F491876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1222 | 565 | 1150 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_0011700|Ga0501036_0011700_163_1041 |
| Length | 292 |
| Sequence | MFANLTALITILVIVLFTAFRILREYERGVVFTLGRFDKVKGPGLIIIIPGIQKMVRVDLRTVVMDVPSQDVISRDNVSVKVNAVVYFRVVDPQKSIIQVENFLSATSQFAQTTLRSVLGKHELDEMLAEREKLNLDIQKALDVQTDAWGIKVSNVEIKHVDIDESMIRAIARQAEAERERRAKVIHAEGELQASHKLMQAAQTLSRQNGAMQLRYLQTLTSIASDKSNTIIFPVSMDLMSTLTNVLKMQNRRGPDEAGSADEPGGPDATDETTLGSSRMEETATDQANSSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 3 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 4 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 5 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 6 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 7 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 8 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 9 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 10 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 11 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 12 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 13 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 14 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 15 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 16 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 17 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 18 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 19 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 20 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 21 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 22 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 23 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 24 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 25 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 26 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 27 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 28 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 29 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 30 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 31 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 32 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 33 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 34 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 35 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 36 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 37 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 38 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 39 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 40 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 41 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 42 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 43 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 44 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 45 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 46 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 47 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 48 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 49 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 50 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 51 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 52 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 53 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 54 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 55 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 56 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 57 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 58 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 59 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 60 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 61 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 62 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 63 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 64 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 65 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 66 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 67 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 68 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 69 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 70 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 71 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 72 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 82 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 85 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 86 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 87 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 89 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 93 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 96 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 119 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 127 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 135 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 136 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 137 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 139 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 140 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 141 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 142 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 143 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 144 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 145 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 146 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 147 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 148 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 150 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 151 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 152 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 154 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 155 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 157 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 158 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 159 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 160 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 161 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 162 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 163 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 164 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 165 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 166 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 168 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 169 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 196 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 199 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 200 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 201 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 203 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 205 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 206 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 216 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 217 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 220 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 222 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 226 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 289 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 298 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 299 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 300 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 301 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 302 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 303 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 304 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 305 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 306 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 307 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 308 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 309 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 310 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 311 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 312 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 313 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 314 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 315 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 316 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 317 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 318 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 319 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 320 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 321 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 322 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 323 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 324 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 325 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 326 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 327 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 328 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 329 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 330 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 332 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 337 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 338 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 339 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 340 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 341 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 342 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 343 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 344 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 345 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 347 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 348 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 349 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 350 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 351 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 352 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 353 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 354 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 355 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 356 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 357 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 358 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 359 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 360 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 361 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 362 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 363 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 364 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 365 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 366 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 367 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 368 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 369 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 370 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 371 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 372 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 373 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 374 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 375 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 376 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 377 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 378 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 379 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 380 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 381 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 382 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 383 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 384 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 385 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 386 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 387 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 388 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 389 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 390 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 391 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 392 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 393 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 485 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 486 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 487 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 488 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 489 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 490 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 491 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 492 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 493 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 494 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 495 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 496 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 497 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 498 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 499 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 500 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 501 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 502 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 503 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 516 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 526 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 533 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 534 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 535 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 544 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 546 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 547 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 548 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 552 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 553 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 554 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 555 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 556 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 557 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 558 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 559 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 560 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 561 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 562 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 563 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 564 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 565 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.04 |
| Metatranscriptomes | 1.06 |
| Isolates | 5.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.82 |
| Nodule | 1.8 |
| Rhizoplane | 2.13 |
| Rhizosphere | 79.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001446 | 3300001915 | Bacteria | 6801 |
| 2 | JGI24740J21852_10000162 | 3300001979 | Bacteria | 26509 |
| 3 | JGI24740J21852_10001865 | 3300001979 | Bacteria | 9647 |
| 4 | JGI24740J21852_10003113 | 3300001979 | Bacteria | 7318 |
| 5 | JGI24739J22299_10001944 | 3300001989 | Bacteria | 7904 |
| 6 | JGI24739J22299_10009203 | 3300001989 | Bacteria | 3686 |
| 7 | JGI24735J21928_10002340 | 3300002067 | Bacteria | 6607 |
| 8 | JGI24735J21928_10051138 | 3300002067 | Bacteria | 1193 |
| 9 | JGI25156J39149_1000123 | 3300002705 | Bacteria | 56592 |
| 10 | JGI25156J39149_1000132 | 3300002705 | Bacteria | 54288 |
| 11 | JGI25156J39149_1001682 | 3300002705 | Bacteria | 8913 |
| 12 | JGI25156J39149_1009142 | 3300002705 | Bacteria | 2433 |
| 13 | JGI25156J39149_1011294 | 3300002705 | Bacteria | 2028 |
| 14 | JGI25156J39149_1011629 | 3300002705 | Bacteria | 1979 |
| 15 | JGI25156J39149_1013888 | 3300002705 | Bacteria | 1688 |
| 16 | JGI25162J39368_1001279 | 3300002737 | Bacteria | 14280 |
| 17 | JGI25154J39366_1002536 | 3300002738 | Bacteria | 4633 |
| 18 | JGI25154J39366_1003951 | 3300002738 | Bacteria | 2848 |
| 19 | JGI25157J39369_1000157 | 3300002741 | Bacteria | 56576 |
| 20 | JGI25157J39369_1001321 | 3300002741 | Bacteria | 9862 |
| 21 | JGI25164J39214_1000716 | 3300002772 | Bacteria | 12630 |
| 22 | JGI25151J46595_10003421 | 3300003187 | Bacteria | 8779 |
| 23 | JGI25151J46595_10009112 | 3300003187 | Bacteria | 4727 |
| 24 | JGI25151J46595_10010145 | 3300003187 | Bacteria | 4399 |
| 25 | JGI25165J46597_1000335 | 3300003214 | Bacteria | 55465 |
| 26 | JGI25165J46597_1001596 | 3300003214 | Bacteria | 10971 |
| 27 | JGI25160J50197_1001515 | 3300003354 | Bacteria | 11522 |
| 28 | Ga0055539_1000038 | 3300003752 | Bacteria | 205053 |
| 29 | Ga0055539_1000409 | 3300003752 | Bacteria | 16463 |
| 30 | Ga0055539_1002822 | 3300003752 | Bacteria | 2540 |
| 31 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 32 | Ga0055533_1000232 | 3300003756 | Bacteria | 36511 |
| 33 | Ga0055533_1004567 | 3300003756 | Bacteria | 2450 |
| 34 | Ga0055533_1007945 | 3300003756 | Bacteria | 1391 |
| 35 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 36 | Ga0055532_1000011 | 3300003758 | Bacteria | 385294 |
| 37 | Ga0055525_1000324 | 3300003759 | Bacteria | 37106 |
| 38 | Ga0055525_1002837 | 3300003759 | Bacteria | 1645 |
| 39 | Ga0055527_1000009 | 3300003760 | Bacteria | 385294 |
| 40 | Ga0055535_1000008 | 3300003761 | Bacteria | 385294 |
| 41 | Ga0055542_1000014 | 3300003762 | Bacteria | 385294 |
| 42 | Ga0055542_1001112 | 3300003762 | Bacteria | 16082 |
| 43 | Ga0055529_1000010 | 3300003763 | Bacteria | 385294 |
| 44 | Ga0055529_1000113 | 3300003763 | Bacteria | 118574 |
| 45 | Ga0055526_1003201 | 3300003771 | Bacteria | 10586 |
| 46 | Ga0055526_1003737 | 3300003771 | Bacteria | 9503 |
| 47 | Ga0055526_1007580 | 3300003771 | Bacteria | 5604 |
| 48 | Ga0055526_1019863 | 3300003771 | Bacteria | 2425 |
| 49 | Ga0055526_1038702 | 3300003771 | Bacteria | 1225 |
| 50 | Ga0055537_1008344 | 3300003773 | Bacteria | 2399 |
| 51 | Ga0055524_1000290 | 3300003775 | Bacteria | 48740 |
| 52 | Ga0055524_1001717 | 3300003775 | Bacteria | 12165 |
| 53 | Ga0055536_1000074 | 3300003781 | Bacteria | 84660 |
| 54 | Ga0055534_1000761 | 3300003784 | Bacteria | 15311 |
| 55 | Ga0055534_1003807 | 3300003784 | Bacteria | 4623 |
| 56 | Ga0055541_1000608 | 3300003841 | Bacteria | 9546 |
| 57 | Ga0065165_1003184 | 3300005262 | Bacteria | 12011 |
| 58 | Ga0065704_10082103 | 3300005289 | Bacteria | 3653 |
| 59 | Ga0065707_10091191 | 3300005295 | Bacteria | 3989 |
| 60 | Ga0070676_10005402 | 3300005328 | Bacteria | 6807 |
| 61 | Ga0070676_10170965 | 3300005328 | Bacteria | 1406 |
| 62 | Ga0070683_100006705 | 3300005329 | Bacteria | 9670 |
| 63 | Ga0070683_100010268 | 3300005329 | Bacteria | 8048 |
| 64 | Ga0070683_100269010 | 3300005329 | Bacteria | 1621 |
| 65 | Ga0070683_100324701 | 3300005329 | Bacteria | 1465 |
| 66 | Ga0070690_100081864 | 3300005330 | Bacteria | 2113 |
| 67 | Ga0070690_100129343 | 3300005330 | Bacteria | 1704 |
| 68 | Ga0068869_100091614 | 3300005334 | Bacteria | 2287 |
| 69 | Ga0068869_100165480 | 3300005334 | Bacteria | 1724 |
| 70 | Ga0070666_10157751 | 3300005335 | Bacteria | 1585 |
| 71 | Ga0070682_100037222 | 3300005337 | Bacteria | 2977 |
| 72 | Ga0068868_100009165 | 3300005338 | Bacteria | 7107 |
| 73 | Ga0070660_100004427 | 3300005339 | Bacteria | 9703 |
| 74 | Ga0070661_100000321 | 3300005344 | Bacteria | 38500 |
| 75 | Ga0070661_100001057 | 3300005344 | Bacteria | 19514 |
| 76 | Ga0070661_100033808 | 3300005344 | Bacteria | 3706 |
| 77 | Ga0070692_10017162 | 3300005345 | Bacteria | 3457 |
| 78 | Ga0070692_10028839 | 3300005345 | Bacteria | 2762 |
| 79 | Ga0070668_100042413 | 3300005347 | Bacteria | 3488 |
| 80 | Ga0070668_100096777 | 3300005347 | Bacteria | 2333 |
| 81 | Ga0070669_100072454 | 3300005353 | Bacteria | 2551 |
| 82 | Ga0070669_100396902 | 3300005353 | Bacteria | 1128 |
| 83 | Ga0070675_100015743 | 3300005354 | Bacteria | 5985 |
| 84 | Ga0070671_100022023 | 3300005355 | Bacteria | 5206 |
| 85 | Ga0070671_100034291 | 3300005355 | Bacteria | 4202 |
| 86 | Ga0070671_100104434 | 3300005355 | Bacteria | 2378 |
| 87 | Ga0070688_100201785 | 3300005365 | Bacteria | 1392 |
| 88 | Ga0070659_100000764 | 3300005366 | Bacteria | 23367 |
| 89 | Ga0070659_100005447 | 3300005366 | Bacteria | 9142 |
| 90 | Ga0070659_100005466 | 3300005366 | Bacteria | 9129 |
| 91 | Ga0070659_100006279 | 3300005366 | Bacteria | 8589 |
| 92 | Ga0070659_100022346 | 3300005366 | Bacteria | 4828 |
| 93 | Ga0070659_100182602 | 3300005366 | Bacteria | 1722 |
| 94 | Ga0070659_100254299 | 3300005366 | Bacteria | 1456 |
| 95 | Ga0070667_100070375 | 3300005367 | Bacteria | 2978 |
| 96 | Ga0070667_100106175 | 3300005367 | Bacteria | 2431 |
| 97 | Ga0070709_10023561 | 3300005434 | Bacteria | 3617 |
| 98 | Ga0070714_100002126 | 3300005435 | Bacteria | 14555 |
| 99 | Ga0070714_100002778 | 3300005435 | Bacteria | 12903 |
| 100 | Ga0070714_100003909 | 3300005435 | Bacteria | 11196 |
| 101 | Ga0070713_100009976 | 3300005436 | Bacteria | 6841 |
| 102 | Ga0070701_10008863 | 3300005438 | Bacteria | 4376 |
| 103 | Ga0070711_100265857 | 3300005439 | Bacteria | 1352 |
| 104 | Ga0070705_100042616 | 3300005440 | Bacteria | 2596 |
| 105 | Ga0070700_100012720 | 3300005441 | Bacteria | 4708 |
| 106 | Ga0070700_100117399 | 3300005441 | Bacteria | 1778 |
| 107 | Ga0070708_100062109 | 3300005445 | Bacteria | 3340 |
| 108 | Ga0070708_100112961 | 3300005445 | Bacteria | 2498 |
| 109 | Ga0070663_100000046 | 3300005455 | Bacteria | 55505 |
| 110 | Ga0070663_100212152 | 3300005455 | Bacteria | 1516 |
| 111 | Ga0070678_100043287 | 3300005456 | Bacteria | 3206 |
| 112 | Ga0070678_100078851 | 3300005456 | Bacteria | 2489 |
| 113 | Ga0070678_100307853 | 3300005456 | Bacteria | 1348 |
| 114 | Ga0070662_100369930 | 3300005457 | Bacteria | 1178 |
| 115 | Ga0070681_10016085 | 3300005458 | Bacteria | 7456 |
| 116 | Ga0070681_10026657 | 3300005458 | Bacteria | 5809 |
| 117 | Ga0070681_10104560 | 3300005458 | Bacteria | 2774 |
| 118 | Ga0068867_100000291 | 3300005459 | Bacteria | 32948 |
| 119 | Ga0068867_100006929 | 3300005459 | Bacteria | 8022 |
| 120 | Ga0068867_100010772 | 3300005459 | Bacteria | 6449 |
| 121 | Ga0068867_100286504 | 3300005459 | Bacteria | 1353 |
| 122 | Ga0070706_100002204 | 3300005467 | Bacteria | 19824 |
| 123 | Ga0070706_100015220 | 3300005467 | Bacteria | 7101 |
| 124 | Ga0070707_100047358 | 3300005468 | Bacteria | 4116 |
| 125 | Ga0070707_100150960 | 3300005468 | Bacteria | 2262 |
| 126 | Ga0070698_100013449 | 3300005471 | Bacteria | 8662 |
| 127 | Ga0070698_100225729 | 3300005471 | Bacteria | 1806 |
| 128 | Ga0070698_100253725 | 3300005471 | Bacteria | 1691 |
| 129 | Ga0070699_100054408 | 3300005518 | Bacteria | 3464 |
| 130 | Ga0070699_100074489 | 3300005518 | Bacteria | 2954 |
| 131 | Ga0070699_100082153 | 3300005518 | Bacteria | 2808 |
| 132 | Ga0070679_100180715 | 3300005530 | Bacteria | 2082 |
| 133 | Ga0070679_100203186 | 3300005530 | Bacteria | 1946 |
| 134 | Ga0070684_100440532 | 3300005535 | Bacteria | 1203 |
| 135 | Ga0070697_100006211 | 3300005536 | Bacteria | 9246 |
| 136 | Ga0070697_100012186 | 3300005536 | Bacteria | 6735 |
| 137 | Ga0070697_100034838 | 3300005536 | Bacteria | 4060 |
| 138 | Ga0068853_100021180 | 3300005539 | Bacteria | 5415 |
| 139 | Ga0068853_100471377 | 3300005539 | Bacteria | 1183 |
| 140 | Ga0068853_100496768 | 3300005539 | Bacteria | 1151 |
| 141 | Ga0070672_100183856 | 3300005543 | Bacteria | 1743 |
| 142 | Ga0070672_100189519 | 3300005543 | Bacteria | 1716 |
| 143 | Ga0070686_100099974 | 3300005544 | Bacteria | 1957 |
| 144 | Ga0070696_100043412 | 3300005546 | Bacteria | 3110 |
| 145 | Ga0070696_100230408 | 3300005546 | Bacteria | 1393 |
| 146 | Ga0070665_100054489 | 3300005548 | Bacteria | 4011 |
| 147 | Ga0070704_100003831 | 3300005549 | Bacteria | 8657 |
| 148 | Ga0070704_100005075 | 3300005549 | Bacteria | 7657 |
| 149 | Ga0070704_100334656 | 3300005549 | Bacteria | 1273 |
| 150 | Ga0068855_100008331 | 3300005563 | Bacteria | 12532 |
| 151 | Ga0068855_100016866 | 3300005563 | Bacteria | 8783 |
| 152 | Ga0068855_100120552 | 3300005563 | Bacteria | 3002 |
| 153 | Ga0068855_100185221 | 3300005563 | Bacteria | 2352 |
| 154 | Ga0068855_100587132 | 3300005563 | Bacteria | 1203 |
| 155 | Ga0070664_100000002 | 3300005564 | Bacteria | 458815 |
| 156 | Ga0070664_100016169 | 3300005564 | Bacteria | 6115 |
| 157 | Ga0070664_100194403 | 3300005564 | Bacteria | 1808 |
| 158 | Ga0068857_100001821 | 3300005577 | Bacteria | 17131 |
| 159 | Ga0068857_100003368 | 3300005577 | Bacteria | 13304 |
| 160 | Ga0068857_100114120 | 3300005577 | Bacteria | 2429 |
| 161 | Ga0068857_100177000 | 3300005577 | Bacteria | 1941 |
| 162 | Ga0068857_100193952 | 3300005577 | Bacteria | 1850 |
| 163 | Ga0068857_100337506 | 3300005577 | Bacteria | 1394 |
| 164 | Ga0068854_100000004 | 3300005578 | Bacteria | 216381 |
| 165 | Ga0068854_100006533 | 3300005578 | Bacteria | 7421 |
| 166 | Ga0068854_100023192 | 3300005578 | Bacteria | 4237 |
| 167 | Ga0068854_100035415 | 3300005578 | Bacteria | 3493 |
| 168 | Ga0068854_100188374 | 3300005578 | Bacteria | 1615 |
| 169 | Ga0068856_100000035 | 3300005614 | Bacteria | 124192 |
| 170 | Ga0068856_100000168 | 3300005614 | Bacteria | 67710 |
| 171 | Ga0068856_100002803 | 3300005614 | Bacteria | 17848 |
| 172 | Ga0070702_100044723 | 3300005615 | Bacteria | 2501 |
| 173 | Ga0070702_100098930 | 3300005615 | Bacteria | 1785 |
| 174 | Ga0068852_100006363 | 3300005616 | Bacteria | 8529 |
| 175 | Ga0068852_100032440 | 3300005616 | Bacteria | 4325 |
| 176 | Ga0068852_100163555 | 3300005616 | Bacteria | 2080 |
| 177 | Ga0068852_100368546 | 3300005616 | Bacteria | 1406 |
| 178 | Ga0068852_100555327 | 3300005616 | Bacteria | 1149 |
| 179 | Ga0068859_100008147 | 3300005617 | Bacteria | 10627 |
| 180 | Ga0068859_100145483 | 3300005617 | Bacteria | 2445 |
| 181 | Ga0068859_100191621 | 3300005617 | Bacteria | 2129 |
| 182 | Ga0068859_100434549 | 3300005617 | Bacteria | 1409 |
| 183 | Ga0068859_100749607 | 3300005617 | Bacteria | 1065 |
| 184 | Ga0068864_100039632 | 3300005618 | Bacteria | 4026 |
| 185 | Ga0068864_100487944 | 3300005618 | Bacteria | 1183 |
| 186 | Ga0068866_10010197 | 3300005718 | Bacteria | 4020 |
| 187 | Ga0068861_100000224 | 3300005719 | Bacteria | 30748 |
| 188 | Ga0068861_100000917 | 3300005719 | Bacteria | 17885 |
| 189 | Ga0068861_100004912 | 3300005719 | Bacteria | 9003 |
| 190 | Ga0068861_100128260 | 3300005719 | Bacteria | 2055 |
| 191 | Ga0068870_10012608 | 3300005840 | Bacteria | 3954 |
| 192 | Ga0068863_100017730 | 3300005841 | Bacteria | 6815 |
| 193 | Ga0068863_100111484 | 3300005841 | Bacteria | 2606 |
| 194 | Ga0068863_100173214 | 3300005841 | Bacteria | 2070 |
| 195 | Ga0068858_100210712 | 3300005842 | Bacteria | 1839 |
| 196 | Ga0068860_100001311 | 3300005843 | Bacteria | 27032 |
| 197 | Ga0068860_100044758 | 3300005843 | Bacteria | 4218 |
| 198 | Ga0068862_100017386 | 3300005844 | Bacteria | 5989 |
| 199 | Ga0068862_100094296 | 3300005844 | Bacteria | 2611 |
| 200 | Ga0070717_10458914 | 3300006028 | Bacteria | 1149 |
| 201 | Ga0075365_10156982 | 3300006038 | Bacteria | 1584 |
| 202 | Ga0075368_10071645 | 3300006042 | Bacteria | 1400 |
| 203 | Ga0075363_100026916 | 3300006048 | Bacteria | 2945 |
| 204 | Ga0075363_100087501 | 3300006048 | Bacteria | 1711 |
| 205 | Ga0070712_100017367 | 3300006175 | Bacteria | 4658 |
| 206 | Ga0075367_10076049 | 3300006178 | Bacteria | 2025 |
| 207 | Ga0075367_10269397 | 3300006178 | Bacteria | 1070 |
| 208 | Ga0075366_10001785 | 3300006195 | Bacteria | 10865 |
| 209 | Ga0075366_10169780 | 3300006195 | Bacteria | 1323 |
| 210 | Ga0075366_10232807 | 3300006195 | Bacteria | 1122 |
| 211 | Ga0097621_100572535 | 3300006237 | Bacteria | 1030 |
| 212 | Ga0075370_10003699 | 3300006353 | Bacteria | 7326 |
| 213 | Ga0075370_10097382 | 3300006353 | Bacteria | 1701 |
| 214 | Ga0075370_10137923 | 3300006353 | Bacteria | 1425 |
| 215 | Ga0068871_100161649 | 3300006358 | Bacteria | 1916 |
| 216 | Ga0068871_100460791 | 3300006358 | Bacteria | 1141 |
| 217 | Ga0075428_100004649 | 3300006844 | Bacteria | 15195 |
| 218 | Ga0075430_100040344 | 3300006846 | Bacteria | 3952 |
| 219 | Ga0075431_100009945 | 3300006847 | Bacteria | 9554 |
| 220 | Ga0075433_10010730 | 3300006852 | Bacteria | 7369 |
| 221 | Ga0075433_10245977 | 3300006852 | Bacteria | 1587 |
| 222 | Ga0075433_10522911 | 3300006852 | Bacteria | 1044 |
| 223 | Ga0075434_100000017 | 3300006871 | Bacteria | 74154 |
| 224 | Ga0075429_100001537 | 3300006880 | Bacteria | 18914 |
| 225 | Ga0068865_100001581 | 3300006881 | Bacteria | 13309 |
| 226 | Ga0068865_100003985 | 3300006881 | Bacteria | 8858 |
| 227 | Ga0075436_100002716 | 3300006914 | Bacteria | 12165 |
| 228 | Ga0075436_100048271 | 3300006914 | Bacteria | 2937 |
| 229 | Ga0075436_100071738 | 3300006914 | Bacteria | 2395 |
| 230 | Ga0097620_100008146 | 3300006931 | Bacteria | 10627 |
| 231 | Ga0097620_100145492 | 3300006931 | Bacteria | 2445 |
| 232 | Ga0097620_100191627 | 3300006931 | Bacteria | 2129 |
| 233 | Ga0097620_100434516 | 3300006931 | Bacteria | 1409 |
| 234 | Ga0097620_100749613 | 3300006931 | Bacteria | 1065 |
| 235 | Ga0099823_1009149 | 3300006944 | Bacteria | 10057 |
| 236 | Ga0099823_1054043 | 3300006944 | Bacteria | 2331 |
| 237 | Ga0075435_100005231 | 3300007076 | Bacteria | 9030 |
| 238 | Ga0075435_100007948 | 3300007076 | Bacteria | 7591 |
| 239 | Ga0075435_100173911 | 3300007076 | Bacteria | 1817 |
| 240 | Ga0075435_100206953 | 3300007076 | Bacteria | 1663 |
| 241 | Ga0075435_100364013 | 3300007076 | Bacteria | 1241 |
| 242 | Ga0105251_10000310 | 3300009011 | Bacteria | 48788 |
| 243 | Ga0105251_10000535 | 3300009011 | Bacteria | 35838 |
| 244 | Ga0105251_10073933 | 3300009011 | Bacteria | 1583 |
| 245 | Ga0105244_10002031 | 3300009036 | Bacteria | 15588 |
| 246 | Ga0105244_10019804 | 3300009036 | Bacteria | 3747 |
| 247 | Ga0105250_10010698 | 3300009092 | Bacteria | 3820 |
| 248 | Ga0105240_10003948 | 3300009093 | Bacteria | 22904 |
| 249 | Ga0105240_10058761 | 3300009093 | Bacteria | 4800 |
| 250 | Ga0105240_10080994 | 3300009093 | Bacteria | 3991 |
| 251 | Ga0105240_10130020 | 3300009093 | Bacteria | 3021 |
| 252 | Ga0105240_10144619 | 3300009093 | Bacteria | 2838 |
| 253 | Ga0105240_10932282 | 3300009093 | Bacteria | 932 |
| 254 | Ga0111539_10506858 | 3300009094 | Bacteria | 1406 |
| 255 | Ga0105245_10004840 | 3300009098 | Bacteria | 11863 |
| 256 | Ga0105245_10027174 | 3300009098 | Bacteria | 5041 |
| 257 | Ga0105245_10254667 | 3300009098 | Bacteria | 1707 |
| 258 | Ga0105245_10455132 | 3300009098 | Bacteria | 1289 |
| 259 | Ga0105247_10343731 | 3300009101 | Bacteria | 1047 |
| 260 | Ga0114129_10021382 | 3300009147 | Bacteria | 9183 |
| 261 | Ga0114129_11225673 | 3300009147 | Bacteria | 933 |
| 262 | Ga0105243_10130720 | 3300009148 | Bacteria | 2129 |
| 263 | Ga0105243_10344451 | 3300009148 | Bacteria | 1366 |
| 264 | Ga0105241_10099145 | 3300009174 | Bacteria | 2313 |
| 265 | Ga0105241_10184882 | 3300009174 | Bacteria | 1731 |
| 266 | Ga0105241_10357678 | 3300009174 | Bacteria | 1270 |
| 267 | Ga0105242_10396610 | 3300009176 | Bacteria | 1286 |
| 268 | Ga0105248_10010268 | 3300009177 | Bacteria | 10307 |
| 269 | Ga0105248_10281918 | 3300009177 | Bacteria | 1871 |
| 270 | Ga0105248_10378403 | 3300009177 | Bacteria | 1594 |
| 271 | Ga0105248_10398929 | 3300009177 | Bacteria | 1549 |
| 272 | Ga0105237_10004557 | 3300009545 | Bacteria | 16011 |
| 273 | Ga0105237_10161966 | 3300009545 | Bacteria | 2236 |
| 274 | Ga0105238_10003338 | 3300009551 | Bacteria | 16016 |
| 275 | Ga0105238_10045962 | 3300009551 | Bacteria | 4409 |
| 276 | Ga0105238_10053683 | 3300009551 | Bacteria | 4049 |
| 277 | Ga0105238_10140446 | 3300009551 | Bacteria | 2392 |
| 278 | Ga0105238_10247396 | 3300009551 | Bacteria | 1761 |
| 279 | Ga0105238_10432097 | 3300009551 | Bacteria | 1312 |
| 280 | Ga0105239_10009841 | 3300010375 | Bacteria | 10740 |
| 281 | Ga0105239_10101564 | 3300010375 | Bacteria | 3182 |
| 282 | Ga0105246_10101503 | 3300011119 | Bacteria | 2096 |
| 283 | Ga0157373_10000343 | 3300013100 | Bacteria | 37673 |
| 284 | Ga0157373_10001190 | 3300013100 | Bacteria | 19903 |
| 285 | Ga0157373_10071969 | 3300013100 | Bacteria | 2441 |
| 286 | Ga0157371_10000581 | 3300013102 | Bacteria | 43290 |
| 287 | Ga0157371_10007374 | 3300013102 | Bacteria | 8910 |
| 288 | Ga0157371_10070486 | 3300013102 | Bacteria | 2475 |
| 289 | Ga0157371_10080221 | 3300013102 | Bacteria | 2311 |
| 290 | Ga0157370_10000231 | 3300013104 | Bacteria | 71321 |
| 291 | Ga0157370_10000793 | 3300013104 | Bacteria | 39742 |
| 292 | Ga0157370_10001148 | 3300013104 | Bacteria | 33003 |
| 293 | Ga0157370_10001426 | 3300013104 | Bacteria | 29655 |
| 294 | Ga0157370_10005802 | 3300013104 | Bacteria | 13800 |
| 295 | Ga0157370_10113103 | 3300013104 | Bacteria | 2537 |
| 296 | Ga0157369_10003285 | 3300013105 | Bacteria | 19261 |
| 297 | Ga0157369_10010253 | 3300013105 | Bacteria | 10693 |
| 298 | Ga0157369_10021806 | 3300013105 | Bacteria | 7163 |
| 299 | Ga0157369_10134559 | 3300013105 | Bacteria | 2617 |
| 300 | Ga0157374_10117758 | 3300013296 | Bacteria | 2561 |
| 301 | Ga0157378_10027353 | 3300013297 | Bacteria | 5033 |
| 302 | Ga0163162_10018531 | 3300013306 | Bacteria | 6821 |
| 303 | Ga0163162_10039730 | 3300013306 | Bacteria | 4703 |
| 304 | Ga0157372_10000786 | 3300013307 | Bacteria | 34433 |
| 305 | Ga0157372_10003322 | 3300013307 | Bacteria | 17379 |
| 306 | Ga0157372_10017103 | 3300013307 | Bacteria | 7784 |
| 307 | Ga0157372_10019438 | 3300013307 | Bacteria | 7322 |
| 308 | Ga0157375_10004064 | 3300013308 | Bacteria | 12688 |
| 309 | Ga0157375_10167475 | 3300013308 | Bacteria | 2343 |
| 310 | Ga0163163_10186771 | 3300014325 | Bacteria | 2120 |
| 311 | Ga0182008_10021992 | 3300014497 | Bacteria | 3269 |
| 312 | Ga0157377_10259661 | 3300014745 | Bacteria | 1130 |
| 313 | Ga0157376_10000749 | 3300014969 | Bacteria | 21105 |
| 314 | Ga0182006_1034035 | 3300015261 | Bacteria | 2040 |
| 315 | Ga0182006_1045425 | 3300015261 | Bacteria | 1709 |
| 316 | Ga0182007_10004662 | 3300015262 | Bacteria | 6184 |
| 317 | Ga0182007_10004882 | 3300015262 | Bacteria | 5989 |
| 318 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 319 | Ga0163161_10027704 | 3300017792 | Bacteria | 4020 |
| 320 | Ga0163161_10120022 | 3300017792 | Bacteria | 1975 |
| 321 | Ga0163161_10514128 | 3300017792 | Bacteria | 977 |
| 322 | Ga0206351_10768670 | 3300020077 | Bacteria | 4241 |
| 323 | Ga0154015_1087227 | 3300020610 | Bacteria | 10496 |
| 324 | Ga0213872_10036729 | 3300021361 | Bacteria | 2238 |
| 325 | Ga0224712_10088843 | 3300022467 | Bacteria | 1291 |
| 326 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 327 | Ga0209784_100778 | 3300025224 | Bacteria | 7729 |
| 328 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 329 | Ga0209566_100519 | 3300025225 | Bacteria | 26446 |
| 330 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 331 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 332 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 333 | Ga0209674_100093 | 3300025226 | Bacteria | 170423 |
| 334 | Ga0209674_100384 | 3300025226 | Bacteria | 23329 |
| 335 | Ga0209674_105494 | 3300025226 | Bacteria | 1862 |
| 336 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 337 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 338 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 339 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 340 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 341 | Ga0209563_100026 | 3300025230 | Bacteria | 559453 |
| 342 | Ga0209563_101409 | 3300025230 | Bacteria | 6421 |
| 343 | Ga0209563_116549 | 3300025230 | Bacteria | 904 |
| 344 | Ga0207427_100178 | 3300025231 | Bacteria | 67956 |
| 345 | Ga0207427_102330 | 3300025231 | Bacteria | 5233 |
| 346 | Ga0209437_100304 | 3300025233 | Bacteria | 67955 |
| 347 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 348 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 349 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 350 | Ga0209646_1000053 | 3300025246 | Bacteria | 284737 |
| 351 | Ga0209026_1000020 | 3300025250 | Bacteria | 376211 |
| 352 | Ga0209026_1002986 | 3300025250 | Bacteria | 5852 |
| 353 | Ga0209677_100013 | 3300025253 | Bacteria | 548200 |
| 354 | Ga0209677_100068 | 3300025253 | Bacteria | 146135 |
| 355 | Ga0209677_100182 | 3300025253 | Bacteria | 52054 |
| 356 | Ga0209677_102011 | 3300025253 | Bacteria | 8080 |
| 357 | Ga0209677_113567 | 3300025253 | Bacteria | 1153 |
| 358 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 359 | Ga0209148_1000158 | 3300025254 | Bacteria | 140830 |
| 360 | Ga0209148_1006086 | 3300025254 | Bacteria | 2658 |
| 361 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 362 | Ga0209759_1000006 | 3300025256 | Bacteria | 492407 |
| 363 | Ga0209759_1000017 | 3300025256 | Bacteria | 376232 |
| 364 | Ga0209759_1000039 | 3300025256 | Bacteria | 256444 |
| 365 | Ga0209759_1005927 | 3300025256 | Bacteria | 4178 |
| 366 | Ga0209759_1006257 | 3300025256 | Bacteria | 4030 |
| 367 | Ga0209759_1014699 | 3300025256 | Bacteria | 2056 |
| 368 | Ga0209759_1017556 | 3300025256 | Bacteria | 1760 |
| 369 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 370 | Ga0209233_1000287 | 3300025261 | Bacteria | 67956 |
| 371 | Ga0209565_1000329 | 3300025263 | Bacteria | 42233 |
| 372 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 373 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 374 | Ga0209673_1037191 | 3300025273 | Bacteria | 1434 |
| 375 | Ga0209130_1006725 | 3300025284 | Bacteria | 3681 |
| 376 | Ga0209675_1000070 | 3300025291 | Bacteria | 169161 |
| 377 | Ga0209675_1000432 | 3300025291 | Bacteria | 33519 |
| 378 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 379 | Ga0209676_1000510 | 3300025292 | Bacteria | 61272 |
| 380 | Ga0209025_1000497 | 3300025294 | Bacteria | 75587 |
| 381 | Ga0209025_1000523 | 3300025294 | Bacteria | 73071 |
| 382 | Ga0209025_1001621 | 3300025294 | Bacteria | 28120 |
| 383 | Ga0209025_1006383 | 3300025294 | Bacteria | 9177 |
| 384 | Ga0209025_1038722 | 3300025294 | Bacteria | 2091 |
| 385 | Ga0209564_1000359 | 3300025295 | Bacteria | 84631 |
| 386 | Ga0209564_1003269 | 3300025295 | Bacteria | 11306 |
| 387 | Ga0209564_1003406 | 3300025295 | Bacteria | 10930 |
| 388 | Ga0209564_1006995 | 3300025295 | Bacteria | 5916 |
| 389 | Ga0209758_1085559 | 3300025297 | Bacteria | 939 |
| 390 | Ga0209256_1000059 | 3300025299 | Bacteria | 272170 |
| 391 | Ga0207426_1000014 | 3300025302 | Bacteria | 649413 |
| 392 | Ga0207696_1004029 | 3300025711 | Bacteria | 6447 |
| 393 | Ga0207655_1000929 | 3300025728 | Bacteria | 30419 |
| 394 | Ga0207713_1000645 | 3300025735 | Bacteria | 33444 |
| 395 | Ga0207713_1000683 | 3300025735 | Bacteria | 31813 |
| 396 | Ga0207713_1005141 | 3300025735 | Bacteria | 8279 |
| 397 | Ga0207692_10066922 | 3300025898 | Bacteria | 1879 |
| 398 | Ga0207642_10009346 | 3300025899 | Bacteria | 3407 |
| 399 | Ga0207642_10032057 | 3300025899 | Bacteria | 2208 |
| 400 | Ga0207642_10102127 | 3300025899 | Bacteria | 1442 |
| 401 | Ga0207647_10068057 | 3300025904 | Bacteria | 2156 |
| 402 | Ga0207647_10071271 | 3300025904 | Bacteria | 2097 |
| 403 | Ga0207647_10158916 | 3300025904 | Bacteria | 1319 |
| 404 | Ga0207647_10271800 | 3300025904 | Bacteria | 969 |
| 405 | Ga0207699_10040819 | 3300025906 | Bacteria | 2676 |
| 406 | Ga0207645_10008797 | 3300025907 | Bacteria | 7020 |
| 407 | Ga0207645_10052005 | 3300025907 | Bacteria | 2617 |
| 408 | Ga0207643_10008707 | 3300025908 | Bacteria | 5443 |
| 409 | Ga0207705_10238247 | 3300025909 | Bacteria | 1385 |
| 410 | Ga0207705_10293620 | 3300025909 | Bacteria | 1246 |
| 411 | Ga0207684_10004348 | 3300025910 | Bacteria | 13380 |
| 412 | Ga0207684_10045442 | 3300025910 | Bacteria | 3725 |
| 413 | Ga0207684_10190386 | 3300025910 | Bacteria | 1769 |
| 414 | Ga0207654_10028858 | 3300025911 | Bacteria | 3029 |
| 415 | Ga0207707_10003189 | 3300025912 | Bacteria | 14562 |
| 416 | Ga0207707_10013605 | 3300025912 | Bacteria | 7095 |
| 417 | Ga0207695_10003684 | 3300025913 | Bacteria | 21345 |
| 418 | Ga0207695_10003938 | 3300025913 | Bacteria | 20542 |
| 419 | Ga0207695_10021676 | 3300025913 | Bacteria | 7324 |
| 420 | Ga0207671_10009421 | 3300025914 | Bacteria | 8166 |
| 421 | Ga0207671_10072048 | 3300025914 | Bacteria | 2578 |
| 422 | Ga0207671_10104147 | 3300025914 | Bacteria | 2152 |
| 423 | Ga0207671_10481882 | 3300025914 | Bacteria | 989 |
| 424 | Ga0207693_10027941 | 3300025915 | Bacteria | 4459 |
| 425 | Ga0207660_10066257 | 3300025917 | Bacteria | 2612 |
| 426 | Ga0207660_10652275 | 3300025917 | Bacteria | 858 |
| 427 | Ga0207657_10005082 | 3300025919 | Bacteria | 13794 |
| 428 | Ga0207657_10017667 | 3300025919 | Bacteria | 6835 |
| 429 | Ga0207657_10055701 | 3300025919 | Bacteria | 3414 |
| 430 | Ga0207657_10111763 | 3300025919 | Bacteria | 2255 |
| 431 | Ga0207657_10247656 | 3300025919 | Bacteria | 1421 |
| 432 | Ga0207649_10000019 | 3300025920 | Bacteria | 212682 |
| 433 | Ga0207649_10050514 | 3300025920 | Bacteria | 2572 |
| 434 | Ga0207652_10122396 | 3300025921 | Bacteria | 2315 |
| 435 | Ga0207652_10366994 | 3300025921 | Bacteria | 1299 |
| 436 | Ga0207646_10037315 | 3300025922 | Bacteria | 4382 |
| 437 | Ga0207681_10040191 | 3300025923 | Bacteria | 3111 |
| 438 | Ga0207681_10087007 | 3300025923 | Bacteria | 2222 |
| 439 | Ga0207694_10006699 | 3300025924 | Bacteria | 8755 |
| 440 | Ga0207694_10006875 | 3300025924 | Bacteria | 8642 |
| 441 | Ga0207694_10057876 | 3300025924 | Bacteria | 3015 |
| 442 | Ga0207694_10147202 | 3300025924 | Bacteria | 1896 |
| 443 | Ga0207659_10073745 | 3300025926 | Bacteria | 2500 |
| 444 | Ga0207659_10082794 | 3300025926 | Bacteria | 2377 |
| 445 | Ga0207659_10308861 | 3300025926 | Bacteria | 1301 |
| 446 | Ga0207687_10017964 | 3300025927 | Bacteria | 4666 |
| 447 | Ga0207700_10082586 | 3300025928 | Bacteria | 2513 |
| 448 | Ga0207664_10000623 | 3300025929 | Bacteria | 24532 |
| 449 | Ga0207664_10021689 | 3300025929 | Bacteria | 4783 |
| 450 | Ga0207664_10122269 | 3300025929 | Bacteria | 2180 |
| 451 | Ga0207644_10050002 | 3300025931 | Bacteria | 2995 |
| 452 | Ga0207644_10097307 | 3300025931 | Bacteria | 2204 |
| 453 | Ga0207644_10114059 | 3300025931 | Bacteria | 2047 |
| 454 | Ga0207690_10002850 | 3300025932 | Bacteria | 10427 |
| 455 | Ga0207690_10005091 | 3300025932 | Bacteria | 7763 |
| 456 | Ga0207690_10025068 | 3300025932 | Bacteria | 3741 |
| 457 | Ga0207690_10041312 | 3300025932 | Bacteria | 3021 |
| 458 | Ga0207690_10109325 | 3300025932 | Bacteria | 1989 |
| 459 | Ga0207706_10264824 | 3300025933 | Bacteria | 1500 |
| 460 | Ga0207686_10444501 | 3300025934 | Bacteria | 996 |
| 461 | Ga0207709_10079700 | 3300025935 | Bacteria | 2106 |
| 462 | Ga0207709_10155749 | 3300025935 | Bacteria | 1588 |
| 463 | Ga0207709_10158805 | 3300025935 | Bacteria | 1574 |
| 464 | Ga0207669_10188141 | 3300025937 | Bacteria | 1487 |
| 465 | Ga0207669_10233431 | 3300025937 | Bacteria | 1359 |
| 466 | Ga0207704_10001999 | 3300025938 | Bacteria | 9144 |
| 467 | Ga0207704_10064958 | 3300025938 | Bacteria | 2283 |
| 468 | Ga0207704_10189078 | 3300025938 | Bacteria | 1496 |
| 469 | Ga0207665_10085295 | 3300025939 | Bacteria | 2180 |
| 470 | Ga0207665_10177530 | 3300025939 | Bacteria | 1541 |
| 471 | Ga0207691_10012480 | 3300025940 | Bacteria | 8146 |
| 472 | Ga0207691_10019512 | 3300025940 | Bacteria | 6415 |
| 473 | Ga0207691_10038079 | 3300025940 | Bacteria | 4449 |
| 474 | Ga0207691_10263627 | 3300025940 | Bacteria | 1485 |
| 475 | Ga0207711_10033488 | 3300025941 | Bacteria | 4347 |
| 476 | Ga0207711_10068436 | 3300025941 | Bacteria | 3075 |
| 477 | Ga0207689_10002136 | 3300025942 | Bacteria | 18609 |
| 478 | Ga0207689_10008782 | 3300025942 | Bacteria | 8784 |
| 479 | Ga0207689_10035448 | 3300025942 | Bacteria | 4145 |
| 480 | Ga0207689_10068994 | 3300025942 | Bacteria | 2905 |
| 481 | Ga0207689_10142432 | 3300025942 | Bacteria | 1975 |
| 482 | Ga0207689_10542224 | 3300025942 | Bacteria | 977 |
| 483 | Ga0207661_10076842 | 3300025944 | Bacteria | 2744 |
| 484 | Ga0207661_10186039 | 3300025944 | Bacteria | 1818 |
| 485 | Ga0207661_10221943 | 3300025944 | Bacteria | 1671 |
| 486 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 487 | Ga0207667_10001689 | 3300025949 | Bacteria | 27781 |
| 488 | Ga0207667_10016473 | 3300025949 | Bacteria | 8352 |
| 489 | Ga0207667_10073979 | 3300025949 | Bacteria | 3539 |
| 490 | Ga0207667_10141834 | 3300025949 | Bacteria | 2474 |
| 491 | Ga0207651_10143199 | 3300025960 | Bacteria | 1849 |
| 492 | Ga0207668_10184148 | 3300025972 | Bacteria | 1650 |
| 493 | Ga0207640_10000075 | 3300025981 | Bacteria | 77684 |
| 494 | Ga0207640_10014541 | 3300025981 | Bacteria | 4534 |
| 495 | Ga0207640_10037321 | 3300025981 | Bacteria | 3056 |
| 496 | Ga0207640_10064746 | 3300025981 | Bacteria | 2436 |
| 497 | Ga0207658_10127376 | 3300025986 | Bacteria | 2040 |
| 498 | Ga0207639_10031041 | 3300026041 | Bacteria | 3924 |
| 499 | Ga0207678_10000004 | 3300026067 | Bacteria | 196743 |
| 500 | Ga0207678_10043149 | 3300026067 | Bacteria | 3904 |
| 501 | Ga0207708_10004997 | 3300026075 | Bacteria | 9769 |
| 502 | Ga0207708_10022743 | 3300026075 | Bacteria | 4734 |
| 503 | Ga0207708_10180002 | 3300026075 | Bacteria | 1678 |
| 504 | Ga0207702_10000029 | 3300026078 | Bacteria | 181652 |
| 505 | Ga0207702_10000329 | 3300026078 | Bacteria | 54291 |
| 506 | Ga0207702_10000372 | 3300026078 | Bacteria | 51212 |
| 507 | Ga0207702_10006444 | 3300026078 | Bacteria | 10119 |
| 508 | Ga0207702_10137731 | 3300026078 | Bacteria | 2205 |
| 509 | Ga0207641_10108372 | 3300026088 | Bacteria | 2458 |
| 510 | Ga0207641_10114442 | 3300026088 | Bacteria | 2397 |
| 511 | Ga0207641_10172380 | 3300026088 | Bacteria | 1976 |
| 512 | Ga0207641_10502809 | 3300026088 | Bacteria | 1177 |
| 513 | Ga0207648_10000182 | 3300026089 | Bacteria | 66368 |
| 514 | Ga0207648_10010471 | 3300026089 | Bacteria | 8785 |
| 515 | Ga0207648_10034900 | 3300026089 | Bacteria | 4434 |
| 516 | Ga0207648_10038420 | 3300026089 | Bacteria | 4212 |
| 517 | Ga0207648_10352453 | 3300026089 | Bacteria | 1327 |
| 518 | Ga0207676_10036715 | 3300026095 | Bacteria | 3730 |
| 519 | Ga0207676_10046087 | 3300026095 | Bacteria | 3372 |
| 520 | Ga0207676_10078051 | 3300026095 | Bacteria | 2681 |
| 521 | Ga0207674_10000039 | 3300026116 | Bacteria | 131096 |
| 522 | Ga0207674_10005988 | 3300026116 | Bacteria | 14395 |
| 523 | Ga0207674_10021683 | 3300026116 | Bacteria | 6916 |
| 524 | Ga0207674_10051345 | 3300026116 | Bacteria | 4208 |
| 525 | Ga0207674_10086467 | 3300026116 | Bacteria | 3130 |
| 526 | Ga0207674_10231818 | 3300026116 | Bacteria | 1794 |
| 527 | Ga0207674_10303224 | 3300026116 | Bacteria | 1546 |
| 528 | Ga0207674_10431512 | 3300026116 | Bacteria | 1273 |
| 529 | Ga0207674_10434343 | 3300026116 | Bacteria | 1269 |
| 530 | Ga0207675_100000551 | 3300026118 | Bacteria | 36576 |
| 531 | Ga0207675_100004383 | 3300026118 | Bacteria | 13642 |
| 532 | Ga0207675_100013693 | 3300026118 | Bacteria | 7570 |
| 533 | Ga0207675_100121252 | 3300026118 | Bacteria | 2474 |
| 534 | Ga0207683_10070861 | 3300026121 | Bacteria | 3080 |
| 535 | Ga0207683_10145182 | 3300026121 | Bacteria | 2139 |
| 536 | Ga0207683_10151342 | 3300026121 | Bacteria | 2094 |
| 537 | Ga0207683_10190368 | 3300026121 | Bacteria | 1862 |
| 538 | Ga0207683_10341837 | 3300026121 | Bacteria | 1373 |
| 539 | Ga0207698_10013356 | 3300026142 | Bacteria | 5415 |
| 540 | Ga0207698_10067203 | 3300026142 | Bacteria | 2826 |
| 541 | Ga0207698_10253432 | 3300026142 | Bacteria | 1612 |
| 542 | Ga0209389_1000049 | 3300027296 | Bacteria | 114702 |
| 543 | Ga0209389_1061539 | 3300027296 | Bacteria | 2299 |
| 544 | Ga0209371_1004494 | 3300027312 | Bacteria | 6024 |
| 545 | Ga0209967_1013142 | 3300027364 | Bacteria | 1173 |
| 546 | Ga0210000_1007935 | 3300027462 | Bacteria | 1556 |
| 547 | Ga0209999_1011598 | 3300027543 | Bacteria | 1596 |
| 548 | Ga0209999_1049948 | 3300027543 | Bacteria | 789 |
| 549 | Ga0209813_10005511 | 3300027866 | Bacteria | 3074 |
| 550 | Ga0268266_10135471 | 3300028379 | Bacteria | 2205 |
| 551 | Ga0268265_10149376 | 3300028380 | Bacteria | 1969 |
| 552 | Ga0268265_10236792 | 3300028380 | Bacteria | 1608 |
| 553 | Ga0268265_10493721 | 3300028380 | Bacteria | 1152 |
| 554 | Ga0268264_10002391 | 3300028381 | Bacteria | 16541 |
| 555 | Ga0265322_10007930 | 3300028654 | Bacteria | 3096 |
| 556 | Ga0307517_10002408 | 3300028786 | Bacteria | 29985 |
| 557 | Ga0307515_10000064 | 3300028794 | Bacteria | 245452 |
| 558 | Ga0307515_10127990 | 3300028794 | Bacteria | 2820 |
| 559 | Ga0265338_10232933 | 3300028800 | Bacteria | 1368 |
| 560 | Ga0268256_1004255 | 3300030500 | Bacteria | 6024 |
| 561 | Ga0307512_10238470 | 3300030522 | Bacteria | 924 |
| 562 | Ga0316178_1108561 | 3300030735 | Bacteria | 985 |
| 563 | Ga0265320_10090829 | 3300031240 | Bacteria | 1415 |
| 564 | Ga0265339_10073221 | 3300031249 | Bacteria | 1822 |
| 565 | Ga0307513_10010724 | 3300031456 | Bacteria | 11459 |
| 566 | Ga0307513_10114676 | 3300031456 | Bacteria | 2679 |
| 567 | Ga0307513_10197551 | 3300031456 | Bacteria | 1856 |
| 568 | Ga0307509_10000006 | 3300031507 | Bacteria | 421538 |
| 569 | Ga0307408_100013852 | 3300031548 | Bacteria | 5354 |
| 570 | Ga0307408_100184017 | 3300031548 | Bacteria | 1678 |
| 571 | Ga0307408_100555674 | 3300031548 | Bacteria | 1013 |
| 572 | Ga0307508_10002237 | 3300031616 | Bacteria | 20629 |
| 573 | Ga0307508_10006263 | 3300031616 | Bacteria | 11207 |
| 574 | Ga0316575_10023346 | 3300031665 | Bacteria | 2391 |
| 575 | Ga0316575_10070842 | 3300031665 | Bacteria | 1400 |
| 576 | Ga0316575_10083207 | 3300031665 | Bacteria | 1292 |
| 577 | Ga0316579_10005579 | 3300031691 | Bacteria | 5090 |
| 578 | Ga0316579_10009237 | 3300031691 | Bacteria | 4142 |
| 579 | Ga0316579_10050038 | 3300031691 | Bacteria | 1953 |
| 580 | Ga0316579_10171275 | 3300031691 | Bacteria | 1049 |
| 581 | Ga0316576_10002913 | 3300031727 | Bacteria | 9895 |
| 582 | Ga0316576_10013079 | 3300031727 | Bacteria | 5504 |
| 583 | Ga0316576_10125768 | 3300031727 | Bacteria | 1926 |
| 584 | Ga0316576_10180663 | 3300031727 | Bacteria | 1591 |
| 585 | Ga0316578_10032042 | 3300031728 | Bacteria | 2999 |
| 586 | Ga0316578_10106809 | 3300031728 | Bacteria | 1680 |
| 587 | Ga0316578_10254800 | 3300031728 | Bacteria | 1052 |
| 588 | Ga0307516_10007080 | 3300031730 | Bacteria | 12966 |
| 589 | Ga0307405_10013627 | 3300031731 | Bacteria | 4342 |
| 590 | Ga0307405_10310766 | 3300031731 | Bacteria | 1200 |
| 591 | Ga0316577_10004863 | 3300031733 | Bacteria | 6991 |
| 592 | Ga0307413_10237804 | 3300031824 | Bacteria | 1342 |
| 593 | Ga0307410_10043289 | 3300031852 | Bacteria | 2982 |
| 594 | Ga0307410_10637176 | 3300031852 | Bacteria | 893 |
| 595 | Ga0307406_10021397 | 3300031901 | Bacteria | 3824 |
| 596 | Ga0307407_10060527 | 3300031903 | Bacteria | 2210 |
| 597 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 598 | Ga0307412_10010556 | 3300031911 | Bacteria | 5321 |
| 599 | Ga0307412_10587633 | 3300031911 | Bacteria | 941 |
| 600 | Ga0307409_100000809 | 3300031995 | Bacteria | 14331 |
| 601 | Ga0307416_100088614 | 3300032002 | Bacteria | 2646 |
| 602 | Ga0307416_100324319 | 3300032002 | Bacteria | 1544 |
| 603 | Ga0307416_100674810 | 3300032002 | Bacteria | 1120 |
| 604 | Ga0307414_10012037 | 3300032004 | Bacteria | 5102 |
| 605 | Ga0307414_10648893 | 3300032004 | Bacteria | 951 |
| 606 | Ga0307411_10031177 | 3300032005 | Bacteria | 3276 |
| 607 | Ga0307415_100041952 | 3300032126 | Bacteria | 3041 |
| 608 | Ga0316583_10001362 | 3300032133 | Bacteria | 8106 |
| 609 | Ga0316583_10014049 | 3300032133 | Bacteria | 2888 |
| 610 | Ga0316583_10016175 | 3300032133 | Bacteria | 2685 |
| 611 | Ga0316583_10021236 | 3300032133 | Bacteria | 2328 |
| 612 | Ga0316583_10043530 | 3300032133 | Bacteria | 1586 |
| 613 | Ga0316583_10094751 | 3300032133 | Bacteria | 1041 |
| 614 | Ga0316583_10099391 | 3300032133 | Bacteria | 1014 |
| 615 | Ga0316585_10000290 | 3300032137 | Bacteria | 11116 |
| 616 | Ga0316585_10011720 | 3300032137 | Bacteria | 2588 |
| 617 | Ga0316585_10117627 | 3300032137 | Bacteria | 874 |
| 618 | Ga0316585_10135490 | 3300032137 | Bacteria | 812 |
| 619 | Ga0316580_10000157 | 3300032139 | Bacteria | 13310 |
| 620 | Ga0316580_10044320 | 3300032139 | Bacteria | 1372 |
| 621 | Ga0316580_10047899 | 3300032139 | Bacteria | 1317 |
| 622 | Ga0316593_10068839 | 3300032168 | Bacteria | 1222 |
| 623 | Ga0307510_10151238 | 3300033180 | Bacteria | 1939 |
| 624 | Ga0316592_1006013 | 3300033524 | Bacteria | 2325 |
| 625 | Ga0316586_1006816 | 3300033527 | Bacteria | 1650 |
| 626 | Ga0316586_1007859 | 3300033527 | Bacteria | 1565 |
| 627 | Ga0316588_1020477 | 3300033528 | Bacteria | 1498 |
| 628 | Ga0316588_1027539 | 3300033528 | Bacteria | 1321 |
| 629 | Ga0316587_1000057 | 3300033529 | Bacteria | 7359 |
| 630 | Ga0316587_1024685 | 3300033529 | Bacteria | 1041 |
| 631 | Ga0373928_0003096 | 3300035084 | Bacteria | 3191 |
| 632 | Ga0373934_0009488 | 3300035086 | Bacteria | 3644 |
| 633 | Ga0373952_0038233 | 3300035092 | Bacteria | 1098 |
| 634 | Ga0373932_0025572 | 3300035112 | Bacteria | 1599 |
| 635 | Ga0373960_0027298 | 3300035121 | Bacteria | 1566 |
| 636 | Ga0316574_0000225 | 3300035398 | Bacteria | 20257 |
| 637 | Ga0316574_0003552 | 3300035398 | Bacteria | 8054 |
| 638 | Ga0316574_0009834 | 3300035398 | Bacteria | 5376 |
| 639 | Ga0316574_0062328 | 3300035398 | Bacteria | 2343 |
| 640 | Ga0316574_0091683 | 3300035398 | Bacteria | 1938 |
| 641 | Ga0316574_0126052 | 3300035398 | Bacteria | 1646 |
| 642 | Ga0316574_0236375 | 3300035398 | Bacteria | 1169 |
| 643 | Ga0373931_0029715 | 3300035691 | Bacteria | 2808 |
| 644 | Ga0373927_0080785 | 3300035695 | Bacteria | 2107 |
| 645 | Ga0373947_0212444 | 3300035725 | Bacteria | 1269 |
| 646 | Ga0373937_0208968 | 3300036401 | Bacteria | 1836 |
| 647 | Ga0316582_0001690 | 3300036647 | Bacteria | 9909 |
| 648 | Ga0316582_0017225 | 3300036647 | Bacteria | 4175 |
| 649 | Ga0316582_0024606 | 3300036647 | Bacteria | 3605 |
| 650 | Ga0316582_0046102 | 3300036647 | Bacteria | 2747 |
| 651 | Ga0316582_0086998 | 3300036647 | Bacteria | 2050 |
| 652 | Ga0316582_0150293 | 3300036647 | Bacteria | 1574 |
| 653 | Ga0316582_0217018 | 3300036647 | Bacteria | 1307 |
| 654 | Ga0316584_0007976 | 3300036712 | Bacteria | 7268 |
| 655 | Ga0316584_0017393 | 3300036712 | Bacteria | 5167 |
| 656 | Ga0316584_0017889 | 3300036712 | Bacteria | 5105 |
| 657 | Ga0316584_0071470 | 3300036712 | Bacteria | 2600 |
| 658 | Ga0373925_0041188 | 3300037068 | Bacteria | 3423 |
| 659 | Ga0373925_0065704 | 3300037068 | Bacteria | 2733 |
| 660 | Ga0395899_0100586 | 3300037312 | Bacteria | 2088 |
| 661 | Ga0395899_0217452 | 3300037312 | Bacteria | 1325 |
| 662 | Ga0395900_0024931 | 3300037418 | Bacteria | 6121 |
| 663 | Ga0395900_0249370 | 3300037418 | Bacteria | 1777 |
| 664 | Ga0395898_0023842 | 3300037466 | Bacteria | 6177 |
| 665 | Ga0395898_0043495 | 3300037466 | Bacteria | 4425 |
| 666 | Ga0395905_0000138 | 3300037471 | Bacteria | 120373 |
| 667 | Ga0395905_0003472 | 3300037471 | Bacteria | 16849 |
| 668 | Ga0395905_0159089 | 3300037471 | Bacteria | 2123 |
| 669 | Ga0395905_0363120 | 3300037471 | Bacteria | 1341 |
| 670 | Ga0316581_0001652 | 3300037588 | Bacteria | 5115 |
| 671 | Ga0316581_0031622 | 3300037588 | Bacteria | 1595 |
| 672 | Ga0316581_0059572 | 3300037588 | Bacteria | 1171 |
| 673 | Ga0395901_0006496 | 3300038443 | Bacteria | 11832 |
| 674 | Ga0395901_0015232 | 3300038443 | Bacteria | 7824 |
| 675 | Ga0395901_0020917 | 3300038443 | Bacteria | 6703 |
| 676 | Ga0400488_40734 | 3300038741 | Bacteria | 3880 |
| 677 | Ga0400486_17590 | 3300038742 | Bacteria | 2824 |
| 678 | Ga0436361_0708871 | 3300039447 | Bacteria | 7065 |
| 679 | Ga0436361_0763281 | 3300039447 | Bacteria | 9370 |
| 680 | Ga0439436_0001760 | 3300041404 | Bacteria | 6358 |
| 681 | Ga0439436_0003056 | 3300041404 | Bacteria | 5078 |
| 682 | Ga0451793_0511053 | 3300041452 | Bacteria | 1982 |
| 683 | Ga0451853_3433684 | 3300041512 | Bacteria | 1759 |
| 684 | Ga0439431_0000936 | 3300041997 | Bacteria | 6335 |
| 685 | Ga0439442_024145 | 3300042002 | Bacteria | 1264 |
| 686 | Ga0439445_0004691 | 3300042004 | Bacteria | 3099 |
| 687 | Ga0439432_000932 | 3300042006 | Bacteria | 11004 |
| 688 | Ga0439432_031900 | 3300042006 | Bacteria | 1702 |
| 689 | Ga0439449_0006682 | 3300042007 | Bacteria | 4405 |
| 690 | Ga0439449_0031638 | 3300042007 | Bacteria | 1972 |
| 691 | Ga0439452_023416 | 3300042010 | Bacteria | 1590 |
| 692 | Ga0439456_000104 | 3300042013 | Bacteria | 28208 |
| 693 | Ga0439462_0039943 | 3300042015 | Bacteria | 1251 |
| 694 | Ga0450900_001178 | 3300042136 | Bacteria | 2458 |
| 695 | Ga0450902_001457 | 3300042137 | Bacteria | 3227 |
| 696 | Ga0450905_000527 | 3300042142 | Bacteria | 4692 |
| 697 | Ga0450909_020936 | 3300042185 | Bacteria | 976 |
| 698 | Ga0439434_0000294 | 3300042435 | Bacteria | 14301 |
| 699 | Ga0439434_0009557 | 3300042435 | Bacteria | 2853 |
| 700 | Ga0439435_0000060 | 3300042436 | Bacteria | 12857 |
| 701 | Ga0439459_0002959 | 3300042438 | Bacteria | 2660 |
| 702 | Ga0450901_000469 | 3300042533 | Bacteria | 4800 |
| 703 | Ga0451577_0004111 | 3300042876 | Bacteria | 15600 |
| 704 | Ga0451577_0004145 | 3300042876 | Bacteria | 15530 |
| 705 | Ga0451577_0243287 | 3300042876 | Bacteria | 1628 |
| 706 | Ga0451577_0270863 | 3300042876 | Bacteria | 1538 |
| 707 | Ga0451577_0329272 | 3300042876 | Bacteria | 1385 |
| 708 | Ga0451577_0359880 | 3300042876 | Bacteria | 1320 |
| 709 | Ga0466969_0032581 | 3300044656 | Bacteria | 2649 |
| 710 | Ga0466972_0000094 | 3300044658 | Bacteria | 78156 |
| 711 | Ga0466972_0013727 | 3300044658 | Bacteria | 4064 |
| 712 | Ga0466972_0175521 | 3300044658 | Bacteria | 1005 |
| 713 | Ga0466978_0021228 | 3300044671 | Bacteria | 3839 |
| 714 | Ga0466982_0194935 | 3300044672 | Bacteria | 1217 |
| 715 | Ga0453683_0005236 | 3300044673 | Bacteria | 9081 |
| 716 | Ga0453683_0077912 | 3300044673 | Bacteria | 2076 |
| 717 | Ga0466966_0366941 | 3300044684 | Bacteria | 865 |
| 718 | Ga0466961_0002119 | 3300044693 | Bacteria | 12342 |
| 719 | Ga0466963_0133434 | 3300044694 | Bacteria | 1717 |
| 720 | Ga0466964_0011262 | 3300044706 | Bacteria | 3378 |
| 721 | Ga0453684_0000039 | 3300044712 | Bacteria | 697730 |
| 722 | Ga0453684_0000209 | 3300044712 | Bacteria | 255543 |
| 723 | Ga0453684_0003587 | 3300044712 | Bacteria | 34638 |
| 724 | Ga0453684_0005764 | 3300044712 | Bacteria | 24186 |
| 725 | Ga0453684_0023208 | 3300044712 | Bacteria | 9152 |
| 726 | Ga0453684_0037047 | 3300044712 | Bacteria | 6702 |
| 727 | Ga0453684_0038797 | 3300044712 | Bacteria | 6501 |
| 728 | Ga0453684_0047956 | 3300044712 | Bacteria | 5656 |
| 729 | Ga0453684_0100394 | 3300044712 | Bacteria | 3542 |
| 730 | Ga0453684_0141098 | 3300044712 | Bacteria | 2877 |
| 731 | Ga0453684_0258833 | 3300044712 | Bacteria | 1994 |
| 732 | Ga0453684_0263642 | 3300044712 | Bacteria | 1972 |
| 733 | Ga0453684_0746219 | 3300044712 | Bacteria | 1060 |
| 734 | Ga0466968_0139078 | 3300044735 | Bacteria | 1109 |
| 735 | Ga0466957_0066210 | 3300044842 | Bacteria | 2226 |
| 736 | Ga0466957_0129625 | 3300044842 | Bacteria | 1615 |
| 737 | Ga0466959_0000328 | 3300045049 | Bacteria | 28046 |
| 738 | Ga0451576_0069652 | 3300045051 | Bacteria | 3661 |
| 739 | Ga0451576_0077326 | 3300045051 | Bacteria | 3463 |
| 740 | Ga0451576_0188454 | 3300045051 | Bacteria | 2154 |
| 741 | Ga0451576_0362614 | 3300045051 | Bacteria | 1518 |
| 742 | Ga0451576_0497406 | 3300045051 | Bacteria | 1281 |
| 743 | Ga0451576_0525702 | 3300045051 | Bacteria | 1243 |
| 744 | Ga0466967_0041666 | 3300045976 | Bacteria | 3961 |
| 745 | Ga0495617_000539 | 3300046452 | Bacteria | 19621 |
| 746 | Ga0495592_0005128 | 3300046454 | Bacteria | 9649 |
| 747 | Ga0495603_0072371 | 3300046455 | Bacteria | 2025 |
| 748 | Ga0495590_0000008 | 3300046457 | Bacteria | 330520 |
| 749 | Ga0495590_0000564 | 3300046457 | Bacteria | 17568 |
| 750 | Ga0495590_0001807 | 3300046457 | Bacteria | 9062 |
| 751 | Ga0495590_0022344 | 3300046457 | Bacteria | 2237 |
| 752 | Ga0495590_0039449 | 3300046457 | Bacteria | 1647 |
| 753 | Ga0495590_0099089 | 3300046457 | Bacteria | 1035 |
| 754 | Ga0495591_000043 | 3300046458 | Bacteria | 148885 |
| 755 | Ga0495591_006006 | 3300046458 | Bacteria | 5476 |
| 756 | Ga0495629_0000068 | 3300046459 | Bacteria | 92619 |
| 757 | Ga0495629_0002001 | 3300046459 | Bacteria | 15835 |
| 758 | Ga0495629_0008667 | 3300046459 | Bacteria | 7490 |
| 759 | Ga0495629_0010808 | 3300046459 | Bacteria | 6640 |
| 760 | Ga0495638_0000142 | 3300046460 | Bacteria | 113893 |
| 761 | Ga0495638_0006804 | 3300046460 | Bacteria | 8256 |
| 762 | Ga0495638_0015524 | 3300046460 | Bacteria | 5113 |
| 763 | Ga0495641_0029655 | 3300046461 | Bacteria | 2634 |
| 764 | Ga0495651_0002428 | 3300046462 | Bacteria | 14382 |
| 765 | Ga0495651_0033735 | 3300046462 | Bacteria | 3992 |
| 766 | Ga0495651_0100947 | 3300046462 | Bacteria | 2149 |
| 767 | Ga0495653_0000106 | 3300046463 | Bacteria | 69465 |
| 768 | Ga0495653_0028519 | 3300046463 | Bacteria | 4463 |
| 769 | Ga0495653_0038059 | 3300046463 | Bacteria | 3776 |
| 770 | Ga0495653_0110105 | 3300046463 | Bacteria | 1980 |
| 771 | Ga0495653_0150697 | 3300046463 | Bacteria | 1625 |
| 772 | Ga0495650_0002257 | 3300046471 | Bacteria | 16099 |
| 773 | Ga0495650_0029397 | 3300046471 | Bacteria | 2505 |
| 774 | Ga0495580_0000062 | 3300046472 | Bacteria | 63605 |
| 775 | Ga0495580_0003904 | 3300046472 | Bacteria | 12596 |
| 776 | Ga0495580_0004329 | 3300046472 | Bacteria | 11920 |
| 777 | Ga0495580_0025177 | 3300046472 | Bacteria | 4349 |
| 778 | Ga0495580_0027318 | 3300046472 | Bacteria | 4153 |
| 779 | Ga0495580_0068274 | 3300046472 | Bacteria | 2486 |
| 780 | Ga0495580_0115496 | 3300046472 | Bacteria | 1864 |
| 781 | Ga0495580_0179619 | 3300046472 | Bacteria | 1461 |
| 782 | Ga0495582_0007318 | 3300046473 | Bacteria | 6117 |
| 783 | Ga0495582_0021578 | 3300046473 | Bacteria | 3523 |
| 784 | Ga0495582_0070828 | 3300046473 | Bacteria | 1929 |
| 785 | Ga0495605_0004132 | 3300046474 | Bacteria | 8554 |
| 786 | Ga0495605_0017063 | 3300046474 | Bacteria | 3919 |
| 787 | Ga0495605_0103072 | 3300046474 | Bacteria | 1309 |
| 788 | Ga0495639_0023188 | 3300046475 | Bacteria | 2726 |
| 789 | Ga0495664_0029571 | 3300046477 | Bacteria | 3205 |
| 790 | Ga0495584_0000017 | 3300046491 | Bacteria | 149686 |
| 791 | Ga0495584_0000025 | 3300046491 | Bacteria | 116731 |
| 792 | Ga0495584_0001098 | 3300046491 | Bacteria | 16805 |
| 793 | Ga0495584_0002329 | 3300046491 | Bacteria | 10825 |
| 794 | Ga0495584_0027660 | 3300046491 | Bacteria | 2873 |
| 795 | Ga0495584_0200006 | 3300046491 | Bacteria | 1016 |
| 796 | Ga0495585_0000064 | 3300046492 | Bacteria | 109302 |
| 797 | Ga0495585_0000254 | 3300046492 | Bacteria | 54984 |
| 798 | Ga0495585_0002313 | 3300046492 | Bacteria | 13727 |
| 799 | Ga0495585_0010392 | 3300046492 | Bacteria | 5542 |
| 800 | Ga0495585_0011365 | 3300046492 | Bacteria | 5268 |
| 801 | Ga0495585_0065670 | 3300046492 | Bacteria | 1987 |
| 802 | Ga0495594_0056756 | 3300046499 | Bacteria | 2162 |
| 803 | Ga0495596_0002354 | 3300046500 | Bacteria | 10230 |
| 804 | Ga0495596_0019412 | 3300046500 | Bacteria | 2792 |
| 805 | Ga0495596_0042249 | 3300046500 | Bacteria | 1796 |
| 806 | Ga0495607_0009729 | 3300046501 | Bacteria | 6489 |
| 807 | Ga0495583_0000160 | 3300046506 | Bacteria | 113560 |
| 808 | Ga0495583_0000512 | 3300046506 | Bacteria | 55428 |
| 809 | Ga0495583_0009872 | 3300046506 | Bacteria | 5647 |
| 810 | Ga0495606_0003064 | 3300046507 | Bacteria | 18209 |
| 811 | Ga0495606_0009929 | 3300046507 | Bacteria | 7970 |
| 812 | Ga0495606_0059816 | 3300046507 | Bacteria | 2443 |
| 813 | Ga0495606_0082712 | 3300046507 | Bacteria | 1992 |
| 814 | Ga0495606_0175631 | 3300046507 | Bacteria | 1239 |
| 815 | Ga0495606_0261742 | 3300046507 | Bacteria | 954 |
| 816 | Ga0495608_0002682 | 3300046511 | Bacteria | 12786 |
| 817 | Ga0495610_0000364 | 3300046512 | Bacteria | 47361 |
| 818 | Ga0495610_0000809 | 3300046512 | Bacteria | 29337 |
| 819 | Ga0495616_0004568 | 3300046513 | Bacteria | 8713 |
| 820 | Ga0495616_0022287 | 3300046513 | Bacteria | 3420 |
| 821 | Ga0495616_0092297 | 3300046513 | Bacteria | 1431 |
| 822 | Ga0495618_0012154 | 3300046514 | Bacteria | 5226 |
| 823 | Ga0495618_0034021 | 3300046514 | Bacteria | 3194 |
| 824 | Ga0495620_0011969 | 3300046515 | Bacteria | 4506 |
| 825 | Ga0495628_0056824 | 3300046516 | Bacteria | 3079 |
| 826 | Ga0495628_0126295 | 3300046516 | Bacteria | 1959 |
| 827 | Ga0495628_0261871 | 3300046516 | Bacteria | 1288 |
| 828 | Ga0495630_0011461 | 3300046517 | Bacteria | 6419 |
| 829 | Ga0495630_0054506 | 3300046517 | Bacteria | 2996 |
| 830 | Ga0495630_0072540 | 3300046517 | Bacteria | 2591 |
| 831 | Ga0495630_0079545 | 3300046517 | Bacteria | 2472 |
| 832 | Ga0495631_0000113 | 3300046518 | Bacteria | 54471 |
| 833 | Ga0495631_0019345 | 3300046518 | Bacteria | 3194 |
| 834 | Ga0495631_0026301 | 3300046518 | Bacteria | 2674 |
| 835 | Ga0495631_0033090 | 3300046518 | Bacteria | 2324 |
| 836 | Ga0495632_0010626 | 3300046519 | Bacteria | 5432 |
| 837 | Ga0495632_0025004 | 3300046519 | Bacteria | 3164 |
| 838 | Ga0495637_0000009 | 3300046520 | Bacteria | 402028 |
| 839 | Ga0495637_0037169 | 3300046520 | Bacteria | 2116 |
| 840 | Ga0495643_0069400 | 3300046522 | Bacteria | 1852 |
| 841 | Ga0495644_0002495 | 3300046523 | Bacteria | 7342 |
| 842 | Ga0495644_0041412 | 3300046523 | Bacteria | 1734 |
| 843 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 844 | Ga0495648_0000856 | 3300046524 | Bacteria | 32108 |
| 845 | Ga0495648_0001462 | 3300046524 | Bacteria | 23121 |
| 846 | Ga0495648_0005631 | 3300046524 | Bacteria | 10371 |
| 847 | Ga0495648_0013118 | 3300046524 | Bacteria | 6143 |
| 848 | Ga0495648_0106806 | 3300046524 | Bacteria | 1531 |
| 849 | Ga0495666_0001428 | 3300046526 | Bacteria | 11597 |
| 850 | Ga0495666_0007370 | 3300046526 | Bacteria | 5515 |
| 851 | Ga0495666_0014337 | 3300046526 | Bacteria | 3947 |
| 852 | Ga0495666_0014921 | 3300046526 | Bacteria | 3867 |
| 853 | Ga0495666_0029789 | 3300046526 | Bacteria | 2684 |
| 854 | Ga0495642_0033608 | 3300046528 | Bacteria | 2062 |
| 855 | Ga0495642_0069831 | 3300046528 | Bacteria | 1468 |
| 856 | Ga0495642_0144332 | 3300046528 | Bacteria | 1028 |
| 857 | Ga0495652_0077689 | 3300046529 | Bacteria | 2750 |
| 858 | Ga0495652_0166659 | 3300046529 | Bacteria | 1704 |
| 859 | Ga0495652_0207008 | 3300046529 | Bacteria | 1484 |
| 860 | Ga0495665_0021697 | 3300046531 | Bacteria | 3452 |
| 861 | Ga0495665_0040356 | 3300046531 | Bacteria | 2485 |
| 862 | Ga0495665_0052825 | 3300046531 | Bacteria | 2150 |
| 863 | Ga0495665_0068412 | 3300046531 | Bacteria | 1872 |
| 864 | Ga0495640_0002419 | 3300046533 | Bacteria | 14983 |
| 865 | Ga0495640_0012920 | 3300046533 | Bacteria | 6365 |
| 866 | Ga0495640_0049451 | 3300046533 | Bacteria | 2899 |
| 867 | Ga0495586_0022459 | 3300046535 | Bacteria | 3367 |
| 868 | Ga0495586_0064202 | 3300046535 | Bacteria | 2000 |
| 869 | Ga0495586_0082798 | 3300046535 | Bacteria | 1765 |
| 870 | Ga0495586_0087580 | 3300046535 | Bacteria | 1717 |
| 871 | Ga0495587_0001498 | 3300046536 | Bacteria | 15536 |
| 872 | Ga0495598_0051159 | 3300046537 | Bacteria | 1244 |
| 873 | Ga0495609_0079327 | 3300046538 | Bacteria | 1436 |
| 874 | Ga0495621_0025804 | 3300046539 | Bacteria | 1977 |
| 875 | Ga0495597_0000958 | 3300046542 | Bacteria | 22301 |
| 876 | Ga0495597_0090184 | 3300046542 | Bacteria | 1302 |
| 877 | Ga0495645_0049738 | 3300046543 | Bacteria | 3052 |
| 878 | Ga0495645_0095348 | 3300046543 | Bacteria | 2121 |
| 879 | Ga0495622_0000005 | 3300046557 | Bacteria | 254434 |
| 880 | Ga0495633_0001467 | 3300046558 | Bacteria | 18303 |
| 881 | Ga0495633_0002408 | 3300046558 | Bacteria | 13218 |
| 882 | Ga0495633_0008090 | 3300046558 | Bacteria | 5969 |
| 883 | Ga0495633_0013815 | 3300046558 | Bacteria | 4239 |
| 884 | Ga0495633_0015441 | 3300046558 | Bacteria | 3962 |
| 885 | Ga0495633_0038594 | 3300046558 | Bacteria | 2280 |
| 886 | Ga0495656_0035858 | 3300046615 | Bacteria | 2040 |
| 887 | Ga0495668_0021800 | 3300046616 | Bacteria | 3667 |
| 888 | Ga0495668_0030352 | 3300046616 | Bacteria | 3052 |
| 889 | Ga0495668_0078425 | 3300046616 | Bacteria | 1813 |
| 890 | Ga0495634_0001826 | 3300046642 | Bacteria | 18400 |
| 891 | Ga0495634_0014590 | 3300046642 | Bacteria | 5660 |
| 892 | Ga0495634_0123621 | 3300046642 | Bacteria | 1655 |
| 893 | Ga0495611_0000361 | 3300046648 | Bacteria | 29629 |
| 894 | Ga0495611_0002708 | 3300046648 | Bacteria | 7988 |
| 895 | Ga0495611_0055084 | 3300046648 | Bacteria | 1798 |
| 896 | Ga0495611_0090398 | 3300046648 | Bacteria | 1415 |
| 897 | Ga0495625_0050710 | 3300046660 | Bacteria | 2977 |
| 898 | Ga0495625_0054646 | 3300046660 | Bacteria | 2851 |
| 899 | Ga0495635_0006638 | 3300046663 | Bacteria | 8079 |
| 900 | Ga0495635_0038217 | 3300046663 | Bacteria | 3323 |
| 901 | Ga0495661_0000725 | 3300046665 | Bacteria | 32331 |
| 902 | Ga0495661_0004554 | 3300046665 | Bacteria | 9986 |
| 903 | Ga0495661_0008840 | 3300046665 | Bacteria | 6945 |
| 904 | Ga0495661_0009821 | 3300046665 | Bacteria | 6546 |
| 905 | Ga0495661_0018782 | 3300046665 | Bacteria | 4540 |
| 906 | Ga0495661_0037601 | 3300046665 | Bacteria | 3020 |
| 907 | Ga0495661_0043099 | 3300046665 | Bacteria | 2776 |
| 908 | Ga0495661_0045031 | 3300046665 | Bacteria | 2700 |
| 909 | Ga0495661_0076162 | 3300046665 | Bacteria | 1947 |
| 910 | Ga0495588_0111560 | 3300046674 | Bacteria | 1440 |
| 911 | Ga0495657_0053248 | 3300046675 | Bacteria | 2709 |
| 912 | Ga0495599_0009080 | 3300046678 | Bacteria | 6059 |
| 913 | Ga0495599_0016433 | 3300046678 | Bacteria | 4593 |
| 914 | Ga0495599_0032937 | 3300046678 | Bacteria | 3254 |
| 915 | Ga0495623_0019454 | 3300046679 | Bacteria | 4388 |
| 916 | Ga0495623_0036214 | 3300046679 | Bacteria | 3162 |
| 917 | Ga0495623_0070802 | 3300046679 | Bacteria | 2171 |
| 918 | Ga0495646_0024982 | 3300046680 | Bacteria | 3759 |
| 919 | Ga0495646_0038413 | 3300046680 | Bacteria | 2956 |
| 920 | Ga0495646_0038578 | 3300046680 | Bacteria | 2948 |
| 921 | Ga0495646_0053415 | 3300046680 | Bacteria | 2436 |
| 922 | Ga0495647_0057608 | 3300046681 | Bacteria | 1526 |
| 923 | Ga0495613_0007287 | 3300046689 | Bacteria | 8236 |
| 924 | Ga0495613_0010933 | 3300046689 | Bacteria | 6737 |
| 925 | Ga0495624_0002899 | 3300046690 | Bacteria | 12825 |
| 926 | Ga0495624_0009904 | 3300046690 | Bacteria | 6587 |
| 927 | Ga0495624_0014833 | 3300046690 | Bacteria | 5277 |
| 928 | Ga0495624_0015212 | 3300046690 | Bacteria | 5203 |
| 929 | Ga0495624_0026356 | 3300046690 | Bacteria | 3810 |
| 930 | Ga0495624_0101477 | 3300046690 | Bacteria | 1771 |
| 931 | Ga0495670_0000157 | 3300046691 | Bacteria | 29533 |
| 932 | Ga0495670_0000977 | 3300046691 | Bacteria | 13866 |
| 933 | Ga0495670_0118806 | 3300046691 | Bacteria | 1372 |
| 934 | Ga0495671_0012253 | 3300046692 | Bacteria | 4688 |
| 935 | Ga0495671_0230959 | 3300046692 | Bacteria | 895 |
| 936 | Ga0495649_0000028 | 3300046694 | Bacteria | 163229 |
| 937 | Ga0495649_0004750 | 3300046694 | Bacteria | 8809 |
| 938 | Ga0495649_0004753 | 3300046694 | Bacteria | 8808 |
| 939 | Ga0495649_0037773 | 3300046694 | Bacteria | 2650 |
| 940 | Ga0495649_0044469 | 3300046694 | Bacteria | 2424 |
| 941 | Ga0495589_0003956 | 3300046794 | Bacteria | 7952 |
| 942 | Ga0495589_0014700 | 3300046794 | Bacteria | 4027 |
| 943 | Ga0495600_0039056 | 3300046809 | Bacteria | 3090 |
| 944 | Ga0495660_0039201 | 3300046810 | Bacteria | 2631 |
| 945 | Ga0495660_0045872 | 3300046810 | Bacteria | 2398 |
| 946 | Ga0495581_0000974 | 3300047315 | Bacteria | 15397 |
| 947 | Ga0495581_0037611 | 3300047315 | Bacteria | 2801 |
| 948 | Ga0495581_0084374 | 3300047315 | Bacteria | 1840 |
| 949 | Ga0495604_0009687 | 3300047317 | Bacteria | 7618 |
| 950 | Ga0495604_0012629 | 3300047317 | Bacteria | 6718 |
| 951 | Ga0495604_0028630 | 3300047317 | Bacteria | 4432 |
| 952 | Ga0495604_0135107 | 3300047317 | Bacteria | 1768 |
| 953 | Ga0495674_0050129 | 3300047319 | Bacteria | 3684 |
| 954 | Ga0495674_0051499 | 3300047319 | Bacteria | 3629 |
| 955 | Ga0495674_0079072 | 3300047319 | Bacteria | 2824 |
| 956 | Ga0495674_0108638 | 3300047319 | Bacteria | 2353 |
| 957 | Ga0495672_0000055 | 3300047320 | Bacteria | 229428 |
| 958 | Ga0495676_0033008 | 3300047321 | Bacteria | 4364 |
| 959 | Ga0495676_0058821 | 3300047321 | Bacteria | 3022 |
| 960 | Ga0495676_0068060 | 3300047321 | Bacteria | 2752 |
| 961 | Ga0495676_0074321 | 3300047321 | Bacteria | 2603 |
| 962 | Ga0495680_0009459 | 3300047322 | Bacteria | 8764 |
| 963 | Ga0495680_0014461 | 3300047322 | Bacteria | 6833 |
| 964 | Ga0495680_0041629 | 3300047322 | Bacteria | 3651 |
| 965 | Ga0495680_0105528 | 3300047322 | Bacteria | 2095 |
| 966 | Ga0495680_0128226 | 3300047322 | Bacteria | 1866 |
| 967 | Ga0495683_0000047 | 3300047323 | Bacteria | 126770 |
| 968 | Ga0495683_0000179 | 3300047323 | Bacteria | 62241 |
| 969 | Ga0495683_0002007 | 3300047323 | Bacteria | 12647 |
| 970 | Ga0495683_0002296 | 3300047323 | Bacteria | 11659 |
| 971 | Ga0495683_0008170 | 3300047323 | Bacteria | 5614 |
| 972 | Ga0495683_0128263 | 3300047323 | Bacteria | 1198 |
| 973 | Ga0495683_0142726 | 3300047323 | Bacteria | 1121 |
| 974 | Ga0495687_003337 | 3300047443 | Bacteria | 11742 |
| 975 | Ga0495687_016328 | 3300047443 | Bacteria | 3735 |
| 976 | Ga0495687_054667 | 3300047443 | Bacteria | 1674 |
| 977 | Ga0495675_0001779 | 3300047444 | Bacteria | 12842 |
| 978 | Ga0495675_0002004 | 3300047444 | Bacteria | 12163 |
| 979 | Ga0495675_0002575 | 3300047444 | Bacteria | 10866 |
| 980 | Ga0495675_0220366 | 3300047444 | Bacteria | 1148 |
| 981 | Ga0495677_0000105 | 3300047445 | Bacteria | 41592 |
| 982 | Ga0495677_0000234 | 3300047445 | Bacteria | 25123 |
| 983 | Ga0495679_000009 | 3300047446 | Bacteria | 343637 |
| 984 | Ga0495679_000272 | 3300047446 | Bacteria | 43249 |
| 985 | Ga0495679_005087 | 3300047446 | Bacteria | 5901 |
| 986 | Ga0495679_033950 | 3300047446 | Bacteria | 1626 |
| 987 | Ga0495685_001131 | 3300047447 | Bacteria | 8166 |
| 988 | Ga0495673_0003578 | 3300047469 | Bacteria | 10194 |
| 989 | Ga0495681_0001995 | 3300047470 | Bacteria | 14918 |
| 990 | Ga0495681_0010188 | 3300047470 | Bacteria | 5708 |
| 991 | Ga0495686_0003031 | 3300047472 | Bacteria | 14902 |
| 992 | Ga0495686_0046261 | 3300047472 | Bacteria | 2751 |
| 993 | Ga0495593_0006303 | 3300047673 | Bacteria | 6958 |
| 994 | Ga0495593_0012286 | 3300047673 | Bacteria | 4894 |
| 995 | Ga0495593_0057511 | 3300047673 | Bacteria | 2041 |
| 996 | Ga0495602_0017169 | 3300048088 | Bacteria | 7257 |
| 997 | Ga0495602_0033154 | 3300048088 | Bacteria | 4849 |
| 998 | Ga0495602_0052347 | 3300048088 | Bacteria | 3627 |
| 999 | Ga0495602_0084640 | 3300048088 | Bacteria | 2652 |
| 1000 | Ga0495602_0195233 | 3300048088 | Bacteria | 1549 |
| 1001 | Ga0495602_0274886 | 3300048088 | Bacteria | 1243 |
| 1002 | Ga0495614_0000338 | 3300048089 | Bacteria | 18550 |
| 1003 | Ga0495614_0002659 | 3300048089 | Bacteria | 7947 |
| 1004 | Ga0495614_0026652 | 3300048089 | Bacteria | 2492 |
| 1005 | Ga0495626_0003089 | 3300048091 | Bacteria | 10917 |
| 1006 | Ga0495626_0015187 | 3300048091 | Bacteria | 3947 |
| 1007 | Ga0495626_0034022 | 3300048091 | Bacteria | 2439 |
| 1008 | Ga0496101_0000892 | 3300048904 | Bacteria | 17545 |
| 1009 | Ga0496101_0005306 | 3300048904 | Bacteria | 8210 |
| 1010 | Ga0496102_0001422 | 3300048905 | Bacteria | 21227 |
| 1011 | Ga0496102_0442022 | 3300048905 | Bacteria | 1220 |
| 1012 | Ga0496103_0001280 | 3300048906 | Bacteria | 17150 |
| 1013 | Ga0496103_0004541 | 3300048906 | Bacteria | 8404 |
| 1014 | Ga0496103_0010012 | 3300048906 | Bacteria | 5607 |
| 1015 | Ga0496104_0000057 | 3300048907 | Bacteria | 119211 |
| 1016 | Ga0496104_0002714 | 3300048907 | Bacteria | 15233 |
| 1017 | Ga0496105_0000037 | 3300048908 | Bacteria | 119355 |
| 1018 | Ga0496106_0008360 | 3300048909 | Bacteria | 7664 |
| 1019 | Ga0496107_0379385 | 3300048910 | Bacteria | 1052 |
| 1020 | Ga0496108_0022485 | 3300048911 | Bacteria | 5185 |
| 1021 | Ga0496108_0066056 | 3300048911 | Bacteria | 3050 |
| 1022 | Ga0496108_0237639 | 3300048911 | Bacteria | 1585 |
| 1023 | Ga0496109_0020897 | 3300048912 | Bacteria | 5786 |
| 1024 | Ga0496109_0156332 | 3300048912 | Bacteria | 2136 |
| 1025 | Ga0496112_0013244 | 3300048915 | Bacteria | 7611 |
| 1026 | Ga0496112_0061620 | 3300048915 | Bacteria | 3699 |
| 1027 | Ga0496114_0010230 | 3300048917 | Bacteria | 7463 |
| 1028 | Ga0496115_0043109 | 3300048918 | Bacteria | 3597 |
| 1029 | Ga0496116_0003464 | 3300048919 | Bacteria | 15558 |
| 1030 | Ga0496116_0037342 | 3300048919 | Bacteria | 3389 |
| 1031 | Ga0496117_0000134 | 3300048920 | Bacteria | 161270 |
| 1032 | Ga0496117_0065945 | 3300048920 | Bacteria | 2458 |
| 1033 | Ga0496118_0000139 | 3300048921 | Bacteria | 128723 |
| 1034 | Ga0496118_0001543 | 3300048921 | Bacteria | 34234 |
| 1035 | Ga0496118_0004355 | 3300048921 | Bacteria | 16849 |
| 1036 | Ga0496118_0049673 | 3300048921 | Bacteria | 3228 |
| 1037 | Ga0496118_0085780 | 3300048921 | Bacteria | 2191 |
| 1038 | Ga0496121_0004590 | 3300048924 | Bacteria | 18409 |
| 1039 | Ga0496121_0167815 | 3300048924 | Bacteria | 1598 |
| 1040 | Ga0496123_0041920 | 3300048926 | Bacteria | 3167 |
| 1041 | Ga0496124_0001295 | 3300048927 | Bacteria | 37945 |
| 1042 | Ga0496124_0062550 | 3300048927 | Bacteria | 3114 |
| 1043 | Ga0496125_0008926 | 3300048928 | Bacteria | 10409 |
| 1044 | Ga0496125_0018966 | 3300048928 | Bacteria | 6510 |
| 1045 | Ga0496126_0000475 | 3300048929 | Bacteria | 79715 |
| 1046 | Ga0496126_0001848 | 3300048929 | Bacteria | 30899 |
| 1047 | Ga0495678_000025 | 3300049459 | Bacteria | 227891 |
| 1048 | Ga0495678_000041 | 3300049459 | Bacteria | 185715 |
| 1049 | Ga0495682_0018505 | 3300049460 | Bacteria | 2623 |
| 1050 | Ga0495682_0027619 | 3300049460 | Bacteria | 2104 |
| 1051 | Ga0501031_0039495 | 3300049568 | Bacteria | 3080 |
| 1052 | Ga0501032_0004457 | 3300049569 | Bacteria | 10558 |
| 1053 | Ga0501033_0001295 | 3300049570 | Bacteria | 22237 |
| 1054 | Ga0501033_0001924 | 3300049570 | Bacteria | 18083 |
| 1055 | Ga0501033_0375130 | 3300049570 | Bacteria | 994 |
| 1056 | Ga0501034_0000056 | 3300049571 | Bacteria | 202540 |
| 1057 | Ga0501034_0000101 | 3300049571 | Bacteria | 158656 |
| 1058 | Ga0501034_0000188 | 3300049571 | Bacteria | 115935 |
| 1059 | Ga0501034_0000578 | 3300049571 | Bacteria | 57983 |
| 1060 | Ga0501034_0003555 | 3300049571 | Bacteria | 17715 |
| 1061 | Ga0501036_0009459 | 3300049572 | Bacteria | 8018 |
| 1062 | Ga0501036_0011700 | 3300049572 | Bacteria | 7271 |
| 1063 | Ga0501036_0073760 | 3300049572 | Bacteria | 2885 |
| 1064 | Ga0501037_0000731 | 3300049573 | Bacteria | 24929 |
| 1065 | Ga0501037_0196298 | 3300049573 | Bacteria | 1427 |
| 1066 | Ga0501038_0002549 | 3300049574 | Bacteria | 16982 |
| 1067 | Ga0501038_0018992 | 3300049574 | Bacteria | 6203 |
| 1068 | Ga0501038_0048173 | 3300049574 | Bacteria | 3689 |
| 1069 | Ga0501038_0051855 | 3300049574 | Bacteria | 3538 |
| 1070 | Ga0501038_0108162 | 3300049574 | Bacteria | 2306 |
| 1071 | Ga0501039_0000137 | 3300049575 | Bacteria | 50348 |
| 1072 | Ga0501040_0004113 | 3300049576 | Bacteria | 9462 |
| 1073 | Ga0501040_0006389 | 3300049576 | Bacteria | 7651 |
| 1074 | Ga0501041_0000864 | 3300049577 | Bacteria | 16341 |
| 1075 | Ga0501042_0001236 | 3300049578 | Bacteria | 14879 |
| 1076 | Ga0501042_0021847 | 3300049578 | Bacteria | 4465 |
| 1077 | Ga0501042_0099048 | 3300049578 | Bacteria | 2096 |
| 1078 | Ga0501043_0000425 | 3300049579 | Bacteria | 37892 |
| 1079 | Ga0501043_0001029 | 3300049579 | Bacteria | 24505 |
| 1080 | Ga0501043_0002650 | 3300049579 | Bacteria | 15049 |
| 1081 | Ga0501043_0003618 | 3300049579 | Bacteria | 12698 |
| 1082 | Ga0501046_0001373 | 3300049580 | Bacteria | 23444 |
| 1083 | Ga0501046_0010156 | 3300049580 | Bacteria | 8101 |
| 1084 | Ga0501046_0023253 | 3300049580 | Bacteria | 5099 |
| 1085 | Ga0501046_0129231 | 3300049580 | Bacteria | 1917 |
| 1086 | Ga0501046_0135565 | 3300049580 | Bacteria | 1865 |
| 1087 | Ga0501046_0224792 | 3300049580 | Bacteria | 1389 |
| 1088 | Ga0501047_0030244 | 3300049581 | Bacteria | 5221 |
| 1089 | Ga0501047_0106731 | 3300049581 | Bacteria | 2681 |
| 1090 | Ga0501068_0194766 | 3300049584 | Bacteria | 1285 |
| 1091 | Ga0501071_0001821 | 3300049587 | Bacteria | 12629 |
| 1092 | Ga0501071_0008369 | 3300049587 | Bacteria | 6835 |
| 1093 | Ga0501072_0005280 | 3300049588 | Bacteria | 9840 |
| 1094 | Ga0501072_0015941 | 3300049588 | Bacteria | 5762 |
| 1095 | Ga0501075_0001079 | 3300049591 | Bacteria | 17539 |
| 1096 | Ga0501075_0032348 | 3300049591 | Bacteria | 3884 |
| 1097 | Ga0501076_0012583 | 3300049592 | Bacteria | 6329 |
| 1098 | Ga0501076_0106754 | 3300049592 | Bacteria | 2260 |
| 1099 | Ga0501077_0002690 | 3300049593 | Bacteria | 10658 |
| 1100 | Ga0501077_0024917 | 3300049593 | Bacteria | 3799 |
| 1101 | Ga0501077_0111073 | 3300049593 | Bacteria | 1737 |
| 1102 | Ga0501230_034663 | 3300049667 | Bacteria | 956 |
| 1103 | Ga0501079_0000543 | 3300049741 | Bacteria | 24597 |
| 1104 | Ga0501079_0027245 | 3300049741 | Bacteria | 4381 |
| 1105 | Ga0501080_0003928 | 3300049742 | Bacteria | 13162 |
| 1106 | Ga0501081_0005581 | 3300049743 | Bacteria | 8124 |
| 1107 | Ga0501035_0015479 | 3300049822 | Bacteria | 7036 |
| 1108 | Ga0501035_0039070 | 3300049822 | Bacteria | 4296 |
| 1109 | Ga0501035_0347314 | 3300049822 | Bacteria | 1242 |
| 1110 | Ga0501044_0000353 | 3300049823 | Bacteria | 57639 |
| 1111 | Ga0501044_0000688 | 3300049823 | Bacteria | 40885 |
| 1112 | Ga0501044_0166430 | 3300049823 | Bacteria | 2179 |
| 1113 | Ga0501044_0264296 | 3300049823 | Bacteria | 1658 |
| 1114 | Ga0501045_0004427 | 3300049824 | Bacteria | 9694 |
| 1115 | Ga0501045_0038705 | 3300049824 | Bacteria | 3469 |
| 1116 | nmdc:mga03683_15387_c1 | 3300050489 | Bacteria | 2854 |
| 1117 | nmdc:mga03683_88033_c1 | 3300050489 | Bacteria | 1350 |
| 1118 | nmdc:mga03683_8977_c1 | 3300050489 | Bacteria | 3537 |
| 1119 | nmdc:mga0k408_152543_c1 | 3300050493 | Bacteria | 1376 |
| 1120 | nmdc:mga0k408_2021_c1 | 3300050493 | Bacteria | 10865 |
| 1121 | nmdc:mga0k408_225564_c1 | 3300050493 | Bacteria | 1119 |
| 1122 | nmdc:mga0k408_77544_c1 | 3300050493 | Bacteria | 1943 |
| 1123 | nmdc:mga07m45_150706_c1 | 3300050496 | Bacteria | 1349 |
| 1124 | nmdc:mga07m45_49256_c1 | 3300050496 | Bacteria | 2371 |
| 1125 | nmdc:mga07m45_5308_c1 | 3300050496 | Bacteria | 6407 |
| 1126 | nmdc:mga07m45_94739_c1 | 3300050496 | Bacteria | 1712 |
| 1127 | nmdc:mga05p37_6731_c1 | 3300050507 | Bacteria | 13547 |
| 1128 | nmdc:mga09592_28641_c1 | 3300050508 | Bacteria | 4629 |
| 1129 | nmdc:mga0qj67_39632_c1 | 3300050509 | Bacteria | 3700 |
| 1130 | nmdc:mga06r32_43800_c1 | 3300050510 | Bacteria | 4259 |
| 1131 | nmdc:mga0n895_31172_c1 | 3300050512 | Bacteria | 5102 |
| 1132 | nmdc:mga0rr50_323833_c1 | 3300050513 | Bacteria | 1292 |
| 1133 | nmdc:mga08x19_112014_c1 | 3300050514 | Bacteria | 1821 |
| 1134 | nmdc:mga08x19_2639_c1 | 3300050514 | Bacteria | 10842 |
| 1135 | nmdc:mga0a205_123975_c1 | 3300050515 | Bacteria | 2483 |
| 1136 | nmdc:mga0a205_433982_c1 | 3300050515 | Bacteria | 1175 |
| 1137 | nmdc:mga0a205_6123_c1 | 3300050515 | Bacteria | 10854 |
| 1138 | nmdc:mga0sz30_109167_c1 | 3300050516 | Bacteria | 1212 |
| 1139 | nmdc:mga0sz30_16840_c1 | 3300050516 | Bacteria | 2908 |
| 1140 | Ga0495612_0003346 | 3300053078 | Bacteria | 6642 |
| 1141 | Ga0500659_0002495 | 3300053135 | Bacteria | 11077 |
| 1142 | Ga0500559_0035106 | 3300053136 | Bacteria | 2164 |
| 1143 | Ga0501084_0071881 | 3300054114 | Bacteria | 2897 |
| 1144 | Ga0587091_022750 | 3300059511 | Bacteria | 1110 |
| 1145 | Ga0587067_004181 | 3300059640 | Bacteria | 1861 |
| 1146 | Ga0501082_0004675 | 3300060353 | Bacteria | 11939 |
| 1147 | Ga0501082_0038427 | 3300060353 | Bacteria | 4130 |
| 1148 | Ga0466962_0034846 | 3300061719 | Bacteria | 2410 |
| 1149 | Ga0530510_0007252 | 3300061734 | Bacteria | 7712 |
| 1150 | Ga0530510_0009274 | 3300061734 | Bacteria | 6904 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0029715 | Ga0373931_0029715_1717_2517 | 207 |
| 2 | 3300002705 | JGI25156J39149_1000123 | JGI25156J39149_100012335 | 209 |
| 3 | 3300002705 | JGI25156J39149_1000132 | JGI25156J39149_100013214 | 209 |
| 4 | 3300002738 | JGI25154J39366_1003951 | JGI25154J39366_10039512 | 209 |
| 5 | 3300002741 | JGI25157J39369_1000157 | JGI25157J39369_100015734 | 209 |
| 6 | 3300003752 | Ga0055539_1002822 | Ga0055539_10028222 | 209 |
| 7 | 3300005328 | Ga0070676_10005402 | Ga0070676_100054027 | 209 |
| 8 | 3300005329 | Ga0070683_100269010 | Ga0070683_1002690102 | 209 |
| 9 | 3300005353 | Ga0070669_100072454 | Ga0070669_1000724543 | 209 |
| 10 | 3300005354 | Ga0070675_100015743 | Ga0070675_1000157436 | 209 |
| 11 | 3300005355 | Ga0070671_100034291 | Ga0070671_1000342916 | 209 |
| 12 | 3300005367 | Ga0070667_100106175 | Ga0070667_1001061753 | 209 |
| 13 | 3300005459 | Ga0068867_100006929 | Ga0068867_1000069296 | 209 |
| 14 | 3300005543 | Ga0070672_100189519 | Ga0070672_1001895192 | 209 |
| 15 | 3300005563 | Ga0068855_100120552 | Ga0068855_1001205523 | 209 |
| 16 | 3300005577 | Ga0068857_100001821 | Ga0068857_10000182111 | 209 |
| 17 | 3300005577 | Ga0068857_100114120 | Ga0068857_1001141202 | 209 |
| 18 | 3300005578 | Ga0068854_100006533 | Ga0068854_1000065336 | 209 |
| 19 | 3300005614 | Ga0068856_100000168 | Ga0068856_10000016831 | 209 |
| 20 | 3300005616 | Ga0068852_100368546 | Ga0068852_1003685462 | 209 |
| 21 | 3300005840 | Ga0068870_10012608 | Ga0068870_100126082 | 209 |
| 22 | 3300006353 | Ga0075370_10097382 | Ga0075370_100973822 | 209 |
| 23 | 3300009093 | Ga0105240_10130020 | Ga0105240_101300203 | 209 |
| 24 | 3300010375 | Ga0105239_10101564 | Ga0105239_101015643 | 209 |
| 25 | 3300013105 | Ga0157369_10134559 | Ga0157369_101345592 | 209 |
| 26 | 3300025246 | Ga0209646_1000053 | Ga0209646_1000053161 | 209 |
| 27 | 3300025250 | Ga0209026_1000020 | Ga0209026_1000020158 | 209 |
| 28 | 3300025253 | Ga0209677_100182 | Ga0209677_10018214 | 209 |
| 29 | 3300025256 | Ga0209759_1000017 | Ga0209759_1000017161 | 209 |
| 30 | 3300025907 | Ga0207645_10008797 | Ga0207645_100087974 | 209 |
| 31 | 3300025908 | Ga0207643_10008707 | Ga0207643_100087076 | 209 |
| 32 | 3300025911 | Ga0207654_10028858 | Ga0207654_100288582 | 209 |
| 33 | 3300025913 | Ga0207695_10003938 | Ga0207695_1000393814 | 209 |
| 34 | 3300025914 | Ga0207671_10072048 | Ga0207671_100720483 | 209 |
| 35 | 3300025924 | Ga0207694_10057876 | Ga0207694_100578763 | 209 |
| 36 | 3300025926 | Ga0207659_10082794 | Ga0207659_100827942 | 209 |
| 37 | 3300025931 | Ga0207644_10114059 | Ga0207644_101140594 | 209 |
| 38 | 3300025940 | Ga0207691_10038079 | Ga0207691_100380792 | 209 |
| 39 | 3300025942 | Ga0207689_10008782 | Ga0207689_100087827 | 209 |
| 40 | 3300025944 | Ga0207661_10186039 | Ga0207661_101860393 | 209 |
| 41 | 3300025949 | Ga0207667_10073979 | Ga0207667_100739792 | 209 |
| 42 | 3300025960 | Ga0207651_10143199 | Ga0207651_101431992 | 209 |
| 43 | 3300025981 | Ga0207640_10064746 | Ga0207640_100647463 | 209 |
| 44 | 3300025986 | Ga0207658_10127376 | Ga0207658_101273762 | 209 |
| 45 | 3300026078 | Ga0207702_10000329 | Ga0207702_1000032916 | 209 |
| 46 | 3300026078 | Ga0207702_10000372 | Ga0207702_1000037225 | 209 |
| 47 | 3300026089 | Ga0207648_10010471 | Ga0207648_100104718 | 209 |
| 48 | 3300026116 | Ga0207674_10005988 | Ga0207674_100059883 | 209 |
| 49 | 3300026116 | Ga0207674_10021683 | Ga0207674_100216835 | 209 |
| 50 | 3300026116 | Ga0207674_10086467 | Ga0207674_100864673 | 209 |
| 51 | 3300026121 | Ga0207683_10070861 | Ga0207683_100708613 | 209 |
| 52 | 3300026142 | Ga0207698_10253432 | Ga0207698_102534322 | 209 |
| 53 | 3300050496 | nmdc:mga07m45_94739_c1 | nmdc:mga07m45_94739_c1_313_1104 | 209 |
| 54 | 3300003752 | Ga0055539_1000409 | Ga0055539_100040913 | 210 |
| 55 | 3300003756 | Ga0055533_1000011 | Ga0055533_100001152 | 210 |
| 56 | 3300003759 | Ga0055525_1002837 | Ga0055525_10028371 | 210 |
| 57 | 3300025226 | Ga0209674_100003 | Ga0209674_100003353 | 210 |
| 58 | 3300025230 | Ga0209563_100010 | Ga0209563_10001082 | 210 |
| 59 | 3300025253 | Ga0209677_100068 | Ga0209677_10006840 | 210 |
| 60 | 3300005539 | Ga0068853_100471377 | Ga0068853_1004713772 | 211 |
| 61 | 3300035086 | Ga0373934_0009488 | Ga0373934_0009488_1224_2003 | 211 |
| 62 | 3300053136 | Ga0500559_0035106 | Ga0500559_0035106_1342_2121 | 211 |
| 63 | 3300031730 | Ga0307516_10007080 | Ga0307516_100070808 | 212 |
| 64 | 3300046462 | Ga0495651_0100947 | Ga0495651_0100947_506_1285 | 212 |
| 65 | 3300037312 | Ga0395899_0100586 | Ga0395899_0100586_1120_1902 | 213 |
| 66 | 3300037466 | Ga0395898_0043495 | Ga0395898_0043495_232_1014 | 213 |
| 67 | 3300038443 | Ga0395901_0015232 | Ga0395901_0015232_515_1297 | 213 |
| 68 | 3300025919 | Ga0207657_10111763 | Ga0207657_101117633 | 214 |
| 69 | 3300009093 | Ga0105240_10932282 | Ga0105240_109322821 | 219 |
| 70 | 3300009177 | Ga0105248_10398929 | Ga0105248_103989292 | 219 |
| 71 | 3300025256 | Ga0209759_1005927 | Ga0209759_10059273 | 219 |
| 72 | 3300039447 | Ga0436361_0708871 | Ga0436361_0708871_2609_3379 | 219 |
| 73 | 3300009148 | Ga0105243_10344451 | Ga0105243_103444512 | 220 |
| 74 | 3300025935 | Ga0207709_10158805 | Ga0207709_101588052 | 220 |
| 75 | 3300005339 | Ga0070660_100004427 | Ga0070660_1000044274 | 230 |
| 76 | 3300005434 | Ga0070709_10023561 | Ga0070709_100235612 | 230 |
| 77 | 3300005435 | Ga0070714_100002778 | Ga0070714_1000027787 | 230 |
| 78 | 3300005436 | Ga0070713_100009976 | Ga0070713_1000099764 | 230 |
| 79 | 3300005439 | Ga0070711_100265857 | Ga0070711_1002658572 | 230 |
| 80 | 3300005455 | Ga0070663_100212152 | Ga0070663_1002121521 | 230 |
| 81 | 3300005467 | Ga0070706_100015220 | Ga0070706_1000152202 | 230 |
| 82 | 3300005518 | Ga0070699_100054408 | Ga0070699_1000544083 | 230 |
| 83 | 3300005530 | Ga0070679_100203186 | Ga0070679_1002031862 | 230 |
| 84 | 3300005536 | Ga0070697_100012186 | Ga0070697_1000121864 | 230 |
| 85 | 3300005578 | Ga0068854_100188374 | Ga0068854_1001883741 | 230 |
| 86 | 3300006028 | Ga0070717_10458914 | Ga0070717_104589142 | 230 |
| 87 | 3300009098 | Ga0105245_10004840 | Ga0105245_100048407 | 230 |
| 88 | 3300009174 | Ga0105241_10184882 | Ga0105241_101848822 | 230 |
| 89 | 3300013100 | Ga0157373_10071969 | Ga0157373_100719692 | 230 |
| 90 | 3300025906 | Ga0207699_10040819 | Ga0207699_100408194 | 230 |
| 91 | 3300025910 | Ga0207684_10190386 | Ga0207684_101903862 | 230 |
| 92 | 3300025912 | Ga0207707_10013605 | Ga0207707_100136055 | 230 |
| 93 | 3300025915 | Ga0207693_10027941 | Ga0207693_100279413 | 230 |
| 94 | 3300025917 | Ga0207660_10066257 | Ga0207660_100662571 | 230 |
| 95 | 3300025919 | Ga0207657_10005082 | Ga0207657_100050825 | 230 |
| 96 | 3300025921 | Ga0207652_10122396 | Ga0207652_101223962 | 230 |
| 97 | 3300025928 | Ga0207700_10082586 | Ga0207700_100825863 | 230 |
| 98 | 3300025929 | Ga0207664_10000623 | Ga0207664_1000062312 | 230 |
| 99 | 3300025939 | Ga0207665_10085295 | Ga0207665_100852952 | 230 |
| 100 | 3300025942 | Ga0207689_10068994 | Ga0207689_100689942 | 230 |
| 101 | 3300025981 | Ga0207640_10037321 | Ga0207640_100373214 | 230 |
| 102 | 3300026067 | Ga0207678_10043149 | Ga0207678_100431493 | 230 |
| 103 | 3300026089 | Ga0207648_10352453 | Ga0207648_103524532 | 230 |
| 104 | 3300048910 | Ga0496107_0379385 | Ga0496107_0379385_94_861 | 230 |
| 105 | 3300050510 | nmdc:mga06r32_43800_c1 | nmdc:mga06r32_43800_c1_3536_4249 | 230 |
| 106 | 3300009551 | Ga0105238_10432097 | Ga0105238_104320971 | 231 |
| 107 | 3300050513 | nmdc:mga0rr50_323833_c1 | nmdc:mga0rr50_323833_c1_261_1025 | 231 |
| 108 | 3300005329 | Ga0070683_100010268 | Ga0070683_1000102684 | 232 |
| 109 | 3300005344 | Ga0070661_100033808 | Ga0070661_1000338084 | 232 |
| 110 | 3300005345 | Ga0070692_10017162 | Ga0070692_100171623 | 232 |
| 111 | 3300005457 | Ga0070662_100369930 | Ga0070662_1003699301 | 232 |
| 112 | 3300005471 | Ga0070698_100225729 | Ga0070698_1002257292 | 232 |
| 113 | 3300005535 | Ga0070684_100440532 | Ga0070684_1004405322 | 232 |
| 114 | 3300005536 | Ga0070697_100034838 | Ga0070697_1000348383 | 232 |
| 115 | 3300005546 | Ga0070696_100043412 | Ga0070696_1000434124 | 232 |
| 116 | 3300005564 | Ga0070664_100194403 | Ga0070664_1001944031 | 232 |
| 117 | 3300005616 | Ga0068852_100163555 | Ga0068852_1001635552 | 232 |
| 118 | 3300006175 | Ga0070712_100017367 | Ga0070712_1000173674 | 232 |
| 119 | 3300006852 | Ga0075433_10010730 | Ga0075433_100107302 | 232 |
| 120 | 3300006914 | Ga0075436_100071738 | Ga0075436_1000717382 | 232 |
| 121 | 3300007076 | Ga0075435_100005231 | Ga0075435_10000523110 | 232 |
| 122 | 3300009551 | Ga0105238_10053683 | Ga0105238_100536833 | 232 |
| 123 | 3300013102 | Ga0157371_10070486 | Ga0157371_100704863 | 232 |
| 124 | 3300025909 | Ga0207705_10293620 | Ga0207705_102936201 | 232 |
| 125 | 3300025914 | Ga0207671_10481882 | Ga0207671_104818822 | 232 |
| 126 | 3300025924 | Ga0207694_10147202 | Ga0207694_101472022 | 232 |
| 127 | 3300025933 | Ga0207706_10264824 | Ga0207706_102648242 | 232 |
| 128 | 3300025939 | Ga0207665_10177530 | Ga0207665_101775301 | 232 |
| 129 | 3300025944 | Ga0207661_10076842 | Ga0207661_100768422 | 232 |
| 130 | 3300026116 | Ga0207674_10434343 | Ga0207674_104343431 | 232 |
| 131 | 3300036401 | Ga0373937_0208968 | Ga0373937_0208968_221_994 | 232 |
| 132 | 3300046692 | Ga0495671_0230959 | Ga0495671_0230959_100_852 | 232 |
| 133 | 3300049572 | Ga0501036_0009459 | Ga0501036_0009459_5951_6706 | 232 |
| 134 | 3300049574 | Ga0501038_0051855 | Ga0501038_0051855_116_871 | 232 |
| 135 | 3300049575 | Ga0501039_0000137 | Ga0501039_0000137_5685_6440 | 232 |
| 136 | 3300049576 | Ga0501040_0004113 | Ga0501040_0004113_3966_4721 | 232 |
| 137 | 3300049577 | Ga0501041_0000864 | Ga0501041_0000864_10173_10928 | 232 |
| 138 | 3300049580 | Ga0501046_0010156 | Ga0501046_0010156_1624_2379 | 232 |
| 139 | 3300049587 | Ga0501071_0001821 | Ga0501071_0001821_3800_4555 | 232 |
| 140 | 3300049588 | Ga0501072_0005280 | Ga0501072_0005280_5724_6479 | 232 |
| 141 | 3300049591 | Ga0501075_0001079 | Ga0501075_0001079_7768_8523 | 232 |
| 142 | 3300049592 | Ga0501076_0106754 | Ga0501076_0106754_867_1622 | 232 |
| 143 | 3300049593 | Ga0501077_0002690 | Ga0501077_0002690_1833_2588 | 232 |
| 144 | 3300049741 | Ga0501079_0000543 | Ga0501079_0000543_7785_8540 | 232 |
| 145 | 3300049743 | Ga0501081_0005581 | Ga0501081_0005581_4583_5338 | 232 |
| 146 | 3300049824 | Ga0501045_0004427 | Ga0501045_0004427_7120_7875 | 232 |
| 147 | 3300050512 | nmdc:mga0n895_31172_c1 | nmdc:mga0n895_31172_c1_1879_2643 | 232 |
| 148 | 3300050514 | nmdc:mga08x19_112014_c1 | nmdc:mga08x19_112014_c1_500_1264 | 232 |
| 149 | 3300050515 | nmdc:mga0a205_6123_c1 | nmdc:mga0a205_6123_c1_8120_8884 | 232 |
| 150 | 3300054114 | Ga0501084_0071881 | Ga0501084_0071881_707_1462 | 232 |
| 151 | 3300060353 | Ga0501082_0004675 | Ga0501082_0004675_4216_4971 | 232 |
| 152 | 3300061734 | Ga0530510_0009274 | Ga0530510_0009274_5639_6394 | 232 |
| 153 | 3300005366 | Ga0070659_100022346 | Ga0070659_1000223464 | 233 |
| 154 | 3300005445 | Ga0070708_100112961 | Ga0070708_1001129611 | 233 |
| 155 | 3300005468 | Ga0070707_100150960 | Ga0070707_1001509602 | 233 |
| 156 | 3300005471 | Ga0070698_100253725 | Ga0070698_1002537252 | 233 |
| 157 | 3300005518 | Ga0070699_100082153 | Ga0070699_1000821532 | 233 |
| 158 | 3300006852 | Ga0075433_10245977 | Ga0075433_102459772 | 233 |
| 159 | 3300025922 | Ga0207646_10037315 | Ga0207646_100373152 | 233 |
| 160 | 3300035695 | Ga0373927_0080785 | Ga0373927_0080785_669_1433 | 233 |
| 161 | 3300046472 | Ga0495580_0027318 | Ga0495580_0027318_3064_3828 | 233 |
| 162 | 3300046531 | Ga0495665_0052825 | Ga0495665_0052825_1268_2047 | 233 |
| 163 | 3300046535 | Ga0495586_0087580 | Ga0495586_0087580_220_999 | 233 |
| 164 | 3300046542 | Ga0495597_0000958 | Ga0495597_0000958_8921_9721 | 233 |
| 165 | 3300046674 | Ga0495588_0111560 | Ga0495588_0111560_345_1124 | 233 |
| 166 | 3300047315 | Ga0495581_0084374 | Ga0495581_0084374_141_920 | 233 |
| 167 | 3300005365 | Ga0070688_100201785 | Ga0070688_1002017852 | 234 |
| 168 | 3300005440 | Ga0070705_100042616 | Ga0070705_1000426163 | 234 |
| 169 | 3300005459 | Ga0068867_100286504 | Ga0068867_1002865042 | 234 |
| 170 | 3300005549 | Ga0070704_100005075 | Ga0070704_1000050752 | 234 |
| 171 | 3300005615 | Ga0070702_100044723 | Ga0070702_1000447234 | 234 |
| 172 | 3300005617 | Ga0068859_100749607 | Ga0068859_1007496072 | 234 |
| 173 | 3300005719 | Ga0068861_100128260 | Ga0068861_1001282602 | 234 |
| 174 | 3300006931 | Ga0097620_100749613 | Ga0097620_1007496132 | 234 |
| 175 | 3300014745 | Ga0157377_10259661 | Ga0157377_102596611 | 234 |
| 176 | 3300025926 | Ga0207659_10073745 | Ga0207659_100737451 | 234 |
| 177 | 3300025935 | Ga0207709_10155749 | Ga0207709_101557492 | 234 |
| 178 | 3300026075 | Ga0207708_10180002 | Ga0207708_101800022 | 234 |
| 179 | 3300026118 | Ga0207675_100121252 | Ga0207675_1001212522 | 234 |
| 180 | 3300027364 | Ga0209967_1013142 | Ga0209967_10131422 | 234 |
| 181 | 3300027543 | Ga0209999_1011598 | Ga0209999_10115983 | 234 |
| 182 | 3300031731 | Ga0307405_10310766 | Ga0307405_103107662 | 234 |
| 183 | 3300031852 | Ga0307410_10637176 | Ga0307410_106371761 | 234 |
| 184 | 3300032002 | Ga0307416_100324319 | Ga0307416_1003243192 | 234 |
| 185 | 3300032002 | Ga0307416_100674810 | Ga0307416_1006748102 | 234 |
| 186 | 3300042185 | Ga0450909_020936 | Ga0450909_020936_33_794 | 234 |
| 187 | 3300045051 | Ga0451576_0188454 | Ga0451576_0188454_79_846 | 234 |
| 188 | 3300046491 | Ga0495584_0027660 | Ga0495584_0027660_407_1201 | 234 |
| 189 | 3300046518 | Ga0495631_0019345 | Ga0495631_0019345_1904_2698 | 234 |
| 190 | 3300046648 | Ga0495611_0055084 | Ga0495611_0055084_135_929 | 234 |
| 191 | 3300046691 | Ga0495670_0118806 | Ga0495670_0118806_419_1213 | 234 |
| 192 | 3300049667 | Ga0501230_034663 | Ga0501230_034663_183_932 | 234 |
| 193 | 3300035725 | Ga0373947_0212444 | Ga0373947_0212444_78_848 | 235 |
| 194 | 3300037068 | Ga0373925_0041188 | Ga0373925_0041188_1557_2327 | 235 |
| 195 | 3300037471 | Ga0395905_0159089 | Ga0395905_0159089_674_1444 | 235 |
| 196 | 3300044712 | Ga0453684_0047956 | Ga0453684_0047956_134_844 | 235 |
| 197 | 3300046507 | Ga0495606_0059816 | Ga0495606_0059816_1076_1858 | 235 |
| 198 | 3300053078 | Ga0495612_0003346 | Ga0495612_0003346_63_833 | 235 |
| 199 | 3300003354 | JGI25160J50197_1001515 | JGI25160J50197_10015154 | 236 |
| 200 | 3300003771 | Ga0055526_1038702 | Ga0055526_10387021 | 236 |
| 201 | 3300005262 | Ga0065165_1003184 | Ga0065165_10031847 | 236 |
| 202 | 3300005536 | Ga0070697_100006211 | Ga0070697_1000062113 | 236 |
| 203 | 3300005549 | Ga0070704_100003831 | Ga0070704_1000038316 | 236 |
| 204 | 3300009093 | Ga0105240_10058761 | Ga0105240_100587612 | 236 |
| 205 | 3300025295 | Ga0209564_1006995 | Ga0209564_10069955 | 236 |
| 206 | 3300025302 | Ga0207426_1000014 | Ga0207426_100001463 | 236 |
| 207 | 3300026116 | Ga0207674_10431512 | Ga0207674_104315122 | 236 |
| 208 | 3300031507 | Ga0307509_10000006 | Ga0307509_10000006282 | 236 |
| 209 | 3300035112 | Ga0373932_0025572 | Ga0373932_0025572_20_739 | 236 |
| 210 | 3300048904 | Ga0496101_0000892 | Ga0496101_0000892_2024_2803 | 236 |
| 211 | 3300048905 | Ga0496102_0001422 | Ga0496102_0001422_12435_13214 | 236 |
| 212 | 3300048906 | Ga0496103_0001280 | Ga0496103_0001280_8303_9082 | 236 |
| 213 | 3300048920 | Ga0496117_0000134 | Ga0496117_0000134_12435_13214 | 236 |
| 214 | 3300048921 | Ga0496118_0000139 | Ga0496118_0000139_115510_116289 | 236 |
| 215 | 3300048924 | Ga0496121_0004590 | Ga0496121_0004590_5196_5975 | 236 |
| 216 | 3300049580 | Ga0501046_0129231 | Ga0501046_0129231_75_866 | 236 |
| 217 | iso_pu_bacteria | 2901300506 | 2901305142 | 236 |
| 218 | 3300031548 | Ga0307408_100013852 | Ga0307408_1000138525 | 237 |
| 219 | 3300031731 | Ga0307405_10013627 | Ga0307405_100136272 | 237 |
| 220 | 3300031824 | Ga0307413_10237804 | Ga0307413_102378042 | 237 |
| 221 | 3300031852 | Ga0307410_10043289 | Ga0307410_100432894 | 237 |
| 222 | 3300031901 | Ga0307406_10021397 | Ga0307406_100213973 | 237 |
| 223 | 3300031903 | Ga0307407_10060527 | Ga0307407_100605272 | 237 |
| 224 | 3300031911 | Ga0307412_10010556 | Ga0307412_100105565 | 237 |
| 225 | 3300031995 | Ga0307409_100000809 | Ga0307409_1000008098 | 237 |
| 226 | 3300032002 | Ga0307416_100088614 | Ga0307416_1000886142 | 237 |
| 227 | 3300032004 | Ga0307414_10012037 | Ga0307414_100120372 | 237 |
| 228 | 3300032005 | Ga0307411_10031177 | Ga0307411_100311772 | 237 |
| 229 | 3300032126 | Ga0307415_100041952 | Ga0307415_1000419523 | 237 |
| 230 | 3300048088 | Ga0495602_0195233 | Ga0495602_0195233_352_1119 | 237 |
| 231 | 3300049576 | Ga0501040_0006389 | Ga0501040_0006389_2211_2987 | 237 |
| 232 | 3300049578 | Ga0501042_0001236 | Ga0501042_0001236_5349_6125 | 237 |
| 233 | 3300049578 | Ga0501042_0021847 | Ga0501042_0021847_2249_3025 | 237 |
| 234 | 3300059511 | Ga0587091_022750 | Ga0587091_022750_111_884 | 237 |
| 235 | 3300005549 | Ga0070704_100334656 | Ga0070704_1003346562 | 238 |
| 236 | 3300007076 | Ga0075435_100364013 | Ga0075435_1003640132 | 238 |
| 237 | 3300003187 | JGI25151J46595_10009112 | JGI25151J46595_100091122 | 239 |
| 238 | 3300025294 | Ga0209025_1000497 | Ga0209025_100049760 | 239 |
| 239 | 3300032004 | Ga0307414_10648893 | Ga0307414_106488931 | 239 |
| 240 | 3300037312 | Ga0395899_0217452 | Ga0395899_0217452_365_1141 | 239 |
| 241 | 3300037418 | Ga0395900_0024931 | Ga0395900_0024931_3647_4423 | 239 |
| 242 | 3300037466 | Ga0395898_0023842 | Ga0395898_0023842_555_1331 | 239 |
| 243 | 3300044658 | Ga0466972_0000094 | Ga0466972_0000094_17520_18269 | 239 |
| 244 | 3300046526 | Ga0495666_0029789 | Ga0495666_0029789_1655_2449 | 239 |
| 245 | 3300046690 | Ga0495624_0009904 | Ga0495624_0009904_5519_6313 | 239 |
| 246 | 3300015261 | Ga0182006_1034035 | Ga0182006_10340351 | 240 |
| 247 | 3300037068 | Ga0373925_0065704 | Ga0373925_0065704_578_1357 | 240 |
| 248 | 3300045051 | Ga0451576_0525702 | Ga0451576_0525702_495_1229 | 240 |
| 249 | 3300049579 | Ga0501043_0003618 | Ga0501043_0003618_11378_12166 | 240 |
| 250 | 3300049580 | Ga0501046_0001373 | Ga0501046_0001373_14283_15071 | 240 |
| 251 | 3300005577 | Ga0068857_100337506 | Ga0068857_1003375062 | 241 |
| 252 | 3300005617 | Ga0068859_100008147 | Ga0068859_1000081479 | 241 |
| 253 | 3300006931 | Ga0097620_100008146 | Ga0097620_1000081469 | 241 |
| 254 | 3300021361 | Ga0213872_10036729 | Ga0213872_100367292 | 241 |
| 255 | 3300025923 | Ga0207681_10087007 | Ga0207681_100870072 | 241 |
| 256 | 3300025937 | Ga0207669_10188141 | Ga0207669_101881412 | 241 |
| 257 | 3300026088 | Ga0207641_10502809 | Ga0207641_105028092 | 241 |
| 258 | 3300026089 | Ga0207648_10034900 | Ga0207648_100349004 | 241 |
| 259 | 3300028800 | Ga0265338_10232933 | Ga0265338_102329332 | 241 |
| 260 | 3300031665 | Ga0316575_10023346 | Ga0316575_100233462 | 241 |
| 261 | 3300031691 | Ga0316579_10005579 | Ga0316579_100055792 | 241 |
| 262 | 3300032133 | Ga0316583_10001362 | Ga0316583_100013622 | 241 |
| 263 | 3300032137 | Ga0316585_10000290 | Ga0316585_100002905 | 241 |
| 264 | 3300032139 | Ga0316580_10000157 | Ga0316580_100001575 | 241 |
| 265 | 3300036647 | Ga0316582_0001690 | Ga0316582_0001690_4991_5746 | 241 |
| 266 | 3300036712 | Ga0316584_0017889 | Ga0316584_0017889_1365_2120 | 241 |
| 267 | 3300037418 | Ga0395900_0249370 | Ga0395900_0249370_772_1530 | 241 |
| 268 | 3300038443 | Ga0395901_0020917 | Ga0395901_0020917_1260_2018 | 241 |
| 269 | 3300039447 | Ga0436361_0763281 | Ga0436361_0763281_7254_8027 | 241 |
| 270 | 3300046660 | Ga0495625_0054646 | Ga0495625_0054646_704_1486 | 241 |
| 271 | iso_pu_bacteria | 2571042365 | 2572255798 | 241 |
| 272 | 3300028786 | Ga0307517_10002408 | Ga0307517_100024087 | 242 |
| 273 | 3300031616 | Ga0307508_10006263 | Ga0307508_100062634 | 242 |
| 274 | iso_pu_bacteria | 2912963787 | 2912963932 | 242 |
| 275 | iso_pu_bacteria | 2939651529 | 2939656792 | 242 |
| 276 | 3300005445 | Ga0070708_100062109 | Ga0070708_1000621092 | 243 |
| 277 | 3300005467 | Ga0070706_100002204 | Ga0070706_10000220410 | 243 |
| 278 | 3300005468 | Ga0070707_100047358 | Ga0070707_1000473583 | 243 |
| 279 | 3300005518 | Ga0070699_100074489 | Ga0070699_1000744893 | 243 |
| 280 | 3300006178 | Ga0075367_10076049 | Ga0075367_100760491 | 243 |
| 281 | 3300006195 | Ga0075366_10001785 | Ga0075366_100017858 | 243 |
| 282 | 3300006237 | Ga0097621_100572535 | Ga0097621_1005725351 | 243 |
| 283 | 3300025910 | Ga0207684_10045442 | Ga0207684_100454423 | 243 |
| 284 | 3300028654 | Ga0265322_10007930 | Ga0265322_100079304 | 243 |
| 285 | 3300031548 | Ga0307408_100555674 | Ga0307408_1005556741 | 243 |
| 286 | 3300041404 | Ga0439436_0003056 | Ga0439436_0003056_3706_4482 | 243 |
| 287 | 3300042007 | Ga0439449_0031638 | Ga0439449_0031638_1036_1812 | 243 |
| 288 | 3300042435 | Ga0439434_0000294 | Ga0439434_0000294_750_1514 | 243 |
| 289 | 3300042435 | Ga0439434_0009557 | Ga0439434_0009557_98_874 | 243 |
| 290 | 3300042436 | Ga0439435_0000060 | Ga0439435_0000060_11991_12755 | 243 |
| 291 | 3300042876 | Ga0451577_0329272 | Ga0451577_0329272_331_1074 | 243 |
| 292 | 3300044712 | Ga0453684_0258833 | Ga0453684_0258833_1135_1878 | 243 |
| 293 | 3300046457 | Ga0495590_0001807 | Ga0495590_0001807_1426_2190 | 243 |
| 294 | 3300050493 | nmdc:mga0k408_225564_c1 | nmdc:mga0k408_225564_c1_246_1025 | 243 |
| 295 | 3300001979 | JGI24740J21852_10001865 | JGI24740J21852_100018652 | 244 |
| 296 | 3300001989 | JGI24739J22299_10001944 | JGI24739J22299_100019441 | 244 |
| 297 | 3300002067 | JGI24735J21928_10002340 | JGI24735J21928_100023404 | 244 |
| 298 | 3300002705 | JGI25156J39149_1001682 | JGI25156J39149_10016822 | 244 |
| 299 | 3300002705 | JGI25156J39149_1009142 | JGI25156J39149_10091422 | 244 |
| 300 | 3300003214 | JGI25165J46597_1001596 | JGI25165J46597_10015962 | 244 |
| 301 | 3300003756 | Ga0055533_1000232 | Ga0055533_100023234 | 244 |
| 302 | 3300003758 | Ga0055532_1000011 | Ga0055532_1000011216 | 244 |
| 303 | 3300003760 | Ga0055527_1000009 | Ga0055527_1000009215 | 244 |
| 304 | 3300003761 | Ga0055535_1000008 | Ga0055535_1000008153 | 244 |
| 305 | 3300003762 | Ga0055542_1000014 | Ga0055542_1000014153 | 244 |
| 306 | 3300003763 | Ga0055529_1000010 | Ga0055529_1000010153 | 244 |
| 307 | 3300006871 | Ga0075434_100000017 | Ga0075434_10000001759 | 244 |
| 308 | 3300007076 | Ga0075435_100007948 | Ga0075435_1000079483 | 244 |
| 309 | 3300009093 | Ga0105240_10144619 | Ga0105240_101446192 | 244 |
| 310 | 3300013105 | Ga0157369_10021806 | Ga0157369_100218064 | 244 |
| 311 | 3300025226 | Ga0209674_100011 | Ga0209674_100011699 | 244 |
| 312 | 3300025226 | Ga0209674_100093 | Ga0209674_100093103 | 244 |
| 313 | 3300025228 | Ga0209672_100002 | Ga0209672_100002692 | 244 |
| 314 | 3300025229 | Ga0209147_100003 | Ga0209147_100003692 | 244 |
| 315 | 3300025230 | Ga0209563_101409 | Ga0209563_1014095 | 244 |
| 316 | 3300025231 | Ga0207427_102330 | Ga0207427_1023305 | 244 |
| 317 | 3300025242 | Ga0209258_100005 | Ga0209258_100005334 | 244 |
| 318 | 3300025253 | Ga0209677_113567 | Ga0209677_1135671 | 244 |
| 319 | 3300025254 | Ga0209148_1000006 | Ga0209148_1000006692 | 244 |
| 320 | 3300025256 | Ga0209759_1000006 | Ga0209759_1000006306 | 244 |
| 321 | 3300025256 | Ga0209759_1000039 | Ga0209759_100003956 | 244 |
| 322 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018656 | 244 |
| 323 | 3300025272 | Ga0209455_1000003 | Ga0209455_1000003692 | 244 |
| 324 | 3300025904 | Ga0207647_10071271 | Ga0207647_100712712 | 244 |
| 325 | 3300031911 | Ga0307412_10000002 | Ga0307412_1000000248 | 244 |
| 326 | 3300032133 | Ga0316583_10014049 | Ga0316583_100140492 | 244 |
| 327 | 3300035398 | Ga0316574_0091683 | Ga0316574_0091683_668_1411 | 244 |
| 328 | 3300036647 | Ga0316582_0046102 | Ga0316582_0046102_94_840 | 244 |
| 329 | 3300036647 | Ga0316582_0150293 | Ga0316582_0150293_694_1437 | 244 |
| 330 | 3300037588 | Ga0316581_0001652 | Ga0316581_0001652_266_1012 | 244 |
| 331 | 3300046457 | Ga0495590_0039449 | Ga0495590_0039449_83_856 | 244 |
| 332 | 3300046474 | Ga0495605_0103072 | Ga0495605_0103072_235_1008 | 244 |
| 333 | 3300046507 | Ga0495606_0009929 | Ga0495606_0009929_3737_4510 | 244 |
| 334 | 3300046507 | Ga0495606_0175631 | Ga0495606_0175631_139_894 | 244 |
| 335 | 3300046512 | Ga0495610_0000364 | Ga0495610_0000364_11467_12240 | 244 |
| 336 | 3300046515 | Ga0495620_0011969 | Ga0495620_0011969_427_1200 | 244 |
| 337 | 3300046694 | Ga0495649_0004753 | Ga0495649_0004753_1054_1827 | 244 |
| 338 | 3300047323 | Ga0495683_0002007 | Ga0495683_0002007_5651_6424 | 244 |
| 339 | 3300047443 | Ga0495687_003337 | Ga0495687_003337_7898_8671 | 244 |
| 340 | 3300047443 | Ga0495687_054667 | Ga0495687_054667_633_1406 | 244 |
| 341 | 3300048920 | Ga0496117_0065945 | Ga0496117_0065945_417_1190 | 244 |
| 342 | 3300048928 | Ga0496125_0008926 | Ga0496125_0008926_7057_7791 | 244 |
| 343 | iso_pu_bacteria | 2554235231 | 2555245536 | 244 |
| 344 | iso_pu_bacteria | 2765235841 | 2765586606 | 244 |
| 345 | iso_pu_bacteria | 8052494512 | 8052499779 | 244 |
| 346 | iso_pu_bacteria | 8054929484 | 8054931169 | 244 |
| 347 | 3300005329 | Ga0070683_100006705 | Ga0070683_1000067052 | 245 |
| 348 | 3300005329 | Ga0070683_100324701 | Ga0070683_1003247012 | 245 |
| 349 | 3300005344 | Ga0070661_100001057 | Ga0070661_10000105719 | 245 |
| 350 | 3300005345 | Ga0070692_10028839 | Ga0070692_100288392 | 245 |
| 351 | 3300005366 | Ga0070659_100005466 | Ga0070659_1000054662 | 245 |
| 352 | 3300005366 | Ga0070659_100182602 | Ga0070659_1001826022 | 245 |
| 353 | 3300005435 | Ga0070714_100002126 | Ga0070714_10000212610 | 245 |
| 354 | 3300005458 | Ga0070681_10016085 | Ga0070681_100160857 | 245 |
| 355 | 3300005471 | Ga0070698_100013449 | Ga0070698_1000134492 | 245 |
| 356 | 3300005530 | Ga0070679_100180715 | Ga0070679_1001807152 | 245 |
| 357 | 3300005539 | Ga0068853_100021180 | Ga0068853_1000211804 | 245 |
| 358 | 3300005563 | Ga0068855_100008331 | Ga0068855_10000833110 | 245 |
| 359 | 3300005564 | Ga0070664_100016169 | Ga0070664_1000161696 | 245 |
| 360 | 3300005577 | Ga0068857_100003368 | Ga0068857_1000033682 | 245 |
| 361 | 3300005578 | Ga0068854_100023192 | Ga0068854_1000231922 | 245 |
| 362 | 3300005614 | Ga0068856_100002803 | Ga0068856_10000280314 | 245 |
| 363 | 3300005616 | Ga0068852_100006363 | Ga0068852_1000063634 | 245 |
| 364 | 3300005719 | Ga0068861_100000917 | Ga0068861_1000009178 | 245 |
| 365 | 3300006844 | Ga0075428_100004649 | Ga0075428_1000046496 | 245 |
| 366 | 3300006846 | Ga0075430_100040344 | Ga0075430_1000403442 | 245 |
| 367 | 3300006847 | Ga0075431_100009945 | Ga0075431_1000099455 | 245 |
| 368 | 3300006852 | Ga0075433_10522911 | Ga0075433_105229112 | 245 |
| 369 | 3300006880 | Ga0075429_100001537 | Ga0075429_10000153719 | 245 |
| 370 | 3300006914 | Ga0075436_100002716 | Ga0075436_10000271610 | 245 |
| 371 | 3300009093 | Ga0105240_10003948 | Ga0105240_100039484 | 245 |
| 372 | 3300009147 | Ga0114129_10021382 | Ga0114129_100213828 | 245 |
| 373 | 3300009174 | Ga0105241_10099145 | Ga0105241_100991452 | 245 |
| 374 | 3300009545 | Ga0105237_10161966 | Ga0105237_101619662 | 245 |
| 375 | 3300009551 | Ga0105238_10003338 | Ga0105238_100033387 | 245 |
| 376 | 3300013102 | Ga0157371_10080221 | Ga0157371_100802212 | 245 |
| 377 | 3300013104 | Ga0157370_10005802 | Ga0157370_100058026 | 245 |
| 378 | 3300013105 | Ga0157369_10010253 | Ga0157369_100102534 | 245 |
| 379 | 3300013307 | Ga0157372_10017103 | Ga0157372_100171036 | 245 |
| 380 | 3300015683 | Ga0183362_10003 | Ga0183362_10003914 | 245 |
| 381 | 3300025910 | Ga0207684_10004348 | Ga0207684_100043486 | 245 |
| 382 | 3300025913 | Ga0207695_10021676 | Ga0207695_100216763 | 245 |
| 383 | 3300025914 | Ga0207671_10104147 | Ga0207671_101041472 | 245 |
| 384 | 3300025919 | Ga0207657_10017667 | Ga0207657_100176673 | 245 |
| 385 | 3300025920 | Ga0207649_10050514 | Ga0207649_100505142 | 245 |
| 386 | 3300025923 | Ga0207681_10040191 | Ga0207681_100401912 | 245 |
| 387 | 3300025924 | Ga0207694_10006699 | Ga0207694_100066996 | 245 |
| 388 | 3300025929 | Ga0207664_10021689 | Ga0207664_100216892 | 245 |
| 389 | 3300025932 | Ga0207690_10025068 | Ga0207690_100250683 | 245 |
| 390 | 3300025944 | Ga0207661_10221943 | Ga0207661_102219432 | 245 |
| 391 | 3300025949 | Ga0207667_10016473 | Ga0207667_100164734 | 245 |
| 392 | 3300025981 | Ga0207640_10014541 | Ga0207640_100145412 | 245 |
| 393 | 3300026041 | Ga0207639_10031041 | Ga0207639_100310413 | 245 |
| 394 | 3300026078 | Ga0207702_10006444 | Ga0207702_100064446 | 245 |
| 395 | 3300026116 | Ga0207674_10000039 | Ga0207674_1000003947 | 245 |
| 396 | 3300026118 | Ga0207675_100004383 | Ga0207675_1000043839 | 245 |
| 397 | 3300026142 | Ga0207698_10013356 | Ga0207698_100133563 | 245 |
| 398 | 3300031727 | Ga0316576_10002913 | Ga0316576_100029134 | 245 |
| 399 | 3300031911 | Ga0307412_10587633 | Ga0307412_105876332 | 245 |
| 400 | 3300032139 | Ga0316580_10047899 | Ga0316580_100478992 | 245 |
| 401 | 3300035398 | Ga0316574_0126052 | Ga0316574_0126052_397_1143 | 245 |
| 402 | 3300036712 | Ga0316584_0071470 | Ga0316584_0071470_84_836 | 245 |
| 403 | 3300038443 | Ga0395901_0006496 | Ga0395901_0006496_3119_3883 | 245 |
| 404 | 3300038741 | Ga0400488_40734 | Ga0400488_40734_1237_1986 | 245 |
| 405 | 3300042013 | Ga0439456_000104 | Ga0439456_000104_14452_15198 | 245 |
| 406 | 3300042876 | Ga0451577_0359880 | Ga0451577_0359880_229_1023 | 245 |
| 407 | 3300044684 | Ga0466966_0366941 | Ga0466966_0366941_72_833 | 245 |
| 408 | 3300044842 | Ga0466957_0129625 | Ga0466957_0129625_454_1215 | 245 |
| 409 | 3300045051 | Ga0451576_0069652 | Ga0451576_0069652_1188_1958 | 245 |
| 410 | 3300047323 | Ga0495683_0142726 | Ga0495683_0142726_329_1096 | 245 |
| 411 | 3300049570 | Ga0501033_0001295 | Ga0501033_0001295_20774_21532 | 245 |
| 412 | 3300049571 | Ga0501034_0000578 | Ga0501034_0000578_39156_39914 | 245 |
| 413 | 3300049572 | Ga0501036_0073760 | Ga0501036_0073760_1382_2140 | 245 |
| 414 | 3300049573 | Ga0501037_0000731 | Ga0501037_0000731_12086_12844 | 245 |
| 415 | 3300049574 | Ga0501038_0002549 | Ga0501038_0002549_8995_9753 | 245 |
| 416 | 3300049579 | Ga0501043_0001029 | Ga0501043_0001029_20684_21442 | 245 |
| 417 | 3300049581 | Ga0501047_0106731 | Ga0501047_0106731_1897_2655 | 245 |
| 418 | 3300049584 | Ga0501068_0194766 | Ga0501068_0194766_381_1139 | 245 |
| 419 | 3300049742 | Ga0501080_0003928 | Ga0501080_0003928_11920_12678 | 245 |
| 420 | 3300049823 | Ga0501044_0000688 | Ga0501044_0000688_2420_3178 | 245 |
| 421 | 3300050507 | nmdc:mga05p37_6731_c1 | nmdc:mga05p37_6731_c1_5499_6272 | 245 |
| 422 | 3300050508 | nmdc:mga09592_28641_c1 | nmdc:mga09592_28641_c1_117_887 | 245 |
| 423 | 3300050509 | nmdc:mga0qj67_39632_c1 | nmdc:mga0qj67_39632_c1_2286_3056 | 245 |
| 424 | 3300050514 | nmdc:mga08x19_2639_c1 | nmdc:mga08x19_2639_c1_2450_3190 | 245 |
| 425 | 3300050515 | nmdc:mga0a205_123975_c1 | nmdc:mga0a205_123975_c1_850_1590 | 245 |
| 426 | 3300050515 | nmdc:mga0a205_433982_c1 | nmdc:mga0a205_433982_c1_280_1053 | 245 |
| 427 | iso_pu_bacteria | 2554235132 | 2554812822 | 245 |
| 428 | iso_pu_bacteria | 2606217733 | 2608383285 | 245 |
| 429 | iso_pu_bacteria | 2885266251 | 2885267684 | 245 |
| 430 | iso_pu_bacteria | 2904518522 | 2904519296 | 245 |
| 431 | iso_pu_bacteria | 8011350971 | 8011352513 | 245 |
| 432 | 3300002737 | JGI25162J39368_1001279 | JGI25162J39368_10012795 | 246 |
| 433 | 3300002741 | JGI25157J39369_1001321 | JGI25157J39369_10013215 | 246 |
| 434 | 3300002772 | JGI25164J39214_1000716 | JGI25164J39214_100071610 | 246 |
| 435 | 3300003214 | JGI25165J46597_1000335 | JGI25165J46597_100033560 | 246 |
| 436 | 3300005330 | Ga0070690_100081864 | Ga0070690_1000818642 | 246 |
| 437 | 3300005330 | Ga0070690_100129343 | Ga0070690_1001293431 | 246 |
| 438 | 3300005335 | Ga0070666_10157751 | Ga0070666_101577512 | 246 |
| 439 | 3300005353 | Ga0070669_100396902 | Ga0070669_1003969022 | 246 |
| 440 | 3300005366 | Ga0070659_100000764 | Ga0070659_10000076411 | 246 |
| 441 | 3300005366 | Ga0070659_100006279 | Ga0070659_1000062792 | 246 |
| 442 | 3300005366 | Ga0070659_100254299 | Ga0070659_1002542992 | 246 |
| 443 | 3300005435 | Ga0070714_100003909 | Ga0070714_1000039094 | 246 |
| 444 | 3300005438 | Ga0070701_10008863 | Ga0070701_100088634 | 246 |
| 445 | 3300005456 | Ga0070678_100078851 | Ga0070678_1000788512 | 246 |
| 446 | 3300005458 | Ga0070681_10026657 | Ga0070681_100266575 | 246 |
| 447 | 3300005459 | Ga0068867_100010772 | Ga0068867_1000107725 | 246 |
| 448 | 3300005544 | Ga0070686_100099974 | Ga0070686_1000999742 | 246 |
| 449 | 3300005563 | Ga0068855_100016866 | Ga0068855_1000168667 | 246 |
| 450 | 3300005563 | Ga0068855_100185221 | Ga0068855_1001852212 | 246 |
| 451 | 3300005563 | Ga0068855_100587132 | Ga0068855_1005871322 | 246 |
| 452 | 3300005577 | Ga0068857_100177000 | Ga0068857_1001770002 | 246 |
| 453 | 3300005615 | Ga0070702_100098930 | Ga0070702_1000989303 | 246 |
| 454 | 3300005719 | Ga0068861_100004912 | Ga0068861_1000049123 | 246 |
| 455 | 3300005841 | Ga0068863_100111484 | Ga0068863_1001114842 | 246 |
| 456 | 3300006358 | Ga0068871_100161649 | Ga0068871_1001616492 | 246 |
| 457 | 3300006881 | Ga0068865_100001581 | Ga0068865_10000158113 | 246 |
| 458 | 3300006914 | Ga0075436_100048271 | Ga0075436_1000482714 | 246 |
| 459 | 3300007076 | Ga0075435_100206953 | Ga0075435_1002069531 | 246 |
| 460 | 3300009098 | Ga0105245_10455132 | Ga0105245_104551322 | 246 |
| 461 | 3300009176 | Ga0105242_10396610 | Ga0105242_103966102 | 246 |
| 462 | 3300009177 | Ga0105248_10378403 | Ga0105248_103784032 | 246 |
| 463 | 3300009551 | Ga0105238_10045962 | Ga0105238_100459623 | 246 |
| 464 | 3300009551 | Ga0105238_10247396 | Ga0105238_102473962 | 246 |
| 465 | 3300013100 | Ga0157373_10001190 | Ga0157373_1000119017 | 246 |
| 466 | 3300013102 | Ga0157371_10007374 | Ga0157371_100073747 | 246 |
| 467 | 3300013104 | Ga0157370_10000793 | Ga0157370_1000079332 | 246 |
| 468 | 3300013104 | Ga0157370_10001148 | Ga0157370_1000114816 | 246 |
| 469 | 3300013296 | Ga0157374_10117758 | Ga0157374_101177582 | 246 |
| 470 | 3300013306 | Ga0163162_10018531 | Ga0163162_100185311 | 246 |
| 471 | 3300013307 | Ga0157372_10003322 | Ga0157372_100033222 | 246 |
| 472 | 3300013308 | Ga0157375_10004064 | Ga0157375_100040644 | 246 |
| 473 | 3300013308 | Ga0157375_10167475 | Ga0157375_101674752 | 246 |
| 474 | 3300014969 | Ga0157376_10000749 | Ga0157376_1000074916 | 246 |
| 475 | 3300017792 | Ga0163161_10514128 | Ga0163161_105141282 | 246 |
| 476 | 3300025231 | Ga0207427_100178 | Ga0207427_10017873 | 246 |
| 477 | 3300025233 | Ga0209437_100304 | Ga0209437_10030473 | 246 |
| 478 | 3300025261 | Ga0209233_1000287 | Ga0209233_10002875 | 246 |
| 479 | 3300025297 | Ga0209758_1085559 | Ga0209758_10855592 | 246 |
| 480 | 3300025899 | Ga0207642_10032057 | Ga0207642_100320571 | 246 |
| 481 | 3300025899 | Ga0207642_10102127 | Ga0207642_101021272 | 246 |
| 482 | 3300025909 | Ga0207705_10238247 | Ga0207705_102382471 | 246 |
| 483 | 3300025912 | Ga0207707_10003189 | Ga0207707_100031893 | 246 |
| 484 | 3300025917 | Ga0207660_10652275 | Ga0207660_106522751 | 246 |
| 485 | 3300025919 | Ga0207657_10055701 | Ga0207657_100557012 | 246 |
| 486 | 3300025919 | Ga0207657_10247656 | Ga0207657_102476561 | 246 |
| 487 | 3300025921 | Ga0207652_10366994 | Ga0207652_103669942 | 246 |
| 488 | 3300025924 | Ga0207694_10006875 | Ga0207694_100068757 | 246 |
| 489 | 3300025926 | Ga0207659_10308861 | Ga0207659_103088612 | 246 |
| 490 | 3300025932 | Ga0207690_10002850 | Ga0207690_100028505 | 246 |
| 491 | 3300025932 | Ga0207690_10041312 | Ga0207690_100413123 | 246 |
| 492 | 3300025932 | Ga0207690_10109325 | Ga0207690_101093252 | 246 |
| 493 | 3300025934 | Ga0207686_10444501 | Ga0207686_104445012 | 246 |
| 494 | 3300025938 | Ga0207704_10064958 | Ga0207704_100649582 | 246 |
| 495 | 3300025938 | Ga0207704_10189078 | Ga0207704_101890781 | 246 |
| 496 | 3300025942 | Ga0207689_10002136 | Ga0207689_100021364 | 246 |
| 497 | 3300025949 | Ga0207667_10001689 | Ga0207667_100016894 | 246 |
| 498 | 3300025949 | Ga0207667_10141834 | Ga0207667_101418342 | 246 |
| 499 | 3300025972 | Ga0207668_10184148 | Ga0207668_101841482 | 246 |
| 500 | 3300026075 | Ga0207708_10004997 | Ga0207708_100049976 | 246 |
| 501 | 3300026078 | Ga0207702_10137731 | Ga0207702_101377312 | 246 |
| 502 | 3300026088 | Ga0207641_10108372 | Ga0207641_101083722 | 246 |
| 503 | 3300026089 | Ga0207648_10038420 | Ga0207648_100384204 | 246 |
| 504 | 3300026095 | Ga0207676_10046087 | Ga0207676_100460872 | 246 |
| 505 | 3300026116 | Ga0207674_10231818 | Ga0207674_102318182 | 246 |
| 506 | 3300026118 | Ga0207675_100013693 | Ga0207675_1000136937 | 246 |
| 507 | 3300026121 | Ga0207683_10145182 | Ga0207683_101451822 | 246 |
| 508 | 3300026121 | Ga0207683_10190368 | Ga0207683_101903682 | 246 |
| 509 | 3300031240 | Ga0265320_10090829 | Ga0265320_100908292 | 246 |
| 510 | 3300031249 | Ga0265339_10073221 | Ga0265339_100732212 | 246 |
| 511 | 3300031727 | Ga0316576_10013079 | Ga0316576_100130793 | 246 |
| 512 | 3300031728 | Ga0316578_10106809 | Ga0316578_101068093 | 246 |
| 513 | 3300032137 | Ga0316585_10011720 | Ga0316585_100117202 | 246 |
| 514 | 3300035398 | Ga0316574_0000225 | Ga0316574_0000225_15046_15798 | 246 |
| 515 | 3300035398 | Ga0316574_0003552 | Ga0316574_0003552_5524_6288 | 246 |
| 516 | 3300036647 | Ga0316582_0217018 | Ga0316582_0217018_201_953 | 246 |
| 517 | 3300036712 | Ga0316584_0007976 | Ga0316584_0007976_5541_6293 | 246 |
| 518 | 3300037471 | Ga0395905_0003472 | Ga0395905_0003472_1395_2147 | 246 |
| 519 | 3300038742 | Ga0400486_17590 | Ga0400486_17590_1479_2231 | 246 |
| 520 | 3300041452 | Ga0451793_0511053 | Ga0451793_0511053_1110_1886 | 246 |
| 521 | 3300042010 | Ga0439452_023416 | Ga0439452_023416_185_928 | 246 |
| 522 | 3300044712 | Ga0453684_0003587 | Ga0453684_0003587_21849_22601 | 246 |
| 523 | 3300044712 | Ga0453684_0746219 | Ga0453684_0746219_122_877 | 246 |
| 524 | 3300046457 | Ga0495590_0000008 | Ga0495590_0000008_20588_21349 | 246 |
| 525 | 3300046458 | Ga0495591_000043 | Ga0495591_000043_90427_91188 | 246 |
| 526 | 3300046491 | Ga0495584_0000025 | Ga0495584_0000025_20511_21272 | 246 |
| 527 | 3300046492 | Ga0495585_0065670 | Ga0495585_0065670_1096_1857 | 246 |
| 528 | 3300046500 | Ga0495596_0019412 | Ga0495596_0019412_1122_1883 | 246 |
| 529 | 3300046501 | Ga0495607_0009729 | Ga0495607_0009729_1530_2291 | 246 |
| 530 | 3300046506 | Ga0495583_0000512 | Ga0495583_0000512_34073_34834 | 246 |
| 531 | 3300046512 | Ga0495610_0000809 | Ga0495610_0000809_1796_2557 | 246 |
| 532 | 3300046519 | Ga0495632_0010626 | Ga0495632_0010626_3222_3983 | 246 |
| 533 | 3300046520 | Ga0495637_0000009 | Ga0495637_0000009_318986_319747 | 246 |
| 534 | 3300046523 | Ga0495644_0041412 | Ga0495644_0041412_715_1476 | 246 |
| 535 | 3300046528 | Ga0495642_0144332 | Ga0495642_0144332_86_847 | 246 |
| 536 | 3300046537 | Ga0495598_0051159 | Ga0495598_0051159_28_783 | 246 |
| 537 | 3300046538 | Ga0495609_0079327 | Ga0495609_0079327_89_850 | 246 |
| 538 | 3300046558 | Ga0495633_0001467 | Ga0495633_0001467_7205_7966 | 246 |
| 539 | 3300046616 | Ga0495668_0030352 | Ga0495668_0030352_1648_2409 | 246 |
| 540 | 3300046648 | Ga0495611_0000361 | Ga0495611_0000361_10323_11084 | 246 |
| 541 | 3300046665 | Ga0495661_0004554 | Ga0495661_0004554_2642_3403 | 246 |
| 542 | 3300046665 | Ga0495661_0076162 | Ga0495661_0076162_149_910 | 246 |
| 543 | 3300046675 | Ga0495657_0053248 | Ga0495657_0053248_627_1394 | 246 |
| 544 | 3300046681 | Ga0495647_0057608 | Ga0495647_0057608_712_1479 | 246 |
| 545 | 3300046694 | Ga0495649_0000028 | Ga0495649_0000028_121704_122465 | 246 |
| 546 | 3300046810 | Ga0495660_0039201 | Ga0495660_0039201_83_844 | 246 |
| 547 | 3300047320 | Ga0495672_0000055 | Ga0495672_0000055_90379_91140 | 246 |
| 548 | 3300047323 | Ga0495683_0000047 | Ga0495683_0000047_103103_103864 | 246 |
| 549 | 3300047445 | Ga0495677_0000234 | Ga0495677_0000234_8049_8810 | 246 |
| 550 | 3300047470 | Ga0495681_0010188 | Ga0495681_0010188_1450_2211 | 246 |
| 551 | 3300047472 | Ga0495686_0046261 | Ga0495686_0046261_866_1627 | 246 |
| 552 | 3300048907 | Ga0496104_0000057 | Ga0496104_0000057_80714_81481 | 246 |
| 553 | 3300048908 | Ga0496105_0000037 | Ga0496105_0000037_80854_81621 | 246 |
| 554 | 3300048911 | Ga0496108_0022485 | Ga0496108_0022485_3796_4554 | 246 |
| 555 | 3300048912 | Ga0496109_0020897 | Ga0496109_0020897_2327_3085 | 246 |
| 556 | 3300048915 | Ga0496112_0061620 | Ga0496112_0061620_702_1460 | 246 |
| 557 | 3300049459 | Ga0495678_000025 | Ga0495678_000025_91257_92018 | 246 |
| 558 | 3300049460 | Ga0495682_0018505 | Ga0495682_0018505_413_1174 | 246 |
| 559 | 3300049580 | Ga0501046_0224792 | Ga0501046_0224792_457_1233 | 246 |
| 560 | iso_pu_bacteria | 2511231024 | 2511377438 | 246 |
| 561 | 3300005347 | Ga0070668_100096777 | Ga0070668_1000967771 | 247 |
| 562 | 3300005456 | Ga0070678_100043287 | Ga0070678_1000432871 | 247 |
| 563 | 3300005458 | Ga0070681_10104560 | Ga0070681_101045602 | 247 |
| 564 | 3300005543 | Ga0070672_100183856 | Ga0070672_1001838562 | 247 |
| 565 | 3300005546 | Ga0070696_100230408 | Ga0070696_1002304082 | 247 |
| 566 | 3300005841 | Ga0068863_100017730 | Ga0068863_1000177303 | 247 |
| 567 | 3300005844 | Ga0068862_100094296 | Ga0068862_1000942963 | 247 |
| 568 | 3300006944 | Ga0099823_1054043 | Ga0099823_10540432 | 247 |
| 569 | 3300007076 | Ga0075435_100173911 | Ga0075435_1001739112 | 247 |
| 570 | 3300009011 | Ga0105251_10000535 | Ga0105251_1000053512 | 247 |
| 571 | 3300009174 | Ga0105241_10357678 | Ga0105241_103576782 | 247 |
| 572 | 3300009551 | Ga0105238_10140446 | Ga0105238_101404463 | 247 |
| 573 | 3300013104 | Ga0157370_10113103 | Ga0157370_101131032 | 247 |
| 574 | 3300013307 | Ga0157372_10019438 | Ga0157372_100194383 | 247 |
| 575 | 3300025292 | Ga0209676_1000510 | Ga0209676_100051056 | 247 |
| 576 | 3300025711 | Ga0207696_1004029 | Ga0207696_10040292 | 247 |
| 577 | 3300025735 | Ga0207713_1000645 | Ga0207713_100064510 | 247 |
| 578 | 3300025735 | Ga0207713_1005141 | Ga0207713_10051413 | 247 |
| 579 | 3300025898 | Ga0207692_10066922 | Ga0207692_100669221 | 247 |
| 580 | 3300025929 | Ga0207664_10122269 | Ga0207664_101222692 | 247 |
| 581 | 3300025935 | Ga0207709_10079700 | Ga0207709_100797002 | 247 |
| 582 | 3300025940 | Ga0207691_10019512 | Ga0207691_100195128 | 247 |
| 583 | 3300026088 | Ga0207641_10172380 | Ga0207641_101723802 | 247 |
| 584 | 3300026121 | Ga0207683_10341837 | Ga0207683_103418372 | 247 |
| 585 | 3300027296 | Ga0209389_1061539 | Ga0209389_10615392 | 247 |
| 586 | 3300027462 | Ga0210000_1007935 | Ga0210000_10079353 | 247 |
| 587 | 3300027543 | Ga0209999_1049948 | Ga0209999_10499481 | 247 |
| 588 | 3300028380 | Ga0268265_10149376 | Ga0268265_101493761 | 247 |
| 589 | 3300031548 | Ga0307408_100184017 | Ga0307408_1001840172 | 247 |
| 590 | 3300031665 | Ga0316575_10070842 | Ga0316575_100708422 | 247 |
| 591 | 3300031665 | Ga0316575_10083207 | Ga0316575_100832072 | 247 |
| 592 | 3300031691 | Ga0316579_10009237 | Ga0316579_100092373 | 247 |
| 593 | 3300031691 | Ga0316579_10050038 | Ga0316579_100500382 | 247 |
| 594 | 3300031691 | Ga0316579_10171275 | Ga0316579_101712752 | 247 |
| 595 | 3300031727 | Ga0316576_10125768 | Ga0316576_101257682 | 247 |
| 596 | 3300031727 | Ga0316576_10180663 | Ga0316576_101806632 | 247 |
| 597 | 3300031728 | Ga0316578_10032042 | Ga0316578_100320423 | 247 |
| 598 | 3300031728 | Ga0316578_10254800 | Ga0316578_102548002 | 247 |
| 599 | 3300031733 | Ga0316577_10004863 | Ga0316577_100048635 | 247 |
| 600 | 3300032133 | Ga0316583_10016175 | Ga0316583_100161752 | 247 |
| 601 | 3300032133 | Ga0316583_10021236 | Ga0316583_100212362 | 247 |
| 602 | 3300032133 | Ga0316583_10043530 | Ga0316583_100435302 | 247 |
| 603 | 3300032133 | Ga0316583_10094751 | Ga0316583_100947511 | 247 |
| 604 | 3300032133 | Ga0316583_10099391 | Ga0316583_100993912 | 247 |
| 605 | 3300032137 | Ga0316585_10117627 | Ga0316585_101176271 | 247 |
| 606 | 3300032137 | Ga0316585_10135490 | Ga0316585_101354901 | 247 |
| 607 | 3300032139 | Ga0316580_10044320 | Ga0316580_100443202 | 247 |
| 608 | 3300032168 | Ga0316593_10068839 | Ga0316593_100688392 | 247 |
| 609 | 3300033524 | Ga0316592_1006013 | Ga0316592_10060132 | 247 |
| 610 | 3300033527 | Ga0316586_1006816 | Ga0316586_10068162 | 247 |
| 611 | 3300033527 | Ga0316586_1007859 | Ga0316586_10078591 | 247 |
| 612 | 3300033528 | Ga0316588_1020477 | Ga0316588_10204771 | 247 |
| 613 | 3300033528 | Ga0316588_1027539 | Ga0316588_10275392 | 247 |
| 614 | 3300033529 | Ga0316587_1000057 | Ga0316587_10000574 | 247 |
| 615 | 3300033529 | Ga0316587_1024685 | Ga0316587_10246852 | 247 |
| 616 | 3300035398 | Ga0316574_0009834 | Ga0316574_0009834_1428_2186 | 247 |
| 617 | 3300035398 | Ga0316574_0062328 | Ga0316574_0062328_530_1291 | 247 |
| 618 | 3300035398 | Ga0316574_0236375 | Ga0316574_0236375_91_846 | 247 |
| 619 | 3300036647 | Ga0316582_0017225 | Ga0316582_0017225_328_1089 | 247 |
| 620 | 3300036647 | Ga0316582_0024606 | Ga0316582_0024606_2349_3107 | 247 |
| 621 | 3300036647 | Ga0316582_0086998 | Ga0316582_0086998_47_802 | 247 |
| 622 | 3300036712 | Ga0316584_0017393 | Ga0316584_0017393_2440_3201 | 247 |
| 623 | 3300037471 | Ga0395905_0000138 | Ga0395905_0000138_77391_78149 | 247 |
| 624 | 3300037588 | Ga0316581_0031622 | Ga0316581_0031622_16_774 | 247 |
| 625 | 3300037588 | Ga0316581_0059572 | Ga0316581_0059572_127_882 | 247 |
| 626 | 3300042438 | Ga0439459_0002959 | Ga0439459_0002959_46_834 | 247 |
| 627 | 3300042876 | Ga0451577_0004145 | Ga0451577_0004145_5215_5997 | 247 |
| 628 | 3300044658 | Ga0466972_0175521 | Ga0466972_0175521_225_992 | 247 |
| 629 | 3300044712 | Ga0453684_0000039 | Ga0453684_0000039_559319_560104 | 247 |
| 630 | 3300046457 | Ga0495590_0000564 | Ga0495590_0000564_14561_15334 | 247 |
| 631 | 3300046460 | Ga0495638_0000142 | Ga0495638_0000142_50922_51704 | 247 |
| 632 | 3300046460 | Ga0495638_0015524 | Ga0495638_0015524_2323_3096 | 247 |
| 633 | 3300046474 | Ga0495605_0017063 | Ga0495605_0017063_560_1333 | 247 |
| 634 | 3300046491 | Ga0495584_0200006 | Ga0495584_0200006_182_940 | 247 |
| 635 | 3300046506 | Ga0495583_0009872 | Ga0495583_0009872_2038_2811 | 247 |
| 636 | 3300046513 | Ga0495616_0092297 | Ga0495616_0092297_645_1418 | 247 |
| 637 | 3300046518 | Ga0495631_0000113 | Ga0495631_0000113_25583_26356 | 247 |
| 638 | 3300046519 | Ga0495632_0025004 | Ga0495632_0025004_259_1032 | 247 |
| 639 | 3300046520 | Ga0495637_0037169 | Ga0495637_0037169_58_831 | 247 |
| 640 | 3300046524 | Ga0495648_0000856 | Ga0495648_0000856_2194_2967 | 247 |
| 641 | 3300046524 | Ga0495648_0001462 | Ga0495648_0001462_641_1414 | 247 |
| 642 | 3300046558 | Ga0495633_0008090 | Ga0495633_0008090_3004_3777 | 247 |
| 643 | 3300046615 | Ga0495656_0035858 | Ga0495656_0035858_912_1688 | 247 |
| 644 | 3300046616 | Ga0495668_0078425 | Ga0495668_0078425_786_1559 | 247 |
| 645 | 3300046660 | Ga0495625_0050710 | Ga0495625_0050710_748_1521 | 247 |
| 646 | 3300046665 | Ga0495661_0037601 | Ga0495661_0037601_2194_2967 | 247 |
| 647 | 3300046665 | Ga0495661_0045031 | Ga0495661_0045031_1142_1915 | 247 |
| 648 | 3300047447 | Ga0495685_001131 | Ga0495685_001131_4496_5269 | 247 |
| 649 | 3300048091 | Ga0495626_0015187 | Ga0495626_0015187_2690_3463 | 247 |
| 650 | 3300049459 | Ga0495678_000041 | Ga0495678_000041_111429_112202 | 247 |
| 651 | 3300049570 | Ga0501033_0001924 | Ga0501033_0001924_8341_9171 | 247 |
| 652 | 3300049572 | Ga0501036_0011700 | Ga0501036_0011700_163_1041 | 247 |
| 653 | 3300049573 | Ga0501037_0196298 | Ga0501037_0196298_229_1059 | 247 |
| 654 | 3300049574 | Ga0501038_0108162 | Ga0501038_0108162_25_855 | 247 |
| 655 | 3300049579 | Ga0501043_0000425 | Ga0501043_0000425_1193_1960 | 247 |
| 656 | 3300049579 | Ga0501043_0002650 | Ga0501043_0002650_3232_4110 | 247 |
| 657 | 3300049580 | Ga0501046_0023253 | Ga0501046_0023253_1193_1960 | 247 |
| 658 | 3300049580 | Ga0501046_0135565 | Ga0501046_0135565_119_949 | 247 |
| 659 | 3300049581 | Ga0501047_0030244 | Ga0501047_0030244_1181_1948 | 247 |
| 660 | 3300049822 | Ga0501035_0015479 | Ga0501035_0015479_3530_4399 | 247 |
| 661 | 3300049822 | Ga0501035_0039070 | Ga0501035_0039070_1468_2346 | 247 |
| 662 | 3300049823 | Ga0501044_0000353 | Ga0501044_0000353_38492_39370 | 247 |
| 663 | 3300049823 | Ga0501044_0264296 | Ga0501044_0264296_200_982 | 247 |
| 664 | iso_pu_bacteria | 2508501125 | 2509129637 | 247 |
| 665 | iso_pu_bacteria | 2510065045 | 2510249179 | 247 |
| 666 | iso_pu_bacteria | 2512047030 | 2512352347 | 247 |
| 667 | iso_pu_bacteria | 2513237150 | 2513955863 | 247 |
| 668 | iso_pu_bacteria | 2513237151 | 2513958738 | 247 |
| 669 | iso_pu_bacteria | 2513237165 | 2514045658 | 247 |
| 670 | iso_pu_bacteria | 2513237166 | 2514047701 | 247 |
| 671 | iso_pu_bacteria | 2515154122 | 2515680538 | 247 |
| 672 | iso_pu_bacteria | 2526164713 | 2527076041 | 247 |
| 673 | iso_pu_bacteria | 2562617112 | 2563063421 | 247 |
| 674 | iso_pu_bacteria | 2599185239 | 2599739816 | 247 |
| 675 | iso_pu_bacteria | 2600255067 | 2600814175 | 247 |
| 676 | iso_pu_bacteria | 2711768613 | 2713474296 | 247 |
| 677 | iso_pu_bacteria | 2718217991 | 2719642412 | 247 |
| 678 | iso_pu_bacteria | 2738541296 | 2738820342 | 247 |
| 679 | iso_pu_bacteria | 2738541298 | 2738832822 | 247 |
| 680 | iso_pu_bacteria | 2738541306 | 2738874349 | 247 |
| 681 | iso_pu_bacteria | 2738543002 | 2739185979 | 247 |
| 682 | iso_pu_bacteria | 2738543008 | 2739220947 | 247 |
| 683 | iso_pu_bacteria | 2744054900 | 2746090604 | 247 |
| 684 | iso_pu_bacteria | 2744054901 | 2746099098 | 247 |
| 685 | iso_pu_bacteria | 2751185846 | 2753570711 | 247 |
| 686 | iso_pu_bacteria | 2791355137 | 2792840968 | 247 |
| 687 | iso_pu_bacteria | 2818991450 | 2819620633 | 247 |
| 688 | iso_pu_bacteria | 2818991452 | 2819636429 | 247 |
| 689 | iso_pu_bacteria | 2842324504 | 2842329352 | 247 |
| 690 | iso_pu_bacteria | 2842348783 | 2842354549 | 247 |
| 691 | iso_pu_bacteria | 2842454564 | 2842456436 | 247 |
| 692 | iso_pu_bacteria | 2857357740 | 2857357903 | 247 |
| 693 | iso_pu_bacteria | 2858688981 | 2858699015 | 247 |
| 694 | iso_pu_bacteria | 2863421361 | 2863424256 | 247 |
| 695 | iso_pu_bacteria | 2885192300 | 2885196664 | 247 |
| 696 | iso_pu_bacteria | 2885270888 | 2885277442 | 247 |
| 697 | iso_pu_bacteria | 2900634093 | 2900640641 | 247 |
| 698 | iso_pu_bacteria | 2902682994 | 2902687729 | 247 |
| 699 | iso_pu_bacteria | 2904483920 | 2904486444 | 247 |
| 700 | iso_pu_bacteria | 2904615490 | 2904622357 | 247 |
| 701 | iso_pu_bacteria | 2919527303 | 2919527789 | 247 |
| 702 | iso_pu_bacteria | 2928108538 | 2928108765 | 247 |
| 703 | iso_pu_bacteria | 2928135762 | 2928135989 | 247 |
| 704 | iso_pu_bacteria | 2928157003 | 2928158481 | 247 |
| 705 | iso_pu_bacteria | 2928170801 | 2928174705 | 247 |
| 706 | iso_pu_bacteria | 2928503688 | 2928504245 | 247 |
| 707 | iso_pu_bacteria | 2945934425 | 2945938877 | 247 |
| 708 | iso_pu_bacteria | 2981990288 | 2981991948 | 247 |
| 709 | iso_pu_bacteria | 2990703756 | 2990708877 | 247 |
| 710 | iso_pu_bacteria | 641736151 | 642421024 | 247 |
| 711 | iso_pu_bacteria | 642555112 | 642596853 | 247 |
| 712 | iso_pu_bacteria | 642555113 | 642616727 | 247 |
| 713 | iso_pu_bacteria | 644736347 | 644748576 | 247 |
| 714 | iso_pu_bacteria | 8003400568 | 8003404375 | 247 |
| 715 | iso_pu_bacteria | 8018845410 | 8018852712 | 247 |
| 716 | iso_pu_bacteria | 8020938398 | 8020942892 | 247 |
| 717 | iso_pu_bacteria | 8020945358 | 8020953222 | 247 |
| 718 | iso_pu_bacteria | 8020953355 | 8020959572 | 247 |
| 719 | iso_pu_bacteria | 8055301274 | 8055304442 | 247 |
| 720 | 3300005334 | Ga0068869_100091614 | Ga0068869_1000916142 | 248 |
| 721 | 3300005347 | Ga0070668_100042413 | Ga0070668_1000424131 | 248 |
| 722 | 3300005441 | Ga0070700_100012720 | Ga0070700_1000127201 | 248 |
| 723 | 3300005459 | Ga0068867_100000291 | Ga0068867_10000029120 | 248 |
| 724 | 3300005617 | Ga0068859_100145483 | Ga0068859_1001454832 | 248 |
| 725 | 3300005718 | Ga0068866_10010197 | Ga0068866_100101974 | 248 |
| 726 | 3300005719 | Ga0068861_100000224 | Ga0068861_10000022429 | 248 |
| 727 | 3300005843 | Ga0068860_100001311 | Ga0068860_1000013119 | 248 |
| 728 | 3300006881 | Ga0068865_100003985 | Ga0068865_1000039859 | 248 |
| 729 | 3300006931 | Ga0097620_100145492 | Ga0097620_1001454922 | 248 |
| 730 | 3300006944 | Ga0099823_1009149 | Ga0099823_10091494 | 248 |
| 731 | 3300009147 | Ga0114129_11225673 | Ga0114129_112256732 | 248 |
| 732 | 3300011119 | Ga0105246_10101503 | Ga0105246_101015032 | 248 |
| 733 | 3300013104 | Ga0157370_10001426 | Ga0157370_100014267 | 248 |
| 734 | 3300013297 | Ga0157378_10027353 | Ga0157378_100273535 | 248 |
| 735 | 3300013306 | Ga0163162_10039730 | Ga0163162_100397303 | 248 |
| 736 | 3300025728 | Ga0207655_1000929 | Ga0207655_100092916 | 248 |
| 737 | 3300025899 | Ga0207642_10009346 | Ga0207642_100093465 | 248 |
| 738 | 3300025938 | Ga0207704_10001999 | Ga0207704_100019994 | 248 |
| 739 | 3300025940 | Ga0207691_10012480 | Ga0207691_100124804 | 248 |
| 740 | 3300025942 | Ga0207689_10035448 | Ga0207689_100354484 | 248 |
| 741 | 3300026075 | Ga0207708_10022743 | Ga0207708_100227436 | 248 |
| 742 | 3300026089 | Ga0207648_10000182 | Ga0207648_1000018253 | 248 |
| 743 | 3300026118 | Ga0207675_100000551 | Ga0207675_10000055132 | 248 |
| 744 | 3300027296 | Ga0209389_1000049 | Ga0209389_100004977 | 248 |
| 745 | 3300028381 | Ga0268264_10002391 | Ga0268264_100023914 | 248 |
| 746 | 3300046558 | Ga0495633_0013815 | Ga0495633_0013815_235_1002 | 248 |
| 747 | 3300046694 | Ga0495649_0004750 | Ga0495649_0004750_2254_3021 | 248 |
| 748 | 3300047472 | Ga0495686_0003031 | Ga0495686_0003031_10301_11074 | 248 |
| 749 | 3300048912 | Ga0496109_0156332 | Ga0496109_0156332_204_965 | 248 |
| 750 | 3300048926 | Ga0496123_0041920 | Ga0496123_0041920_2193_2948 | 248 |
| 751 | 3300048927 | Ga0496124_0001295 | Ga0496124_0001295_24873_25628 | 248 |
| 752 | 3300048928 | Ga0496125_0018966 | Ga0496125_0018966_1453_2208 | 248 |
| 753 | 3300049571 | Ga0501034_0000056 | Ga0501034_0000056_99151_99909 | 248 |
| 754 | 3300049593 | Ga0501077_0111073 | Ga0501077_0111073_301_1107 | 248 |
| 755 | 3300049822 | Ga0501035_0347314 | Ga0501035_0347314_399_1205 | 248 |
| 756 | iso_pu_bacteria | 2596583598 | 2597029091 | 248 |
| 757 | iso_pu_bacteria | 2599185178 | 2599445708 | 248 |
| 758 | 3300001979 | JGI24740J21852_10003113 | JGI24740J21852_100031138 | 249 |
| 759 | 3300002705 | JGI25156J39149_1011294 | JGI25156J39149_10112942 | 249 |
| 760 | 3300002738 | JGI25154J39366_1002536 | JGI25154J39366_10025364 | 249 |
| 761 | 3300003756 | Ga0055533_1007945 | Ga0055533_10079451 | 249 |
| 762 | 3300003762 | Ga0055542_1001112 | Ga0055542_10011122 | 249 |
| 763 | 3300003841 | Ga0055541_1000608 | Ga0055541_10006085 | 249 |
| 764 | 3300005366 | Ga0070659_100005447 | Ga0070659_1000054472 | 249 |
| 765 | 3300005616 | Ga0068852_100032440 | Ga0068852_1000324402 | 249 |
| 766 | 3300005616 | Ga0068852_100555327 | Ga0068852_1005553272 | 249 |
| 767 | 3300005617 | Ga0068859_100434549 | Ga0068859_1004345492 | 249 |
| 768 | 3300005618 | Ga0068864_100487944 | Ga0068864_1004879442 | 249 |
| 769 | 3300005841 | Ga0068863_100173214 | Ga0068863_1001732142 | 249 |
| 770 | 3300005842 | Ga0068858_100210712 | Ga0068858_1002107122 | 249 |
| 771 | 3300005844 | Ga0068862_100017386 | Ga0068862_1000173863 | 249 |
| 772 | 3300006931 | Ga0097620_100434516 | Ga0097620_1004345162 | 249 |
| 773 | 3300009011 | Ga0105251_10073933 | Ga0105251_100739332 | 249 |
| 774 | 3300009036 | Ga0105244_10019804 | Ga0105244_100198043 | 249 |
| 775 | 3300009092 | Ga0105250_10010698 | Ga0105250_100106983 | 249 |
| 776 | 3300009094 | Ga0111539_10506858 | Ga0111539_105068582 | 249 |
| 777 | 3300009101 | Ga0105247_10343731 | Ga0105247_103437312 | 249 |
| 778 | 3300009148 | Ga0105243_10130720 | Ga0105243_101307202 | 249 |
| 779 | 3300009177 | Ga0105248_10010268 | Ga0105248_100102682 | 249 |
| 780 | 3300009177 | Ga0105248_10281918 | Ga0105248_102819182 | 249 |
| 781 | 3300015261 | Ga0182006_1045425 | Ga0182006_10454252 | 249 |
| 782 | 3300025224 | Ga0209784_100778 | Ga0209784_1007784 | 249 |
| 783 | 3300025225 | Ga0209566_100519 | Ga0209566_10051910 | 249 |
| 784 | 3300025226 | Ga0209674_100384 | Ga0209674_1003845 | 249 |
| 785 | 3300025230 | Ga0209563_116549 | Ga0209563_1165491 | 249 |
| 786 | 3300025246 | Ga0209646_1000022 | Ga0209646_100002241 | 249 |
| 787 | 3300025250 | Ga0209026_1002986 | Ga0209026_10029862 | 249 |
| 788 | 3300025253 | Ga0209677_102011 | Ga0209677_1020112 | 249 |
| 789 | 3300025254 | Ga0209148_1000158 | Ga0209148_1000158118 | 249 |
| 790 | 3300025256 | Ga0209759_1014699 | Ga0209759_10146992 | 249 |
| 791 | 3300025904 | Ga0207647_10271800 | Ga0207647_102718002 | 249 |
| 792 | 3300025931 | Ga0207644_10050002 | Ga0207644_100500021 | 249 |
| 793 | 3300025932 | Ga0207690_10005091 | Ga0207690_100050912 | 249 |
| 794 | 3300025941 | Ga0207711_10033488 | Ga0207711_100334884 | 249 |
| 795 | 3300025942 | Ga0207689_10542224 | Ga0207689_105422242 | 249 |
| 796 | 3300026088 | Ga0207641_10114442 | Ga0207641_101144421 | 249 |
| 797 | 3300026095 | Ga0207676_10078051 | Ga0207676_100780512 | 249 |
| 798 | 3300028380 | Ga0268265_10236792 | Ga0268265_102367922 | 249 |
| 799 | 3300028380 | Ga0268265_10493721 | Ga0268265_104937212 | 249 |
| 800 | 3300028794 | Ga0307515_10000064 | Ga0307515_100000641 | 249 |
| 801 | 3300031456 | Ga0307513_10114676 | Ga0307513_101146762 | 249 |
| 802 | 3300042006 | Ga0439432_000932 | Ga0439432_000932_1936_2694 | 249 |
| 803 | 3300042136 | Ga0450900_001178 | Ga0450900_001178_1390_2148 | 249 |
| 804 | 3300042142 | Ga0450905_000527 | Ga0450905_000527_710_1468 | 249 |
| 805 | 3300042876 | Ga0451577_0004111 | Ga0451577_0004111_2091_2855 | 249 |
| 806 | 3300042876 | Ga0451577_0270863 | Ga0451577_0270863_182_946 | 249 |
| 807 | 3300044656 | Ga0466969_0032581 | Ga0466969_0032581_1444_2193 | 249 |
| 808 | 3300044658 | Ga0466972_0013727 | Ga0466972_0013727_3229_3978 | 249 |
| 809 | 3300044671 | Ga0466978_0021228 | Ga0466978_0021228_2791_3540 | 249 |
| 810 | 3300044672 | Ga0466982_0194935 | Ga0466982_0194935_293_1042 | 249 |
| 811 | 3300044673 | Ga0453683_0005236 | Ga0453683_0005236_6740_7519 | 249 |
| 812 | 3300044693 | Ga0466961_0002119 | Ga0466961_0002119_5317_6066 | 249 |
| 813 | 3300044694 | Ga0466963_0133434 | Ga0466963_0133434_420_1169 | 249 |
| 814 | 3300044706 | Ga0466964_0011262 | Ga0466964_0011262_1224_1973 | 249 |
| 815 | 3300044712 | Ga0453684_0023208 | Ga0453684_0023208_3150_3914 | 249 |
| 816 | 3300044735 | Ga0466968_0139078 | Ga0466968_0139078_296_1045 | 249 |
| 817 | 3300044842 | Ga0466957_0066210 | Ga0466957_0066210_419_1168 | 249 |
| 818 | 3300045049 | Ga0466959_0000328 | Ga0466959_0000328_2857_3606 | 249 |
| 819 | 3300045051 | Ga0451576_0497406 | Ga0451576_0497406_491_1255 | 249 |
| 820 | 3300045976 | Ga0466967_0041666 | Ga0466967_0041666_1753_2502 | 249 |
| 821 | 3300046491 | Ga0495584_0002329 | Ga0495584_0002329_3672_4454 | 249 |
| 822 | 3300046492 | Ga0495585_0002313 | Ga0495585_0002313_12528_13298 | 249 |
| 823 | 3300046492 | Ga0495585_0010392 | Ga0495585_0010392_3402_4184 | 249 |
| 824 | 3300046500 | Ga0495596_0002354 | Ga0495596_0002354_3876_4658 | 249 |
| 825 | 3300046506 | Ga0495583_0000160 | Ga0495583_0000160_17943_18725 | 249 |
| 826 | 3300046513 | Ga0495616_0022287 | Ga0495616_0022287_303_1085 | 249 |
| 827 | 3300046518 | Ga0495631_0033090 | Ga0495631_0033090_73_855 | 249 |
| 828 | 3300046523 | Ga0495644_0002495 | Ga0495644_0002495_6198_6980 | 249 |
| 829 | 3300046526 | Ga0495666_0007370 | Ga0495666_0007370_1881_2651 | 249 |
| 830 | 3300046558 | Ga0495633_0015441 | Ga0495633_0015441_1472_2254 | 249 |
| 831 | 3300046616 | Ga0495668_0021800 | Ga0495668_0021800_157_939 | 249 |
| 832 | 3300046648 | Ga0495611_0002708 | Ga0495611_0002708_2983_3765 | 249 |
| 833 | 3300046665 | Ga0495661_0000725 | Ga0495661_0000725_28027_28797 | 249 |
| 834 | 3300046665 | Ga0495661_0009821 | Ga0495661_0009821_3408_4190 | 249 |
| 835 | 3300046691 | Ga0495670_0000977 | Ga0495670_0000977_12714_13484 | 249 |
| 836 | 3300046794 | Ga0495589_0003956 | Ga0495589_0003956_3298_4080 | 249 |
| 837 | 3300047323 | Ga0495683_0008170 | Ga0495683_0008170_1679_2461 | 249 |
| 838 | 3300047445 | Ga0495677_0000105 | Ga0495677_0000105_5692_6474 | 249 |
| 839 | 3300047446 | Ga0495679_005087 | Ga0495679_005087_549_1331 | 249 |
| 840 | 3300047470 | Ga0495681_0001995 | Ga0495681_0001995_3198_3968 | 249 |
| 841 | 3300048091 | Ga0495626_0003089 | Ga0495626_0003089_4415_5197 | 249 |
| 842 | 3300048911 | Ga0496108_0066056 | Ga0496108_0066056_114_875 | 249 |
| 843 | 3300048915 | Ga0496112_0013244 | Ga0496112_0013244_293_1054 | 249 |
| 844 | 3300048917 | Ga0496114_0010230 | Ga0496114_0010230_30_788 | 249 |
| 845 | 3300048927 | Ga0496124_0062550 | Ga0496124_0062550_1554_2312 | 249 |
| 846 | 3300049568 | Ga0501031_0039495 | Ga0501031_0039495_1797_2570 | 249 |
| 847 | 3300049569 | Ga0501032_0004457 | Ga0501032_0004457_6885_7658 | 249 |
| 848 | 3300049570 | Ga0501033_0375130 | Ga0501033_0375130_133_921 | 249 |
| 849 | 3300049571 | Ga0501034_0000101 | Ga0501034_0000101_119430_120188 | 249 |
| 850 | 3300049574 | Ga0501038_0018992 | Ga0501038_0018992_3745_4518 | 249 |
| 851 | 3300049823 | Ga0501044_0166430 | Ga0501044_0166430_684_1472 | 249 |
| 852 | 3300053135 | Ga0500659_0002495 | Ga0500659_0002495_4061_4819 | 249 |
| 853 | 3300061719 | Ga0466962_0034846 | Ga0466962_0034846_366_1115 | 249 |
| 854 | 3300003187 | JGI25151J46595_10003421 | JGI25151J46595_100034217 | 250 |
| 855 | 3300003187 | JGI25151J46595_10010145 | JGI25151J46595_100101452 | 250 |
| 856 | 3300003771 | Ga0055526_1003201 | Ga0055526_10032014 | 250 |
| 857 | 3300003771 | Ga0055526_1003737 | Ga0055526_10037372 | 250 |
| 858 | 3300003771 | Ga0055526_1007580 | Ga0055526_10075802 | 250 |
| 859 | 3300003771 | Ga0055526_1019863 | Ga0055526_10198631 | 250 |
| 860 | 3300003773 | Ga0055537_1008344 | Ga0055537_10083442 | 250 |
| 861 | 3300003775 | Ga0055524_1000290 | Ga0055524_10002908 | 250 |
| 862 | 3300003775 | Ga0055524_1001717 | Ga0055524_10017178 | 250 |
| 863 | 3300003781 | Ga0055536_1000074 | Ga0055536_100007467 | 250 |
| 864 | 3300003784 | Ga0055534_1000761 | Ga0055534_100076112 | 250 |
| 865 | 3300003784 | Ga0055534_1003807 | Ga0055534_10038072 | 250 |
| 866 | 3300005289 | Ga0065704_10082103 | Ga0065704_100821034 | 250 |
| 867 | 3300005295 | Ga0065707_10091191 | Ga0065707_100911913 | 250 |
| 868 | 3300005328 | Ga0070676_10170965 | Ga0070676_101709651 | 250 |
| 869 | 3300005334 | Ga0068869_100165480 | Ga0068869_1001654802 | 250 |
| 870 | 3300005338 | Ga0068868_100009165 | Ga0068868_1000091655 | 250 |
| 871 | 3300005355 | Ga0070671_100022023 | Ga0070671_1000220235 | 250 |
| 872 | 3300005355 | Ga0070671_100104434 | Ga0070671_1001044342 | 250 |
| 873 | 3300005367 | Ga0070667_100070375 | Ga0070667_1000703752 | 250 |
| 874 | 3300005441 | Ga0070700_100117399 | Ga0070700_1001173992 | 250 |
| 875 | 3300005456 | Ga0070678_100307853 | Ga0070678_1003078532 | 250 |
| 876 | 3300005539 | Ga0068853_100496768 | Ga0068853_1004967682 | 250 |
| 877 | 3300005548 | Ga0070665_100054489 | Ga0070665_1000544892 | 250 |
| 878 | 3300005578 | Ga0068854_100035415 | Ga0068854_1000354153 | 250 |
| 879 | 3300005617 | Ga0068859_100191621 | Ga0068859_1001916212 | 250 |
| 880 | 3300005618 | Ga0068864_100039632 | Ga0068864_1000396324 | 250 |
| 881 | 3300005843 | Ga0068860_100044758 | Ga0068860_1000447582 | 250 |
| 882 | 3300006038 | Ga0075365_10156982 | Ga0075365_101569821 | 250 |
| 883 | 3300006042 | Ga0075368_10071645 | Ga0075368_100716452 | 250 |
| 884 | 3300006048 | Ga0075363_100026916 | Ga0075363_1000269163 | 250 |
| 885 | 3300006048 | Ga0075363_100087501 | Ga0075363_1000875012 | 250 |
| 886 | 3300006178 | Ga0075367_10269397 | Ga0075367_102693972 | 250 |
| 887 | 3300006195 | Ga0075366_10169780 | Ga0075366_101697802 | 250 |
| 888 | 3300006195 | Ga0075366_10232807 | Ga0075366_102328072 | 250 |
| 889 | 3300006353 | Ga0075370_10003699 | Ga0075370_100036996 | 250 |
| 890 | 3300006353 | Ga0075370_10137923 | Ga0075370_101379232 | 250 |
| 891 | 3300006358 | Ga0068871_100460791 | Ga0068871_1004607912 | 250 |
| 892 | 3300006931 | Ga0097620_100191627 | Ga0097620_1001916272 | 250 |
| 893 | 3300009036 | Ga0105244_10002031 | Ga0105244_100020314 | 250 |
| 894 | 3300009098 | Ga0105245_10027174 | Ga0105245_100271745 | 250 |
| 895 | 3300009098 | Ga0105245_10254667 | Ga0105245_102546672 | 250 |
| 896 | 3300009545 | Ga0105237_10004557 | Ga0105237_100045576 | 250 |
| 897 | 3300010375 | Ga0105239_10009841 | Ga0105239_1000984111 | 250 |
| 898 | 3300014325 | Ga0163163_10186771 | Ga0163163_101867712 | 250 |
| 899 | 3300014497 | Ga0182008_10021992 | Ga0182008_100219922 | 250 |
| 900 | 3300015262 | Ga0182007_10004882 | Ga0182007_100048823 | 250 |
| 901 | 3300017792 | Ga0163161_10027704 | Ga0163161_100277042 | 250 |
| 902 | 3300017792 | Ga0163161_10120022 | Ga0163161_101200222 | 250 |
| 903 | 3300025263 | Ga0209565_1000329 | Ga0209565_100032935 | 250 |
| 904 | 3300025273 | Ga0209673_1037191 | Ga0209673_10371912 | 250 |
| 905 | 3300025291 | Ga0209675_1000070 | Ga0209675_1000070139 | 250 |
| 906 | 3300025291 | Ga0209675_1000432 | Ga0209675_10004328 | 250 |
| 907 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012484 | 250 |
| 908 | 3300025294 | Ga0209025_1000523 | Ga0209025_100052351 | 250 |
| 909 | 3300025294 | Ga0209025_1001621 | Ga0209025_100162110 | 250 |
| 910 | 3300025294 | Ga0209025_1006383 | Ga0209025_10063832 | 250 |
| 911 | 3300025294 | Ga0209025_1038722 | Ga0209025_10387222 | 250 |
| 912 | 3300025295 | Ga0209564_1000359 | Ga0209564_100035954 | 250 |
| 913 | 3300025295 | Ga0209564_1003269 | Ga0209564_100326910 | 250 |
| 914 | 3300025295 | Ga0209564_1003406 | Ga0209564_10034069 | 250 |
| 915 | 3300025299 | Ga0209256_1000059 | Ga0209256_100005983 | 250 |
| 916 | 3300025907 | Ga0207645_10052005 | Ga0207645_100520053 | 250 |
| 917 | 3300025914 | Ga0207671_10009421 | Ga0207671_100094213 | 250 |
| 918 | 3300025927 | Ga0207687_10017964 | Ga0207687_100179642 | 250 |
| 919 | 3300025931 | Ga0207644_10097307 | Ga0207644_100973072 | 250 |
| 920 | 3300025937 | Ga0207669_10233431 | Ga0207669_102334312 | 250 |
| 921 | 3300025940 | Ga0207691_10263627 | Ga0207691_102636272 | 250 |
| 922 | 3300025942 | Ga0207689_10142432 | Ga0207689_101424322 | 250 |
| 923 | 3300026095 | Ga0207676_10036715 | Ga0207676_100367152 | 250 |
| 924 | 3300026116 | Ga0207674_10303224 | Ga0207674_103032242 | 250 |
| 925 | 3300026121 | Ga0207683_10151342 | Ga0207683_101513422 | 250 |
| 926 | 3300026142 | Ga0207698_10067203 | Ga0207698_100672032 | 250 |
| 927 | 3300027866 | Ga0209813_10005511 | Ga0209813_100055112 | 250 |
| 928 | 3300028379 | Ga0268266_10135471 | Ga0268266_101354712 | 250 |
| 929 | 3300028794 | Ga0307515_10127990 | Ga0307515_101279902 | 250 |
| 930 | 3300030522 | Ga0307512_10238470 | Ga0307512_102384701 | 250 |
| 931 | 3300030735 | Ga0316178_1108561 | Ga0316178_11085611 | 250 |
| 932 | 3300031456 | Ga0307513_10010724 | Ga0307513_100107247 | 250 |
| 933 | 3300031456 | Ga0307513_10197551 | Ga0307513_101975512 | 250 |
| 934 | 3300031616 | Ga0307508_10002237 | Ga0307508_1000223712 | 250 |
| 935 | 3300033180 | Ga0307510_10151238 | Ga0307510_101512382 | 250 |
| 936 | 3300035084 | Ga0373928_0003096 | Ga0373928_0003096_861_1634 | 250 |
| 937 | 3300035092 | Ga0373952_0038233 | Ga0373952_0038233_170_955 | 250 |
| 938 | 3300035121 | Ga0373960_0027298 | Ga0373960_0027298_132_917 | 250 |
| 939 | 3300037471 | Ga0395905_0363120 | Ga0395905_0363120_398_1195 | 250 |
| 940 | 3300041512 | Ga0451853_3433684 | Ga0451853_3433684_547_1326 | 250 |
| 941 | 3300042002 | Ga0439442_024145 | Ga0439442_024145_99_869 | 250 |
| 942 | 3300042004 | Ga0439445_0004691 | Ga0439445_0004691_1703_2479 | 250 |
| 943 | 3300042015 | Ga0439462_0039943 | Ga0439462_0039943_454_1224 | 250 |
| 944 | 3300042137 | Ga0450902_001457 | Ga0450902_001457_1749_2510 | 250 |
| 945 | 3300042533 | Ga0450901_000469 | Ga0450901_000469_1898_2659 | 250 |
| 946 | 3300042876 | Ga0451577_0243287 | Ga0451577_0243287_438_1205 | 250 |
| 947 | 3300044673 | Ga0453683_0077912 | Ga0453683_0077912_147_914 | 250 |
| 948 | 3300044712 | Ga0453684_0000209 | Ga0453684_0000209_83001_83774 | 250 |
| 949 | 3300044712 | Ga0453684_0005764 | Ga0453684_0005764_2894_3661 | 250 |
| 950 | 3300044712 | Ga0453684_0037047 | Ga0453684_0037047_2863_3633 | 250 |
| 951 | 3300044712 | Ga0453684_0038797 | Ga0453684_0038797_5252_6025 | 250 |
| 952 | 3300044712 | Ga0453684_0100394 | Ga0453684_0100394_1858_2631 | 250 |
| 953 | 3300044712 | Ga0453684_0141098 | Ga0453684_0141098_1361_2134 | 250 |
| 954 | 3300044712 | Ga0453684_0263642 | Ga0453684_0263642_52_819 | 250 |
| 955 | 3300045051 | Ga0451576_0077326 | Ga0451576_0077326_316_1083 | 250 |
| 956 | 3300045051 | Ga0451576_0362614 | Ga0451576_0362614_266_1036 | 250 |
| 957 | 3300046452 | Ga0495617_000539 | Ga0495617_000539_17771_18535 | 250 |
| 958 | 3300046457 | Ga0495590_0099089 | Ga0495590_0099089_209_991 | 250 |
| 959 | 3300046472 | Ga0495580_0068274 | Ga0495580_0068274_119_889 | 250 |
| 960 | 3300046475 | Ga0495639_0023188 | Ga0495639_0023188_119_898 | 250 |
| 961 | 3300046491 | Ga0495584_0000017 | Ga0495584_0000017_78753_79517 | 250 |
| 962 | 3300046491 | Ga0495584_0001098 | Ga0495584_0001098_5044_5820 | 250 |
| 963 | 3300046492 | Ga0495585_0000064 | Ga0495585_0000064_87030_87794 | 250 |
| 964 | 3300046492 | Ga0495585_0000254 | Ga0495585_0000254_26780_27556 | 250 |
| 965 | 3300046492 | Ga0495585_0011365 | Ga0495585_0011365_2125_2889 | 250 |
| 966 | 3300046507 | Ga0495606_0003064 | Ga0495606_0003064_5862_6629 | 250 |
| 967 | 3300046507 | Ga0495606_0082712 | Ga0495606_0082712_714_1478 | 250 |
| 968 | 3300046513 | Ga0495616_0004568 | Ga0495616_0004568_1254_2030 | 250 |
| 969 | 3300046517 | Ga0495630_0054506 | Ga0495630_0054506_1272_2051 | 250 |
| 970 | 3300046522 | Ga0495643_0069400 | Ga0495643_0069400_540_1304 | 250 |
| 971 | 3300046524 | Ga0495648_0000007 | Ga0495648_0000007_244583_245347 | 250 |
| 972 | 3300046524 | Ga0495648_0005631 | Ga0495648_0005631_8913_9677 | 250 |
| 973 | 3300046528 | Ga0495642_0033608 | Ga0495642_0033608_1235_2002 | 250 |
| 974 | 3300046528 | Ga0495642_0069831 | Ga0495642_0069831_138_902 | 250 |
| 975 | 3300046539 | Ga0495621_0025804 | Ga0495621_0025804_250_1035 | 250 |
| 976 | 3300046542 | Ga0495597_0090184 | Ga0495597_0090184_127_897 | 250 |
| 977 | 3300046558 | Ga0495633_0002408 | Ga0495633_0002408_10093_10857 | 250 |
| 978 | 3300046558 | Ga0495633_0038594 | Ga0495633_0038594_794_1558 | 250 |
| 979 | 3300046665 | Ga0495661_0008840 | Ga0495661_0008840_85_849 | 250 |
| 980 | 3300046692 | Ga0495671_0012253 | Ga0495671_0012253_1837_2601 | 250 |
| 981 | 3300046694 | Ga0495649_0044469 | Ga0495649_0044469_596_1378 | 250 |
| 982 | 3300046810 | Ga0495660_0045872 | Ga0495660_0045872_1082_1864 | 250 |
| 983 | 3300047323 | Ga0495683_0000179 | Ga0495683_0000179_27409_28185 | 250 |
| 984 | 3300047443 | Ga0495687_016328 | Ga0495687_016328_2702_3484 | 250 |
| 985 | 3300048904 | Ga0496101_0005306 | Ga0496101_0005306_2148_2927 | 250 |
| 986 | 3300048906 | Ga0496103_0010012 | Ga0496103_0010012_3821_4600 | 250 |
| 987 | 3300048907 | Ga0496104_0002714 | Ga0496104_0002714_8384_9163 | 250 |
| 988 | 3300048909 | Ga0496106_0008360 | Ga0496106_0008360_3042_3821 | 250 |
| 989 | 3300048911 | Ga0496108_0237639 | Ga0496108_0237639_431_1210 | 250 |
| 990 | 3300048918 | Ga0496115_0043109 | Ga0496115_0043109_887_1651 | 250 |
| 991 | 3300048919 | Ga0496116_0037342 | Ga0496116_0037342_585_1355 | 250 |
| 992 | 3300048924 | Ga0496121_0167815 | Ga0496121_0167815_332_1093 | 250 |
| 993 | 3300049571 | Ga0501034_0000188 | Ga0501034_0000188_19547_20311 | 250 |
| 994 | 3300049571 | Ga0501034_0003555 | Ga0501034_0003555_7796_8578 | 250 |
| 995 | 3300049574 | Ga0501038_0048173 | Ga0501038_0048173_1050_1817 | 250 |
| 996 | 3300049578 | Ga0501042_0099048 | Ga0501042_0099048_607_1374 | 250 |
| 997 | 3300049587 | Ga0501071_0008369 | Ga0501071_0008369_5016_5783 | 250 |
| 998 | 3300049588 | Ga0501072_0015941 | Ga0501072_0015941_197_964 | 250 |
| 999 | 3300049591 | Ga0501075_0032348 | Ga0501075_0032348_1876_2643 | 250 |
| 1000 | 3300049592 | Ga0501076_0012583 | Ga0501076_0012583_3219_3986 | 250 |
| 1001 | 3300049593 | Ga0501077_0024917 | Ga0501077_0024917_661_1428 | 250 |
| 1002 | 3300049741 | Ga0501079_0027245 | Ga0501079_0027245_1288_2055 | 250 |
| 1003 | 3300049824 | Ga0501045_0038705 | Ga0501045_0038705_1159_1926 | 250 |
| 1004 | 3300050489 | nmdc:mga03683_15387_c1 | nmdc:mga03683_15387_c1_440_1222 | 250 |
| 1005 | 3300050489 | nmdc:mga03683_88033_c1 | nmdc:mga03683_88033_c1_362_1144 | 250 |
| 1006 | 3300050489 | nmdc:mga03683_8977_c1 | nmdc:mga03683_8977_c1_2439_3215 | 250 |
| 1007 | 3300050493 | nmdc:mga0k408_152543_c1 | nmdc:mga0k408_152543_c1_319_1101 | 250 |
| 1008 | 3300050493 | nmdc:mga0k408_2021_c1 | nmdc:mga0k408_2021_c1_2436_3230 | 250 |
| 1009 | 3300050493 | nmdc:mga0k408_77544_c1 | nmdc:mga0k408_77544_c1_522_1298 | 250 |
| 1010 | 3300050496 | nmdc:mga07m45_150706_c1 | nmdc:mga07m45_150706_c1_223_999 | 250 |
| 1011 | 3300050496 | nmdc:mga07m45_49256_c1 | nmdc:mga07m45_49256_c1_293_1087 | 250 |
| 1012 | 3300050496 | nmdc:mga07m45_5308_c1 | nmdc:mga07m45_5308_c1_4157_4939 | 250 |
| 1013 | 3300050516 | nmdc:mga0sz30_109167_c1 | nmdc:mga0sz30_109167_c1_84_866 | 250 |
| 1014 | 3300050516 | nmdc:mga0sz30_16840_c1 | nmdc:mga0sz30_16840_c1_1822_2616 | 250 |
| 1015 | 3300060353 | Ga0501082_0038427 | Ga0501082_0038427_431_1198 | 250 |
| 1016 | 3300061734 | Ga0530510_0007252 | Ga0530510_0007252_4526_5293 | 250 |
| 1017 | 3300001989 | JGI24739J22299_10009203 | JGI24739J22299_100092033 | 251 |
| 1018 | 3300002067 | JGI24735J21928_10051138 | JGI24735J21928_100511382 | 251 |
| 1019 | 3300009011 | Ga0105251_10000310 | Ga0105251_100003109 | 251 |
| 1020 | 3300015262 | Ga0182007_10004662 | Ga0182007_100046623 | 251 |
| 1021 | 3300025256 | Ga0209759_1000002 | Ga0209759_100000298 | 251 |
| 1022 | 3300025284 | Ga0209130_1006725 | Ga0209130_10067254 | 251 |
| 1023 | 3300025735 | Ga0207713_1000683 | Ga0207713_10006837 | 251 |
| 1024 | 3300025904 | Ga0207647_10068057 | Ga0207647_100680572 | 251 |
| 1025 | 3300025904 | Ga0207647_10158916 | Ga0207647_101589162 | 251 |
| 1026 | 3300025941 | Ga0207711_10068436 | Ga0207711_100684362 | 251 |
| 1027 | 3300027312 | Ga0209371_1004494 | Ga0209371_10044945 | 251 |
| 1028 | 3300030500 | Ga0268256_1004255 | Ga0268256_10042552 | 251 |
| 1029 | 3300041404 | Ga0439436_0001760 | Ga0439436_0001760_5029_5805 | 251 |
| 1030 | 3300041997 | Ga0439431_0000936 | Ga0439431_0000936_3252_4028 | 251 |
| 1031 | 3300042006 | Ga0439432_031900 | Ga0439432_031900_797_1579 | 251 |
| 1032 | 3300042007 | Ga0439449_0006682 | Ga0439449_0006682_1276_2058 | 251 |
| 1033 | 3300046454 | Ga0495592_0005128 | Ga0495592_0005128_7174_7947 | 251 |
| 1034 | 3300046455 | Ga0495603_0072371 | Ga0495603_0072371_801_1574 | 251 |
| 1035 | 3300046457 | Ga0495590_0022344 | Ga0495590_0022344_646_1419 | 251 |
| 1036 | 3300046458 | Ga0495591_006006 | Ga0495591_006006_3342_4115 | 251 |
| 1037 | 3300046459 | Ga0495629_0000068 | Ga0495629_0000068_61430_62203 | 251 |
| 1038 | 3300046459 | Ga0495629_0002001 | Ga0495629_0002001_4779_5552 | 251 |
| 1039 | 3300046459 | Ga0495629_0008667 | Ga0495629_0008667_6460_7233 | 251 |
| 1040 | 3300046459 | Ga0495629_0010808 | Ga0495629_0010808_2591_3364 | 251 |
| 1041 | 3300046460 | Ga0495638_0006804 | Ga0495638_0006804_6249_7022 | 251 |
| 1042 | 3300046461 | Ga0495641_0029655 | Ga0495641_0029655_789_1562 | 251 |
| 1043 | 3300046462 | Ga0495651_0002428 | Ga0495651_0002428_8255_9028 | 251 |
| 1044 | 3300046462 | Ga0495651_0033735 | Ga0495651_0033735_342_1115 | 251 |
| 1045 | 3300046463 | Ga0495653_0000106 | Ga0495653_0000106_38736_39509 | 251 |
| 1046 | 3300046463 | Ga0495653_0028519 | Ga0495653_0028519_1267_2040 | 251 |
| 1047 | 3300046463 | Ga0495653_0038059 | Ga0495653_0038059_1721_2494 | 251 |
| 1048 | 3300046463 | Ga0495653_0110105 | Ga0495653_0110105_57_830 | 251 |
| 1049 | 3300046463 | Ga0495653_0150697 | Ga0495653_0150697_500_1273 | 251 |
| 1050 | 3300046471 | Ga0495650_0002257 | Ga0495650_0002257_7436_8209 | 251 |
| 1051 | 3300046471 | Ga0495650_0029397 | Ga0495650_0029397_33_806 | 251 |
| 1052 | 3300046472 | Ga0495580_0000062 | Ga0495580_0000062_53619_54392 | 251 |
| 1053 | 3300046472 | Ga0495580_0003904 | Ga0495580_0003904_8897_9670 | 251 |
| 1054 | 3300046472 | Ga0495580_0004329 | Ga0495580_0004329_8182_8955 | 251 |
| 1055 | 3300046472 | Ga0495580_0025177 | Ga0495580_0025177_1118_1891 | 251 |
| 1056 | 3300046472 | Ga0495580_0115496 | Ga0495580_0115496_521_1294 | 251 |
| 1057 | 3300046472 | Ga0495580_0179619 | Ga0495580_0179619_279_1052 | 251 |
| 1058 | 3300046473 | Ga0495582_0007318 | Ga0495582_0007318_4698_5471 | 251 |
| 1059 | 3300046473 | Ga0495582_0021578 | Ga0495582_0021578_1461_2234 | 251 |
| 1060 | 3300046473 | Ga0495582_0070828 | Ga0495582_0070828_657_1430 | 251 |
| 1061 | 3300046474 | Ga0495605_0004132 | Ga0495605_0004132_2611_3384 | 251 |
| 1062 | 3300046477 | Ga0495664_0029571 | Ga0495664_0029571_427_1200 | 251 |
| 1063 | 3300046499 | Ga0495594_0056756 | Ga0495594_0056756_966_1739 | 251 |
| 1064 | 3300046500 | Ga0495596_0042249 | Ga0495596_0042249_557_1330 | 251 |
| 1065 | 3300046507 | Ga0495606_0261742 | Ga0495606_0261742_81_854 | 251 |
| 1066 | 3300046511 | Ga0495608_0002682 | Ga0495608_0002682_1761_2534 | 251 |
| 1067 | 3300046514 | Ga0495618_0012154 | Ga0495618_0012154_317_1090 | 251 |
| 1068 | 3300046514 | Ga0495618_0034021 | Ga0495618_0034021_2176_2949 | 251 |
| 1069 | 3300046516 | Ga0495628_0056824 | Ga0495628_0056824_594_1367 | 251 |
| 1070 | 3300046516 | Ga0495628_0126295 | Ga0495628_0126295_343_1116 | 251 |
| 1071 | 3300046516 | Ga0495628_0261871 | Ga0495628_0261871_213_986 | 251 |
| 1072 | 3300046517 | Ga0495630_0011461 | Ga0495630_0011461_4496_5269 | 251 |
| 1073 | 3300046517 | Ga0495630_0072540 | Ga0495630_0072540_1390_2163 | 251 |
| 1074 | 3300046517 | Ga0495630_0079545 | Ga0495630_0079545_1110_1883 | 251 |
| 1075 | 3300046518 | Ga0495631_0026301 | Ga0495631_0026301_692_1465 | 251 |
| 1076 | 3300046524 | Ga0495648_0013118 | Ga0495648_0013118_3437_4210 | 251 |
| 1077 | 3300046524 | Ga0495648_0106806 | Ga0495648_0106806_442_1215 | 251 |
| 1078 | 3300046526 | Ga0495666_0001428 | Ga0495666_0001428_9786_10559 | 251 |
| 1079 | 3300046526 | Ga0495666_0014337 | Ga0495666_0014337_2867_3640 | 251 |
| 1080 | 3300046526 | Ga0495666_0014921 | Ga0495666_0014921_1370_2143 | 251 |
| 1081 | 3300046529 | Ga0495652_0077689 | Ga0495652_0077689_1635_2408 | 251 |
| 1082 | 3300046529 | Ga0495652_0166659 | Ga0495652_0166659_743_1516 | 251 |
| 1083 | 3300046529 | Ga0495652_0207008 | Ga0495652_0207008_466_1239 | 251 |
| 1084 | 3300046531 | Ga0495665_0021697 | Ga0495665_0021697_1510_2283 | 251 |
| 1085 | 3300046531 | Ga0495665_0040356 | Ga0495665_0040356_1186_1959 | 251 |
| 1086 | 3300046531 | Ga0495665_0068412 | Ga0495665_0068412_392_1165 | 251 |
| 1087 | 3300046533 | Ga0495640_0002419 | Ga0495640_0002419_10655_11428 | 251 |
| 1088 | 3300046533 | Ga0495640_0012920 | Ga0495640_0012920_729_1502 | 251 |
| 1089 | 3300046533 | Ga0495640_0049451 | Ga0495640_0049451_1532_2305 | 251 |
| 1090 | 3300046535 | Ga0495586_0022459 | Ga0495586_0022459_91_864 | 251 |
| 1091 | 3300046535 | Ga0495586_0064202 | Ga0495586_0064202_836_1609 | 251 |
| 1092 | 3300046535 | Ga0495586_0082798 | Ga0495586_0082798_603_1376 | 251 |
| 1093 | 3300046536 | Ga0495587_0001498 | Ga0495587_0001498_4900_5673 | 251 |
| 1094 | 3300046543 | Ga0495645_0049738 | Ga0495645_0049738_863_1636 | 251 |
| 1095 | 3300046543 | Ga0495645_0095348 | Ga0495645_0095348_790_1563 | 251 |
| 1096 | 3300046557 | Ga0495622_0000005 | Ga0495622_0000005_68978_69751 | 251 |
| 1097 | 3300046642 | Ga0495634_0001826 | Ga0495634_0001826_14003_14776 | 251 |
| 1098 | 3300046642 | Ga0495634_0014590 | Ga0495634_0014590_888_1661 | 251 |
| 1099 | 3300046642 | Ga0495634_0123621 | Ga0495634_0123621_52_825 | 251 |
| 1100 | 3300046648 | Ga0495611_0090398 | Ga0495611_0090398_165_938 | 251 |
| 1101 | 3300046663 | Ga0495635_0006638 | Ga0495635_0006638_4728_5501 | 251 |
| 1102 | 3300046663 | Ga0495635_0038217 | Ga0495635_0038217_2367_3140 | 251 |
| 1103 | 3300046665 | Ga0495661_0018782 | Ga0495661_0018782_3355_4128 | 251 |
| 1104 | 3300046665 | Ga0495661_0043099 | Ga0495661_0043099_1234_2007 | 251 |
| 1105 | 3300046678 | Ga0495599_0009080 | Ga0495599_0009080_3039_3812 | 251 |
| 1106 | 3300046678 | Ga0495599_0016433 | Ga0495599_0016433_174_947 | 251 |
| 1107 | 3300046678 | Ga0495599_0032937 | Ga0495599_0032937_226_999 | 251 |
| 1108 | 3300046679 | Ga0495623_0019454 | Ga0495623_0019454_1171_1944 | 251 |
| 1109 | 3300046679 | Ga0495623_0036214 | Ga0495623_0036214_1965_2738 | 251 |
| 1110 | 3300046679 | Ga0495623_0070802 | Ga0495623_0070802_189_962 | 251 |
| 1111 | 3300046680 | Ga0495646_0024982 | Ga0495646_0024982_1836_2609 | 251 |
| 1112 | 3300046680 | Ga0495646_0038413 | Ga0495646_0038413_2111_2884 | 251 |
| 1113 | 3300046680 | Ga0495646_0038578 | Ga0495646_0038578_463_1236 | 251 |
| 1114 | 3300046680 | Ga0495646_0053415 | Ga0495646_0053415_736_1509 | 251 |
| 1115 | 3300046689 | Ga0495613_0007287 | Ga0495613_0007287_1266_2039 | 251 |
| 1116 | 3300046689 | Ga0495613_0010933 | Ga0495613_0010933_3293_4066 | 251 |
| 1117 | 3300046690 | Ga0495624_0002899 | Ga0495624_0002899_4583_5356 | 251 |
| 1118 | 3300046690 | Ga0495624_0014833 | Ga0495624_0014833_1577_2350 | 251 |
| 1119 | 3300046690 | Ga0495624_0015212 | Ga0495624_0015212_1133_1906 | 251 |
| 1120 | 3300046690 | Ga0495624_0026356 | Ga0495624_0026356_1867_2640 | 251 |
| 1121 | 3300046690 | Ga0495624_0101477 | Ga0495624_0101477_557_1330 | 251 |
| 1122 | 3300046691 | Ga0495670_0000157 | Ga0495670_0000157_24728_25510 | 251 |
| 1123 | 3300046694 | Ga0495649_0037773 | Ga0495649_0037773_968_1741 | 251 |
| 1124 | 3300046794 | Ga0495589_0014700 | Ga0495589_0014700_2268_3041 | 251 |
| 1125 | 3300046809 | Ga0495600_0039056 | Ga0495600_0039056_1252_2025 | 251 |
| 1126 | 3300047315 | Ga0495581_0000974 | Ga0495581_0000974_10071_10844 | 251 |
| 1127 | 3300047315 | Ga0495581_0037611 | Ga0495581_0037611_1932_2705 | 251 |
| 1128 | 3300047317 | Ga0495604_0009687 | Ga0495604_0009687_5684_6457 | 251 |
| 1129 | 3300047317 | Ga0495604_0012629 | Ga0495604_0012629_317_1090 | 251 |
| 1130 | 3300047317 | Ga0495604_0028630 | Ga0495604_0028630_2153_2926 | 251 |
| 1131 | 3300047317 | Ga0495604_0135107 | Ga0495604_0135107_917_1690 | 251 |
| 1132 | 3300047319 | Ga0495674_0050129 | Ga0495674_0050129_2490_3263 | 251 |
| 1133 | 3300047319 | Ga0495674_0051499 | Ga0495674_0051499_573_1346 | 251 |
| 1134 | 3300047319 | Ga0495674_0079072 | Ga0495674_0079072_1012_1785 | 251 |
| 1135 | 3300047319 | Ga0495674_0108638 | Ga0495674_0108638_987_1760 | 251 |
| 1136 | 3300047321 | Ga0495676_0033008 | Ga0495676_0033008_1019_1792 | 251 |
| 1137 | 3300047321 | Ga0495676_0058821 | Ga0495676_0058821_1080_1853 | 251 |
| 1138 | 3300047321 | Ga0495676_0068060 | Ga0495676_0068060_427_1200 | 251 |
| 1139 | 3300047321 | Ga0495676_0074321 | Ga0495676_0074321_556_1329 | 251 |
| 1140 | 3300047322 | Ga0495680_0009459 | Ga0495680_0009459_706_1479 | 251 |
| 1141 | 3300047322 | Ga0495680_0014461 | Ga0495680_0014461_4104_4877 | 251 |
| 1142 | 3300047322 | Ga0495680_0041629 | Ga0495680_0041629_1043_1816 | 251 |
| 1143 | 3300047322 | Ga0495680_0105528 | Ga0495680_0105528_303_1076 | 251 |
| 1144 | 3300047322 | Ga0495680_0128226 | Ga0495680_0128226_836_1609 | 251 |
| 1145 | 3300047323 | Ga0495683_0002296 | Ga0495683_0002296_8812_9585 | 251 |
| 1146 | 3300047323 | Ga0495683_0128263 | Ga0495683_0128263_241_1014 | 251 |
| 1147 | 3300047444 | Ga0495675_0001779 | Ga0495675_0001779_2600_3373 | 251 |
| 1148 | 3300047444 | Ga0495675_0002004 | Ga0495675_0002004_7928_8701 | 251 |
| 1149 | 3300047444 | Ga0495675_0002575 | Ga0495675_0002575_3817_4590 | 251 |
| 1150 | 3300047444 | Ga0495675_0220366 | Ga0495675_0220366_357_1130 | 251 |
| 1151 | 3300047446 | Ga0495679_000009 | Ga0495679_000009_325933_326706 | 251 |
| 1152 | 3300047446 | Ga0495679_000272 | Ga0495679_000272_25137_25910 | 251 |
| 1153 | 3300047446 | Ga0495679_033950 | Ga0495679_033950_297_1070 | 251 |
| 1154 | 3300047469 | Ga0495673_0003578 | Ga0495673_0003578_7958_8731 | 251 |
| 1155 | 3300047673 | Ga0495593_0006303 | Ga0495593_0006303_2629_3402 | 251 |
| 1156 | 3300047673 | Ga0495593_0012286 | Ga0495593_0012286_834_1607 | 251 |
| 1157 | 3300047673 | Ga0495593_0057511 | Ga0495593_0057511_429_1202 | 251 |
| 1158 | 3300048088 | Ga0495602_0017169 | Ga0495602_0017169_2146_2919 | 251 |
| 1159 | 3300048088 | Ga0495602_0033154 | Ga0495602_0033154_2806_3579 | 251 |
| 1160 | 3300048088 | Ga0495602_0052347 | Ga0495602_0052347_1816_2589 | 251 |
| 1161 | 3300048088 | Ga0495602_0084640 | Ga0495602_0084640_1323_2096 | 251 |
| 1162 | 3300048088 | Ga0495602_0274886 | Ga0495602_0274886_442_1215 | 251 |
| 1163 | 3300048089 | Ga0495614_0000338 | Ga0495614_0000338_8130_8903 | 251 |
| 1164 | 3300048089 | Ga0495614_0002659 | Ga0495614_0002659_1679_2452 | 251 |
| 1165 | 3300048089 | Ga0495614_0026652 | Ga0495614_0026652_1308_2081 | 251 |
| 1166 | 3300048091 | Ga0495626_0034022 | Ga0495626_0034022_236_1003 | 251 |
| 1167 | 3300048905 | Ga0496102_0442022 | Ga0496102_0442022_37_810 | 251 |
| 1168 | 3300048906 | Ga0496103_0004541 | Ga0496103_0004541_4607_5380 | 251 |
| 1169 | 3300048919 | Ga0496116_0003464 | Ga0496116_0003464_9583_10353 | 251 |
| 1170 | 3300048921 | Ga0496118_0001543 | Ga0496118_0001543_8086_8859 | 251 |
| 1171 | 3300048921 | Ga0496118_0004355 | Ga0496118_0004355_3606_4379 | 251 |
| 1172 | 3300048921 | Ga0496118_0049673 | Ga0496118_0049673_892_1665 | 251 |
| 1173 | 3300048921 | Ga0496118_0085780 | Ga0496118_0085780_1190_1963 | 251 |
| 1174 | 3300048929 | Ga0496126_0000475 | Ga0496126_0000475_46570_47343 | 251 |
| 1175 | 3300048929 | Ga0496126_0001848 | Ga0496126_0001848_13840_14613 | 251 |
| 1176 | 3300049460 | Ga0495682_0027619 | Ga0495682_0027619_1211_1984 | 251 |
| 1177 | 3300001915 | JGI24741J21665_1001446 | JGI24741J21665_10014464 | 252 |
| 1178 | 3300001979 | JGI24740J21852_10000162 | JGI24740J21852_100001628 | 252 |
| 1179 | 3300002705 | JGI25156J39149_1011629 | JGI25156J39149_10116292 | 252 |
| 1180 | 3300002705 | JGI25156J39149_1013888 | JGI25156J39149_10138882 | 252 |
| 1181 | 3300003752 | Ga0055539_1000038 | Ga0055539_100003820 | 252 |
| 1182 | 3300003756 | Ga0055533_1004567 | Ga0055533_10045672 | 252 |
| 1183 | 3300003758 | Ga0055532_1000002 | Ga0055532_1000002441 | 252 |
| 1184 | 3300003759 | Ga0055525_1000324 | Ga0055525_100032423 | 252 |
| 1185 | 3300003763 | Ga0055529_1000113 | Ga0055529_100011311 | 252 |
| 1186 | 3300005337 | Ga0070682_100037222 | Ga0070682_1000372222 | 252 |
| 1187 | 3300005344 | Ga0070661_100000321 | Ga0070661_10000032123 | 252 |
| 1188 | 3300005455 | Ga0070663_100000046 | Ga0070663_1000000466 | 252 |
| 1189 | 3300005564 | Ga0070664_100000002 | Ga0070664_100000002397 | 252 |
| 1190 | 3300005577 | Ga0068857_100193952 | Ga0068857_1001939522 | 252 |
| 1191 | 3300005578 | Ga0068854_100000004 | Ga0068854_100000004202 | 252 |
| 1192 | 3300005614 | Ga0068856_100000035 | Ga0068856_10000003519 | 252 |
| 1193 | 3300009093 | Ga0105240_10080994 | Ga0105240_100809942 | 252 |
| 1194 | 3300013100 | Ga0157373_10000343 | Ga0157373_1000034338 | 252 |
| 1195 | 3300013102 | Ga0157371_10000581 | Ga0157371_1000058114 | 252 |
| 1196 | 3300013104 | Ga0157370_10000231 | Ga0157370_1000023114 | 252 |
| 1197 | 3300013105 | Ga0157369_10003285 | Ga0157369_1000328513 | 252 |
| 1198 | 3300013307 | Ga0157372_10000786 | Ga0157372_1000078617 | 252 |
| 1199 | 3300020077 | Ga0206351_10768670 | Ga0206351_107686704 | 252 |
| 1200 | 3300020610 | Ga0154015_1087227 | Ga0154015_108722712 | 252 |
| 1201 | 3300022467 | Ga0224712_10088843 | Ga0224712_100888432 | 252 |
| 1202 | 3300025224 | Ga0209784_100003 | Ga0209784_100003274 | 252 |
| 1203 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021317 | 252 |
| 1204 | 3300025226 | Ga0209674_100008 | Ga0209674_100008872 | 252 |
| 1205 | 3300025226 | Ga0209674_105494 | Ga0209674_1054942 | 252 |
| 1206 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021970 | 252 |
| 1207 | 3300025230 | Ga0209563_100004 | Ga0209563_100004730 | 252 |
| 1208 | 3300025230 | Ga0209563_100026 | Ga0209563_10002619 | 252 |
| 1209 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021970 | 252 |
| 1210 | 3300025253 | Ga0209677_100013 | Ga0209677_100013353 | 252 |
| 1211 | 3300025254 | Ga0209148_1006086 | Ga0209148_10060862 | 252 |
| 1212 | 3300025256 | Ga0209759_1006257 | Ga0209759_10062573 | 252 |
| 1213 | 3300025256 | Ga0209759_1017556 | Ga0209759_10175562 | 252 |
| 1214 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021557 | 252 |
| 1215 | 3300025913 | Ga0207695_10003684 | Ga0207695_1000368416 | 252 |
| 1216 | 3300025920 | Ga0207649_10000019 | Ga0207649_10000019194 | 252 |
| 1217 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001563 | 252 |
| 1218 | 3300025981 | Ga0207640_10000075 | Ga0207640_1000007532 | 252 |
| 1219 | 3300026067 | Ga0207678_10000004 | Ga0207678_1000000438 | 252 |
| 1220 | 3300026078 | Ga0207702_10000029 | Ga0207702_1000002961 | 252 |
| 1221 | 3300026116 | Ga0207674_10051345 | Ga0207674_100513452 | 252 |
| 1222 | 3300059640 | Ga0587067_004181 | Ga0587067_004181_1045_1803 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gn9-assembly1.cif.gz_A-2 | spfh domain of pyrococcus horikoshii stomatin | 0.9766 | 62 | 167 |
| 8gn9-assembly1.cif.gz_A-2 | spfh domain of pyrococcus horikoshii stomatin | 0.9676 | 62 | 167 |
| 4fvj-assembly2.cif.gz_B | spfh domain of the mouse stomatin (crystal form 2) | 0.9512 | 59 | 168 |
| 4fvj-assembly2.cif.gz_B | spfh domain of the mouse stomatin (crystal form 2) | 0.9112 | 59 | 168 |
| 2rpb-assembly1.cif.gz_A | the solution structure of membrane protein | 0.8671 | 61 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8T4B6_101_212_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9976 | 61 | 167 | 3.30.479.30 |
| af_Q9VGD7_116_226_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9968 | 59 | 167 | 3.30.479.30 |
| af_F1R5A4_90_200_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9876 | 59 | 168 | 3.30.479.30 |
| af_A0A1D8PTU3_111_221_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9833 | 59 | 168 | 3.30.479.30 |
| af_Q8K4G9_162_272_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9822 | 61 | 167 | 3.30.479.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523WQZ2-F1-model_v4 | Slipin family protein | 0.9966 | 22 | 162 |
GO:0005886
|
| AF-A0A381SQX3-F1-model_v4 | Band 7 domain-containing protein | 0.9929 | 12 | 166 |
GO:0005886
|
| AF-A0A7C5Y882-F1-model_v4 | Band 7 domain-containing protein | 0.99 | 6 | 168 |
GO:0005886
|
| AF-A0A6F9DU42-F1-model_v4 | Stomatin-like protein 1 | 0.9875 | 20 | 166 |
GO:0005886
|
| AF-A0A538TLL3-F1-model_v4 | Slipin family protein | 0.9853 | 3 | 163 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar