 Ga0070659_100005447 Ga0070659_1000054472 249
765 3300005616 Ga0068852_100032440 Ga0068852_1000324402 249
766 3300005616 Ga0068852_100555327 Ga0068852_1005553272 249
767 3300005617 Ga0068859_100434549 Ga0068859_1004345492 249
768 3300005618 Ga0068864_100487944 Ga0068864_1004879442 249
769 3300005841 Ga0068863_100173214 Ga0068863_1001732142 249
770 3300005842 Ga0068858_100210712 Ga0068858_1002107122 249
771 3300005844 Ga0068862_100017386 Ga0068862_1000173863 249
772 3300006931 Ga0097620_100434516 Ga0097620_1004345162 249
773 3300009011 Ga0105251_10073933 Ga0105251_100739332 249
774 3300009036 Ga0105244_10019804 Ga0105244_100198043 249
775 3300009092 Ga0105250_10010698 Ga0105250_100106983 249
776 3300009094 Ga0111539_10506858 Ga0111539_105068582 249
777 3300009101 Ga0105247_10343731 Ga0105247_103437312 249
778 3300009148 Ga0105243_10130720 Ga0105243_101307202 249
779 3300009177 Ga0105248_10010268 Ga0105248_100102682 249
780 3300009177 Ga0105248_10281918 Ga0105248_102819182 249
781 3300015261 Ga0182006_1045425 Ga0182006_10454252 249
782 3300025224 Ga0209784_100778 Ga0209784_1007784 249
783 3300025225 Ga0209566_100519 Ga0209566_10051910 249
784 3300025226 Ga0209674_100384 Ga0209674_1003845 249
785 3300025230 Ga0209563_116549 Ga0209563_1165491 249
786 3300025246 Ga0209646_1000022 Ga0209646_100002241 249
787 3300025250 Ga0209026_1002986 Ga0209026_10029862 249
788 3300025253 Ga0209677_102011 Ga0209677_1020112 249
789 3300025254 Ga0209148_1000158 Ga0209148_1000158118 249
790 3300025256 Ga0209759_1014699 Ga0209759_10146992 249
791 3300025904 Ga0207647_10271800 Ga0207647_102718002 249
792 3300025931 Ga0207644_10050002 Ga0207644_100500021 249
793 3300025932 Ga0207690_10005091 Ga0207690_100050912 249
794 3300025941 Ga0207711_10033488 Ga0207711_100334884 249
795 3300025942 Ga0207689_10542224 Ga0207689_105422242 249
796 3300026088 Ga0207641_10114442 Ga0207641_101144421 249
797 3300026095 Ga0207676_10078051 Ga0207676_100780512 249
798 3300028380 Ga0268265_10236792 Ga0268265_102367922 249
799 3300028380 Ga0268265_10493721 Ga0268265_104937212 249
800 3300028794 Ga0307515_10000064 Ga0307515_100000641 249
801 3300031456 Ga0307513_10114676 Ga0307513_101146762 249
802 3300042006 Ga0439432_000932 Ga0439432_000932_1936_2694 249
803 3300042136 Ga0450900_001178 Ga0450900_001178_1390_2148 249
804 3300042142 Ga0450905_000527 Ga0450905_000527_710_1468 249
805 3300042876 Ga0451577_0004111 Ga0451577_0004111_2091_2855 249
806 3300042876 Ga0451577_0270863 Ga0451577_0270863_182_946 249
807 3300044656 Ga0466969_0032581 Ga0466969_0032581_1444_2193 249
808 3300044658 Ga0466972_0013727 Ga0466972_0013727_3229_3978 249
809 3300044671 Ga0466978_0021228 Ga0466978_0021228_2791_3540 249
810 3300044672 Ga0466982_0194935 Ga0466982_0194935_293_1042 249
811 3300044673 Ga0453683_0005236 Ga0453683_0005236_6740_7519 249
812 3300044693 Ga0466961_0002119 Ga0466961_0002119_5317_6066 249
813 3300044694 Ga0466963_0133434 Ga0466963_0133434_420_1169 249
814 3300044706 Ga0466964_0011262 Ga0466964_0011262_1224_1973 249
815 3300044712 Ga0453684_0023208 Ga0453684_0023208_3150_3914 249
816 3300044735 Ga0466968_0139078 Ga0466968_0139078_296_1045 249
817 3300044842 Ga0466957_0066210 Ga0466957_0066210_419_1168 249
818 3300045049 Ga0466959_0000328 Ga0466959_0000328_2857_3606 249
819 3300045051 Ga0451576_0497406 Ga0451576_0497406_491_1255 249
820 3300045976 Ga0466967_0041666 Ga0466967_0041666_1753_2502 249
821 3300046491 Ga0495584_0002329 Ga0495584_0002329_3672_4454 249
822 3300046492 Ga0495585_0002313 Ga0495585_0002313_12528_13298 249
823 3300046492 Ga0495585_0010392 Ga0495585_0010392_3402_4184 249
824 3300046500 Ga0495596_0002354 Ga0495596_0002354_3876_4658 249
825 3300046506 Ga0495583_0000160 Ga0495583_0000160_17943_18725 249
826 3300046513 Ga0495616_0022287 Ga0495616_0022287_303_1085 249
827 3300046518 Ga0495631_0033090 Ga0495631_0033090_73_855 249
828 3300046523 Ga0495644_0002495 Ga0495644_0002495_6198_6980 249
829 3300046526 Ga0495666_0007370 Ga0495666_0007370_1881_2651 249
830 3300046558 Ga0495633_0015441 Ga0495633_0015441_1472_2254 249
831 3300046616 Ga0495668_0021800 Ga0495668_0021800_157_939 249
832 3300046648 Ga0495611_0002708 Ga0495611_0002708_2983_3765 249
833 3300046665 Ga0495661_0000725 Ga0495661_0000725_28027_28797 249
834 3300046665 Ga0495661_0009821 Ga0495661_0009821_3408_4190 249
835 3300046691 Ga0495670_0000977 Ga0495670_0000977_12714_13484 249
836 3300046794 Ga0495589_0003956 Ga0495589_0003956_3298_4080 249
837 3300047323 Ga0495683_0008170 Ga0495683_0008170_1679_2461 249
838 3300047445 Ga0495677_0000105 Ga0495677_0000105_5692_6474 249
839 3300047446 Ga0495679_005087 Ga0495679_005087_549_1331 249
840 3300047470 Ga0495681_0001995 Ga0495681_0001995_3198_3968 249
841 3300048091 Ga0495626_0003089 Ga0495626_0003089_4415_5197 249
842 3300048911 Ga0496108_0066056 Ga0496108_0066056_114_875 249
843 3300048915 Ga0496112_0013244 Ga0496112_0013244_293_1054 249
844 3300048917 Ga0496114_0010230 Ga0496114_0010230_30_788 249
845 3300048927 Ga0496124_0062550 Ga0496124_0062550_1554_2312 249
846 3300049568 Ga0501031_0039495 Ga0501031_0039495_1797_2570 249
847 3300049569 Ga0501032_0004457 Ga0501032_0004457_6885_7658 249
848 3300049570 Ga0501033_0375130 Ga0501033_0375130_133_921 249
849 3300049571 Ga0501034_0000101 Ga0501034_0000101_119430_120188 249
850 3300049574 Ga0501038_0018992 Ga0501038_0018992_3745_4518 249
851 3300049823 Ga0501044_0166430 Ga0501044_0166430_684_1472 249
852 3300053135 Ga0500659_0002495 Ga0500659_0002495_4061_4819 249
853 3300061719 Ga0466962_0034846 Ga0466962_0034846_366_1115 249
854 3300003187 JGI25151J46595_10003421 JGI25151J46595_100034217 250
855 3300003187 JGI25151J46595_10010145 JGI25151J46595_100101452 250
856 3300003771 Ga0055526_1003201 Ga0055526_10032014 250
857 3300003771 Ga0055526_1003737 Ga0055526_10037372 250
858 3300003771 Ga0055526_1007580 Ga0055526_10075802 250
859 3300003771 Ga0055526_1019863 Ga0055526_10198631 250
860 3300003773 Ga0055537_1008344 Ga0055537_10083442 250
861 3300003775 Ga0055524_1000290 Ga0055524_10002908 250
862 3300003775 Ga0055524_1001717 Ga0055524_10017178 250
863 3300003781 Ga0055536_1000074 Ga0055536_100007467 250
864 3300003784 Ga0055534_1000761 Ga0055534_100076112 250
865 3300003784 Ga0055534_1003807 Ga0055534_10038072 250
866 3300005289 Ga0065704_10082103 Ga0065704_100821034 250
867 3300005295 Ga0065707_10091191 Ga0065707_100911913 250
868 3300005328 Ga0070676_10170965 Ga0070676_101709651 250
869 3300005334 Ga0068869_100165480 Ga0068869_1001654802 250
870 3300005338 Ga0068868_100009165 Ga0068868_1000091655 250
871 3300005355 Ga0070671_100022023 Ga0070671_1000220235 250
872 3300005355 Ga0070671_100104434 Ga0070671_1001044342 250
873 3300005367 Ga0070667_100070375 Ga0070667_1000703752 250
874 3300005441 Ga0070700_100117399 Ga0070700_1001173992 250
875 3300005456 Ga0070678_100307853 Ga0070678_1003078532 250
876 3300005539 Ga0068853_100496768 Ga0068853_1004967682 250
877 3300005548 Ga0070665_100054489 Ga0070665_1000544892 250
878 3300005578 Ga0068854_100035415 Ga0068854_1000354153 250
879 3300005617 Ga0068859_100191621 Ga0068859_1001916212 250
880 3300005618 Ga0068864_100039632 Ga0068864_1000396324 250
881 3300005843 Ga0068860_100044758 Ga0068860_1000447582 250
882 3300006038 Ga0075365_10156982 Ga0075365_101569821 250
883 3300006042 Ga0075368_10071645 Ga0075368_100716452 250
884 3300006048 Ga0075363_100026916 Ga0075363_1000269163 250
885 3300006048 Ga0075363_100087501 Ga0075363_1000875012 250
886 3300006178 Ga0075367_10269397 Ga0075367_102693972 250
887 3300006195 Ga0075366_10169780 Ga0075366_101697802 250
888 3300006195 Ga0075366_10232807 Ga0075366_102328072 250
889 3300006353 Ga0075370_10003699 Ga0075370_100036996 250
890 3300006353 Ga0075370_10137923 Ga0075370_101379232 250
891 3300006358 Ga0068871_100460791 Ga0068871_1004607912 250
892 3300006931 Ga0097620_100191627 Ga0097620_1001916272 250
893 3300009036 Ga0105244_10002031 Ga0105244_100020314 250
894 3300009098 Ga0105245_10027174 Ga0105245_100271745 250
895 3300009098 Ga0105245_10254667 Ga0105245_102546672 250
896 3300009545 Ga0105237_10004557 Ga0105237_100045576 250
897 3300010375 Ga0105239_10009841 Ga0105239_1000984111 250
898 3300014325 Ga0163163_10186771 Ga0163163_101867712 250
899 3300014497 Ga0182008_10021992 Ga0182008_100219922 250
900 3300015262 Ga0182007_10004882 Ga0182007_100048823 250
901 3300017792 Ga0163161_10027704 Ga0163161_100277042 250
902 3300017792 Ga0163161_10120022 Ga0163161_101200222 250
903 3300025263 Ga0209565_1000329 Ga0209565_100032935 250
904 3300025273 Ga0209673_1037191 Ga0209673_10371912 250
905 3300025291 Ga0209675_1000070 Ga0209675_1000070139 250
906 3300025291 Ga0209675_1000432 Ga0209675_10004328 250
907 3300025292 Ga0209676_1000012 Ga0209676_1000012484 250
908 3300025294 Ga0209025_1000523 Ga0209025_100052351 250
909 3300025294 Ga0209025_1001621 Ga0209025_100162110 250
910 3300025294 Ga0209025_1006383 Ga0209025_10063832 250
911 3300025294 Ga0209025_1038722 Ga0209025_10387222 250
912 3300025295 Ga0209564_1000359 Ga0209564_100035954 250
913 3300025295 Ga0209564_1003269 Ga0209564_100326910 250
914 3300025295 Ga0209564_1003406 Ga0209564_10034069 250
915 3300025299 Ga0209256_1000059 Ga0209256_100005983 250
916 3300025907 Ga0207645_10052005 Ga0207645_100520053 250
917 3300025914 Ga0207671_10009421 Ga0207671_100094213 250
918 3300025927 Ga0207687_10017964 Ga0207687_100179642 250
919 3300025931 Ga0207644_10097307 Ga0207644_100973072 250
920 3300025937 Ga0207669_10233431 Ga0207669_102334312 250
921 3300025940 Ga0207691_10263627 Ga0207691_102636272 250
922 3300025942 Ga0207689_10142432 Ga0207689_101424322 250
923 3300026095 Ga0207676_10036715 Ga0207676_100367152 250
924 3300026116 Ga0207674_10303224 Ga0207674_103032242 250
925 3300026121 Ga0207683_10151342 Ga0207683_101513422 250
926 3300026142 Ga0207698_10067203 Ga0207698_100672032 250
927 3300027866 Ga0209813_10005511 Ga0209813_100055112 250
928 3300028379 Ga0268266_10135471 Ga0268266_101354712 250
929 3300028794 Ga0307515_10127990 Ga0307515_101279902 250
930 3300030522 Ga0307512_10238470 Ga0307512_102384701 250
931 3300030735 Ga0316178_1108561 Ga0316178_11085611 250
932 3300031456 Ga0307513_10010724 Ga0307513_100107247 250
933 3300031456 Ga0307513_10197551 Ga0307513_101975512 250
934 3300031616 Ga0307508_10002237 Ga0307508_1000223712 250
935 3300033180 Ga0307510_10151238 Ga0307510_101512382 250
936 3300035084 Ga0373928_0003096 Ga0373928_0003096_861_1634 250
937 3300035092 Ga0373952_0038233 Ga0373952_0038233_170_955 250
938 3300035121 Ga0373960_0027298 Ga0373960_0027298_132_917 250
939 3300037471 Ga0395905_0363120 Ga0395905_0363120_398_1195 250
940 3300041512 Ga0451853_3433684 Ga0451853_3433684_547_1326 250
941 3300042002 Ga0439442_024145 Ga0439442_024145_99_869 250
942 3300042004 Ga0439445_0004691 Ga0439445_0004691_1703_2479 250
943 3300042015 Ga0439462_0039943 Ga0439462_0039943_454_1224 250
944 3300042137 Ga0450902_001457 Ga0450902_001457_1749_2510 250
945 3300042533 Ga0450901_000469 Ga0450901_000469_1898_2659 250
946 3300042876 Ga0451577_0243287 Ga0451577_0243287_438_1205 250
947 3300044673 Ga0453683_0077912 Ga0453683_0077912_147_914 250
948 3300044712 Ga0453684_0000209 Ga0453684_0000209_83001_83774 250
949 3300044712 Ga0453684_0005764 Ga0453684_0005764_2894_3661 250
950 3300044712 Ga0453684_0037047 Ga0453684_0037047_2863_3633 250
951 3300044712 Ga0453684_0038797 Ga0453684_0038797_5252_6025 250
952 3300044712 Ga0453684_0100394 Ga0453684_0100394_1858_2631 250
953 3300044712 Ga0453684_0141098 Ga0453684_0141098_1361_2134 250
954 3300044712 Ga0453684_0263642 Ga0453684_0263642_52_819 250
955 3300045051 Ga0451576_0077326 Ga0451576_0077326_316_1083 250
956 3300045051 Ga0451576_0362614 Ga0451576_0362614_266_1036 250
957 3300046452 Ga0495617_000539 Ga0495617_000539_17771_18535 250
958 3300046457 Ga0495590_0099089 Ga0495590_0099089_209_991 250
959 3300046472 Ga0495580_0068274 Ga0495580_0068274_119_889 250
960 3300046475 Ga0495639_0023188 Ga0495639_0023188_119_898 250
961 3300046491 Ga0495584_0000017 Ga0495584_0000017_78753_79517 250
962 3300046491 Ga0495584_0001098 Ga0495584_0001098_5044_5820 250
963 3300046492 Ga0495585_0000064 Ga0495585_0000064_87030_87794 250
964 3300046492 Ga0495585_0000254 Ga0495585_0000254_26780_27556 250
965 3300046492 Ga0495585_0011365 Ga0495585_0011365_2125_2889 250
966 3300046507 Ga0495606_0003064 Ga0495606_0003064_5862_6629 250
967 3300046507 Ga0495606_0082712 Ga0495606_0082712_714_1478 250
968 3300046513 Ga0495616_0004568 Ga0495616_0004568_1254_2030 250
969 3300046517 Ga0495630_0054506 Ga0495630_0054506_1272_2051 250
970 3300046522 Ga0495643_0069400 Ga0495643_0069400_540_1304 250
971 3300046524 Ga0495648_0000007 Ga0495648_0000007_244583_245347 250
972 3300046524 Ga0495648_0005631 Ga0495648_0005631_8913_9677 250
973 3300046528 Ga0495642_0033608 Ga0495642_0033608_1235_2002 250
974 3300046528 Ga0495642_0069831 Ga0495642_0069831_138_902 250
975 3300046539 Ga0495621_0025804 Ga0495621_0025804_250_1035 250
976 3300046542 Ga0495597_0090184 Ga0495597_0090184_127_897 250
977 3300046558 Ga0495633_0002408 Ga0495633_0002408_10093_10857 250
978 3300046558 Ga0495633_0038594 Ga0495633_0038594_794_1558 250
979 3300046665 Ga0495661_0008840 Ga0495661_0008840_85_849 250
980 3300046692 Ga0495671_0012253 Ga0495671_0012253_1837_2601 250
981 3300046694 Ga0495649_0044469 Ga0495649_0044469_596_1378 250
982 3300046810 Ga0495660_0045872 Ga0495660_0045872_1082_1864 250
983 3300047323 Ga0495683_0000179 Ga0495683_0000179_27409_28185 250
984 3300047443 Ga0495687_016328 Ga0495687_016328_2702_3484 250
985 3300048904 Ga0496101_0005306 Ga0496101_0005306_2148_2927 250
986 3300048906 Ga0496103_0010012 Ga0496103_0010012_3821_4600 250
987 3300048907 Ga0496104_0002714 Ga0496104_0002714_8384_9163 250
988 3300048909 Ga0496106_0008360 Ga0496106_0008360_3042_3821 250
989 3300048911 Ga0496108_0237639 Ga0496108_0237639_431_1210 250
990 3300048918 Ga0496115_0043109 Ga0496115_0043109_887_1651 250
991 3300048919 Ga0496116_0037342 Ga0496116_0037342_585_1355 250
992 3300048924 Ga0496121_0167815 Ga0496121_0167815_332_1093 250
993 3300049571 Ga0501034_0000188 Ga0501034_0000188_19547_20311 250
994 3300049571 Ga0501034_0003555 Ga0501034_0003555_7796_8578 250
995 3300049574 Ga0501038_0048173 Ga0501038_0048173_1050_1817 250
996 3300049578 Ga0501042_0099048 Ga0501042_0099048_607_1374 250
997 3300049587 Ga0501071_0008369 Ga0501071_0008369_5016_5783 250
998 3300049588 Ga0501072_0015941 Ga0501072_0015941_197_964 250
999 3300049591 Ga0501075_0032348 Ga0501075_0032348_1876_2643 250
1000 3300049592 Ga0501076_0012583 Ga0501076_0012583_3219_3986 250
1001 3300049593 Ga0501077_0024917 Ga0501077_0024917_661_1428 250
1002 3300049741 Ga0501079_0027245 Ga0501079_0027245_1288_2055 250
1003 3300049824 Ga0501045_0038705 Ga0501045_0038705_1159_1926 250
1004 3300050489 nmdc:mga03683_15387_c1 nmdc:mga03683_15387_c1_440_1222 250
1005 3300050489 nmdc:mga03683_88033_c1 nmdc:mga03683_88033_c1_362_1144 250
1006 3300050489 nmdc:mga03683_8977_c1 nmdc:mga03683_8977_c1_2439_3215 250
1007 3300050493 nmdc:mga0k408_152543_c1 nmdc:mga0k408_152543_c1_319_1101 250
1008 3300050493 nmdc:mga0k408_2021_c1 nmdc:mga0k408_2021_c1_2436_3230 250
1009 3300050493 nmdc:mga0k408_77544_c1 nmdc:mga0k408_77544_c1_522_1298 250
1010 3300050496 nmdc:mga07m45_150706_c1 nmdc:mga07m45_150706_c1_223_999 250
1011 3300050496 nmdc:mga07m45_49256_c1 nmdc:mga07m45_49256_c1_293_1087 250
1012 3300050496 nmdc:mga07m45_5308_c1 nmdc:mga07m45_5308_c1_4157_4939 250
1013 3300050516 nmdc:mga0sz30_109167_c1 nmdc:mga0sz30_109167_c1_84_866 250
1014 3300050516 nmdc:mga0sz30_16840_c1 nmdc:mga0sz30_16840_c1_1822_2616 250
1015 3300060353 Ga0501082_0038427 Ga0501082_0038427_431_1198 250
1016 3300061734 Ga0530510_0007252 Ga0530510_0007252_4526_5293 250
1017 3300001989 JGI24739J22299_10009203 JGI24739J22299_100092033 251
1018 3300002067 JGI24735J21928_10051138 JGI24735J21928_100511382 251
1019 3300009011 Ga0105251_10000310 Ga0105251_100003109 251
1020 3300015262 Ga0182007_10004662 Ga0182007_100046623 251
1021 3300025256 Ga0209759_1000002 Ga0209759_100000298 251
1022 3300025284 Ga0209130_1006725 Ga0209130_10067254 251
1023 3300025735 Ga0207713_1000683 Ga0207713_10006837 251
1024 3300025904 Ga0207647_10068057 Ga0207647_100680572 251
1025 3300025904 Ga0207647_10158916 Ga0207647_101589162 251
1026 3300025941 Ga0207711_10068436 Ga0207711_100684362 251
1027 3300027312 Ga0209371_1004494 Ga0209371_10044945 251
1028 3300030500 Ga0268256_1004255 Ga0268256_10042552 251
1029 3300041404 Ga0439436_0001760 Ga0439436_0001760_5029_5805 251
1030 3300041997 Ga0439431_0000936 Ga0439431_0000936_3252_4028 251
1031 3300042006 Ga0439432_031900 Ga0439432_031900_797_1579 251
1032 3300042007 Ga0439449_0006682 Ga0439449_0006682_1276_2058 251
1033 3300046454 Ga0495592_0005128 Ga0495592_0005128_7174_7947 251
1034 3300046455 Ga0495603_0072371 Ga0495603_0072371_801_1574 251
1035 3300046457 Ga0495590_0022344 Ga0495590_0022344_646_1419 251
1036 3300046458 Ga0495591_006006 Ga0495591_006006_3342_4115 251
1037 3300046459 Ga0495629_0000068 Ga0495629_0000068_61430_62203 251
1038 3300046459 Ga0495629_0002001 Ga0495629_0002001_4779_5552 251
1039 3300046459 Ga0495629_0008667 Ga0495629_0008667_6460_7233 251
1040 3300046459 Ga0495629_0010808 Ga0495629_0010808_2591_3364 251
1041 3300046460 Ga0495638_0006804 Ga0495638_0006804_6249_7022 251
1042 3300046461 Ga0495641_0029655 Ga0495641_0029655_789_1562 251
1043 3300046462 Ga0495651_0002428 Ga0495651_0002428_8255_9028 251
1044 3300046462 Ga0495651_0033735 Ga0495651_0033735_342_1115 251
1045 3300046463 Ga0495653_0000106 Ga0495653_0000106_38736_39509 251
1046 3300046463 Ga0495653_0028519 Ga0495653_0028519_1267_2040 251
1047 3300046463 Ga0495653_0038059 Ga0495653_0038059_1721_2494 251
1048 3300046463 Ga0495653_0110105 Ga0495653_0110105_57_830 251
1049 3300046463 Ga0495653_0150697 Ga0495653_0150697_500_1273 251
1050 3300046471 Ga0495650_0002257 Ga0495650_0002257_7436_8209 251
1051 3300046471 Ga0495650_0029397 Ga0495650_0029397_33_806 251
1052 3300046472 Ga0495580_0000062 Ga0495580_0000062_53619_54392 251
1053 3300046472 Ga0495580_0003904 Ga0495580_0003904_8897_9670 251
1054 3300046472 Ga0495580_0004329 Ga0495580_0004329_8182_8955 251
1055 3300046472 Ga0495580_0025177 Ga0495580_0025177_1118_1891 251
1056 3300046472 Ga0495580_0115496 Ga0495580_0115496_521_1294 251
1057 3300046472 Ga0495580_0179619 Ga0495580_0179619_279_1052 251
1058 3300046473 Ga0495582_0007318 Ga0495582_0007318_4698_5471 251
1059 3300046473 Ga0495582_0021578 Ga0495582_0021578_1461_2234 251
1060 3300046473 Ga0495582_0070828 Ga0495582_0070828_657_1430 251
1061 3300046474 Ga0495605_0004132 Ga0495605_0004132_2611_3384 251
1062 3300046477 Ga0495664_0029571 Ga0495664_0029571_427_1200 251
1063 3300046499 Ga0495594_0056756 Ga0495594_0056756_966_1739 251
1064 3300046500 Ga0495596_0042249 Ga0495596_0042249_557_1330 251
1065 3300046507 Ga0495606_0261742 Ga0495606_0261742_81_854 251
1066 3300046511 Ga0495608_0002682 Ga0495608_0002682_1761_2534 251
1067 3300046514 Ga0495618_0012154 Ga0495618_0012154_317_1090 251
1068 3300046514 Ga0495618_0034021 Ga0495618_0034021_2176_2949 251
1069 3300046516 Ga0495628_0056824 Ga0495628_0056824_594_1367 251
1070 3300046516 Ga0495628_0126295 Ga0495628_0126295_343_1116 251
1071 3300046516 Ga0495628_0261871 Ga0495628_0261871_213_986 251
1072 3300046517 Ga0495630_0011461 Ga0495630_0011461_4496_5269 251
1073 3300046517 Ga0495630_0072540 Ga0495630_0072540_1390_2163 251
1074 3300046517 Ga0495630_0079545 Ga0495630_0079545_1110_1883 251
1075 3300046518 Ga0495631_0026301 Ga0495631_0026301_692_1465 251
1076 3300046524 Ga0495648_0013118 Ga0495648_0013118_3437_4210 251
1077 3300046524 Ga0495648_0106806 Ga0495648_0106806_442_1215 251
1078 3300046526 Ga0495666_0001428 Ga0495666_0001428_9786_10559 251
1079 3300046526 Ga0495666_0014337 Ga0495666_0014337_2867_3640 251
1080 3300046526 Ga0495666_0014921 Ga0495666_0014921_1370_2143 251
1081 3300046529 Ga0495652_0077689 Ga0495652_0077689_1635_2408 251
1082 3300046529 Ga0495652_0166659 Ga0495652_0166659_743_1516 251
1083 3300046529 Ga0495652_0207008 Ga0495652_0207008_466_1239 251
1084 3300046531 Ga0495665_0021697 Ga0495665_0021697_1510_2283 251
1085 3300046531 Ga0495665_0040356 Ga0495665_0040356_1186_1959 251
1086 3300046531 Ga0495665_0068412 Ga0495665_0068412_392_1165 251
1087 3300046533 Ga0495640_0002419 Ga0495640_0002419_10655_11428 251
1088 3300046533 Ga0495640_0012920 Ga0495640_0012920_729_1502 251
1089 3300046533 Ga0495640_0049451 Ga0495640_0049451_1532_2305 251
1090 3300046535 Ga0495586_0022459 Ga0495586_0022459_91_864 251
1091 3300046535 Ga0495586_0064202 Ga0495586_0064202_836_1609 251
1092 3300046535 Ga0495586_0082798 Ga0495586_0082798_603_1376 251
1093 3300046536 Ga0495587_0001498 Ga0495587_0001498_4900_5673 251
1094 3300046543 Ga0495645_0049738 Ga0495645_0049738_863_1636 251
1095 3300046543 Ga0495645_0095348 Ga0495645_0095348_790_1563 251
1096 3300046557 Ga0495622_0000005 Ga0495622_0000005_68978_69751 251
1097 3300046642 Ga0495634_0001826 Ga0495634_0001826_14003_14776 251
1098 3300046642 Ga0495634_0014590 Ga0495634_0014590_888_1661 251
1099 3300046642 Ga0495634_0123621 Ga0495634_0123621_52_825 251
1100 3300046648 Ga0495611_0090398 Ga0495611_0090398_165_938 251
1101 3300046663 Ga0495635_0006638 Ga0495635_0006638_4728_5501 251
1102 3300046663 Ga0495635_0038217 Ga0495635_0038217_2367_3140 251
1103 3300046665 Ga0495661_0018782 Ga0495661_0018782_3355_4128 251
1104 3300046665 Ga0495661_0043099 Ga0495661_0043099_1234_2007 251
1105 3300046678 Ga0495599_0009080 Ga0495599_0009080_3039_3812 251
1106 3300046678 Ga0495599_0016433 Ga0495599_0016433_174_947 251
1107 3300046678 Ga0495599_0032937 Ga0495599_0032937_226_999 251
1108 3300046679 Ga0495623_0019454 Ga0495623_0019454_1171_1944 251
1109 3300046679 Ga0495623_0036214 Ga0495623_0036214_1965_2738 251
1110 3300046679 Ga0495623_0070802 Ga0495623_0070802_189_962 251
1111 3300046680 Ga0495646_0024982 Ga0495646_0024982_1836_2609 251
1112 3300046680 Ga0495646_0038413 Ga0495646_0038413_2111_2884 251
1113 3300046680 Ga0495646_0038578 Ga0495646_0038578_463_1236 251
1114 3300046680 Ga0495646_0053415 Ga0495646_0053415_736_1509 251
1115 3300046689 Ga0495613_0007287 Ga0495613_0007287_1266_2039 251
1116 3300046689 Ga0495613_0010933 Ga0495613_0010933_3293_4066 251
1117 3300046690 Ga0495624_0002899 Ga0495624_0002899_4583_5356 251
1118 3300046690 Ga0495624_0014833 Ga0495624_0014833_1577_2350 251
1119 3300046690 Ga0495624_0015212 Ga0495624_0015212_1133_1906 251
1120 3300046690 Ga0495624_0026356 Ga0495624_0026356_1867_2640 251
1121 3300046690 Ga0495624_0101477 Ga0495624_0101477_557_1330 251
1122 3300046691 Ga0495670_0000157 Ga0495670_0000157_24728_25510 251
1123 3300046694 Ga0495649_0037773 Ga0495649_0037773_968_1741 251
1124 3300046794 Ga0495589_0014700 Ga0495589_0014700_2268_3041 251
1125 3300046809 Ga0495600_0039056 Ga0495600_0039056_1252_2025 251
1126 3300047315 Ga0495581_0000974 Ga0495581_0000974_10071_10844 251
1127 3300047315 Ga0495581_0037611 Ga0495581_0037611_1932_2705 251
1128 3300047317 Ga0495604_0009687 Ga0495604_0009687_5684_6457 251
1129 3300047317 Ga0495604_0012629 Ga0495604_0012629_317_1090 251
1130 3300047317 Ga0495604_0028630 Ga0495604_0028630_2153_2926 251
1131 3300047317 Ga0495604_0135107 Ga0495604_0135107_917_1690 251
1132 3300047319 Ga0495674_0050129 Ga0495674_0050129_2490_3263 251
1133 3300047319 Ga0495674_0051499 Ga0495674_0051499_573_1346 251
1134 3300047319 Ga0495674_0079072 Ga0495674_0079072_1012_1785 251
1135 3300047319 Ga0495674_0108638 Ga0495674_0108638_987_1760 251
1136 3300047321 Ga0495676_0033008 Ga0495676_0033008_1019_1792 251
1137 3300047321 Ga0495676_0058821 Ga0495676_0058821_1080_1853 251
1138 3300047321 Ga0495676_0068060 Ga0495676_0068060_427_1200 251
1139 3300047321 Ga0495676_0074321 Ga0495676_0074321_556_1329 251
1140 3300047322 Ga0495680_0009459 Ga0495680_0009459_706_1479 251
1141 3300047322 Ga0495680_0014461 Ga0495680_0014461_4104_4877 251
1142 3300047322 Ga0495680_0041629 Ga0495680_0041629_1043_1816 251
1143 3300047322 Ga0495680_0105528 Ga0495680_0105528_303_1076 251
1144 3300047322 Ga0495680_0128226 Ga0495680_0128226_836_1609 251
1145 3300047323 Ga0495683_0002296 Ga0495683_0002296_8812_9585 251
1146 3300047323 Ga0495683_0128263 Ga0495683_0128263_241_1014 251
1147 3300047444 Ga0495675_0001779 Ga0495675_0001779_2600_3373 251
1148 3300047444 Ga0495675_0002004 Ga0495675_0002004_7928_8701 251
1149 3300047444 Ga0495675_0002575 Ga0495675_0002575_3817_4590 251
1150 3300047444 Ga0495675_0220366 Ga0495675_0220366_357_1130 251
1151 3300047446 Ga0495679_000009 Ga0495679_000009_325933_326706 251
1152 3300047446 Ga0495679_000272 Ga0495679_000272_25137_25910 251
1153 3300047446 Ga0495679_033950 Ga0495679_033950_297_1070 251
1154 3300047469 Ga0495673_0003578 Ga0495673_0003578_7958_8731 251
1155 3300047673 Ga0495593_0006303 Ga0495593_0006303_2629_3402 251
1156 3300047673 Ga0495593_0012286 Ga0495593_0012286_834_1607 251
1157 3300047673 Ga0495593_0057511 Ga0495593_0057511_429_1202 251
1158 3300048088 Ga0495602_0017169 Ga0495602_0017169_2146_2919 251
1159 3300048088 Ga0495602_0033154 Ga0495602_0033154_2806_3579 251
1160 3300048088 Ga0495602_0052347 Ga0495602_0052347_1816_2589 251
1161 3300048088 Ga0495602_0084640 Ga0495602_0084640_1323_2096 251
1162 3300048088 Ga0495602_0274886 Ga0495602_0274886_442_1215 251
1163 3300048089 Ga0495614_0000338 Ga0495614_0000338_8130_8903 251
1164 3300048089 Ga0495614_0002659 Ga0495614_0002659_1679_2452 251
1165 3300048089 Ga0495614_0026652 Ga0495614_0026652_1308_2081 251
1166 3300048091 Ga0495626_0034022 Ga0495626_0034022_236_1003 251
1167 3300048905 Ga0496102_0442022 Ga0496102_0442022_37_810 251
1168 3300048906 Ga0496103_0004541 Ga0496103_0004541_4607_5380 251
1169 3300048919 Ga0496116_0003464 Ga0496116_0003464_9583_10353 251
1170 3300048921 Ga0496118_0001543 Ga0496118_0001543_8086_8859 251
1171 3300048921 Ga0496118_0004355 Ga0496118_0004355_3606_4379 251
1172 3300048921 Ga0496118_0049673 Ga0496118_0049673_892_1665 251
1173 3300048921 Ga0496118_0085780 Ga0496118_0085780_1190_1963 251
1174 3300048929 Ga0496126_0000475 Ga0496126_0000475_46570_47343 251
1175 3300048929 Ga0496126_0001848 Ga0496126_0001848_13840_14613 251
1176 3300049460 Ga0495682_0027619 Ga0495682_0027619_1211_1984 251
1177 3300001915 JGI24741J21665_1001446 JGI24741J21665_10014464 252
1178 3300001979 JGI24740J21852_10000162 JGI24740J21852_100001628 252
1179 3300002705 JGI25156J39149_1011629 JGI25156J39149_10116292 252
1180 3300002705 JGI25156J39149_1013888 JGI25156J39149_10138882 252
1181 3300003752 Ga0055539_1000038 Ga0055539_100003820 252
1182 3300003756 Ga0055533_1004567 Ga0055533_10045672 252
1183 3300003758 Ga0055532_1000002 Ga0055532_1000002441 252
1184 3300003759 Ga0055525_1000324 Ga0055525_100032423 252
1185 3300003763 Ga0055529_1000113 Ga0055529_100011311 252
1186 3300005337 Ga0070682_100037222 Ga0070682_1000372222 252
1187 3300005344 Ga0070661_100000321 Ga0070661_10000032123 252
1188 3300005455 Ga0070663_100000046 Ga0070663_1000000466 252
1189 3300005564 Ga0070664_100000002 Ga0070664_100000002397 252
1190 3300005577 Ga0068857_100193952 Ga0068857_1001939522 252
1191 3300005578 Ga0068854_100000004 Ga0068854_100000004202 252
1192 3300005614 Ga0068856_100000035 Ga0068856_10000003519 252
1193 3300009093 Ga0105240_10080994 Ga0105240_100809942 252
1194 3300013100 Ga0157373_10000343 Ga0157373_1000034338 252
1195 3300013102 Ga0157371_10000581 Ga0157371_1000058114 252
1196 3300013104 Ga0157370_10000231 Ga0157370_1000023114 252
1197 3300013105 Ga0157369_10003285 Ga0157369_1000328513 252
1198 3300013307 Ga0157372_10000786 Ga0157372_1000078617 252
1199 3300020077 Ga0206351_10768670 Ga0206351_107686704 252
1200 3300020610 Ga0154015_1087227 Ga0154015_108722712 252
1201 3300022467 Ga0224712_10088843 Ga0224712_100888432 252
1202 3300025224 Ga0209784_100003 Ga0209784_100003274 252
1203 3300025225 Ga0209566_100002 Ga0209566_1000021317 252
1204 3300025226 Ga0209674_100008 Ga0209674_100008872 252
1205 3300025226 Ga0209674_105494 Ga0209674_1054942 252
1206 3300025229 Ga0209147_100002 Ga0209147_1000021970 252
1207 3300025230 Ga0209563_100004 Ga0209563_100004730 252
1208 3300025230 Ga0209563_100026 Ga0209563_10002619 252
1209 3300025242 Ga0209258_100002 Ga0209258_1000021970 252
1210 3300025253 Ga0209677_100013 Ga0209677_100013353 252
1211 3300025254 Ga0209148_1006086 Ga0209148_10060862 252
1212 3300025256 Ga0209759_1006257 Ga0209759_10062573 252
1213 3300025256 Ga0209759_1017556 Ga0209759_10175562 252
1214 3300025272 Ga0209455_1000021 Ga0209455_1000021557 252
1215 3300025913 Ga0207695_10003684 Ga0207695_1000368416 252
1216 3300025920 Ga0207649_10000019 Ga0207649_10000019194 252
1217 3300025945 Ga0207679_10000001 Ga0207679_10000001563 252
1218 3300025981 Ga0207640_10000075 Ga0207640_1000007532 252
1219 3300026067 Ga0207678_10000004 Ga0207678_1000000438 252
1220 3300026078 Ga0207702_10000029 Ga0207702_1000002961 252
1221 3300026116 Ga0207674_10051345 Ga0207674_100513452 252
1222 3300059640 Ga0587067_004181 Ga0587067_004181_1045_1803 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

21

192

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.9766 62 167
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.9676 62 167
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.9512 59 168
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.9112 59 168
2rpb-assembly1.cif.gz_A the solution structure of membrane protein 0.8671 61 168
ID Description Score Start End Superfamily
af_Q8T4B6_101_212_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9976 61 167 3.30.479.30
af_Q9VGD7_116_226_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9968 59 167 3.30.479.30
af_F1R5A4_90_200_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9876 59 168 3.30.479.30
af_A0A1D8PTU3_111_221_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9833 59 168 3.30.479.30
af_Q8K4G9_162_272_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9822 61 167 3.30.479.30
ID Description Score Start End GO Terms
AF-A0A523WQZ2-F1-model_v4 Slipin family protein 0.9966 22 162 GO:0005886
AF-A0A381SQX3-F1-model_v4 Band 7 domain-containing protein 0.9929 12 166 GO:0005886
AF-A0A7C5Y882-F1-model_v4 Band 7 domain-containing protein 0.99 6 168 GO:0005886
AF-A0A6F9DU42-F1-model_v4 Stomatin-like protein 1 0.9875 20 166 GO:0005886
AF-A0A538TLL3-F1-model_v4 Slipin family protein 0.9853 3 163 GO:0005886

Feature Viewer

pLDDT pTM Quality
85.31 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map