F491824

General Info

Members Datasets Scaffolds Average Seq Length
1219 406 1183 248

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10005743|rootH1_1000574313
Length 268
Sequence MSSFQNPDHDELAGTEQPFVAHLMELRDRLLRAVIAIAVCFGALCLYPGPGHLYDLLAAPLVANLPEGTKMIATNVIAPFFVPLKITMLAGFLLALPVVLYQAWAFIAPGLYSHEKRLVMPLVISSTLLFFAGVAFCYFFVFGQVFKFIQGFAPKSIAAAPDIEAYLGFVMNMFIAFGAAFEVPVVVVVLARMGIVSVDKLREWRGYFIVVAFIVAAVITPPDIVSQLALAIPMCLLYELGLFAATYFIRATTSPEESTDQSSSDDAR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738541297 Duganella sp. GV083 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543009 Luteibacter sp. OK325 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2739367700 Dyella sp. YR388 Isolate Unclassified
17 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
18 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
19 2821131069 Duganella sp. 1224 Isolate Unclassified
20 2842711865 Duganella sp. R-73148 Isolate Unclassified
21 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
22 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
23 2857558681 Duganella sp. R-74565 Isolate Unclassified
24 2857564685 Duganella sp. R-74599 Isolate Unclassified
25 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
26 2884411467 Dyella sp. AD56 Isolate Rhizosphere
27 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
28 2904424332 Duganella sp. 1411 Isolate Rhizosphere
29 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
30 2919085039 Luteibacter sp. 1214 Isolate Unclassified
31 2919404418 Luteibacter sp. 3190 Isolate Unclassified
32 2928963466 Dyella japonica 1073 Isolate Unclassified
33 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
34 2941471342 Luteibacter sp. 621 Isolate Unclassified
35 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
36 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
37 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
40 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
41 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
42 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
43 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
44 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
49 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
50 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
56 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
57 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
58 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
61 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
62 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
63 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
64 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
72 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
131 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
158 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
210 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
211 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
212 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
243 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
244 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
245 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
246 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
247 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
248 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
252 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
267 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
325 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
397 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
398 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
399 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
400 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
401 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
402 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
403 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
404 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
406 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.82
Metatranscriptomes 1.23
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.57
Nodule 0.08
Rhizoplane 2.46
Rhizosphere 76.13
Stem 0
Stem Tuber 0
Unclassified 9.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000710 3300001904 Bacteria 6070
2 JGI24741J21665_1001821 3300001915 Bacteria 5842
3 JGI24741J21665_1002981 3300001915 Bacteria 4213
4 JGI24740J21852_10000692 3300001979 Bacteria 14633
5 JGI24740J21852_10000975 3300001979 Bacteria 12770
6 JGI24739J22299_10002578 3300001989 Bacteria 6986
7 JGI24737J22298_10001024 3300001990 Bacteria 9894
8 JGI24735J21928_10011588 3300002067 Bacteria 2793
9 JGI24738J21930_10003068 3300002075 Bacteria 4269
10 JGI25156J39149_1016335 3300002705 Bacteria 1447
11 JGI25162J39368_1000428 3300002737 Bacteria 33844
12 JGI25162J39368_1000613 3300002737 Bacteria 25624
13 JGI25162J39368_1001665 3300002737 Bacteria 10957
14 JGI25162J39368_1001985 3300002737 Bacteria 9149
15 JGI25162J39368_1002008 3300002737 Bacteria 9039
16 JGI25162J39368_1002523 3300002737 Bacteria 7003
17 JGI25162J39368_1008970 3300002737 Bacteria 1379
18 JGI25157J39369_1000460 3300002741 Bacteria 25623
19 JGI25157J39369_1000961 3300002741 Bacteria 13461
20 JGI25157J39369_1006842 3300002741 Bacteria 1698
21 JGI25164J39214_1000064 3300002772 Bacteria 107073
22 JGI25164J39214_1000395 3300002772 Bacteria 25635
23 JGI25164J39214_1000971 3300002772 Bacteria 9157
24 JGI25164J39214_1000980 3300002772 Bacteria 9039
25 JGI25164J39214_1004037 3300002772 Bacteria 1740
26 JGI25150J39212_1010844 3300002774 Bacteria 1676
27 JGI25165J46597_1000278 3300003214 Bacteria 65807
28 JGI25165J46597_1000735 3300003214 Bacteria 25643
29 JGI25165J46597_1001797 3300003214 Bacteria 9157
30 JGI25165J46597_1002008 3300003214 Bacteria 7781
31 JGI25153J46596_10011887 3300003215 Bacteria 3813
32 rootH1_10005743 3300003316 Bacteria 6867
33 rootH2_10001137 3300003320 Bacteria 56547
34 rootL2_10019723 3300003322 Bacteria 9239
35 rootL2_10023806 3300003322 Bacteria 3708
36 rootL2_10107535 3300003322 Bacteria 3477
37 rootH1_10130296 3300003323 Bacteria 1154
38 JGI25161J50226_1012920 3300003374 Bacteria 984
39 Ga0006562J51391_1045663 3300003578 Bacteria 5219
40 Ga0006562J51391_1045664 3300003578 Bacteria 2310
41 Ga0006562J51391_1059690 3300003578 Bacteria 10780
42 Ga0006562J51391_1059691 3300003578 Bacteria 10670
43 Ga0055538_1003606 3300003751 Bacteria 1927
44 Ga0055539_1015916 3300003752 Bacteria 913
45 Ga0055533_1000407 3300003756 Bacteria 16792
46 Ga0055533_1003239 3300003756 Bacteria 3346
47 Ga0055525_1000043 3300003759 Bacteria 268656
48 Ga0055527_1000028 3300003760 Bacteria 172877
49 Ga0055527_1000068 3300003760 Bacteria 87357
50 Ga0055527_1002058 3300003760 Bacteria 3630
51 Ga0055535_1000081 3300003761 Bacteria 107148
52 Ga0055535_1000090 3300003761 Bacteria 102120
53 Ga0055535_1000351 3300003761 Bacteria 45382
54 Ga0055535_1000368 3300003761 Bacteria 43481
55 Ga0055535_1000744 3300003761 Bacteria 24366
56 Ga0055542_1000053 3300003762 Bacteria 172877
57 Ga0055542_1000093 3300003762 Bacteria 120262
58 Ga0055542_1000113 3300003762 Bacteria 107148
59 Ga0055542_1000247 3300003762 Bacteria 62095
60 Ga0055542_1000450 3300003762 Bacteria 39041
61 Ga0055542_1000728 3300003762 Bacteria 25643
62 Ga0055542_1007038 3300003762 Bacteria 2330
63 Ga0055529_1000015 3300003763 Bacteria 366950
64 Ga0055529_1000104 3300003763 Bacteria 126692
65 Ga0055529_1000281 3300003763 Bacteria 60403
66 Ga0055529_1000312 3300003763 Bacteria 55812
67 Ga0055529_1000642 3300003763 Bacteria 25643
68 Ga0055529_1001736 3300003763 Bacteria 5480
69 Ga0055529_1002216 3300003763 Bacteria 3987
70 Ga0055526_1000007 3300003771 Bacteria 321998
71 Ga0055526_1000037 3300003771 Bacteria 134834
72 Ga0055543_1003646 3300004625 Bacteria 4442
73 Ga0065165_1000177 3300005262 Bacteria 113446
74 Ga0065165_1005293 3300005262 Bacteria 7350
75 Ga0070658_10013337 3300005327 Bacteria 6595
76 Ga0070658_10050584 3300005327 Bacteria 3368
77 Ga0070658_10303537 3300005327 Bacteria 1361
78 Ga0070683_100077261 3300005329 Bacteria 3113
79 Ga0070670_100021532 3300005331 Bacteria 5544
80 Ga0070666_10000001 3300005335 Bacteria 543080
81 Ga0070680_100030427 3300005336 Bacteria 4337
82 Ga0070680_100100179 3300005336 Bacteria 2404
83 Ga0070680_100184653 3300005336 Bacteria 1756
84 Ga0070680_100448780 3300005336 Bacteria 1101
85 Ga0070682_100016460 3300005337 Bacteria 4298
86 Ga0070682_100018616 3300005337 Bacteria 4064
87 Ga0070682_100148110 3300005337 Bacteria 1607
88 Ga0070682_100241093 3300005337 Bacteria 1298
89 Ga0070660_100038795 3300005339 Bacteria 3618
90 Ga0070660_100131399 3300005339 Bacteria 2004
91 Ga0070660_100306656 3300005339 Bacteria 1302
92 Ga0070689_100006673 3300005340 Bacteria 8020
93 Ga0070691_10003659 3300005341 Bacteria 6940
94 Ga0070691_10012371 3300005341 Bacteria 3907
95 Ga0070661_100010095 3300005344 Bacteria 6557
96 Ga0070661_100012552 3300005344 Bacteria 5928
97 Ga0070661_100028620 3300005344 Bacteria 4019
98 Ga0070661_100060639 3300005344 Bacteria 2776
99 Ga0070661_100205934 3300005344 Bacteria 1504
100 Ga0070692_10000562 3300005345 Bacteria 11615
101 Ga0070692_10022705 3300005345 Bacteria 3067
102 Ga0070692_10048401 3300005345 Bacteria 2202
103 Ga0070692_10094485 3300005345 Bacteria 1630
104 Ga0070692_10109226 3300005345 Bacteria 1527
105 Ga0070668_100119141 3300005347 Bacteria 2108
106 Ga0070659_100005254 3300005366 Bacteria 9290
107 Ga0070659_100007602 3300005366 Bacteria 7878
108 Ga0070659_100045834 3300005366 Bacteria 3426
109 Ga0070659_100185084 3300005366 Bacteria 1710
110 Ga0070667_100095144 3300005367 Bacteria 2567
111 Ga0070714_100000469 3300005435 Bacteria 29344
112 Ga0070714_100003767 3300005435 Bacteria 11380
113 Ga0070714_100023297 3300005435 Bacteria 5084
114 Ga0070713_100003302 3300005436 Bacteria 10632
115 Ga0070694_100136603 3300005444 Bacteria 1777
116 Ga0070663_100008195 3300005455 Bacteria 6414
117 Ga0070663_100017905 3300005455 Bacteria 4632
118 Ga0070663_100049501 3300005455 Bacteria 2984
119 Ga0070663_100052268 3300005455 Bacteria 2914
120 Ga0070663_100123453 3300005455 Bacteria 1959
121 Ga0070678_100084002 3300005456 Bacteria 2422
122 Ga0070662_100007813 3300005457 Bacteria 6947
123 Ga0070681_10000073 3300005458 Bacteria 74242
124 Ga0070681_10000367 3300005458 Bacteria 36431
125 Ga0070681_10004454 3300005458 Bacteria 13341
126 Ga0070681_10006342 3300005458 Bacteria 11502
127 Ga0070681_10164917 3300005458 Bacteria 2138
128 Ga0070681_10379774 3300005458 Bacteria 1324
129 Ga0070685_10066018 3300005466 Bacteria 2131
130 Ga0070679_100000042 3300005530 Bacteria 95394
131 Ga0070679_100004157 3300005530 Bacteria 13341
132 Ga0070679_100013727 3300005530 Bacteria 7759
133 Ga0070679_100139290 3300005530 Bacteria 2407
134 Ga0070679_100252132 3300005530 Bacteria 1721
135 Ga0070679_100529322 3300005530 Bacteria 1122
136 Ga0070679_100650471 3300005530 Bacteria 997
137 Ga0070684_100297141 3300005535 Bacteria 1481
138 Ga0068853_100005750 3300005539 Bacteria 9764
139 Ga0068853_100269007 3300005539 Bacteria 1569
140 Ga0070672_100021973 3300005543 Bacteria 4677
141 Ga0070696_100006278 3300005546 Bacteria 7958
142 Ga0070696_100054138 3300005546 Bacteria 2795
143 Ga0070696_100100676 3300005546 Bacteria 2070
144 Ga0070696_100522159 3300005546 Bacteria 948
145 Ga0070693_100017913 3300005547 Bacteria 3692
146 Ga0070693_100100744 3300005547 Bacteria 1759
147 Ga0068855_100001918 3300005563 Bacteria 25795
148 Ga0068855_100034011 3300005563 Bacteria 6080
149 Ga0068855_100155501 3300005563 Bacteria 2598
150 Ga0068855_100171476 3300005563 Bacteria 2457
151 Ga0068855_100196982 3300005563 Bacteria 2269
152 Ga0070664_100021873 3300005564 Bacteria 5272
153 Ga0070664_100110409 3300005564 Bacteria 2399
154 Ga0068857_100001411 3300005577 Bacteria 18992
155 Ga0068857_100277700 3300005577 Bacteria 1540
156 Ga0068854_100010173 3300005578 Bacteria 6095
157 Ga0068854_100023170 3300005578 Bacteria 4239
158 Ga0068854_100312692 3300005578 Bacteria 1274
159 Ga0068854_100463391 3300005578 Bacteria 1061
160 Ga0068856_100000207 3300005614 Bacteria 63158
161 Ga0068856_100002135 3300005614 Bacteria 20493
162 Ga0068856_100087030 3300005614 Bacteria 3105
163 Ga0068856_100184740 3300005614 Bacteria 2098
164 Ga0068856_100192983 3300005614 Bacteria 2050
165 Ga0068856_100270320 3300005614 Bacteria 1716
166 Ga0070702_100045349 3300005615 Bacteria 2487
167 Ga0068852_100006397 3300005616 Bacteria 8509
168 Ga0068852_100033894 3300005616 Bacteria 4244
169 Ga0068852_100130085 3300005616 Bacteria 2317
170 Ga0068852_100133824 3300005616 Bacteria 2286
171 Ga0068852_100191455 3300005616 Bacteria 1930
172 Ga0068851_10002928 3300005834 Bacteria 7541
173 Ga0068851_10076432 3300005834 Bacteria 1741
174 Ga0068851_10233816 3300005834 Bacteria 1037
175 Ga0068858_100050627 3300005842 Bacteria 3844
176 Ga0075364_10001078 3300006051 Bacteria 14541
177 Ga0075364_10226279 3300006051 Bacteria 1270
178 Ga0075369_10023521 3300006186 Bacteria 2548
179 Ga0075366_10213942 3300006195 Bacteria 1174
180 Ga0075430_100037292 3300006846 Bacteria 4121
181 Ga0075431_100000766 3300006847 Bacteria 27825
182 Ga0075429_100107656 3300006880 Bacteria 2436
183 Ga0105244_10012826 3300009036 Bacteria 4936
184 Ga0105240_10000179 3300009093 Bacteria 128695
185 Ga0105240_10133502 3300009093 Bacteria 2975
186 Ga0105240_10170660 3300009093 Bacteria 2577
187 Ga0105240_10188660 3300009093 Bacteria 2426
188 Ga0105240_10469567 3300009093 Bacteria 1404
189 Ga0105240_10718849 3300009093 Bacteria 1089
190 Ga0105247_10033012 3300009101 Bacteria 3146
191 Ga0105243_10160102 3300009148 Bacteria 1940
192 Ga0105241_10118974 3300009174 Bacteria 2124
193 Ga0105237_10000022 3300009545 Bacteria 228427
194 Ga0105237_10000027 3300009545 Bacteria 205777
195 Ga0105237_10105227 3300009545 Bacteria 2813
196 Ga0105237_10175322 3300009545 Bacteria 2144
197 Ga0105238_10000680 3300009551 Bacteria 35775
198 Ga0105238_10013264 3300009551 Bacteria 8315
199 Ga0105238_10018302 3300009551 Bacteria 7129
200 Ga0105238_10046801 3300009551 Bacteria 4362
201 Ga0105238_10299580 3300009551 Bacteria 1591
202 Ga0105238_10526534 3300009551 Bacteria 1185
203 Ga0105239_10000273 3300010375 Bacteria 75974
204 Ga0105239_10009138 3300010375 Bacteria 11211
205 Ga0105239_10025459 3300010375 Bacteria 6515
206 Ga0105239_10249342 3300010375 Bacteria 1994
207 Ga0157314_1000005 3300012500 Bacteria 31285
208 Ga0157373_10016190 3300013100 Bacteria 5442
209 Ga0157373_10033016 3300013100 Bacteria 3725
210 Ga0157373_10048396 3300013100 Bacteria 3031
211 Ga0157373_10372328 3300013100 Bacteria 1021
212 Ga0157371_10006745 3300013102 Bacteria 9388
213 Ga0157371_10023643 3300013102 Bacteria 4494
214 Ga0157371_10230542 3300013102 Bacteria 1331
215 Ga0157370_10000076 3300013104 Bacteria 107887
216 Ga0157370_10000664 3300013104 Bacteria 42816
217 Ga0157370_10001560 3300013104 Bacteria 28402
218 Ga0157370_10007105 3300013104 Bacteria 12221
219 Ga0157370_10010296 3300013104 Bacteria 9865
220 Ga0157370_10042132 3300013104 Bacteria 4401
221 Ga0157370_10129227 3300013104 Bacteria 2357
222 Ga0157370_10238871 3300013104 Bacteria 1681
223 Ga0157370_10371330 3300013104 Bacteria 1318
224 Ga0157370_10642734 3300013104 Bacteria 970
225 Ga0157369_10003428 3300013105 Bacteria 18812
226 Ga0157369_10074318 3300013105 Bacteria 3645
227 Ga0157369_10175636 3300013105 Bacteria 2255
228 Ga0157369_10393625 3300013105 Bacteria 1438
229 Ga0157369_10621853 3300013105 Bacteria 1114
230 Ga0163162_10002978 3300013306 Bacteria 16177
231 Ga0163162_10227996 3300013306 Bacteria 1993
232 Ga0157372_10007798 3300013307 Bacteria 11371
233 Ga0157372_10026755 3300013307 Bacteria 6278
234 Ga0157372_10042985 3300013307 Bacteria 5002
235 Ga0157372_10084098 3300013307 Bacteria 3605
236 Ga0157372_10142612 3300013307 Bacteria 2762
237 Ga0157372_10170706 3300013307 Bacteria 2516
238 Ga0157372_10375731 3300013307 Bacteria 1656
239 Ga0157372_10695419 3300013307 Bacteria 1183
240 Ga0157372_11054508 3300013307 Bacteria 941
241 Ga0182008_10002453 3300014497 Bacteria 11616
242 Ga0182008_10016178 3300014497 Bacteria 3881
243 Ga0182008_10042827 3300014497 Bacteria 2255
244 Ga0182008_10061564 3300014497 Bacteria 1850
245 Ga0157376_10012423 3300014969 Bacteria 6321
246 Ga0182006_1000023 3300015261 Bacteria 275031
247 Ga0182006_1000082 3300015261 Bacteria 119023
248 Ga0182006_1000161 3300015261 Bacteria 71421
249 Ga0182006_1008097 3300015261 Bacteria 4773
250 Ga0182006_1065136 3300015261 Bacteria 1365
251 Ga0182007_10002295 3300015262 Bacteria 9628
252 Ga0182007_10030957 3300015262 Bacteria 1825
253 Ga0182007_10040964 3300015262 Bacteria 1545
254 Ga0182005_1000006 3300015265 Bacteria 515188
255 Ga0182005_1000015 3300015265 Bacteria 387565
256 Ga0182005_1002057 3300015265 Bacteria 7529
257 Ga0182005_1005858 3300015265 Bacteria 3807
258 Ga0183369_1011 3300015685 Bacteria 252490
259 Ga0183368_1007 3300015687 Bacteria 405609
260 Ga0163161_10001649 3300017792 Bacteria 16394
261 Ga0163161_10073822 3300017792 Bacteria 2500
262 Ga0163161_10082422 3300017792 Bacteria 2370
263 Ga0197907_11023788 3300020069 Bacteria 2849
264 Ga0206356_10873902 3300020070 Bacteria 1466
265 Ga0206351_10563863 3300020077 Bacteria 1770
266 Ga0206352_10886806 3300020078 Bacteria 1995
267 Ga0206350_11570562 3300020080 Bacteria 1704
268 Ga0206354_10175486 3300020081 Bacteria 1338
269 Ga0206354_10215344 3300020081 Bacteria 1554
270 Ga0206353_10068883 3300020082 Bacteria 3956
271 Ga0154015_1110485 3300020610 Bacteria 2092
272 Ga0154015_1622279 3300020610 Bacteria 3372
273 Ga0213872_10000007 3300021361 Bacteria 228206
274 Ga0213872_10000169 3300021361 Bacteria 58596
275 Ga0213872_10000313 3300021361 Bacteria 41306
276 Ga0213872_10005704 3300021361 Bacteria 6340
277 Ga0213872_10010012 3300021361 Bacteria 4524
278 Ga0209760_101500 3300025207 Bacteria 2435
279 Ga0209784_100094 3300025224 Bacteria 113434
280 Ga0209566_101050 3300025225 Bacteria 11196
281 Ga0209674_100037 3300025226 Bacteria 404339
282 Ga0209674_100059 3300025226 Bacteria 282517
283 Ga0209674_100504 3300025226 Bacteria 16095
284 Ga0209672_100004 3300025228 Bacteria 1467504
285 Ga0209672_100008 3300025228 Bacteria 946876
286 Ga0209672_100148 3300025228 Bacteria 62818
287 Ga0209672_101410 3300025228 Bacteria 8763
288 Ga0209672_101512 3300025228 Bacteria 8082
289 Ga0209672_104778 3300025228 Bacteria 2452
290 Ga0209672_107879 3300025228 Bacteria 1613
291 Ga0209147_104519 3300025229 Bacteria 2297
292 Ga0209563_100013 3300025230 Bacteria 941463
293 Ga0209563_100036 3300025230 Bacteria 448275
294 Ga0207427_100037 3300025231 Bacteria 303108
295 Ga0207427_100068 3300025231 Bacteria 164460
296 Ga0207427_100100 3300025231 Bacteria 121264
297 Ga0207427_100143 3300025231 Bacteria 82800
298 Ga0207427_103939 3300025231 Bacteria 2747
299 Ga0207427_112452 3300025231 Bacteria 850
300 Ga0209437_100005 3300025233 Bacteria 1071596
301 Ga0209437_100059 3300025233 Bacteria 355048
302 Ga0209437_100213 3300025233 Bacteria 107087
303 Ga0209437_100285 3300025233 Bacteria 74366
304 Ga0209437_100305 3300025233 Bacteria 67799
305 Ga0209437_100382 3300025233 Bacteria 43727
306 Ga0209437_101844 3300025233 Bacteria 4498
307 Ga0209437_102036 3300025233 Bacteria 4123
308 Ga0209258_100003 3300025242 Bacteria 1467504
309 Ga0209258_100004 3300025242 Bacteria 1376422
310 Ga0209258_100008 3300025242 Bacteria 1009355
311 Ga0209258_100034 3300025242 Bacteria 437372
312 Ga0209258_100057 3300025242 Bacteria 334259
313 Ga0209258_100106 3300025242 Bacteria 206622
314 Ga0209258_100599 3300025242 Bacteria 29609
315 Ga0209258_104844 3300025242 Bacteria 2426
316 Ga0207425_1000176 3300025245 Bacteria 52680
317 Ga0209646_1000125 3300025246 Bacteria 135847
318 Ga0209646_1001441 3300025246 Bacteria 6383
319 Ga0209646_1002300 3300025246 Bacteria 4348
320 Ga0209646_1002924 3300025246 Bacteria 3559
321 Ga0209026_1000081 3300025250 Bacteria 196861
322 Ga0209026_1000161 3300025250 Bacteria 102959
323 Ga0209026_1000203 3300025250 Bacteria 82196
324 Ga0209026_1001231 3300025250 Bacteria 11730
325 Ga0209026_1005580 3300025250 Bacteria 3338
326 Ga0209026_1009282 3300025250 Bacteria 1947
327 Ga0209026_1010342 3300025250 Bacteria 1745
328 Ga0209026_1011425 3300025250 Bacteria 1601
329 Ga0209677_104649 3300025253 Bacteria 3878
330 Ga0209148_1000001 3300025254 Bacteria 2545271
331 Ga0209148_1000016 3300025254 Bacteria 804369
332 Ga0209148_1000042 3300025254 Bacteria 464111
333 Ga0209148_1000055 3300025254 Bacteria 367500
334 Ga0209148_1000068 3300025254 Bacteria 335510
335 Ga0209148_1000200 3300025254 Bacteria 107200
336 Ga0209148_1000470 3300025254 Bacteria 42979
337 Ga0209148_1001090 3300025254 Bacteria 16409
338 Ga0209759_1000117 3300025256 Bacteria 141785
339 Ga0209759_1000185 3300025256 Bacteria 100505
340 Ga0209759_1000786 3300025256 Bacteria 26464
341 Ga0209759_1004673 3300025256 Bacteria 5020
342 Ga0209759_1006478 3300025256 Bacteria 3926
343 Ga0209759_1018116 3300025256 Bacteria 1711
344 Ga0209129_1002035 3300025258 Bacteria 10457
345 Ga0209233_1000002 3300025261 Bacteria 2501366
346 Ga0209233_1000011 3300025261 Bacteria 1071611
347 Ga0209233_1000096 3300025261 Bacteria 303482
348 Ga0209233_1000172 3300025261 Bacteria 146504
349 Ga0209455_1000004 3300025272 Bacteria 1467504
350 Ga0209455_1000007 3300025272 Bacteria 1157983
351 Ga0209455_1000016 3300025272 Bacteria 753097
352 Ga0209455_1000031 3300025272 Bacteria 519952
353 Ga0209455_1000054 3300025272 Bacteria 358936
354 Ga0209455_1000103 3300025272 Bacteria 201664
355 Ga0209455_1000142 3300025272 Bacteria 138027
356 Ga0209455_1000198 3300025272 Bacteria 87559
357 Ga0209455_1012194 3300025272 Bacteria 2072
358 Ga0209025_1003577 3300025294 Bacteria 14530
359 Ga0209564_1000010 3300025295 Bacteria 885399
360 Ga0209564_1000042 3300025295 Bacteria 392805
361 Ga0209758_1000452 3300025297 Bacteria 68495
362 Ga0209758_1006831 3300025297 Bacteria 7993
363 Ga0209758_1032810 3300025297 Bacteria 2100
364 Ga0209256_1006536 3300025299 Bacteria 6118
365 Ga0209051_1001853 3300025303 Bacteria 16660
366 Ga0207656_10022392 3300025321 Bacteria 2535
367 Ga0207655_1001557 3300025728 Bacteria 20676
368 Ga0207655_1005830 3300025728 Bacteria 8274
369 Ga0207642_10241978 3300025899 Bacteria 1019
370 Ga0207710_10028439 3300025900 Bacteria 2427
371 Ga0207680_10000003 3300025903 Bacteria 925264
372 Ga0207647_10000005 3300025904 Bacteria 223490
373 Ga0207647_10000581 3300025904 Bacteria 28436
374 Ga0207647_10001393 3300025904 Bacteria 18564
375 Ga0207647_10003754 3300025904 Bacteria 11351
376 Ga0207647_10017619 3300025904 Bacteria 4853
377 Ga0207647_10059842 3300025904 Bacteria 2330
378 Ga0207705_10001879 3300025909 Bacteria 16477
379 Ga0207705_10002720 3300025909 Bacteria 13549
380 Ga0207705_10015405 3300025909 Bacteria 5486
381 Ga0207705_10025781 3300025909 Bacteria 4194
382 Ga0207705_10027814 3300025909 Bacteria 4032
383 Ga0207705_10047450 3300025909 Bacteria 3088
384 Ga0207705_10242191 3300025909 Bacteria 1374
385 Ga0207654_10117842 3300025911 Bacteria 1662
386 Ga0207654_10403350 3300025911 Bacteria 951
387 Ga0207707_10000105 3300025912 Bacteria 83206
388 Ga0207707_10000306 3300025912 Bacteria 51447
389 Ga0207707_10003824 3300025912 Bacteria 13336
390 Ga0207707_10006628 3300025912 Bacteria 10102
391 Ga0207707_10008190 3300025912 Bacteria 9072
392 Ga0207707_10049572 3300025912 Bacteria 3658
393 Ga0207707_10096773 3300025912 Bacteria 2579
394 Ga0207707_10372631 3300025912 Bacteria 1228
395 Ga0207707_10441134 3300025912 Bacteria 1114
396 Ga0207695_10000100 3300025913 Bacteria 258626
397 Ga0207695_10000265 3300025913 Bacteria 132524
398 Ga0207695_10000362 3300025913 Bacteria 104132
399 Ga0207695_10007089 3300025913 Bacteria 14361
400 Ga0207695_10023320 3300025913 Bacteria 6997
401 Ga0207695_10029291 3300025913 Bacteria 6088
402 Ga0207695_10054572 3300025913 Bacteria 4171
403 Ga0207695_10161160 3300025913 Bacteria 2175
404 Ga0207671_10000009 3300025914 Bacteria 724862
405 Ga0207671_10002579 3300025914 Bacteria 19142
406 Ga0207671_10242687 3300025914 Bacteria 1415
407 Ga0207671_10350960 3300025914 Bacteria 1170
408 Ga0207693_10044732 3300025915 Bacteria 3479
409 Ga0207693_10319727 3300025915 Bacteria 1215
410 Ga0207660_10007927 3300025917 Bacteria 6871
411 Ga0207660_10021385 3300025917 Bacteria 4350
412 Ga0207660_10028914 3300025917 Bacteria 3797
413 Ga0207660_10061382 3300025917 Bacteria 2705
414 Ga0207660_10360329 3300025917 Bacteria 1166
415 Ga0207657_10006894 3300025919 Bacteria 11719
416 Ga0207657_10013655 3300025919 Bacteria 7960
417 Ga0207657_10026405 3300025919 Bacteria 5338
418 Ga0207657_10031500 3300025919 Bacteria 4802
419 Ga0207657_10062434 3300025919 Bacteria 3190
420 Ga0207657_10085072 3300025919 Bacteria 2650
421 Ga0207649_10014184 3300025920 Bacteria 4459
422 Ga0207649_10017714 3300025920 Bacteria 4038
423 Ga0207649_10028347 3300025920 Bacteria 3296
424 Ga0207649_10031082 3300025920 Bacteria 3170
425 Ga0207649_10047425 3300025920 Bacteria 2644
426 Ga0207649_10049980 3300025920 Bacteria 2585
427 Ga0207652_10000048 3300025921 Bacteria 124452
428 Ga0207652_10000117 3300025921 Bacteria 87807
429 Ga0207652_10007462 3300025921 Bacteria 8817
430 Ga0207652_10040878 3300025921 Bacteria 3939
431 Ga0207652_10056875 3300025921 Bacteria 3368
432 Ga0207652_10092844 3300025921 Bacteria 2655
433 Ga0207694_10001193 3300025924 Bacteria 22516
434 Ga0207694_10030578 3300025924 Bacteria 4112
435 Ga0207694_10048583 3300025924 Bacteria 3283
436 Ga0207694_10217011 3300025924 Bacteria 1559
437 Ga0207650_10017054 3300025925 Bacteria 5083
438 Ga0207700_10005894 3300025928 Bacteria 7367
439 Ga0207664_10000587 3300025929 Bacteria 25388
440 Ga0207664_10014209 3300025929 Bacteria 5741
441 Ga0207664_10060545 3300025929 Bacteria 3017
442 Ga0207690_10000350 3300025932 Bacteria 30729
443 Ga0207690_10001768 3300025932 Bacteria 13287
444 Ga0207690_10017611 3300025932 Bacteria 4367
445 Ga0207690_10027938 3300025932 Bacteria 3570
446 Ga0207690_10153152 3300025932 Bacteria 1711
447 Ga0207690_10218057 3300025932 Bacteria 1458
448 Ga0207706_10044138 3300025933 Bacteria 3951
449 Ga0207706_10054512 3300025933 Bacteria 3529
450 Ga0207706_10071145 3300025933 Bacteria 3059
451 Ga0207706_10366002 3300025933 Bacteria 1252
452 Ga0207670_10000825 3300025936 Bacteria 16217
453 Ga0207670_10051873 3300025936 Bacteria 2757
454 Ga0207689_10250107 3300025942 Bacteria 1466
455 Ga0207661_10030600 3300025944 Bacteria 4148
456 Ga0207661_10065407 3300025944 Bacteria 2951
457 Ga0207679_10063309 3300025945 Bacteria 2760
458 Ga0207679_10341282 3300025945 Bacteria 1303
459 Ga0207667_10000262 3300025949 Bacteria 73170
460 Ga0207667_10000329 3300025949 Bacteria 65667
461 Ga0207667_10005935 3300025949 Bacteria 14872
462 Ga0207667_10007913 3300025949 Bacteria 12694
463 Ga0207667_10008462 3300025949 Bacteria 12220
464 Ga0207667_10011996 3300025949 Bacteria 10032
465 Ga0207667_10014550 3300025949 Bacteria 8964
466 Ga0207667_10032082 3300025949 Bacteria 5663
467 Ga0207667_10119132 3300025949 Bacteria 2720
468 Ga0207667_10277607 3300025949 Bacteria 1712
469 Ga0207651_10107959 3300025960 Bacteria 2082
470 Ga0207668_10012530 3300025972 Bacteria 5194
471 Ga0207640_10000116 3300025981 Bacteria 60174
472 Ga0207640_10000556 3300025981 Bacteria 22318
473 Ga0207640_10009889 3300025981 Bacteria 5354
474 Ga0207640_10010775 3300025981 Bacteria 5158
475 Ga0207640_10012132 3300025981 Bacteria 4899
476 Ga0207640_10057601 3300025981 Bacteria 2557
477 Ga0207640_10126109 3300025981 Bacteria 1843
478 Ga0207640_10147372 3300025981 Bacteria 1724
479 Ga0207658_10025713 3300025986 Bacteria 4123
480 Ga0207703_10221920 3300026035 Bacteria 1690
481 Ga0207639_10001438 3300026041 Bacteria 16052
482 Ga0207639_10003605 3300026041 Bacteria 10401
483 Ga0207678_10005060 3300026067 Bacteria 11825
484 Ga0207678_10010644 3300026067 Bacteria 8081
485 Ga0207678_10029060 3300026067 Bacteria 4825
486 Ga0207678_10033693 3300026067 Bacteria 4461
487 Ga0207678_10054114 3300026067 Bacteria 3457
488 Ga0207678_10088271 3300026067 Bacteria 2650
489 Ga0207678_10136681 3300026067 Bacteria 2091
490 Ga0207678_10349846 3300026067 Bacteria 1274
491 Ga0207678_10389334 3300026067 Bacteria 1206
492 Ga0207708_10079581 3300026075 Bacteria 2517
493 Ga0207702_10000279 3300026078 Bacteria 58912
494 Ga0207702_10001944 3300026078 Bacteria 20145
495 Ga0207702_10025547 3300026078 Bacteria 4903
496 Ga0207702_10091588 3300026078 Bacteria 2662
497 Ga0207702_10131275 3300026078 Bacteria 2255
498 Ga0207674_10000879 3300026116 Bacteria 39305
499 Ga0207674_10015601 3300026116 Bacteria 8341
500 Ga0207674_10016923 3300026116 Bacteria 7963
501 Ga0207674_10034835 3300026116 Bacteria 5258
502 Ga0207674_10641590 3300026116 Bacteria 1025
503 Ga0207698_10007614 3300026142 Bacteria 6790
504 Ga0207698_10023349 3300026142 Bacteria 4318
505 Ga0207698_10328999 3300026142 Bacteria 1434
506 Ga0207698_10810188 3300026142 Bacteria 939
507 Ga0209281_1004779 3300027111 Bacteria 3952
508 Ga0268266_10000011 3300028379 Bacteria 757403
509 Ga0268265_10228944 3300028380 Bacteria 1632
510 Ga0268264_10137621 3300028381 Bacteria 2173
511 Ga0307515_10349100 3300028794 Bacteria 1127
512 Ga0316177_1120559 3300030731 Bacteria 5084
513 Ga0316180_1185546 3300030736 Bacteria 3201
514 Ga0316181_1136479 3300030744 Bacteria 2892
515 Ga0316182_1306192 3300030745 Bacteria 1398
516 Ga0265332_10036363 3300031238 Bacteria 2138
517 Ga0265328_10119248 3300031239 Bacteria 983
518 Ga0265331_10009412 3300031250 Bacteria 5484
519 Ga0265327_10000012 3300031251 Bacteria 530403
520 Ga0307408_100000109 3300031548 Bacteria 91284
521 Ga0307408_100044158 3300031548 Bacteria 3175
522 Ga0265314_10019340 3300031711 Bacteria 5278
523 Ga0307405_10171203 3300031731 Bacteria 1549
524 Ga0307413_10132395 3300031824 Bacteria 1709
525 Ga0307407_10046980 3300031903 Bacteria 2447
526 Ga0307412_10008980 3300031911 Bacteria 5726
527 Ga0307414_10067313 3300032004 Bacteria 2565
528 Ga0307411_10001682 3300032005 Bacteria 9259
529 Ga0316583_10000295 3300032133 Bacteria 13972
530 Ga0307510_10004626 3300033180 Bacteria 16229
531 Ga0373948_0016998 3300034817 Bacteria 1351
532 Ga0373959_0052824 3300034820 Bacteria 881
533 Ga0373940_0047210 3300035088 Bacteria 1200
534 Ga0373939_0000040 3300035114 Bacteria 45617
535 Ga0373960_0000506 3300035121 Bacteria 7775
536 Ga0373962_0014344 3300035242 Bacteria 2019
537 Ga0373931_0000637 3300035691 Bacteria 14552
538 Ga0395899_0000047 3300037312 Bacteria 233482
539 Ga0395899_0003695 3300037312 Bacteria 12110
540 Ga0395899_0006107 3300037312 Bacteria 9339
541 Ga0395899_0025244 3300037312 Bacteria 4486
542 Ga0395899_0042012 3300037312 Bacteria 3414
543 Ga0395899_0042834 3300037312 Bacteria 3377
544 Ga0395899_0045216 3300037312 Bacteria 3280
545 Ga0395900_0000011 3300037418 Bacteria 421926
546 Ga0395900_0000239 3300037418 Bacteria 86321
547 Ga0395900_0000733 3300037418 Bacteria 43644
548 Ga0395900_0001714 3300037418 Bacteria 25336
549 Ga0395900_0011101 3300037418 Bacteria 9206
550 Ga0395900_0062999 3300037418 Bacteria 3811
551 Ga0395900_0070686 3300037418 Bacteria 3588
552 Ga0395900_0148552 3300037418 Bacteria 2395
553 Ga0395898_0000029 3300037466 Bacteria 370667
554 Ga0395898_0000336 3300037466 Bacteria 106457
555 Ga0395898_0011209 3300037466 Bacteria 9331
556 Ga0395898_0022841 3300037466 Bacteria 6328
557 Ga0395898_0069011 3300037466 Bacteria 3420
558 Ga0395898_0159338 3300037466 Bacteria 2158
559 Ga0395898_0254277 3300037466 Bacteria 1675
560 Ga0395905_0013255 3300037471 Bacteria 7906
561 Ga0395905_0044043 3300037471 Bacteria 4188
562 Ga0395905_0331832 3300037471 Bacteria 1412
563 Ga0395901_0006758 3300038443 Bacteria 11584
564 Ga0395901_0048940 3300038443 Bacteria 4390
565 Ga0395901_0110528 3300038443 Bacteria 2885
566 Ga0395901_0169539 3300038443 Bacteria 2290
567 Ga0395901_0215092 3300038443 Bacteria 2010
568 Ga0395901_0732177 3300038443 Bacteria 983
569 Ga0436361_0031960 3300039447 Bacteria 30752
570 Ga0436361_0094944 3300039447 Bacteria 20715
571 Ga0436361_0159126 3300039447 Bacteria 34073
572 Ga0436361_0163583 3300039447 Bacteria 173204
573 Ga0436361_0280882 3300039447 Bacteria 4449
574 Ga0436361_0374453 3300039447 Bacteria 1446
575 Ga0439436_0000023 3300041404 Bacteria 58899
576 Ga0439465_0000150 3300041413 Bacteria 17137
577 Ga0451793_1432460 3300041452 Bacteria 4648
578 Ga0439437_000188 3300042000 Bacteria 5331
579 Ga0439448_0016864 3300042005 Bacteria 2226
580 Ga0439455_0011341 3300042012 Bacteria 1977
581 Ga0439455_0050080 3300042012 Bacteria 1090
582 Ga0450904_000603 3300042139 Bacteria 6675
583 Ga0450908_000188 3300042184 Bacteria 12641
584 Ga0439459_0011451 3300042438 Bacteria 1563
585 Ga0439459_0020856 3300042438 Bacteria 1254
586 Ga0466969_0001366 3300044656 Bacteria 13145
587 Ga0466969_0010929 3300044656 Bacteria 4807
588 Ga0466969_0040498 3300044656 Bacteria 2334
589 Ga0466972_0003714 3300044658 Bacteria 7595
590 Ga0466982_0000001 3300044672 Bacteria 514662
591 Ga0466982_0000024 3300044672 Bacteria 76608
592 Ga0466965_0009221 3300044683 Bacteria 4583
593 Ga0466965_0024439 3300044683 Bacteria 2922
594 Ga0466965_0077001 3300044683 Bacteria 1684
595 Ga0466965_0096651 3300044683 Bacteria 1507
596 Ga0466966_0006112 3300044684 Bacteria 7955
597 Ga0466966_0010252 3300044684 Bacteria 6217
598 Ga0466961_0004973 3300044693 Bacteria 8359
599 Ga0466961_0008608 3300044693 Bacteria 6503
600 Ga0466961_0029378 3300044693 Bacteria 3534
601 Ga0466961_0056440 3300044693 Bacteria 2502
602 Ga0466961_0112683 3300044693 Bacteria 1710
603 Ga0466964_0010672 3300044706 Bacteria 3466
604 Ga0466964_0030658 3300044706 Bacteria 2129
605 Ga0466964_0070543 3300044706 Bacteria 1476
606 Ga0453684_0003881 3300044712 Bacteria 32897
607 Ga0453684_0391957 3300044712 Bacteria 1557
608 Ga0466971_0005812 3300044719 Bacteria 5369
609 Ga0466968_0000976 3300044735 Bacteria 10063
610 Ga0466968_0020136 3300044735 Bacteria 2689
611 Ga0466968_0228957 3300044735 Bacteria 877
612 Ga0466970_0014053 3300044765 Bacteria 4105
613 Ga0466970_0047688 3300044765 Bacteria 2283
614 Ga0466970_0173150 3300044765 Bacteria 1196
615 Ga0466957_0000178 3300044842 Bacteria 28520
616 Ga0466957_0004423 3300044842 Bacteria 7823
617 Ga0466957_0019017 3300044842 Bacteria 4039
618 Ga0466957_0077258 3300044842 Bacteria 2068
619 Ga0466957_0087133 3300044842 Bacteria 1952
620 Ga0466957_0146696 3300044842 Bacteria 1523
621 Ga0466960_0005551 3300044901 Bacteria 5002
622 Ga0466959_0000006 3300045049 Bacteria 192678
623 Ga0466959_0021639 3300045049 Bacteria 4746
624 Ga0466959_0063844 3300045049 Bacteria 2673
625 Ga0466959_0175839 3300045049 Bacteria 1499
626 Ga0466959_0185192 3300045049 Bacteria 1455
627 Ga0451576_0000313 3300045051 Bacteria 117520
628 Ga0451576_0089766 3300045051 Bacteria 3196
629 Ga0451576_0094129 3300045051 Bacteria 3115
630 Ga0466958_0078058 3300045836 Bacteria 2034
631 Ga0466958_0251184 3300045836 Bacteria 1131
632 Ga0466967_0006764 3300045976 Bacteria 8163
633 Ga0495617_000020 3300046452 Bacteria 230257
634 Ga0495617_000040 3300046452 Bacteria 126637
635 Ga0495617_001037 3300046452 Bacteria 12760
636 Ga0495617_003735 3300046452 Bacteria 5656
637 Ga0495627_000170 3300046453 Bacteria 74046
638 Ga0495627_051134 3300046453 Bacteria 1243
639 Ga0495603_0019247 3300046455 Bacteria 4133
640 Ga0495590_0000012 3300046457 Bacteria 303377
641 Ga0495590_0013619 3300046457 Bacteria 2985
642 Ga0495590_0032283 3300046457 Bacteria 1831
643 Ga0495638_0000047 3300046460 Bacteria 216004
644 Ga0495638_0000060 3300046460 Bacteria 190580
645 Ga0495638_0000251 3300046460 Bacteria 73147
646 Ga0495638_0000324 3300046460 Bacteria 60721
647 Ga0495638_0000429 3300046460 Bacteria 50776
648 Ga0495638_0008349 3300046460 Bacteria 7346
649 Ga0495638_0088513 3300046460 Bacteria 1869
650 Ga0495638_0260126 3300046460 Bacteria 952
651 Ga0495653_0000035 3300046463 Bacteria 129875
652 Ga0495653_0037052 3300046463 Bacteria 3836
653 Ga0495653_0050481 3300046463 Bacteria 3199
654 Ga0495650_0000077 3300046471 Bacteria 245511
655 Ga0495650_0000092 3300046471 Bacteria 224681
656 Ga0495650_0000128 3300046471 Bacteria 177256
657 Ga0495650_0000157 3300046471 Bacteria 155023
658 Ga0495650_0000167 3300046471 Bacteria 145804
659 Ga0495650_0000261 3300046471 Bacteria 101830
660 Ga0495650_0000852 3300046471 Bacteria 36650
661 Ga0495650_0001533 3300046471 Bacteria 21946
662 Ga0495650_0002873 3300046471 Bacteria 13135
663 Ga0495650_0008544 3300046471 Bacteria 5956
664 Ga0495580_0056681 3300046472 Bacteria 2758
665 Ga0495582_0033983 3300046473 Bacteria 2803
666 Ga0495605_0000018 3300046474 Bacteria 270187
667 Ga0495605_0000055 3300046474 Bacteria 157514
668 Ga0495605_0009789 3300046474 Bacteria 5380
669 Ga0495605_0014043 3300046474 Bacteria 4393
670 Ga0495605_0040636 3300046474 Bacteria 2321
671 Ga0495639_0015928 3300046475 Bacteria 3260
672 Ga0495639_0072920 3300046475 Bacteria 1588
673 Ga0495584_0000004 3300046491 Bacteria 314714
674 Ga0495584_0000073 3300046491 Bacteria 72062
675 Ga0495584_0000565 3300046491 Bacteria 24922
676 Ga0495584_0001199 3300046491 Bacteria 15941
677 Ga0495584_0001324 3300046491 Bacteria 15018
678 Ga0495584_0006743 3300046491 Bacteria 6002
679 Ga0495584_0022350 3300046491 Bacteria 3209
680 Ga0495584_0026921 3300046491 Bacteria 2914
681 Ga0495585_0000024 3300046492 Bacteria 148384
682 Ga0495585_0001611 3300046492 Bacteria 17407
683 Ga0495585_0001698 3300046492 Bacteria 16806
684 Ga0495585_0002189 3300046492 Bacteria 14194
685 Ga0495585_0005917 3300046492 Bacteria 7653
686 Ga0495585_0006008 3300046492 Bacteria 7597
687 Ga0495585_0006253 3300046492 Bacteria 7417
688 Ga0495585_0008654 3300046492 Bacteria 6156
689 Ga0495585_0016931 3300046492 Bacteria 4220
690 Ga0495585_0042253 3300046492 Bacteria 2554
691 Ga0495585_0232241 3300046492 Bacteria 926
692 Ga0495594_0016561 3300046499 Bacteria 3885
693 Ga0495594_0088201 3300046499 Bacteria 1736
694 Ga0495594_0155058 3300046499 Bacteria 1300
695 Ga0495596_0000348 3300046500 Bacteria 29917
696 Ga0495596_0012319 3300046500 Bacteria 3664
697 Ga0495607_0000034 3300046501 Bacteria 147547
698 Ga0495607_0000616 3300046501 Bacteria 34506
699 Ga0495607_0001560 3300046501 Bacteria 20071
700 Ga0495607_0002674 3300046501 Bacteria 14244
701 Ga0495607_0002757 3300046501 Bacteria 14009
702 Ga0495607_0003655 3300046501 Bacteria 11676
703 Ga0495607_0007691 3300046501 Bacteria 7428
704 Ga0495607_0008233 3300046501 Bacteria 7135
705 Ga0495607_0035113 3300046501 Bacteria 3036
706 Ga0495607_0046652 3300046501 Bacteria 2543
707 Ga0495607_0057791 3300046501 Bacteria 2221
708 Ga0495583_0000132 3300046506 Bacteria 125343
709 Ga0495583_0000898 3300046506 Bacteria 35571
710 Ga0495583_0001083 3300046506 Bacteria 30244
711 Ga0495583_0002214 3300046506 Bacteria 17208
712 Ga0495583_0007998 3300046506 Bacteria 6537
713 Ga0495583_0016026 3300046506 Bacteria 4046
714 Ga0495606_0000228 3300046507 Bacteria 99761
715 Ga0495606_0000512 3300046507 Bacteria 63012
716 Ga0495606_0000572 3300046507 Bacteria 58413
717 Ga0495606_0000790 3300046507 Bacteria 48364
718 Ga0495606_0000829 3300046507 Bacteria 46771
719 Ga0495606_0000902 3300046507 Bacteria 44174
720 Ga0495606_0000923 3300046507 Bacteria 43313
721 Ga0495606_0001799 3300046507 Bacteria 27290
722 Ga0495606_0003321 3300046507 Bacteria 17178
723 Ga0495606_0005323 3300046507 Bacteria 12372
724 Ga0495606_0020549 3300046507 Bacteria 4863
725 Ga0495606_0026284 3300046507 Bacteria 4151
726 Ga0495606_0032285 3300046507 Bacteria 3629
727 Ga0495606_0035596 3300046507 Bacteria 3401
728 Ga0495606_0128545 3300046507 Bacteria 1508
729 Ga0495606_0163980 3300046507 Bacteria 1294
730 Ga0495606_0181875 3300046507 Bacteria 1211
731 Ga0495606_0187393 3300046507 Bacteria 1188
732 Ga0495610_0000014 3300046512 Bacteria 444708
733 Ga0495610_0002535 3300046512 Bacteria 15238
734 Ga0495610_0004230 3300046512 Bacteria 10694
735 Ga0495610_0006774 3300046512 Bacteria 7774
736 Ga0495610_0020967 3300046512 Bacteria 3607
737 Ga0495610_0024515 3300046512 Bacteria 3253
738 Ga0495610_0039615 3300046512 Bacteria 2381
739 Ga0495616_0000090 3300046513 Bacteria 76632
740 Ga0495616_0000157 3300046513 Bacteria 59518
741 Ga0495616_0002573 3300046513 Bacteria 11943
742 Ga0495616_0027100 3300046513 Bacteria 3043
743 Ga0495616_0034543 3300046513 Bacteria 2625
744 Ga0495620_0000117 3300046515 Bacteria 63752
745 Ga0495620_0005054 3300046515 Bacteria 7389
746 Ga0495620_0021550 3300046515 Bacteria 3127
747 Ga0495630_0010470 3300046517 Bacteria 6698
748 Ga0495631_0000049 3300046518 Bacteria 72261
749 Ga0495631_0000130 3300046518 Bacteria 50580
750 Ga0495631_0001932 3300046518 Bacteria 12166
751 Ga0495631_0016829 3300046518 Bacteria 3474
752 Ga0495631_0028541 3300046518 Bacteria 2544
753 Ga0495631_0033611 3300046518 Bacteria 2302
754 Ga0495631_0065298 3300046518 Bacteria 1575
755 Ga0495631_0074108 3300046518 Bacteria 1469
756 Ga0495632_0000005 3300046519 Bacteria 362872
757 Ga0495632_0000017 3300046519 Bacteria 228941
758 Ga0495632_0000874 3300046519 Bacteria 26486
759 Ga0495632_0001146 3300046519 Bacteria 22644
760 Ga0495632_0007200 3300046519 Bacteria 7028
761 Ga0495632_0012273 3300046519 Bacteria 4945
762 Ga0495632_0038695 3300046519 Bacteria 2413
763 Ga0495632_0092403 3300046519 Bacteria 1433
764 Ga0495637_0000142 3300046520 Bacteria 54212
765 Ga0495637_0000731 3300046520 Bacteria 22394
766 Ga0495637_0005748 3300046520 Bacteria 6288
767 Ga0495637_0015478 3300046520 Bacteria 3577
768 Ga0495643_0000082 3300046522 Bacteria 159651
769 Ga0495643_0000085 3300046522 Bacteria 157223
770 Ga0495643_0000160 3300046522 Bacteria 107502
771 Ga0495643_0000399 3300046522 Bacteria 57013
772 Ga0495643_0004179 3300046522 Bacteria 10250
773 Ga0495643_0009199 3300046522 Bacteria 6165
774 Ga0495644_0003768 3300046523 Bacteria 5970
775 Ga0495644_0018445 3300046523 Bacteria 2666
776 Ga0495644_0020034 3300046523 Bacteria 2552
777 Ga0495644_0038171 3300046523 Bacteria 1812
778 Ga0495648_0000019 3300046524 Bacteria 276407
779 Ga0495648_0000449 3300046524 Bacteria 44521
780 Ga0495648_0008608 3300046524 Bacteria 8003
781 Ga0495648_0008625 3300046524 Bacteria 7996
782 Ga0495648_0012605 3300046524 Bacteria 6294
783 Ga0495648_0013009 3300046524 Bacteria 6177
784 Ga0495648_0031420 3300046524 Bacteria 3496
785 Ga0495648_0032080 3300046524 Bacteria 3452
786 Ga0495648_0039230 3300046524 Bacteria 3015
787 Ga0495648_0094804 3300046524 Bacteria 1662
788 Ga0495648_0164100 3300046524 Bacteria 1145
789 Ga0495648_0193859 3300046524 Bacteria 1023
790 Ga0495663_0120959 3300046525 Bacteria 876
791 Ga0495642_0000382 3300046528 Bacteria 23967
792 Ga0495642_0000449 3300046528 Bacteria 21699
793 Ga0495642_0000602 3300046528 Bacteria 18076
794 Ga0495642_0002330 3300046528 Bacteria 7749
795 Ga0495642_0004833 3300046528 Bacteria 5205
796 Ga0495642_0007799 3300046528 Bacteria 4102
797 Ga0495642_0018353 3300046528 Bacteria 2738
798 Ga0495642_0018703 3300046528 Bacteria 2712
799 Ga0495642_0022574 3300046528 Bacteria 2480
800 Ga0495652_0003227 3300046529 Bacteria 16263
801 Ga0495654_0000014 3300046530 Bacteria 312126
802 Ga0495654_0001451 3300046530 Bacteria 16278
803 Ga0495654_0016894 3300046530 Bacteria 3843
804 Ga0495654_0020043 3300046530 Bacteria 3491
805 Ga0495654_0025010 3300046530 Bacteria 3079
806 Ga0495665_0013361 3300046531 Bacteria 4441
807 Ga0495665_0066308 3300046531 Bacteria 1905
808 Ga0495586_0002395 3300046535 Bacteria 10187
809 Ga0495586_0300573 3300046535 Bacteria 919
810 Ga0495587_0287686 3300046536 Bacteria 920
811 Ga0495609_0000038 3300046538 Bacteria 182264
812 Ga0495609_0003103 3300046538 Bacteria 9737
813 Ga0495609_0005751 3300046538 Bacteria 6444
814 Ga0495609_0012193 3300046538 Bacteria 4078
815 Ga0495609_0023023 3300046538 Bacteria 2866
816 Ga0495609_0053511 3300046538 Bacteria 1794
817 Ga0495609_0111069 3300046538 Bacteria 1183
818 Ga0495597_0000133 3300046542 Bacteria 67356
819 Ga0495597_0000321 3300046542 Bacteria 43353
820 Ga0495597_0000535 3300046542 Bacteria 31448
821 Ga0495597_0003877 3300046542 Bacteria 8463
822 Ga0495597_0033370 3300046542 Bacteria 2331
823 Ga0495597_0035321 3300046542 Bacteria 2254
824 Ga0495597_0035903 3300046542 Bacteria 2234
825 Ga0495645_0108053 3300046543 Bacteria 1971
826 Ga0495622_0000034 3300046557 Bacteria 123671
827 Ga0495622_0000071 3300046557 Bacteria 89071
828 Ga0495622_0010058 3300046557 Bacteria 4376
829 Ga0495622_0184220 3300046557 Bacteria 935
830 Ga0495633_0000077 3300046558 Bacteria 129051
831 Ga0495633_0000100 3300046558 Bacteria 116284
832 Ga0495633_0000217 3300046558 Bacteria 71892
833 Ga0495633_0004840 3300046558 Bacteria 8430
834 Ga0495633_0012021 3300046558 Bacteria 4625
835 Ga0495633_0016168 3300046558 Bacteria 3854
836 Ga0495633_0017411 3300046558 Bacteria 3676
837 Ga0495633_0021410 3300046558 Bacteria 3234
838 Ga0495633_0084320 3300046558 Bacteria 1478
839 Ga0495656_0002410 3300046615 Bacteria 6201
840 Ga0495656_0035248 3300046615 Bacteria 2055
841 Ga0495656_0223771 3300046615 Bacteria 942
842 Ga0495668_0000308 3300046616 Bacteria 67599
843 Ga0495668_0000692 3300046616 Bacteria 40520
844 Ga0495668_0001569 3300046616 Bacteria 21645
845 Ga0495668_0002147 3300046616 Bacteria 16956
846 Ga0495668_0008414 3300046616 Bacteria 6447
847 Ga0495668_0020832 3300046616 Bacteria 3765
848 Ga0495668_0023921 3300046616 Bacteria 3477
849 Ga0495668_0107663 3300046616 Bacteria 1524
850 Ga0495634_0008555 3300046642 Bacteria 7605
851 Ga0495611_0000005 3300046648 Bacteria 284271
852 Ga0495611_0000054 3300046648 Bacteria 81818
853 Ga0495611_0017387 3300046648 Bacteria 3076
854 Ga0495611_0020345 3300046648 Bacteria 2855
855 Ga0495611_0021970 3300046648 Bacteria 2758
856 Ga0495625_0000066 3300046660 Bacteria 172144
857 Ga0495625_0000447 3300046660 Bacteria 62017
858 Ga0495625_0001794 3300046660 Bacteria 24663
859 Ga0495625_0003312 3300046660 Bacteria 16245
860 Ga0495625_0004560 3300046660 Bacteria 13032
861 Ga0495625_0022747 3300046660 Bacteria 4799
862 Ga0495625_0040819 3300046660 Bacteria 3381
863 Ga0495625_0148103 3300046660 Bacteria 1579
864 Ga0495635_0061146 3300046663 Bacteria 2587
865 Ga0495659_0088345 3300046664 Bacteria 1187
866 Ga0495661_0001562 3300046665 Bacteria 18875
867 Ga0495661_0001766 3300046665 Bacteria 17376
868 Ga0495661_0002651 3300046665 Bacteria 13699
869 Ga0495661_0004522 3300046665 Bacteria 10019
870 Ga0495661_0016091 3300046665 Bacteria 4969
871 Ga0495661_0020306 3300046665 Bacteria 4338
872 Ga0495661_0020901 3300046665 Bacteria 4269
873 Ga0495661_0024501 3300046665 Bacteria 3905
874 Ga0495661_0039642 3300046665 Bacteria 2926
875 Ga0495661_0050888 3300046665 Bacteria 2504
876 Ga0495661_0065357 3300046665 Bacteria 2143
877 Ga0495661_0136632 3300046665 Bacteria 1337
878 Ga0495588_0000156 3300046674 Bacteria 93559
879 Ga0495588_0009796 3300046674 Bacteria 4443
880 Ga0495588_0009853 3300046674 Bacteria 4429
881 Ga0495588_0015263 3300046674 Bacteria 3693
882 Ga0495588_0017583 3300046674 Bacteria 3476
883 Ga0495588_0259627 3300046674 Bacteria 915
884 Ga0495623_0029491 3300046679 Bacteria 3530
885 Ga0495669_0000032 3300046684 Bacteria 100472
886 Ga0495669_0001016 3300046684 Bacteria 11725
887 Ga0495669_0001071 3300046684 Bacteria 11381
888 Ga0495669_0022793 3300046684 Bacteria 2722
889 Ga0495613_0065853 3300046689 Bacteria 2647
890 Ga0495624_0116858 3300046690 Bacteria 1639
891 Ga0495670_0000420 3300046691 Bacteria 20377
892 Ga0495670_0000864 3300046691 Bacteria 14678
893 Ga0495670_0000920 3300046691 Bacteria 14206
894 Ga0495670_0001653 3300046691 Bacteria 10924
895 Ga0495670_0002541 3300046691 Bacteria 9013
896 Ga0495670_0005929 3300046691 Bacteria 5982
897 Ga0495670_0008338 3300046691 Bacteria 5092
898 Ga0495670_0017952 3300046691 Bacteria 3485
899 Ga0495670_0039484 3300046691 Bacteria 2354
900 Ga0495670_0047703 3300046691 Bacteria 2141
901 Ga0495670_0107750 3300046691 Bacteria 1440
902 Ga0495671_0000005 3300046692 Bacteria 509397
903 Ga0495671_0001951 3300046692 Bacteria 13235
904 Ga0495671_0031505 3300046692 Bacteria 2711
905 Ga0495671_0058006 3300046692 Bacteria 1915
906 Ga0495671_0066347 3300046692 Bacteria 1776
907 Ga0495649_0000482 3300046694 Bacteria 34235
908 Ga0495649_0003639 3300046694 Bacteria 10284
909 Ga0495649_0006253 3300046694 Bacteria 7420
910 Ga0495649_0019405 3300046694 Bacteria 3820
911 Ga0495649_0038845 3300046694 Bacteria 2610
912 Ga0495649_0104591 3300046694 Bacteria 1503
913 Ga0495589_0000026 3300046794 Bacteria 184723
914 Ga0495589_0000074 3300046794 Bacteria 93716
915 Ga0495589_0000099 3300046794 Bacteria 83606
916 Ga0495589_0001180 3300046794 Bacteria 15566
917 Ga0495589_0009539 3300046794 Bacteria 5044
918 Ga0495589_0010526 3300046794 Bacteria 4807
919 Ga0495589_0013228 3300046794 Bacteria 4258
920 Ga0495589_0013619 3300046794 Bacteria 4193
921 Ga0495589_0021758 3300046794 Bacteria 3276
922 Ga0495600_0187892 3300046809 Bacteria 1329
923 Ga0495660_0000047 3300046810 Bacteria 149291
924 Ga0495660_0000277 3300046810 Bacteria 47885
925 Ga0495660_0001717 3300046810 Bacteria 14655
926 Ga0495660_0001878 3300046810 Bacteria 13804
927 Ga0495660_0011523 3300046810 Bacteria 5130
928 Ga0495660_0012777 3300046810 Bacteria 4872
929 Ga0495660_0015062 3300046810 Bacteria 4470
930 Ga0495660_0030739 3300046810 Bacteria 3024
931 Ga0495660_0035293 3300046810 Bacteria 2795
932 Ga0495660_0036426 3300046810 Bacteria 2744
933 Ga0495660_0049292 3300046810 Bacteria 2300
934 Ga0495636_0048329 3300047318 Bacteria 1777
935 Ga0495674_0240295 3300047319 Bacteria 1493
936 Ga0495672_0000019 3300047320 Bacteria 448153
937 Ga0495672_0000081 3300047320 Bacteria 159863
938 Ga0495672_0000256 3300047320 Bacteria 74232
939 Ga0495672_0000421 3300047320 Bacteria 50887
940 Ga0495672_0001024 3300047320 Bacteria 28735
941 Ga0495672_0011544 3300047320 Bacteria 6229
942 Ga0495672_0082434 3300047320 Bacteria 1789
943 Ga0495676_0000031 3300047321 Bacteria 132364
944 Ga0495676_0084548 3300047321 Bacteria 2394
945 Ga0495680_0100558 3300047322 Bacteria 2154
946 Ga0495683_0000385 3300047323 Bacteria 35791
947 Ga0495683_0002398 3300047323 Bacteria 11354
948 Ga0495683_0003367 3300047323 Bacteria 9341
949 Ga0495683_0006360 3300047323 Bacteria 6454
950 Ga0495683_0013798 3300047323 Bacteria 4218
951 Ga0495683_0019005 3300047323 Bacteria 3547
952 Ga0495683_0020780 3300047323 Bacteria 3385
953 Ga0495683_0056954 3300047323 Bacteria 1943
954 Ga0495687_000071 3300047443 Bacteria 159096
955 Ga0495687_000167 3300047443 Bacteria 97418
956 Ga0495687_000172 3300047443 Bacteria 95963
957 Ga0495687_000238 3300047443 Bacteria 76186
958 Ga0495687_000699 3300047443 Bacteria 37523
959 Ga0495687_003946 3300047443 Bacteria 10371
960 Ga0495675_0010506 3300047444 Bacteria 5785
961 Ga0495675_0016557 3300047444 Bacteria 4664
962 Ga0495675_0124488 3300047444 Bacteria 1604
963 Ga0495677_0000016 3300047445 Bacteria 126981
964 Ga0495677_0001268 3300047445 Bacteria 10123
965 Ga0495677_0001615 3300047445 Bacteria 9061
966 Ga0495677_0001817 3300047445 Bacteria 8535
967 Ga0495677_0008653 3300047445 Bacteria 3777
968 Ga0495677_0009842 3300047445 Bacteria 3521
969 Ga0495677_0045977 3300047445 Bacteria 1602
970 Ga0495677_0048941 3300047445 Bacteria 1553
971 Ga0495679_000010 3300047446 Bacteria 337760
972 Ga0495679_006996 3300047446 Bacteria 4772
973 Ga0495679_023648 3300047446 Bacteria 2081
974 Ga0495679_070867 3300047446 Bacteria 1004
975 Ga0495673_0000008 3300047469 Bacteria 752462
976 Ga0495673_0000009 3300047469 Bacteria 731993
977 Ga0495673_0000012 3300047469 Bacteria 656908
978 Ga0495673_0000038 3300047469 Bacteria 303785
979 Ga0495673_0000045 3300047469 Bacteria 280765
980 Ga0495673_0002264 3300047469 Bacteria 13803
981 Ga0495681_0004302 3300047470 Bacteria 9752
982 Ga0495681_0004454 3300047470 Bacteria 9554
983 Ga0495681_0021349 3300047470 Bacteria 3493
984 Ga0495681_0031971 3300047470 Bacteria 2654
985 Ga0495686_0000050 3300047472 Bacteria 269010
986 Ga0495686_0000320 3300047472 Bacteria 79875
987 Ga0495686_0002061 3300047472 Bacteria 19783
988 Ga0495686_0003146 3300047472 Bacteria 14560
989 Ga0495686_0005435 3300047472 Bacteria 10053
990 Ga0495686_0014303 3300047472 Bacteria 5466
991 Ga0495686_0049650 3300047472 Bacteria 2639
992 Ga0495602_0065123 3300048088 Bacteria 3147
993 Ga0495602_0081597 3300048088 Bacteria 2718
994 Ga0495615_0001856 3300048090 Bacteria 3246
995 Ga0495626_0000042 3300048091 Bacteria 169058
996 Ga0495626_0001373 3300048091 Bacteria 19597
997 Ga0495626_0002441 3300048091 Bacteria 12900
998 Ga0495626_0003455 3300048091 Bacteria 10128
999 Ga0495626_0006420 3300048091 Bacteria 6696
1000 Ga0495626_0037088 3300048091 Bacteria 2319
1001 Ga0495626_0042382 3300048091 Bacteria 2138
1002 Ga0495626_0058098 3300048091 Bacteria 1768
1003 Ga0496100_0037598 3300048903 Bacteria 3061
1004 Ga0496100_0046613 3300048903 Bacteria 2788
1005 Ga0496100_0132725 3300048903 Bacteria 1756
1006 Ga0496101_0004439 3300048904 Bacteria 8834
1007 Ga0496101_0005231 3300048904 Bacteria 8256
1008 Ga0496101_0372977 3300048904 Bacteria 1122
1009 Ga0496102_0004881 3300048905 Bacteria 11352
1010 Ga0496102_0042701 3300048905 Bacteria 4109
1011 Ga0496102_0049077 3300048905 Bacteria 3839
1012 Ga0496103_0001821 3300048906 Bacteria 13881
1013 Ga0496103_0009556 3300048906 Bacteria 5741
1014 Ga0496104_0037257 3300048907 Bacteria 4549
1015 Ga0496105_0028753 3300048908 Bacteria 4548
1016 Ga0496106_0000097 3300048909 Bacteria 66262
1017 Ga0496106_0051043 3300048909 Bacteria 3118
1018 Ga0496107_0123418 3300048910 Bacteria 1908
1019 Ga0496108_0224696 3300048911 Bacteria 1632
1020 Ga0496109_0008346 3300048912 Bacteria 8799
1021 Ga0496111_0119197 3300048914 Bacteria 1949
1022 Ga0496111_0143740 3300048914 Bacteria 1768
1023 Ga0496112_0317260 3300048915 Bacteria 1503
1024 Ga0496112_0632497 3300048915 Bacteria 1001
1025 Ga0496113_0004863 3300048916 Bacteria 8318
1026 Ga0496113_0023313 3300048916 Bacteria 4389
1027 Ga0496115_0000105 3300048918 Bacteria 78763
1028 Ga0496115_0000261 3300048918 Bacteria 46951
1029 Ga0496115_0015673 3300048918 Bacteria 5754
1030 Ga0496115_0086523 3300048918 Bacteria 2557
1031 Ga0496115_0111488 3300048918 Bacteria 2248
1032 Ga0496116_0021907 3300048919 Bacteria 4806
1033 Ga0496116_0070951 3300048919 Bacteria 2208
1034 Ga0496116_0115414 3300048919 Bacteria 1567
1035 Ga0496117_0009819 3300048920 Bacteria 8818
1036 Ga0496117_0021680 3300048920 Bacteria 5185
1037 Ga0496117_0083371 3300048920 Bacteria 2090
1038 Ga0496118_0000815 3300048921 Bacteria 49685
1039 Ga0496118_0014794 3300048921 Bacteria 7278
1040 Ga0496118_0026285 3300048921 Bacteria 4963
1041 Ga0496119_0002696 3300048922 Bacteria 19174
1042 Ga0496119_0024024 3300048922 Bacteria 4302
1043 Ga0496120_0000013 3300048923 Bacteria 331109
1044 Ga0496120_0000311 3300048923 Bacteria 80971
1045 Ga0496121_0001099 3300048924 Bacteria 47710
1046 Ga0496121_0001168 3300048924 Bacteria 46072
1047 Ga0496121_0001172 3300048924 Bacteria 45963
1048 Ga0496121_0001773 3300048924 Bacteria 35057
1049 Ga0496121_0006624 3300048924 Bacteria 14266
1050 Ga0496121_0045227 3300048924 Bacteria 3785
1051 Ga0496121_0072075 3300048924 Bacteria 2774
1052 Ga0496121_0077623 3300048924 Bacteria 2644
1053 Ga0496121_0346182 3300048924 Bacteria 991
1054 Ga0496122_0000482 3300048925 Bacteria 82868
1055 Ga0496122_0018318 3300048925 Bacteria 6480
1056 Ga0496122_0021701 3300048925 Bacteria 5737
1057 Ga0496122_0026655 3300048925 Bacteria 4973
1058 Ga0496122_0068739 3300048925 Bacteria 2541
1059 Ga0496122_0118483 3300048925 Bacteria 1715
1060 Ga0496122_0171333 3300048925 Bacteria 1308
1061 Ga0496123_0000662 3300048926 Bacteria 56930
1062 Ga0496123_0001791 3300048926 Bacteria 28275
1063 Ga0496123_0005185 3300048926 Bacteria 13250
1064 Ga0496123_0024751 3300048926 Bacteria 4551
1065 Ga0496123_0025054 3300048926 Bacteria 4509
1066 Ga0496123_0039717 3300048926 Bacteria 3288
1067 Ga0496123_0041588 3300048926 Bacteria 3183
1068 Ga0496124_0000770 3300048927 Bacteria 52198
1069 Ga0496124_0002826 3300048927 Bacteria 21971
1070 Ga0496124_0011857 3300048927 Bacteria 8678
1071 Ga0496124_0017492 3300048927 Bacteria 6752
1072 Ga0496124_0040289 3300048927 Bacteria 4043
1073 Ga0496124_0062949 3300048927 Bacteria 3102
1074 Ga0496124_0069965 3300048927 Bacteria 2912
1075 Ga0496125_0000088 3300048928 Bacteria 214942
1076 Ga0496125_0001380 3300048928 Bacteria 35616
1077 Ga0496125_0374634 3300048928 Bacteria 841
1078 Ga0496126_0005591 3300048929 Bacteria 14295
1079 Ga0496126_0006494 3300048929 Bacteria 13016
1080 Ga0496126_0011014 3300048929 Bacteria 9407
1081 Ga0496126_0020339 3300048929 Bacteria 6514
1082 Ga0496126_0050275 3300048929 Bacteria 3800
1083 Ga0496126_0123821 3300048929 Bacteria 2239
1084 Ga0496126_0127247 3300048929 Bacteria 2204
1085 Ga0496126_0130433 3300048929 Bacteria 2172
1086 Ga0495678_000346 3300049459 Bacteria 48212
1087 Ga0495678_000660 3300049459 Bacteria 31650
1088 Ga0495678_000672 3300049459 Bacteria 31401
1089 Ga0495678_002173 3300049459 Bacteria 13800
1090 Ga0495678_011688 3300049459 Bacteria 4192
1091 Ga0495682_0000999 3300049460 Bacteria 16865
1092 Ga0495682_0003586 3300049460 Bacteria 6853
1093 Ga0495682_0005088 3300049460 Bacteria 5514
1094 Ga0495682_0008161 3300049460 Bacteria 4136
1095 Ga0501031_0056696 3300049568 Bacteria 2552
1096 Ga0501032_0056300 3300049569 Bacteria 2643
1097 Ga0501032_0089966 3300049569 Bacteria 2037
1098 Ga0501032_0127167 3300049569 Bacteria 1683
1099 Ga0501032_0257006 3300049569 Bacteria 1133
1100 Ga0501033_0017618 3300049570 Bacteria 5395
1101 Ga0501033_0025135 3300049570 Bacteria 4487
1102 Ga0501033_0110540 3300049570 Bacteria 2000
1103 Ga0501034_0073167 3300049571 Bacteria 3436
1104 Ga0501034_0313315 3300049571 Bacteria 1503
1105 Ga0501034_0441171 3300049571 Bacteria 1220
1106 Ga0501036_0060971 3300049572 Bacteria 3195
1107 Ga0501036_0068324 3300049572 Bacteria 3007
1108 Ga0501036_0232050 3300049572 Bacteria 1548
1109 Ga0501037_0011598 3300049573 Bacteria 6489
1110 Ga0501037_0012878 3300049573 Bacteria 6165
1111 Ga0501037_0014092 3300049573 Bacteria 5889
1112 Ga0501037_0074797 3300049573 Bacteria 2461
1113 Ga0501038_0051528 3300049574 Bacteria 3551
1114 Ga0501042_0252630 3300049578 Bacteria 1272
1115 Ga0501043_0056558 3300049579 Bacteria 3081
1116 Ga0501046_0018827 3300049580 Bacteria 5735
1117 Ga0501046_0355159 3300049580 Bacteria 1063
1118 Ga0501047_0003952 3300049581 Bacteria 13937
1119 Ga0501047_0018619 3300049581 Bacteria 6658
1120 Ga0501047_0035677 3300049581 Bacteria 4804
1121 Ga0501047_0072697 3300049581 Bacteria 3310
1122 Ga0501047_0131748 3300049581 Bacteria 2380
1123 Ga0501047_0240893 3300049581 Bacteria 1659
1124 Ga0501069_0020889 3300049585 Bacteria 3550
1125 Ga0501069_0021869 3300049585 Bacteria 3474
1126 Ga0501069_0025021 3300049585 Bacteria 3260
1127 Ga0501069_0029323 3300049585 Bacteria 3019
1128 Ga0501070_0000426 3300049586 Bacteria 38386
1129 Ga0501070_0009079 3300049586 Bacteria 8410
1130 Ga0501070_0028867 3300049586 Bacteria 4651
1131 Ga0501070_0031217 3300049586 Bacteria 4463
1132 Ga0501070_0035242 3300049586 Bacteria 4183
1133 Ga0501070_0057238 3300049586 Bacteria 3231
1134 Ga0501070_0063850 3300049586 Bacteria 3050
1135 Ga0501070_0155102 3300049586 Bacteria 1888
1136 Ga0501070_0194818 3300049586 Bacteria 1664
1137 Ga0501070_0212461 3300049586 Bacteria 1588
1138 Ga0501070_0339991 3300049586 Bacteria 1219
1139 Ga0501073_0062339 3300049589 Bacteria 2601
1140 Ga0501074_0004341 3300049590 Bacteria 10126
1141 Ga0501074_0010346 3300049590 Bacteria 6769
1142 Ga0501074_0091642 3300049590 Bacteria 2176
1143 Ga0501077_0003933 3300049593 Bacteria 8952
1144 Ga0501077_0111987 3300049593 Bacteria 1730
1145 Ga0501080_0031412 3300049742 Bacteria 4948
1146 Ga0501080_0080545 3300049742 Bacteria 3026
1147 Ga0501269_000005 3300049766 Bacteria 77832
1148 Ga0501035_0000999 3300049822 Bacteria 29881
1149 Ga0501035_0008852 3300049822 Bacteria 9365
1150 Ga0501035_0020438 3300049822 Bacteria 6080
1151 Ga0501035_0023299 3300049822 Bacteria 5679
1152 Ga0501035_0033840 3300049822 Bacteria 4645
1153 Ga0501035_0043052 3300049822 Bacteria 4070
1154 Ga0501035_0044045 3300049822 Bacteria 4020
1155 Ga0501044_0000316 3300049823 Bacteria 61151
1156 Ga0501044_0002865 3300049823 Bacteria 19639
1157 Ga0501044_0007837 3300049823 Bacteria 11741
1158 Ga0501044_0014881 3300049823 Bacteria 8387
1159 Ga0501044_0074604 3300049823 Bacteria 3445
1160 Ga0501044_0240437 3300049823 Bacteria 1754
1161 Ga0501044_0286331 3300049823 Bacteria 1580
1162 nmdc:mga00v17_36016_c1 3300050491 Bacteria 2948
1163 nmdc:mga0k408_107593_c1 3300050493 Bacteria 1647
1164 nmdc:mga0k408_108877_c1 3300050493 Bacteria 1637
1165 nmdc:mga07m45_824_c1 3300050496 Bacteria 13393
1166 nmdc:mga09592_305507_c1 3300050508 Bacteria 1379
1167 nmdc:mga0qj67_120260_c1 3300050509 Bacteria 2124
1168 nmdc:mga06r32_10171_c1 3300050510 Bacteria 8492
1169 nmdc:mga0sz30_28493_c1 3300050516 Bacteria 2299
1170 Ga0500643_000074 3300053087 Bacteria 111502
1171 Ga0500555_000749 3300053103 Bacteria 11916
1172 Ga0500594_0014384 3300053118 Bacteria 1894
1173 Ga0500594_0033405 3300053118 Bacteria 1368
1174 Ga0500618_000170 3300053125 Bacteria 54570
1175 Ga0500586_000788 3300053145 Bacteria 6487
1176 Ga0500586_000850 3300053145 Bacteria 6309
1177 Ga0500600_0019665 3300053149 Bacteria 4065
1178 Ga0500633_0001819 3300053160 Bacteria 4184
1179 Ga0500625_002017 3300053729 Bacteria 7380
1180 Ga0500645_002041 3300053730 Bacteria 9407
1181 Ga0587090_004825 3300059510 Bacteria 1658
1182 Ga0466962_0002918 3300061719 Bacteria 8149
1183 Ga0466962_0033719 3300061719 Bacteria 2450

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0021869 Ga0501069_0021869_2507_3292 206
2 3300049586 Ga0501070_0000426 Ga0501070_0000426_2730_3515 206
3 3300003322 rootL2_10107535 rootL2_101075352 214
4 3300046665 Ga0495661_0001562 Ga0495661_0001562_9613_10365 214
5 3300048903 Ga0496100_0037598 Ga0496100_0037598_74_826 214
6 3300048904 Ga0496101_0005231 Ga0496101_0005231_5802_6554 214
7 3300048912 Ga0496109_0008346 Ga0496109_0008346_6240_6992 214
8 3300048915 Ga0496112_0317260 Ga0496112_0317260_155_907 214
9 3300048916 Ga0496113_0023313 Ga0496113_0023313_2816_3568 214
10 3300048925 Ga0496122_0000482 Ga0496122_0000482_73014_73766 214
11 3300048926 Ga0496123_0000662 Ga0496123_0000662_8886_9638 214
12 3300048926 Ga0496123_0041588 Ga0496123_0041588_15_683 214
13 3300048928 Ga0496125_0001380 Ga0496125_0001380_25907_26659 214
14 3300005615 Ga0070702_100045349 Ga0070702_1000453496 215
15 3300025899 Ga0207642_10241978 Ga0207642_102419782 215
16 3300025936 Ga0207670_10051873 Ga0207670_100518735 215
17 3300025942 Ga0207689_10250107 Ga0207689_102501073 215
18 3300026075 Ga0207708_10079581 Ga0207708_100795816 215
19 3300013104 Ga0157370_10007105 Ga0157370_100071057 216
20 3300049569 Ga0501032_0127167 Ga0501032_0127167_299_1075 216
21 3300049570 Ga0501033_0025135 Ga0501033_0025135_3328_4104 216
22 3300049585 Ga0501069_0020889 Ga0501069_0020889_188_964 216
23 3300049586 Ga0501070_0031217 Ga0501070_0031217_2320_3111 216
24 3300049586 Ga0501070_0063850 Ga0501070_0063850_1758_2534 216
25 3300049590 Ga0501074_0010346 Ga0501074_0010346_5675_6451 216
26 3300049742 Ga0501080_0080545 Ga0501080_0080545_224_1000 216
27 3300049822 Ga0501035_0000999 Ga0501035_0000999_484_1266 216
28 3300049822 Ga0501035_0033840 Ga0501035_0033840_181_957 216
29 3300049823 Ga0501044_0007837 Ga0501044_0007837_7000_7776 216
30 3300049823 Ga0501044_0286331 Ga0501044_0286331_234_1016 216
31 3300001979 JGI24740J21852_10000692 JGI24740J21852_1000069217 217
32 3300005327 Ga0070658_10013337 Ga0070658_100133375 217
33 3300005329 Ga0070683_100077261 Ga0070683_1000772613 217
34 3300005336 Ga0070680_100030427 Ga0070680_1000304273 217
35 3300005336 Ga0070680_100448780 Ga0070680_1004487802 217
36 3300005339 Ga0070660_100038795 Ga0070660_1000387953 217
37 3300005339 Ga0070660_100306656 Ga0070660_1003066561 217
38 3300005344 Ga0070661_100205934 Ga0070661_1002059341 217
39 3300005345 Ga0070692_10022705 Ga0070692_100227054 217
40 3300005366 Ga0070659_100045834 Ga0070659_1000458344 217
41 3300005366 Ga0070659_100185084 Ga0070659_1001850844 217
42 3300005455 Ga0070663_100017905 Ga0070663_1000179053 217
43 3300005458 Ga0070681_10000367 Ga0070681_100003675 217
44 3300005530 Ga0070679_100000042 Ga0070679_10000004286 217
45 3300005530 Ga0070679_100529322 Ga0070679_1005293221 217
46 3300005535 Ga0070684_100297141 Ga0070684_1002971412 217
47 3300005546 Ga0070696_100100676 Ga0070696_1001006762 217
48 3300005546 Ga0070696_100522159 Ga0070696_1005221591 217
49 3300005563 Ga0068855_100001918 Ga0068855_10000191820 217
50 3300005564 Ga0070664_100110409 Ga0070664_1001104093 217
51 3300005577 Ga0068857_100277700 Ga0068857_1002777003 217
52 3300005616 Ga0068852_100133824 Ga0068852_1001338243 217
53 3300005616 Ga0068852_100191455 Ga0068852_1001914552 217
54 3300009093 Ga0105240_10188660 Ga0105240_101886602 217
55 3300009093 Ga0105240_10718849 Ga0105240_107188492 217
56 3300013100 Ga0157373_10016190 Ga0157373_100161903 217
57 3300013100 Ga0157373_10372328 Ga0157373_103723282 217
58 3300013102 Ga0157371_10230542 Ga0157371_102305422 217
59 3300013104 Ga0157370_10001560 Ga0157370_1000156022 217
60 3300013104 Ga0157370_10642734 Ga0157370_106427342 217
61 3300013307 Ga0157372_10042985 Ga0157372_100429855 217
62 3300013307 Ga0157372_10142612 Ga0157372_101426124 217
63 3300020069 Ga0197907_11023788 Ga0197907_110237884 217
64 3300020070 Ga0206356_10873902 Ga0206356_108739022 217
65 3300020077 Ga0206351_10563863 Ga0206351_105638632 217
66 3300020078 Ga0206352_10886806 Ga0206352_108868063 217
67 3300020080 Ga0206350_11570562 Ga0206350_115705622 217
68 3300020081 Ga0206354_10175486 Ga0206354_101754862 217
69 3300020610 Ga0154015_1110485 Ga0154015_11104852 217
70 3300025904 Ga0207647_10003754 Ga0207647_100037543 217
71 3300025909 Ga0207705_10025781 Ga0207705_100257814 217
72 3300025909 Ga0207705_10047450 Ga0207705_100474504 217
73 3300025909 Ga0207705_10242191 Ga0207705_102421912 217
74 3300025912 Ga0207707_10000306 Ga0207707_1000030649 217
75 3300025912 Ga0207707_10006628 Ga0207707_100066283 217
76 3300025912 Ga0207707_10049572 Ga0207707_100495723 217
77 3300025913 Ga0207695_10161160 Ga0207695_101611602 217
78 3300025917 Ga0207660_10021385 Ga0207660_100213853 217
79 3300025917 Ga0207660_10061382 Ga0207660_100613822 217
80 3300025919 Ga0207657_10062434 Ga0207657_100624344 217
81 3300025919 Ga0207657_10085072 Ga0207657_100850723 217
82 3300025920 Ga0207649_10047425 Ga0207649_100474252 217
83 3300025920 Ga0207649_10049980 Ga0207649_100499802 217
84 3300025921 Ga0207652_10000048 Ga0207652_10000048111 217
85 3300025921 Ga0207652_10040878 Ga0207652_100408783 217
86 3300025921 Ga0207652_10092844 Ga0207652_100928442 217
87 3300025932 Ga0207690_10153152 Ga0207690_101531522 217
88 3300025932 Ga0207690_10218057 Ga0207690_102180573 217
89 3300025944 Ga0207661_10065407 Ga0207661_100654073 217
90 3300025945 Ga0207679_10341282 Ga0207679_103412822 217
91 3300025949 Ga0207667_10005935 Ga0207667_100059354 217
92 3300025949 Ga0207667_10011996 Ga0207667_100119965 217
93 3300025949 Ga0207667_10014550 Ga0207667_100145504 217
94 3300025981 Ga0207640_10010775 Ga0207640_100107758 217
95 3300025981 Ga0207640_10057601 Ga0207640_100576012 217
96 3300025981 Ga0207640_10147372 Ga0207640_101473723 217
97 3300026067 Ga0207678_10033693 Ga0207678_100336933 217
98 3300026067 Ga0207678_10088271 Ga0207678_100882712 217
99 3300026067 Ga0207678_10389334 Ga0207678_103893342 217
100 3300026078 Ga0207702_10025547 Ga0207702_100255472 217
101 3300026116 Ga0207674_10015601 Ga0207674_100156013 217
102 3300026142 Ga0207698_10007614 Ga0207698_100076149 217
103 3300046463 Ga0495653_0050481 Ga0495653_0050481_50_802 217
104 3300047322 Ga0495680_0100558 Ga0495680_0100558_1246_1998 217
105 3300047444 Ga0495675_0124488 Ga0495675_0124488_406_1158 217
106 3300049585 Ga0501069_0025021 Ga0501069_0025021_2371_3183 217
107 3300049586 Ga0501070_0212461 Ga0501070_0212461_369_1166 217
108 3300049586 Ga0501070_0339991 Ga0501070_0339991_268_1050 217
109 3300049581 Ga0501047_0035677 Ga0501047_0035677_1077_1874 218
110 3300049581 Ga0501047_0131748 Ga0501047_0131748_1096_1878 218
111 3300049585 Ga0501069_0029323 Ga0501069_0029323_747_1529 218
112 3300049586 Ga0501070_0057238 Ga0501070_0057238_324_1106 218
113 3300049586 Ga0501070_0194818 Ga0501070_0194818_326_1108 218
114 3300049590 Ga0501074_0091642 Ga0501074_0091642_140_922 218
115 3300049742 Ga0501080_0031412 Ga0501080_0031412_1236_2033 218
116 3300049822 Ga0501035_0008852 Ga0501035_0008852_6915_7697 218
117 3300001915 JGI24741J21665_1001821 JGI24741J21665_10018216 219
118 3300005327 Ga0070658_10303537 Ga0070658_103035372 219
119 3300005341 Ga0070691_10003659 Ga0070691_100036594 219
120 3300005341 Ga0070691_10012371 Ga0070691_100123712 219
121 3300005344 Ga0070661_100012552 Ga0070661_1000125525 219
122 3300005345 Ga0070692_10000562 Ga0070692_100005626 219
123 3300005455 Ga0070663_100008195 Ga0070663_1000081957 219
124 3300005458 Ga0070681_10004454 Ga0070681_100044546 219
125 3300005530 Ga0070679_100004157 Ga0070679_10000415710 219
126 3300005563 Ga0068855_100196982 Ga0068855_1001969822 219
127 3300005578 Ga0068854_100010173 Ga0068854_1000101737 219
128 3300005614 Ga0068856_100087030 Ga0068856_1000870305 219
129 3300005616 Ga0068852_100006397 Ga0068852_1000063977 219
130 3300009093 Ga0105240_10133502 Ga0105240_101335022 219
131 3300009545 Ga0105237_10175322 Ga0105237_101753224 219
132 3300013105 Ga0157369_10074318 Ga0157369_100743185 219
133 3300013307 Ga0157372_10695419 Ga0157372_106954192 219
134 3300025909 Ga0207705_10001879 Ga0207705_1000187912 219
135 3300025912 Ga0207707_10003824 Ga0207707_100038249 219
136 3300025913 Ga0207695_10023320 Ga0207695_100233207 219
137 3300025914 Ga0207671_10242687 Ga0207671_102426872 219
138 3300025917 Ga0207660_10007927 Ga0207660_100079277 219
139 3300025919 Ga0207657_10006894 Ga0207657_100068948 219
140 3300025920 Ga0207649_10014184 Ga0207649_100141846 219
141 3300025921 Ga0207652_10000117 Ga0207652_100001176 219
142 3300025932 Ga0207690_10001768 Ga0207690_100017689 219
143 3300025949 Ga0207667_10007913 Ga0207667_100079138 219
144 3300025981 Ga0207640_10126109 Ga0207640_101261092 219
145 3300026041 Ga0207639_10003605 Ga0207639_100036059 219
146 3300026067 Ga0207678_10005060 Ga0207678_100050608 219
147 3300026078 Ga0207702_10091588 Ga0207702_100915884 219
148 3300026142 Ga0207698_10023349 Ga0207698_100233495 219
149 3300037312 Ga0395899_0042012 Ga0395899_0042012_674_1459 219
150 3300037466 Ga0395898_0159338 Ga0395898_0159338_1049_1834 219
151 3300049573 Ga0501037_0012878 Ga0501037_0012878_2372_3169 219
152 3300049573 Ga0501037_0074797 Ga0501037_0074797_1141_1926 219
153 3300049586 Ga0501070_0035242 Ga0501070_0035242_2761_3546 219
154 3300049590 Ga0501074_0004341 Ga0501074_0004341_7926_8723 219
155 3300049593 Ga0501077_0003933 Ga0501077_0003933_3595_4380 219
156 3300049823 Ga0501044_0014881 Ga0501044_0014881_5417_6214 219
157 3300001915 JGI24741J21665_1002981 JGI24741J21665_10029814 220
158 3300005337 Ga0070682_100016460 Ga0070682_1000164605 220
159 3300005345 Ga0070692_10109226 Ga0070692_101092261 220
160 3300005457 Ga0070662_100007813 Ga0070662_1000078136 220
161 3300005546 Ga0070696_100054138 Ga0070696_1000541382 220
162 3300005547 Ga0070693_100017913 Ga0070693_1000179134 220
163 3300005564 Ga0070664_100021873 Ga0070664_1000218734 220
164 3300005578 Ga0068854_100023170 Ga0068854_1000231704 220
165 3300005614 Ga0068856_100184740 Ga0068856_1001847402 220
166 3300005616 Ga0068852_100130085 Ga0068852_1001300852 220
167 3300005834 Ga0068851_10076432 Ga0068851_100764323 220
168 3300009174 Ga0105241_10118974 Ga0105241_101189742 220
169 3300009551 Ga0105238_10018302 Ga0105238_100183027 220
170 3300020082 Ga0206353_10068883 Ga0206353_100688833 220
171 3300020610 Ga0154015_1622279 Ga0154015_16222793 220
172 3300025904 Ga0207647_10001393 Ga0207647_1000139317 220
173 3300025909 Ga0207705_10002720 Ga0207705_1000272013 220
174 3300025911 Ga0207654_10117842 Ga0207654_101178422 220
175 3300025912 Ga0207707_10008190 Ga0207707_100081908 220
176 3300025917 Ga0207660_10028914 Ga0207660_100289142 220
177 3300025919 Ga0207657_10013655 Ga0207657_100136553 220
178 3300025920 Ga0207649_10031082 Ga0207649_100310822 220
179 3300025921 Ga0207652_10007462 Ga0207652_100074628 220
180 3300025924 Ga0207694_10048583 Ga0207694_100485834 220
181 3300025932 Ga0207690_10027938 Ga0207690_100279384 220
182 3300025933 Ga0207706_10054512 Ga0207706_100545124 220
183 3300025944 Ga0207661_10030600 Ga0207661_100306004 220
184 3300025945 Ga0207679_10063309 Ga0207679_100633094 220
185 3300025949 Ga0207667_10008462 Ga0207667_100084624 220
186 3300025981 Ga0207640_10009889 Ga0207640_100098896 220
187 3300026067 Ga0207678_10010644 Ga0207678_100106443 220
188 3300026116 Ga0207674_10016923 Ga0207674_100169233 220
189 3300026142 Ga0207698_10810188 Ga0207698_108101882 220
190 3300037418 Ga0395900_0070686 Ga0395900_0070686_300_1085 220
191 3300038443 Ga0395901_0215092 Ga0395901_0215092_824_1609 220
192 3300001979 JGI24740J21852_10000975 JGI24740J21852_100009756 221
193 3300013307 Ga0157372_10084098 Ga0157372_100840982 221
194 3300048918 Ga0496115_0000105 Ga0496115_0000105_7512_8276 221
195 3300049586 Ga0501070_0155102 Ga0501070_0155102_870_1667 221
196 3300006846 Ga0075430_100037292 Ga0075430_1000372926 222
197 3300006847 Ga0075431_100000766 Ga0075431_10000076623 222
198 3300006880 Ga0075429_100107656 Ga0075429_1001076562 222
199 3300009551 Ga0105238_10299580 Ga0105238_102995802 222
200 3300025924 Ga0207694_10217011 Ga0207694_102170112 222
201 3300046471 Ga0495650_0000167 Ga0495650_0000167_122384_123139 222
202 3300046474 Ga0495605_0014043 Ga0495605_0014043_2636_3391 222
203 3300046524 Ga0495648_0008625 Ga0495648_0008625_6365_7120 222
204 3300046538 Ga0495609_0012193 Ga0495609_0012193_2480_3235 222
205 3300046794 Ga0495589_0009539 Ga0495589_0009539_1830_2585 222
206 3300047320 Ga0495672_0001024 Ga0495672_0001024_5266_6021 222
207 3300047323 Ga0495683_0019005 Ga0495683_0019005_25_780 222
208 3300050508 nmdc:mga09592_305507_c1 nmdc:mga09592_305507_c1_234_1052 222
209 3300050509 nmdc:mga0qj67_120260_c1 nmdc:mga0qj67_120260_c1_66_884 222
210 3300050510 nmdc:mga06r32_10171_c1 nmdc:mga06r32_10171_c1_6334_7152 222
211 3300046679 Ga0495623_0029491 Ga0495623_0029491_1779_2531 223
212 3300031711 Ga0265314_10019340 Ga0265314_100193406 224
213 3300044656 Ga0466969_0040498 Ga0466969_0040498_111_869 224
214 3300044672 Ga0466982_0000001 Ga0466982_0000001_357528_358286 224
215 3300044684 Ga0466966_0006112 Ga0466966_0006112_3124_3882 224
216 3300044706 Ga0466964_0010672 Ga0466964_0010672_1122_1880 224
217 3300044735 Ga0466968_0020136 Ga0466968_0020136_196_954 224
218 3300044765 Ga0466970_0047688 Ga0466970_0047688_1214_1972 224
219 3300044842 Ga0466957_0087133 Ga0466957_0087133_767_1525 224
220 3300044901 Ga0466960_0005551 Ga0466960_0005551_986_1744 224
221 3300046471 Ga0495650_0000128 Ga0495650_0000128_67849_68601 224
222 3300046506 Ga0495583_0002214 Ga0495583_0002214_16291_17046 224
223 3300046507 Ga0495606_0020549 Ga0495606_0020549_1393_2145 224
224 3300046513 Ga0495616_0000157 Ga0495616_0000157_48888_49646 224
225 3300046520 Ga0495637_0015478 Ga0495637_0015478_1952_2710 224
226 3300046522 Ga0495643_0000085 Ga0495643_0000085_79833_80588 224
227 3300046528 Ga0495642_0007799 Ga0495642_0007799_74_826 224
228 3300046557 Ga0495622_0000034 Ga0495622_0000034_101246_101998 224
229 3300046665 Ga0495661_0039642 Ga0495661_0039642_1182_1940 224
230 3300047323 Ga0495683_0002398 Ga0495683_0002398_4638_5396 224
231 3300048091 Ga0495626_0001373 Ga0495626_0001373_16164_16922 224
232 3300042139 Ga0450904_000603 Ga0450904_000603_2803_3558 225
233 3300044842 Ga0466957_0019017 Ga0466957_0019017_3318_4028 225
234 3300031548 Ga0307408_100044158 Ga0307408_1000441582 226
235 3300031903 Ga0307407_10046980 Ga0307407_100469803 226
236 3300005345 Ga0070692_10048401 Ga0070692_100484012 228
237 3300005614 Ga0068856_100192983 Ga0068856_1001929833 228
238 3300025909 Ga0207705_10027814 Ga0207705_100278142 228
239 3300025914 Ga0207671_10350960 Ga0207671_103509602 228
240 3300025933 Ga0207706_10044138 Ga0207706_100441385 228
241 3300031824 Ga0307413_10132395 Ga0307413_101323952 228
242 3300049569 Ga0501032_0056300 Ga0501032_0056300_805_1566 228
243 3300049569 Ga0501032_0257006 Ga0501032_0257006_260_1027 228
244 3300049571 Ga0501034_0441171 Ga0501034_0441171_205_975 228
245 3300049572 Ga0501036_0232050 Ga0501036_0232050_587_1357 228
246 3300049573 Ga0501037_0011598 Ga0501037_0011598_2129_2899 228
247 3300049580 Ga0501046_0018827 Ga0501046_0018827_4600_5361 228
248 3300049586 Ga0501070_0028867 Ga0501070_0028867_3547_4317 228
249 3300049822 Ga0501035_0023299 Ga0501035_0023299_726_1496 228
250 3300002737 JGI25162J39368_1000428 JGI25162J39368_10004286 229
251 3300003762 Ga0055542_1000247 Ga0055542_100024734 229
252 3300005336 Ga0070680_100100179 Ga0070680_1001001792 229
253 3300005530 Ga0070679_100013727 Ga0070679_1000137274 229
254 3300005546 Ga0070696_100006278 Ga0070696_1000062785 229
255 3300006051 Ga0075364_10001078 Ga0075364_100010789 229
256 3300025231 Ga0207427_103939 Ga0207427_1039392 229
257 3300025233 Ga0209437_100382 Ga0209437_10038234 229
258 3300025250 Ga0209026_1009282 Ga0209026_10092824 229
259 3300025254 Ga0209148_1000055 Ga0209148_1000055211 229
260 3300025912 Ga0207707_10096773 Ga0207707_100967732 229
261 3300025917 Ga0207660_10360329 Ga0207660_103603292 229
262 3300026116 Ga0207674_10034835 Ga0207674_100348353 229
263 3300046460 Ga0495638_0000429 Ga0495638_0000429_28695_29456 229
264 3300046471 Ga0495650_0000092 Ga0495650_0000092_121227_121988 229
265 3300050491 nmdc:mga00v17_36016_c1 nmdc:mga00v17_36016_c1_1571_2377 229
266 3300003756 Ga0055533_1000407 Ga0055533_10004075 230
267 3300005344 Ga0070661_100028620 Ga0070661_1000286202 230
268 3300005435 Ga0070714_100000469 Ga0070714_10000046924 230
269 3300005455 Ga0070663_100052268 Ga0070663_1000522684 230
270 3300005458 Ga0070681_10164917 Ga0070681_101649172 230
271 3300005834 Ga0068851_10233816 Ga0068851_102338162 230
272 3300010375 Ga0105239_10249342 Ga0105239_102493422 230
273 3300013105 Ga0157369_10621853 Ga0157369_106218532 230
274 3300015687 Ga0183368_1007 Ga0183368_1007133 230
275 3300025226 Ga0209674_100037 Ga0209674_100037229 230
276 3300025228 Ga0209672_101410 Ga0209672_1014106 230
277 3300025242 Ga0209258_100599 Ga0209258_1005999 230
278 3300025904 Ga0207647_10000581 Ga0207647_100005815 230
279 3300025915 Ga0207693_10319727 Ga0207693_103197272 230
280 3300025929 Ga0207664_10000587 Ga0207664_1000058723 230
281 3300025932 Ga0207690_10000350 Ga0207690_1000035011 230
282 3300026067 Ga0207678_10054114 Ga0207678_100541142 230
283 3300042000 Ga0439437_000188 Ga0439437_000188_1588_2346 230
284 3300046460 Ga0495638_0000324 Ga0495638_0000324_22878_23642 230
285 3300046507 Ga0495606_0000923 Ga0495606_0000923_38788_39552 230
286 3300046507 Ga0495606_0163980 Ga0495606_0163980_68_820 230
287 3300046524 Ga0495648_0094804 Ga0495648_0094804_792_1556 230
288 3300046557 Ga0495622_0010058 Ga0495622_0010058_2488_3252 230
289 3300046660 Ga0495625_0040819 Ga0495625_0040819_592_1356 230
290 3300046694 Ga0495649_0019405 Ga0495649_0019405_886_1650 230
291 3300048916 Ga0496113_0004863 Ga0496113_0004863_3835_4599 230
292 3300048918 Ga0496115_0000261 Ga0496115_0000261_22258_23022 230
293 3300048918 Ga0496115_0086523 Ga0496115_0086523_369_1133 230
294 3300048929 Ga0496126_0123821 Ga0496126_0123821_1309_2073 230
295 3300048929 Ga0496126_0130433 Ga0496126_0130433_999_1763 230
296 3300049459 Ga0495678_011688 Ga0495678_011688_2124_2888 230
297 3300005340 Ga0070689_100006673 Ga0070689_1000066738 231
298 3300009551 Ga0105238_10046801 Ga0105238_100468012 231
299 3300014497 Ga0182008_10042827 Ga0182008_100428272 231
300 3300014969 Ga0157376_10012423 Ga0157376_100124234 231
301 3300025936 Ga0207670_10000825 Ga0207670_100008253 231
302 3300028380 Ga0268265_10228944 Ga0268265_102289442 231
303 3300028381 Ga0268264_10137621 Ga0268264_101376212 231
304 3300042438 Ga0439459_0020856 Ga0439459_0020856_258_1019 231
305 3300046463 Ga0495653_0037052 Ga0495653_0037052_233_997 231
306 3300046472 Ga0495580_0056681 Ga0495580_0056681_1904_2668 231
307 3300046473 Ga0495582_0033983 Ga0495582_0033983_192_956 231
308 3300046475 Ga0495639_0072920 Ga0495639_0072920_466_1230 231
309 3300046499 Ga0495594_0016561 Ga0495594_0016561_886_1650 231
310 3300046517 Ga0495630_0010470 Ga0495630_0010470_3320_4084 231
311 3300046529 Ga0495652_0003227 Ga0495652_0003227_2323_3087 231
312 3300046531 Ga0495665_0013361 Ga0495665_0013361_3429_4193 231
313 3300046535 Ga0495586_0300573 Ga0495586_0300573_92_856 231
314 3300046642 Ga0495634_0008555 Ga0495634_0008555_2123_2887 231
315 3300046674 Ga0495588_0017583 Ga0495588_0017583_602_1366 231
316 3300046690 Ga0495624_0116858 Ga0495624_0116858_784_1548 231
317 3300047319 Ga0495674_0240295 Ga0495674_0240295_414_1178 231
318 3300047444 Ga0495675_0010506 Ga0495675_0010506_3286_4050 231
319 3300048918 Ga0496115_0015673 Ga0496115_0015673_1841_2602 231
320 3300048929 Ga0496126_0050275 Ga0496126_0050275_1858_2619 231
321 3300049460 Ga0495682_0008161 Ga0495682_0008161_662_1426 232
322 3300041452 Ga0451793_1432460 Ga0451793_1432460_1223_2002 233
323 3300042438 Ga0439459_0011451 Ga0439459_0011451_72_851 233
324 3300046460 Ga0495638_0000060 Ga0495638_0000060_125259_126038 233
325 3300050493 nmdc:mga0k408_108877_c1 nmdc:mga0k408_108877_c1_504_1277 233
326 3300048088 Ga0495602_0081597 Ga0495602_0081597_1549_2313 234
327 iso_pu_bacteria 2537561836 2538835092 234
328 iso_pu_bacteria 2643221562 2643829023 234
329 3300049570 Ga0501033_0017618 Ga0501033_0017618_2583_3335 235
330 3300005339 Ga0070660_100131399 Ga0070660_1001313992 236
331 3300021361 Ga0213872_10000169 Ga0213872_1000016939 236
332 3300039447 Ga0436361_0159126 Ga0436361_0159126_20577_21374 236
333 iso_pu_bacteria 2738541297 2738826206 236
334 iso_pu_bacteria 2738541357 2739150003 236
335 iso_pu_bacteria 2738543003 2739191922 236
336 iso_pu_bacteria 2738543026 2739318399 236
337 iso_pu_bacteria 2738543029 2739336640 236
338 iso_pu_bacteria 2808606418 2809146410 236
339 iso_pu_bacteria 2821131069 2821134991 236
340 iso_pu_bacteria 2842711865 2842715850 236
341 iso_pu_bacteria 2857558681 2857558759 236
342 iso_pu_bacteria 2857564685 2857569636 236
343 iso_pu_bacteria 2904424332 2904428355 236
344 iso_pu_bacteria 8047673197 8047674675 236
345 3300032133 Ga0316583_10000295 Ga0316583_1000029512 237
346 3300044712 Ga0453684_0003881 Ga0453684_0003881_8142_8882 237
347 3300044712 Ga0453684_0391957 Ga0453684_0391957_513_1298 237
348 3300045051 Ga0451576_0000313 Ga0451576_0000313_7954_8694 237
349 iso_pu_bacteria 2687453130 2687581595 237
350 iso_pu_bacteria 2939611941 2939613233 237
351 3300013100 Ga0157373_10033016 Ga0157373_100330162 238
352 3300013102 Ga0157371_10023643 Ga0157371_100236432 238
353 3300046457 Ga0495590_0013619 Ga0495590_0013619_1224_1976 238
354 3300046524 Ga0495648_0008608 Ga0495648_0008608_1447_2199 238
355 3300046536 Ga0495587_0287686 Ga0495587_0287686_117_869 238
356 3300046810 Ga0495660_0011523 Ga0495660_0011523_425_1177 238
357 3300047320 Ga0495672_0000019 Ga0495672_0000019_264062_264814 238
358 3300048091 Ga0495626_0006420 Ga0495626_0006420_4916_5674 238
359 3300049459 Ga0495678_000660 Ga0495678_000660_10493_11245 238
360 3300049586 Ga0501070_0009079 Ga0501070_0009079_6683_7459 238
361 3300053729 Ga0500625_002017 Ga0500625_002017_4549_5304 238
362 3300002737 JGI25162J39368_1001665 JGI25162J39368_10016655 239
363 3300002737 JGI25162J39368_1002523 JGI25162J39368_10025234 239
364 3300002772 JGI25164J39214_1000064 JGI25164J39214_100006418 239
365 3300002774 JGI25150J39212_1010844 JGI25150J39212_10108442 239
366 3300003214 JGI25165J46597_1000278 JGI25165J46597_100027817 239
367 3300003760 Ga0055527_1002058 Ga0055527_10020585 239
368 3300003761 Ga0055535_1000351 Ga0055535_100035126 239
369 3300003762 Ga0055542_1000450 Ga0055542_100045028 239
370 3300003762 Ga0055542_1007038 Ga0055542_10070383 239
371 3300003763 Ga0055529_1000015 Ga0055529_100001578 239
372 3300003763 Ga0055529_1000312 Ga0055529_100031235 239
373 3300003771 Ga0055526_1000007 Ga0055526_100000796 239
374 3300003771 Ga0055526_1000037 Ga0055526_100003792 239
375 3300005337 Ga0070682_100241093 Ga0070682_1002410932 239
376 3300005614 Ga0068856_100270320 Ga0068856_1002703202 239
377 3300009036 Ga0105244_10012826 Ga0105244_100128265 239
378 3300013307 Ga0157372_10375731 Ga0157372_103757312 239
379 3300015261 Ga0182006_1000023 Ga0182006_100002383 239
380 3300015261 Ga0182006_1008097 Ga0182006_10080974 239
381 3300015265 Ga0182005_1000006 Ga0182005_100000641 239
382 3300017792 Ga0163161_10082422 Ga0163161_100824223 239
383 3300021361 Ga0213872_10005704 Ga0213872_100057047 239
384 3300021361 Ga0213872_10010012 Ga0213872_100100122 239
385 3300025228 Ga0209672_100148 Ga0209672_10014827 239
386 3300025231 Ga0207427_100037 Ga0207427_100037246 239
387 3300025233 Ga0209437_100213 Ga0209437_10021317 239
388 3300025233 Ga0209437_101844 Ga0209437_1018443 239
389 3300025242 Ga0209258_100106 Ga0209258_100106101 239
390 3300025245 Ga0207425_1000176 Ga0207425_100017625 239
391 3300025246 Ga0209646_1000125 Ga0209646_100012556 239
392 3300025246 Ga0209646_1002300 Ga0209646_10023005 239
393 3300025250 Ga0209026_1005580 Ga0209026_10055802 239
394 3300025250 Ga0209026_1010342 Ga0209026_10103422 239
395 3300025250 Ga0209026_1011425 Ga0209026_10114253 239
396 3300025254 Ga0209148_1000042 Ga0209148_1000042227 239
397 3300025254 Ga0209148_1000470 Ga0209148_100047025 239
398 3300025256 Ga0209759_1000185 Ga0209759_10001852 239
399 3300025256 Ga0209759_1018116 Ga0209759_10181162 239
400 3300025261 Ga0209233_1000096 Ga0209233_1000096247 239
401 3300025272 Ga0209455_1000016 Ga0209455_1000016482 239
402 3300025272 Ga0209455_1000031 Ga0209455_100003179 239
403 3300025294 Ga0209025_1003577 Ga0209025_100357717 239
404 3300025295 Ga0209564_1000010 Ga0209564_1000010581 239
405 3300025295 Ga0209564_1000042 Ga0209564_1000042167 239
406 3300025728 Ga0207655_1001557 Ga0207655_100155711 239
407 3300025728 Ga0207655_1005830 Ga0207655_10058304 239
408 3300025913 Ga0207695_10054572 Ga0207695_100545723 239
409 3300025919 Ga0207657_10026405 Ga0207657_100264055 239
410 3300026067 Ga0207678_10349846 Ga0207678_103498462 239
411 3300027111 Ga0209281_1004779 Ga0209281_10047792 239
412 3300028794 Ga0307515_10349100 Ga0307515_103491002 239
413 3300030731 Ga0316177_1120559 Ga0316177_11205592 239
414 3300030736 Ga0316180_1185546 Ga0316180_11855462 239
415 3300030744 Ga0316181_1136479 Ga0316181_11364793 239
416 3300030745 Ga0316182_1306192 Ga0316182_13061922 239
417 3300037312 Ga0395899_0006107 Ga0395899_0006107_1674_2429 239
418 3300037418 Ga0395900_0011101 Ga0395900_0011101_1637_2392 239
419 3300039447 Ga0436361_0031960 Ga0436361_0031960_6841_7596 239
420 3300039447 Ga0436361_0280882 Ga0436361_0280882_2219_2974 239
421 3300039447 Ga0436361_0374453 Ga0436361_0374453_103_858 239
422 3300042005 Ga0439448_0016864 Ga0439448_0016864_409_1164 239
423 3300042012 Ga0439455_0011341 Ga0439455_0011341_424_1179 239
424 3300044658 Ga0466972_0003714 Ga0466972_0003714_3390_4145 239
425 3300044683 Ga0466965_0024439 Ga0466965_0024439_1399_2154 239
426 3300044693 Ga0466961_0056440 Ga0466961_0056440_526_1281 239
427 3300044693 Ga0466961_0112683 Ga0466961_0112683_781_1536 239
428 3300044706 Ga0466964_0070543 Ga0466964_0070543_172_927 239
429 3300044735 Ga0466968_0000976 Ga0466968_0000976_6788_7543 239
430 3300044842 Ga0466957_0077258 Ga0466957_0077258_1115_1870 239
431 3300044842 Ga0466957_0146696 Ga0466957_0146696_751_1506 239
432 3300045049 Ga0466959_0063844 Ga0466959_0063844_1571_2326 239
433 3300045049 Ga0466959_0175839 Ga0466959_0175839_409_1164 239
434 3300046452 Ga0495617_000020 Ga0495617_000020_75227_75982 239
435 3300046452 Ga0495617_001037 Ga0495617_001037_8850_9605 239
436 3300046453 Ga0495627_000170 Ga0495627_000170_71074_71829 239
437 3300046453 Ga0495627_051134 Ga0495627_051134_225_980 239
438 3300046455 Ga0495603_0019247 Ga0495603_0019247_194_949 239
439 3300046457 Ga0495590_0000012 Ga0495590_0000012_287153_287908 239
440 3300046457 Ga0495590_0032283 Ga0495590_0032283_139_894 239
441 3300046460 Ga0495638_0000047 Ga0495638_0000047_33497_34252 239
442 3300046460 Ga0495638_0008349 Ga0495638_0008349_5869_6624 239
443 3300046460 Ga0495638_0088513 Ga0495638_0088513_193_948 239
444 3300046460 Ga0495638_0260126 Ga0495638_0260126_61_819 239
445 3300046463 Ga0495653_0000035 Ga0495653_0000035_56183_56941 239
446 3300046471 Ga0495650_0000077 Ga0495650_0000077_203226_203993 239
447 3300046471 Ga0495650_0000157 Ga0495650_0000157_145608_146363 239
448 3300046471 Ga0495650_0000261 Ga0495650_0000261_9342_10097 239
449 3300046471 Ga0495650_0002873 Ga0495650_0002873_3390_4145 239
450 3300046471 Ga0495650_0008544 Ga0495650_0008544_2804_3559 239
451 3300046474 Ga0495605_0000018 Ga0495605_0000018_88426_89181 239
452 3300046474 Ga0495605_0000055 Ga0495605_0000055_24655_25410 239
453 3300046474 Ga0495605_0009789 Ga0495605_0009789_2993_3748 239
454 3300046474 Ga0495605_0040636 Ga0495605_0040636_190_945 239
455 3300046475 Ga0495639_0015928 Ga0495639_0015928_2397_3152 239
456 3300046491 Ga0495584_0000004 Ga0495584_0000004_18917_19672 239
457 3300046491 Ga0495584_0000073 Ga0495584_0000073_50507_51262 239
458 3300046491 Ga0495584_0000565 Ga0495584_0000565_1010_1765 239
459 3300046491 Ga0495584_0001199 Ga0495584_0001199_13392_14147 239
460 3300046491 Ga0495584_0006743 Ga0495584_0006743_3109_3864 239
461 3300046491 Ga0495584_0022350 Ga0495584_0022350_2152_2907 239
462 3300046491 Ga0495584_0026921 Ga0495584_0026921_1392_2147 239
463 3300046492 Ga0495585_0001611 Ga0495585_0001611_8113_8868 239
464 3300046492 Ga0495585_0002189 Ga0495585_0002189_10474_11232 239
465 3300046492 Ga0495585_0005917 Ga0495585_0005917_3102_3857 239
466 3300046492 Ga0495585_0006008 Ga0495585_0006008_2980_3735 239
467 3300046492 Ga0495585_0006253 Ga0495585_0006253_6238_6993 239
468 3300046492 Ga0495585_0008654 Ga0495585_0008654_3206_3961 239
469 3300046492 Ga0495585_0016931 Ga0495585_0016931_2862_3620 239
470 3300046492 Ga0495585_0042253 Ga0495585_0042253_162_917 239
471 3300046492 Ga0495585_0232241 Ga0495585_0232241_36_794 239
472 3300046499 Ga0495594_0088201 Ga0495594_0088201_320_1075 239
473 3300046499 Ga0495594_0155058 Ga0495594_0155058_533_1288 239
474 3300046500 Ga0495596_0000348 Ga0495596_0000348_27121_27876 239
475 3300046500 Ga0495596_0012319 Ga0495596_0012319_401_1156 239
476 3300046501 Ga0495607_0001560 Ga0495607_0001560_16308_17063 239
477 3300046501 Ga0495607_0002674 Ga0495607_0002674_11094_11849 239
478 3300046501 Ga0495607_0002757 Ga0495607_0002757_1851_2606 239
479 3300046501 Ga0495607_0003655 Ga0495607_0003655_3372_4127 239
480 3300046501 Ga0495607_0007691 Ga0495607_0007691_649_1404 239
481 3300046501 Ga0495607_0008233 Ga0495607_0008233_985_1740 239
482 3300046501 Ga0495607_0046652 Ga0495607_0046652_1326_2081 239
483 3300046501 Ga0495607_0057791 Ga0495607_0057791_1291_2046 239
484 3300046506 Ga0495583_0000132 Ga0495583_0000132_64075_64830 239
485 3300046506 Ga0495583_0000898 Ga0495583_0000898_32000_32755 239
486 3300046506 Ga0495583_0001083 Ga0495583_0001083_27167_27922 239
487 3300046506 Ga0495583_0016026 Ga0495583_0016026_1944_2699 239
488 3300046507 Ga0495606_0000228 Ga0495606_0000228_3224_3979 239
489 3300046507 Ga0495606_0000512 Ga0495606_0000512_15918_16676 239
490 3300046507 Ga0495606_0000790 Ga0495606_0000790_25705_26460 239
491 3300046507 Ga0495606_0000829 Ga0495606_0000829_2189_2944 239
492 3300046507 Ga0495606_0001799 Ga0495606_0001799_6638_7393 239
493 3300046507 Ga0495606_0005323 Ga0495606_0005323_9783_10538 239
494 3300046507 Ga0495606_0026284 Ga0495606_0026284_2794_3549 239
495 3300046507 Ga0495606_0032285 Ga0495606_0032285_1275_2030 239
496 3300046507 Ga0495606_0035596 Ga0495606_0035596_175_930 239
497 3300046507 Ga0495606_0181875 Ga0495606_0181875_194_949 239
498 3300046507 Ga0495606_0187393 Ga0495606_0187393_416_1174 239
499 3300046512 Ga0495610_0000014 Ga0495610_0000014_184280_185035 239
500 3300046512 Ga0495610_0004230 Ga0495610_0004230_2439_3194 239
501 3300046512 Ga0495610_0006774 Ga0495610_0006774_5524_6279 239
502 3300046512 Ga0495610_0020967 Ga0495610_0020967_1878_2633 239
503 3300046512 Ga0495610_0024515 Ga0495610_0024515_459_1217 239
504 3300046513 Ga0495616_0027100 Ga0495616_0027100_1730_2485 239
505 3300046513 Ga0495616_0034543 Ga0495616_0034543_1553_2308 239
506 3300046515 Ga0495620_0005054 Ga0495620_0005054_2124_2882 239
507 3300046518 Ga0495631_0001932 Ga0495631_0001932_10856_11611 239
508 3300046518 Ga0495631_0016829 Ga0495631_0016829_1736_2491 239
509 3300046518 Ga0495631_0028541 Ga0495631_0028541_1733_2488 239
510 3300046518 Ga0495631_0033611 Ga0495631_0033611_1373_2128 239
511 3300046518 Ga0495631_0065298 Ga0495631_0065298_301_1056 239
512 3300046518 Ga0495631_0074108 Ga0495631_0074108_193_948 239
513 3300046519 Ga0495632_0000017 Ga0495632_0000017_30570_31325 239
514 3300046519 Ga0495632_0000874 Ga0495632_0000874_4680_5435 239
515 3300046519 Ga0495632_0001146 Ga0495632_0001146_18532_19287 239
516 3300046519 Ga0495632_0038695 Ga0495632_0038695_998_1753 239
517 3300046520 Ga0495637_0000142 Ga0495637_0000142_38915_39670 239
518 3300046520 Ga0495637_0000731 Ga0495637_0000731_18611_19366 239
519 3300046522 Ga0495643_0000082 Ga0495643_0000082_137931_138686 239
520 3300046522 Ga0495643_0000160 Ga0495643_0000160_20957_21712 239
521 3300046522 Ga0495643_0000399 Ga0495643_0000399_47693_48448 239
522 3300046522 Ga0495643_0004179 Ga0495643_0004179_1467_2222 239
523 3300046522 Ga0495643_0009199 Ga0495643_0009199_2282_3037 239
524 3300046523 Ga0495644_0003768 Ga0495644_0003768_1282_2037 239
525 3300046523 Ga0495644_0018445 Ga0495644_0018445_1043_1798 239
526 3300046523 Ga0495644_0020034 Ga0495644_0020034_575_1330 239
527 3300046523 Ga0495644_0038171 Ga0495644_0038171_630_1385 239
528 3300046524 Ga0495648_0000019 Ga0495648_0000019_91663_92418 239
529 3300046524 Ga0495648_0013009 Ga0495648_0013009_1097_1852 239
530 3300046524 Ga0495648_0031420 Ga0495648_0031420_1957_2712 239
531 3300046524 Ga0495648_0032080 Ga0495648_0032080_944_1699 239
532 3300046524 Ga0495648_0039230 Ga0495648_0039230_1745_2500 239
533 3300046524 Ga0495648_0164100 Ga0495648_0164100_249_1007 239
534 3300046524 Ga0495648_0193859 Ga0495648_0193859_191_946 239
535 3300046525 Ga0495663_0120959 Ga0495663_0120959_86_841 239
536 3300046528 Ga0495642_0000382 Ga0495642_0000382_7517_8272 239
537 3300046528 Ga0495642_0000449 Ga0495642_0000449_11672_12427 239
538 3300046528 Ga0495642_0000602 Ga0495642_0000602_4735_5490 239
539 3300046528 Ga0495642_0002330 Ga0495642_0002330_2253_3008 239
540 3300046528 Ga0495642_0004833 Ga0495642_0004833_2465_3223 239
541 3300046528 Ga0495642_0018353 Ga0495642_0018353_780_1535 239
542 3300046528 Ga0495642_0018703 Ga0495642_0018703_29_784 239
543 3300046528 Ga0495642_0022574 Ga0495642_0022574_1158_1913 239
544 3300046530 Ga0495654_0000014 Ga0495654_0000014_133008_133763 239
545 3300046530 Ga0495654_0016894 Ga0495654_0016894_2056_2811 239
546 3300046530 Ga0495654_0020043 Ga0495654_0020043_1012_1767 239
547 3300046530 Ga0495654_0025010 Ga0495654_0025010_2295_3050 239
548 3300046531 Ga0495665_0066308 Ga0495665_0066308_16_771 239
549 3300046535 Ga0495586_0002395 Ga0495586_0002395_4914_5669 239
550 3300046538 Ga0495609_0000038 Ga0495609_0000038_155674_156429 239
551 3300046538 Ga0495609_0003103 Ga0495609_0003103_5540_6295 239
552 3300046538 Ga0495609_0005751 Ga0495609_0005751_606_1361 239
553 3300046538 Ga0495609_0023023 Ga0495609_0023023_1161_1916 239
554 3300046538 Ga0495609_0053511 Ga0495609_0053511_553_1308 239
555 3300046538 Ga0495609_0111069 Ga0495609_0111069_259_1017 239
556 3300046542 Ga0495597_0000133 Ga0495597_0000133_4692_5447 239
557 3300046542 Ga0495597_0000321 Ga0495597_0000321_39357_40112 239
558 3300046542 Ga0495597_0000535 Ga0495597_0000535_19036_19791 239
559 3300046542 Ga0495597_0003877 Ga0495597_0003877_3628_4386 239
560 3300046542 Ga0495597_0033370 Ga0495597_0033370_384_1139 239
561 3300046542 Ga0495597_0035321 Ga0495597_0035321_1089_1844 239
562 3300046542 Ga0495597_0035903 Ga0495597_0035903_49_804 239
563 3300046543 Ga0495645_0108053 Ga0495645_0108053_752_1507 239
564 3300046557 Ga0495622_0000071 Ga0495622_0000071_11586_12341 239
565 3300046557 Ga0495622_0184220 Ga0495622_0184220_62_817 239
566 3300046558 Ga0495633_0000077 Ga0495633_0000077_1411_2166 239
567 3300046558 Ga0495633_0000100 Ga0495633_0000100_112338_113093 239
568 3300046558 Ga0495633_0000217 Ga0495633_0000217_48882_49637 239
569 3300046558 Ga0495633_0004840 Ga0495633_0004840_2164_2919 239
570 3300046558 Ga0495633_0012021 Ga0495633_0012021_2992_3747 239
571 3300046558 Ga0495633_0016168 Ga0495633_0016168_1915_2670 239
572 3300046558 Ga0495633_0017411 Ga0495633_0017411_2230_2985 239
573 3300046558 Ga0495633_0021410 Ga0495633_0021410_70_825 239
574 3300046558 Ga0495633_0084320 Ga0495633_0084320_416_1174 239
575 3300046615 Ga0495656_0002410 Ga0495656_0002410_1236_1991 239
576 3300046615 Ga0495656_0035248 Ga0495656_0035248_32_787 239
577 3300046615 Ga0495656_0223771 Ga0495656_0223771_171_929 239
578 3300046616 Ga0495668_0000308 Ga0495668_0000308_47742_48497 239
579 3300046616 Ga0495668_0000692 Ga0495668_0000692_2093_2848 239
580 3300046616 Ga0495668_0001569 Ga0495668_0001569_8626_9381 239
581 3300046616 Ga0495668_0002147 Ga0495668_0002147_6327_7082 239
582 3300046616 Ga0495668_0008414 Ga0495668_0008414_2928_3683 239
583 3300046616 Ga0495668_0020832 Ga0495668_0020832_2664_3419 239
584 3300046616 Ga0495668_0023921 Ga0495668_0023921_2420_3175 239
585 3300046616 Ga0495668_0107663 Ga0495668_0107663_298_1053 239
586 3300046648 Ga0495611_0017387 Ga0495611_0017387_564_1319 239
587 3300046648 Ga0495611_0020345 Ga0495611_0020345_611_1366 239
588 3300046648 Ga0495611_0021970 Ga0495611_0021970_1927_2682 239
589 3300046660 Ga0495625_0000447 Ga0495625_0000447_39367_40122 239
590 3300046660 Ga0495625_0001794 Ga0495625_0001794_1767_2522 239
591 3300046660 Ga0495625_0004560 Ga0495625_0004560_1498_2253 239
592 3300046660 Ga0495625_0148103 Ga0495625_0148103_269_1024 239
593 3300046663 Ga0495635_0061146 Ga0495635_0061146_118_873 239
594 3300046664 Ga0495659_0088345 Ga0495659_0088345_156_911 239
595 3300046665 Ga0495661_0001766 Ga0495661_0001766_8070_8825 239
596 3300046665 Ga0495661_0002651 Ga0495661_0002651_10539_11294 239
597 3300046665 Ga0495661_0004522 Ga0495661_0004522_3723_4478 239
598 3300046665 Ga0495661_0016091 Ga0495661_0016091_3233_3988 239
599 3300046665 Ga0495661_0020901 Ga0495661_0020901_1139_1897 239
600 3300046665 Ga0495661_0024501 Ga0495661_0024501_2249_3004 239
601 3300046665 Ga0495661_0050888 Ga0495661_0050888_1409_2164 239
602 3300046665 Ga0495661_0065357 Ga0495661_0065357_930_1685 239
603 3300046665 Ga0495661_0136632 Ga0495661_0136632_454_1209 239
604 3300046674 Ga0495588_0000156 Ga0495588_0000156_25172_25927 239
605 3300046674 Ga0495588_0009796 Ga0495588_0009796_3215_3970 239
606 3300046674 Ga0495588_0009853 Ga0495588_0009853_982_1737 239
607 3300046674 Ga0495588_0015263 Ga0495588_0015263_1394_2149 239
608 3300046674 Ga0495588_0259627 Ga0495588_0259627_44_799 239
609 3300046684 Ga0495669_0000032 Ga0495669_0000032_73764_74519 239
610 3300046684 Ga0495669_0001016 Ga0495669_0001016_4677_5432 239
611 3300046684 Ga0495669_0001071 Ga0495669_0001071_2525_3280 239
612 3300046684 Ga0495669_0022793 Ga0495669_0022793_1082_1837 239
613 3300046689 Ga0495613_0065853 Ga0495613_0065853_487_1242 239
614 3300046691 Ga0495670_0000420 Ga0495670_0000420_14726_15481 239
615 3300046691 Ga0495670_0000920 Ga0495670_0000920_4508_5263 239
616 3300046691 Ga0495670_0001653 Ga0495670_0001653_3316_4074 239
617 3300046691 Ga0495670_0008338 Ga0495670_0008338_2382_3137 239
618 3300046691 Ga0495670_0017952 Ga0495670_0017952_1941_2696 239
619 3300046691 Ga0495670_0039484 Ga0495670_0039484_800_1555 239
620 3300046691 Ga0495670_0047703 Ga0495670_0047703_1152_1907 239
621 3300046691 Ga0495670_0107750 Ga0495670_0107750_615_1370 239
622 3300046692 Ga0495671_0000005 Ga0495671_0000005_266069_266824 239
623 3300046692 Ga0495671_0031505 Ga0495671_0031505_1946_2701 239
624 3300046692 Ga0495671_0058006 Ga0495671_0058006_45_800 239
625 3300046692 Ga0495671_0066347 Ga0495671_0066347_1004_1759 239
626 3300046694 Ga0495649_0000482 Ga0495649_0000482_518_1273 239
627 3300046694 Ga0495649_0003639 Ga0495649_0003639_7627_8382 239
628 3300046694 Ga0495649_0006253 Ga0495649_0006253_4211_4966 239
629 3300046694 Ga0495649_0104591 Ga0495649_0104591_322_1077 239
630 3300046794 Ga0495589_0000074 Ga0495589_0000074_68047_68802 239
631 3300046794 Ga0495589_0000099 Ga0495589_0000099_24573_25328 239
632 3300046794 Ga0495589_0001180 Ga0495589_0001180_12200_12955 239
633 3300046794 Ga0495589_0010526 Ga0495589_0010526_1106_1861 239
634 3300046794 Ga0495589_0013228 Ga0495589_0013228_2394_3149 239
635 3300046794 Ga0495589_0013619 Ga0495589_0013619_2699_3454 239
636 3300046794 Ga0495589_0021758 Ga0495589_0021758_2046_2801 239
637 3300046809 Ga0495600_0187892 Ga0495600_0187892_448_1203 239
638 3300046810 Ga0495660_0000047 Ga0495660_0000047_138223_138978 239
639 3300046810 Ga0495660_0001717 Ga0495660_0001717_3834_4589 239
640 3300046810 Ga0495660_0012777 Ga0495660_0012777_2203_2958 239
641 3300046810 Ga0495660_0015062 Ga0495660_0015062_1783_2538 239
642 3300046810 Ga0495660_0030739 Ga0495660_0030739_589_1344 239
643 3300046810 Ga0495660_0035293 Ga0495660_0035293_111_866 239
644 3300046810 Ga0495660_0036426 Ga0495660_0036426_1773_2528 239
645 3300046810 Ga0495660_0049292 Ga0495660_0049292_299_1057 239
646 3300047318 Ga0495636_0048329 Ga0495636_0048329_616_1371 239
647 3300047320 Ga0495672_0000081 Ga0495672_0000081_20588_21343 239
648 3300047320 Ga0495672_0000256 Ga0495672_0000256_10699_11454 239
649 3300047320 Ga0495672_0000421 Ga0495672_0000421_27624_28379 239
650 3300047320 Ga0495672_0011544 Ga0495672_0011544_2777_3532 239
651 3300047320 Ga0495672_0082434 Ga0495672_0082434_968_1723 239
652 3300047321 Ga0495676_0000031 Ga0495676_0000031_104364_105119 239
653 3300047321 Ga0495676_0084548 Ga0495676_0084548_1560_2315 239
654 3300047323 Ga0495683_0003367 Ga0495683_0003367_7197_7952 239
655 3300047323 Ga0495683_0006360 Ga0495683_0006360_1847_2602 239
656 3300047323 Ga0495683_0013798 Ga0495683_0013798_2201_2956 239
657 3300047323 Ga0495683_0020780 Ga0495683_0020780_145_900 239
658 3300047323 Ga0495683_0056954 Ga0495683_0056954_494_1249 239
659 3300047443 Ga0495687_000071 Ga0495687_000071_25640_26395 239
660 3300047443 Ga0495687_000167 Ga0495687_000167_5232_5987 239
661 3300047443 Ga0495687_000172 Ga0495687_000172_60459_61214 239
662 3300047443 Ga0495687_000238 Ga0495687_000238_64511_65266 239
663 3300047443 Ga0495687_000699 Ga0495687_000699_18051_18806 239
664 3300047443 Ga0495687_003946 Ga0495687_003946_1468_2223 239
665 3300047444 Ga0495675_0016557 Ga0495675_0016557_366_1121 239
666 3300047445 Ga0495677_0000016 Ga0495677_0000016_25505_26260 239
667 3300047445 Ga0495677_0001268 Ga0495677_0001268_6052_6807 239
668 3300047445 Ga0495677_0001615 Ga0495677_0001615_3501_4256 239
669 3300047445 Ga0495677_0001817 Ga0495677_0001817_2823_3578 239
670 3300047445 Ga0495677_0008653 Ga0495677_0008653_154_909 239
671 3300047445 Ga0495677_0009842 Ga0495677_0009842_1998_2753 239
672 3300047445 Ga0495677_0045977 Ga0495677_0045977_780_1535 239
673 3300047445 Ga0495677_0048941 Ga0495677_0048941_12_767 239
674 3300047446 Ga0495679_006996 Ga0495679_006996_1728_2483 239
675 3300047446 Ga0495679_023648 Ga0495679_023648_1280_2035 239
676 3300047446 Ga0495679_070867 Ga0495679_070867_230_988 239
677 3300047469 Ga0495673_0000008 Ga0495673_0000008_597423_598178 239
678 3300047469 Ga0495673_0000009 Ga0495673_0000009_526014_526769 239
679 3300047469 Ga0495673_0000012 Ga0495673_0000012_411593_412348 239
680 3300047470 Ga0495681_0004302 Ga0495681_0004302_4473_5228 239
681 3300047470 Ga0495681_0004454 Ga0495681_0004454_5893_6648 239
682 3300047470 Ga0495681_0021349 Ga0495681_0021349_87_842 239
683 3300047470 Ga0495681_0031971 Ga0495681_0031971_433_1191 239
684 3300047472 Ga0495686_0014303 Ga0495686_0014303_2979_3734 239
685 3300047472 Ga0495686_0049650 Ga0495686_0049650_1799_2554 239
686 3300048088 Ga0495602_0065123 Ga0495602_0065123_1425_2180 239
687 3300048090 Ga0495615_0001856 Ga0495615_0001856_1949_2704 239
688 3300048091 Ga0495626_0000042 Ga0495626_0000042_24494_25249 239
689 3300048091 Ga0495626_0002441 Ga0495626_0002441_5559_6314 239
690 3300048091 Ga0495626_0003455 Ga0495626_0003455_9101_9856 239
691 3300048091 Ga0495626_0037088 Ga0495626_0037088_588_1343 239
692 3300048091 Ga0495626_0042382 Ga0495626_0042382_1332_2087 239
693 3300048091 Ga0495626_0058098 Ga0495626_0058098_210_965 239
694 3300048903 Ga0496100_0132725 Ga0496100_0132725_794_1549 239
695 3300048905 Ga0496102_0004881 Ga0496102_0004881_5853_6608 239
696 3300048905 Ga0496102_0042701 Ga0496102_0042701_639_1394 239
697 3300048905 Ga0496102_0049077 Ga0496102_0049077_804_1559 239
698 3300048906 Ga0496103_0001821 Ga0496103_0001821_7954_8709 239
699 3300048906 Ga0496103_0009556 Ga0496103_0009556_2237_2995 239
700 3300048909 Ga0496106_0051043 Ga0496106_0051043_922_1677 239
701 3300048910 Ga0496107_0123418 Ga0496107_0123418_710_1465 239
702 3300048914 Ga0496111_0119197 Ga0496111_0119197_455_1210 239
703 3300048914 Ga0496111_0143740 Ga0496111_0143740_388_1143 239
704 3300048915 Ga0496112_0632497 Ga0496112_0632497_47_802 239
705 3300048924 Ga0496121_0045227 Ga0496121_0045227_715_1473 239
706 3300048924 Ga0496121_0077623 Ga0496121_0077623_996_1751 239
707 3300048925 Ga0496122_0026655 Ga0496122_0026655_2468_3226 239
708 3300048925 Ga0496122_0068739 Ga0496122_0068739_1461_2216 239
709 3300048925 Ga0496122_0171333 Ga0496122_0171333_472_1230 239
710 3300048926 Ga0496123_0001791 Ga0496123_0001791_24966_25721 239
711 3300048926 Ga0496123_0005185 Ga0496123_0005185_9548_10306 239
712 3300048927 Ga0496124_0011857 Ga0496124_0011857_3468_4223 239
713 3300048927 Ga0496124_0017492 Ga0496124_0017492_2692_3447 239
714 3300048927 Ga0496124_0040289 Ga0496124_0040289_2050_2805 239
715 3300048927 Ga0496124_0069965 Ga0496124_0069965_235_990 239
716 3300048929 Ga0496126_0011014 Ga0496126_0011014_4235_4990 239
717 3300049459 Ga0495678_000346 Ga0495678_000346_34943_35698 239
718 3300049459 Ga0495678_002173 Ga0495678_002173_2447_3202 239
719 3300049460 Ga0495682_0000999 Ga0495682_0000999_7389_8144 239
720 3300049460 Ga0495682_0005088 Ga0495682_0005088_589_1344 239
721 3300049766 Ga0501269_000005 Ga0501269_000005_63229_63987 239
722 3300053118 Ga0500594_0014384 Ga0500594_0014384_748_1503 239
723 3300053118 Ga0500594_0033405 Ga0500594_0033405_548_1303 239
724 3300053125 Ga0500618_000170 Ga0500618_000170_35346_36101 239
725 3300053145 Ga0500586_000788 Ga0500586_000788_5241_5996 239
726 3300053145 Ga0500586_000850 Ga0500586_000850_1867_2622 239
727 3300053149 Ga0500600_0019665 Ga0500600_0019665_3218_3997 239
728 3300059510 Ga0587090_004825 Ga0587090_004825_49_804 239
729 3300002741 JGI25157J39369_1000961 JGI25157J39369_10009612 240
730 3300003752 Ga0055539_1015916 Ga0055539_10159161 240
731 3300003756 Ga0055533_1003239 Ga0055533_10032395 240
732 3300003759 Ga0055525_1000043 Ga0055525_100004399 240
733 3300003760 Ga0055527_1000028 Ga0055527_1000028137 240
734 3300003760 Ga0055527_1000068 Ga0055527_100006828 240
735 3300003761 Ga0055535_1000081 Ga0055535_100008128 240
736 3300003761 Ga0055535_1000090 Ga0055535_100009028 240
737 3300003761 Ga0055535_1000368 Ga0055535_100036823 240
738 3300003762 Ga0055542_1000053 Ga0055542_1000053137 240
739 3300003762 Ga0055542_1000093 Ga0055542_100009329 240
740 3300003762 Ga0055542_1000113 Ga0055542_100011367 240
741 3300003763 Ga0055529_1000104 Ga0055529_100010489 240
742 3300003763 Ga0055529_1000281 Ga0055529_100028128 240
743 3300005327 Ga0070658_10050584 Ga0070658_100505842 240
744 3300005345 Ga0070692_10094485 Ga0070692_100944852 240
745 3300005458 Ga0070681_10000073 Ga0070681_1000007333 240
746 3300005614 Ga0068856_100002135 Ga0068856_10000213523 240
747 3300013100 Ga0157373_10048396 Ga0157373_100483964 240
748 3300013104 Ga0157370_10129227 Ga0157370_101292273 240
749 3300013307 Ga0157372_11054508 Ga0157372_110545082 240
750 3300015685 Ga0183369_1011 Ga0183369_1011118 240
751 3300025226 Ga0209674_100059 Ga0209674_100059132 240
752 3300025226 Ga0209674_100504 Ga0209674_1005042 240
753 3300025228 Ga0209672_100004 Ga0209672_100004670 240
754 3300025228 Ga0209672_100008 Ga0209672_100008574 240
755 3300025228 Ga0209672_101512 Ga0209672_1015124 240
756 3300025230 Ga0209563_100036 Ga0209563_100036227 240
757 3300025242 Ga0209258_100003 Ga0209258_100003670 240
758 3300025242 Ga0209258_100004 Ga0209258_100004616 240
759 3300025242 Ga0209258_100008 Ga0209258_100008241 240
760 3300025242 Ga0209258_100057 Ga0209258_10005772 240
761 3300025250 Ga0209026_1000081 Ga0209026_1000081165 240
762 3300025253 Ga0209677_104649 Ga0209677_1046496 240
763 3300025254 Ga0209148_1000016 Ga0209148_1000016670 240
764 3300025254 Ga0209148_1000068 Ga0209148_100006872 240
765 3300025254 Ga0209148_1000200 Ga0209148_100020067 240
766 3300025256 Ga0209759_1000117 Ga0209759_100011724 240
767 3300025272 Ga0209455_1000004 Ga0209455_1000004670 240
768 3300025272 Ga0209455_1000007 Ga0209455_1000007361 240
769 3300025272 Ga0209455_1000103 Ga0209455_1000103161 240
770 3300025272 Ga0209455_1012194 Ga0209455_10121943 240
771 3300025911 Ga0207654_10403350 Ga0207654_104033502 240
772 3300025912 Ga0207707_10000105 Ga0207707_1000010558 240
773 3300025912 Ga0207707_10441134 Ga0207707_104411342 240
774 3300026078 Ga0207702_10001944 Ga0207702_100019449 240
775 3300031238 Ga0265332_10036363 Ga0265332_100363632 240
776 3300037312 Ga0395899_0000047 Ga0395899_0000047_228996_229757 240
777 3300037312 Ga0395899_0003695 Ga0395899_0003695_7103_7864 240
778 3300037418 Ga0395900_0000011 Ga0395900_0000011_331761_332522 240
779 3300037418 Ga0395900_0000239 Ga0395900_0000239_70264_71040 240
780 3300037466 Ga0395898_0000029 Ga0395898_0000029_88269_89030 240
781 3300037466 Ga0395898_0000336 Ga0395898_0000336_79761_80522 240
782 3300037471 Ga0395905_0044043 Ga0395905_0044043_2925_3710 240
783 3300038443 Ga0395901_0169539 Ga0395901_0169539_1287_2048 240
784 3300038443 Ga0395901_0732177 Ga0395901_0732177_91_849 240
785 3300044656 Ga0466969_0001366 Ga0466969_0001366_5535_6293 240
786 3300044656 Ga0466969_0010929 Ga0466969_0010929_2452_3213 240
787 3300044683 Ga0466965_0009221 Ga0466965_0009221_2968_3729 240
788 3300044683 Ga0466965_0077001 Ga0466965_0077001_660_1421 240
789 3300044683 Ga0466965_0096651 Ga0466965_0096651_33_791 240
790 3300044684 Ga0466966_0010252 Ga0466966_0010252_4086_4844 240
791 3300044693 Ga0466961_0004973 Ga0466961_0004973_7544_8305 240
792 3300044693 Ga0466961_0008608 Ga0466961_0008608_399_1160 240
793 3300044693 Ga0466961_0029378 Ga0466961_0029378_2365_3123 240
794 3300044706 Ga0466964_0030658 Ga0466964_0030658_832_1593 240
795 3300044719 Ga0466971_0005812 Ga0466971_0005812_1489_2247 240
796 3300044735 Ga0466968_0228957 Ga0466968_0228957_86_847 240
797 3300044765 Ga0466970_0014053 Ga0466970_0014053_376_1137 240
798 3300044765 Ga0466970_0173150 Ga0466970_0173150_60_821 240
799 3300044842 Ga0466957_0000178 Ga0466957_0000178_7871_8632 240
800 3300044842 Ga0466957_0004423 Ga0466957_0004423_1577_2338 240
801 3300045049 Ga0466959_0000006 Ga0466959_0000006_66876_67637 240
802 3300045049 Ga0466959_0021639 Ga0466959_0021639_1008_1769 240
803 3300045049 Ga0466959_0185192 Ga0466959_0185192_74_835 240
804 3300045836 Ga0466958_0078058 Ga0466958_0078058_1254_2015 240
805 3300045836 Ga0466958_0251184 Ga0466958_0251184_110_868 240
806 3300045976 Ga0466967_0006764 Ga0466967_0006764_6582_7343 240
807 3300046530 Ga0495654_0001451 Ga0495654_0001451_6517_7314 240
808 3300049568 Ga0501031_0056696 Ga0501031_0056696_139_888 240
809 3300049569 Ga0501032_0089966 Ga0501032_0089966_832_1581 240
810 3300049570 Ga0501033_0110540 Ga0501033_0110540_582_1331 240
811 3300049572 Ga0501036_0068324 Ga0501036_0068324_1210_1959 240
812 3300049573 Ga0501037_0014092 Ga0501037_0014092_1782_2531 240
813 3300049574 Ga0501038_0051528 Ga0501038_0051528_1517_2266 240
814 3300049578 Ga0501042_0252630 Ga0501042_0252630_87_836 240
815 3300049580 Ga0501046_0355159 Ga0501046_0355159_160_909 240
816 3300049581 Ga0501047_0072697 Ga0501047_0072697_1263_2012 240
817 3300049581 Ga0501047_0240893 Ga0501047_0240893_329_1078 240
818 3300049589 Ga0501073_0062339 Ga0501073_0062339_204_953 240
819 3300049823 Ga0501044_0240437 Ga0501044_0240437_99_848 240
820 3300061719 Ga0466962_0002918 Ga0466962_0002918_3173_3931 240
821 3300061719 Ga0466962_0033719 Ga0466962_0033719_1462_2223 240
822 iso_pu_bacteria 2643221577 2643895814 240
823 iso_pu_bacteria 2643221685 2644478006 240
824 iso_pu_bacteria 2884411467 2884411697 240
825 3300003322 rootL2_10019723 rootL2_100197235 241
826 3300003374 JGI25161J50226_1012920 JGI25161J50226_10129201 241
827 3300003763 Ga0055529_1001736 Ga0055529_10017367 241
828 3300004625 Ga0055543_1003646 Ga0055543_10036469 241
829 3300005262 Ga0065165_1000177 Ga0065165_100017758 241
830 3300005336 Ga0070680_100184653 Ga0070680_1001846532 241
831 3300005366 Ga0070659_100007602 Ga0070659_1000076024 241
832 3300005444 Ga0070694_100136603 Ga0070694_1001366032 241
833 3300005458 Ga0070681_10006342 Ga0070681_100063428 241
834 3300005530 Ga0070679_100139290 Ga0070679_1001392902 241
835 3300005539 Ga0068853_100005750 Ga0068853_1000057504 241
836 3300005563 Ga0068855_100155501 Ga0068855_1001555012 241
837 3300009551 Ga0105238_10013264 Ga0105238_100132643 241
838 3300013102 Ga0157371_10006745 Ga0157371_100067457 241
839 3300013104 Ga0157370_10010296 Ga0157370_100102964 241
840 3300013307 Ga0157372_10007798 Ga0157372_100077988 241
841 3300025228 Ga0209672_104778 Ga0209672_1047783 241
842 3300025272 Ga0209455_1000198 Ga0209455_100019811 241
843 3300025912 Ga0207707_10372631 Ga0207707_103726311 241
844 3300025921 Ga0207652_10056875 Ga0207652_100568755 241
845 3300025924 Ga0207694_10030578 Ga0207694_100305782 241
846 3300025932 Ga0207690_10017611 Ga0207690_100176115 241
847 3300025949 Ga0207667_10032082 Ga0207667_100320822 241
848 3300026041 Ga0207639_10001438 Ga0207639_100014387 241
849 3300037312 Ga0395899_0025244 Ga0395899_0025244_3238_3990 241
850 3300037312 Ga0395899_0042834 Ga0395899_0042834_1151_1903 241
851 3300037418 Ga0395900_0001714 Ga0395900_0001714_6961_7713 241
852 3300037418 Ga0395900_0062999 Ga0395900_0062999_1585_2337 241
853 3300037466 Ga0395898_0011209 Ga0395898_0011209_4307_5059 241
854 3300037466 Ga0395898_0069011 Ga0395898_0069011_944_1696 241
855 3300037471 Ga0395905_0331832 Ga0395905_0331832_45_797 241
856 3300038443 Ga0395901_0006758 Ga0395901_0006758_3574_4326 241
857 3300038443 Ga0395901_0048940 Ga0395901_0048940_2695_3447 241
858 3300047472 Ga0495686_0000050 Ga0495686_0000050_115641_116393 241
859 3300049593 Ga0501077_0111987 Ga0501077_0111987_259_1032 241
860 3300049822 Ga0501035_0020438 Ga0501035_0020438_5036_5827 241
861 3300049823 Ga0501044_0000316 Ga0501044_0000316_26394_27185 241
862 iso_pu_bacteria 2739367700 2739733773 241
863 iso_pu_bacteria 2884338543 2884342333 241
864 iso_pu_bacteria 2895395659 2895396017 241
865 iso_pu_bacteria 2928963466 2928966558 241
866 iso_pu_bacteria 2941471342 2941474892 241
867 3300003763 Ga0055529_1002216 Ga0055529_10022162 242
868 3300005331 Ga0070670_100021532 Ga0070670_1000215325 242
869 3300005337 Ga0070682_100148110 Ga0070682_1001481102 242
870 3300005455 Ga0070663_100049501 Ga0070663_1000495012 242
871 3300005458 Ga0070681_10379774 Ga0070681_103797742 242
872 3300005530 Ga0070679_100650471 Ga0070679_1006504711 242
873 3300005547 Ga0070693_100100744 Ga0070693_1001007443 242
874 3300005563 Ga0068855_100034011 Ga0068855_1000340117 242
875 3300005614 Ga0068856_100000207 Ga0068856_10000020736 242
876 3300006195 Ga0075366_10213942 Ga0075366_102139422 242
877 3300009093 Ga0105240_10469567 Ga0105240_104695672 242
878 3300009545 Ga0105237_10000027 Ga0105237_10000027146 242
879 3300009551 Ga0105238_10526534 Ga0105238_105265342 242
880 3300010375 Ga0105239_10025459 Ga0105239_100254592 242
881 3300013105 Ga0157369_10393625 Ga0157369_103936252 242
882 3300013307 Ga0157372_10026755 Ga0157372_100267552 242
883 3300013307 Ga0157372_10170706 Ga0157372_101707064 242
884 3300020081 Ga0206354_10215344 Ga0206354_102153443 242
885 3300021361 Ga0213872_10000007 Ga0213872_10000007132 242
886 3300025246 Ga0209646_1002924 Ga0209646_10029242 242
887 3300025250 Ga0209026_1000203 Ga0209026_100020355 242
888 3300025256 Ga0209759_1004673 Ga0209759_10046732 242
889 3300025272 Ga0209455_1000142 Ga0209455_1000142100 242
890 3300025904 Ga0207647_10059842 Ga0207647_100598424 242
891 3300025913 Ga0207695_10007089 Ga0207695_100070897 242
892 3300025914 Ga0207671_10002579 Ga0207671_1000257919 242
893 3300025925 Ga0207650_10017054 Ga0207650_100170543 242
894 3300025949 Ga0207667_10119132 Ga0207667_101191322 242
895 3300025981 Ga0207640_10012132 Ga0207640_100121323 242
896 3300026067 Ga0207678_10029060 Ga0207678_100290601 242
897 3300026078 Ga0207702_10000279 Ga0207702_1000027940 242
898 3300026116 Ga0207674_10641590 Ga0207674_106415901 242
899 3300037312 Ga0395899_0045216 Ga0395899_0045216_1254_2021 242
900 3300037418 Ga0395900_0148552 Ga0395900_0148552_100_867 242
901 3300037466 Ga0395898_0254277 Ga0395898_0254277_111_878 242
902 3300038443 Ga0395901_0110528 Ga0395901_0110528_1156_1923 242
903 3300039447 Ga0436361_0163583 Ga0436361_0163583_92971_93756 242
904 3300048925 Ga0496122_0118483 Ga0496122_0118483_242_1009 242
905 3300048927 Ga0496124_0000770 Ga0496124_0000770_42929_43696 242
906 3300048927 Ga0496124_0002826 Ga0496124_0002826_8503_9270 242
907 3300049571 Ga0501034_0073167 Ga0501034_0073167_18_773 242
908 3300049571 Ga0501034_0313315 Ga0501034_0313315_290_1045 242
909 3300049572 Ga0501036_0060971 Ga0501036_0060971_2164_2919 242
910 3300049579 Ga0501043_0056558 Ga0501043_0056558_142_897 242
911 3300049581 Ga0501047_0003952 Ga0501047_0003952_12480_13235 242
912 3300049581 Ga0501047_0018619 Ga0501047_0018619_3226_3981 242
913 3300049822 Ga0501035_0043052 Ga0501035_0043052_1216_1971 242
914 3300049822 Ga0501035_0044045 Ga0501035_0044045_215_970 242
915 3300049823 Ga0501044_0002865 Ga0501044_0002865_6009_6764 242
916 3300049823 Ga0501044_0074604 Ga0501044_0074604_105_860 242
917 iso_pu_bacteria 2593339238 2595447676 242
918 iso_pu_bacteria 2593339239 2595450399 242
919 iso_pu_bacteria 2718218334 2721029140 242
920 iso_pu_bacteria 2734482264 2735835273 242
921 iso_pu_bacteria 2738543009 2739229607 242
922 iso_pu_bacteria 2818991440 2819565001 242
923 iso_pu_bacteria 2842914999 2842916929 242
924 iso_pu_bacteria 2842918807 2842922431 242
925 iso_pu_bacteria 2904463128 2904465477 242
926 iso_pu_bacteria 2919085039 2919087993 242
927 iso_pu_bacteria 2919404418 2919406953 242
928 iso_pu_bacteria 2953994433 2953996893 242
929 3300002705 JGI25156J39149_1016335 JGI25156J39149_10163352 243
930 3300002737 JGI25162J39368_1000613 JGI25162J39368_100061325 243
931 3300002741 JGI25157J39369_1000460 JGI25157J39369_10004602 243
932 3300002741 JGI25157J39369_1006842 JGI25157J39369_10068422 243
933 3300002772 JGI25164J39214_1000395 JGI25164J39214_100039525 243
934 3300002772 JGI25164J39214_1004037 JGI25164J39214_10040372 243
935 3300003214 JGI25165J46597_1000735 JGI25165J46597_100073525 243
936 3300003316 rootH1_10005743 rootH1_1000574313 243
937 3300003320 rootH2_10001137 rootH2_100011376 243
938 3300003322 rootL2_10023806 rootL2_100238062 243
939 3300003751 Ga0055538_1003606 Ga0055538_10036064 243
940 3300003761 Ga0055535_1000744 Ga0055535_10007442 243
941 3300003762 Ga0055542_1000728 Ga0055542_100072825 243
942 3300003763 Ga0055529_1000642 Ga0055529_100064225 243
943 3300005344 Ga0070661_100010095 Ga0070661_1000100956 243
944 3300005435 Ga0070714_100003767 Ga0070714_1000037678 243
945 3300005436 Ga0070713_100003302 Ga0070713_1000033022 243
946 3300005578 Ga0068854_100463391 Ga0068854_1004633912 243
947 3300006051 Ga0075364_10226279 Ga0075364_102262792 243
948 3300009093 Ga0105240_10000179 Ga0105240_1000017916 243
949 3300009101 Ga0105247_10033012 Ga0105247_100330123 243
950 3300009148 Ga0105243_10160102 Ga0105243_101601023 243
951 3300010375 Ga0105239_10000273 Ga0105239_1000027336 243
952 3300013104 Ga0157370_10371330 Ga0157370_103713302 243
953 3300013306 Ga0163162_10227996 Ga0163162_102279962 243
954 3300014497 Ga0182008_10016178 Ga0182008_100161783 243
955 3300015261 Ga0182006_1000082 Ga0182006_1000082108 243
956 3300015262 Ga0182007_10002295 Ga0182007_1000229511 243
957 3300015262 Ga0182007_10040964 Ga0182007_100409642 243
958 3300015265 Ga0182005_1005858 Ga0182005_10058585 243
959 3300017792 Ga0163161_10001649 Ga0163161_1000164912 243
960 3300025207 Ga0209760_101500 Ga0209760_1015004 243
961 3300025224 Ga0209784_100094 Ga0209784_10009464 243
962 3300025225 Ga0209566_101050 Ga0209566_1010504 243
963 3300025228 Ga0209672_107879 Ga0209672_1078792 243
964 3300025231 Ga0207427_100100 Ga0207427_10010064 243
965 3300025233 Ga0209437_100059 Ga0209437_100059264 243
966 3300025242 Ga0209258_100034 Ga0209258_100034151 243
967 3300025242 Ga0209258_104844 Ga0209258_1048442 243
968 3300025246 Ga0209646_1001441 Ga0209646_10014412 243
969 3300025250 Ga0209026_1000161 Ga0209026_100016125 243
970 3300025250 Ga0209026_1001231 Ga0209026_100123110 243
971 3300025254 Ga0209148_1000001 Ga0209148_1000001553 243
972 3300025256 Ga0209759_1000786 Ga0209759_10007862 243
973 3300025256 Ga0209759_1006478 Ga0209759_10064783 243
974 3300025261 Ga0209233_1000002 Ga0209233_10000021678 243
975 3300025272 Ga0209455_1000054 Ga0209455_1000054120 243
976 3300025299 Ga0209256_1006536 Ga0209256_10065363 243
977 3300025900 Ga0207710_10028439 Ga0207710_100284394 243
978 3300025913 Ga0207695_10000100 Ga0207695_1000010020 243
979 3300025913 Ga0207695_10000265 Ga0207695_10000265109 243
980 3300025920 Ga0207649_10028347 Ga0207649_100283472 243
981 3300025928 Ga0207700_10005894 Ga0207700_100058942 243
982 3300025929 Ga0207664_10060545 Ga0207664_100605452 243
983 3300025933 Ga0207706_10366002 Ga0207706_103660022 243
984 3300031548 Ga0307408_100000109 Ga0307408_10000010929 243
985 3300032004 Ga0307414_10067313 Ga0307414_100673133 243
986 3300032005 Ga0307411_10001682 Ga0307411_100016824 243
987 3300034817 Ga0373948_0016998 Ga0373948_0016998_107_910 243
988 3300034820 Ga0373959_0052824 Ga0373959_0052824_64_867 243
989 3300035088 Ga0373940_0047210 Ga0373940_0047210_298_1101 243
990 3300035114 Ga0373939_0000040 Ga0373939_0000040_27674_28477 243
991 3300035121 Ga0373960_0000506 Ga0373960_0000506_3181_3984 243
992 3300035242 Ga0373962_0014344 Ga0373962_0014344_353_1156 243
993 3300035691 Ga0373931_0000637 Ga0373931_0000637_1076_1879 243
994 3300037471 Ga0395905_0013255 Ga0395905_0013255_564_1367 243
995 3300045051 Ga0451576_0089766 Ga0451576_0089766_2258_3064 243
996 3300045051 Ga0451576_0094129 Ga0451576_0094129_2168_2962 243
997 3300046452 Ga0495617_000040 Ga0495617_000040_83353_84120 243
998 3300046452 Ga0495617_003735 Ga0495617_003735_3466_4233 243
999 3300046460 Ga0495638_0000251 Ga0495638_0000251_50338_51105 243
1000 3300046471 Ga0495650_0001533 Ga0495650_0001533_11171_11938 243
1001 3300046491 Ga0495584_0001324 Ga0495584_0001324_4004_4762 243
1002 3300046492 Ga0495585_0000024 Ga0495585_0000024_26688_27455 243
1003 3300046492 Ga0495585_0001698 Ga0495585_0001698_11974_12732 243
1004 3300046501 Ga0495607_0000616 Ga0495607_0000616_14687_15454 243
1005 3300046506 Ga0495583_0007998 Ga0495583_0007998_3519_4286 243
1006 3300046507 Ga0495606_0000572 Ga0495606_0000572_13781_14539 243
1007 3300046507 Ga0495606_0000902 Ga0495606_0000902_34001_34759 243
1008 3300046507 Ga0495606_0128545 Ga0495606_0128545_687_1454 243
1009 3300046512 Ga0495610_0039615 Ga0495610_0039615_905_1672 243
1010 3300046513 Ga0495616_0000090 Ga0495616_0000090_9827_10585 243
1011 3300046513 Ga0495616_0002573 Ga0495616_0002573_10762_11529 243
1012 3300046515 Ga0495620_0000117 Ga0495620_0000117_9125_9883 243
1013 3300046515 Ga0495620_0021550 Ga0495620_0021550_265_1032 243
1014 3300046518 Ga0495631_0000049 Ga0495631_0000049_3517_4284 243
1015 3300046518 Ga0495631_0000130 Ga0495631_0000130_11513_12280 243
1016 3300046519 Ga0495632_0007200 Ga0495632_0007200_544_1311 243
1017 3300046519 Ga0495632_0012273 Ga0495632_0012273_894_1652 243
1018 3300046519 Ga0495632_0092403 Ga0495632_0092403_167_934 243
1019 3300046520 Ga0495637_0005748 Ga0495637_0005748_4711_5478 243
1020 3300046524 Ga0495648_0000449 Ga0495648_0000449_12780_13547 243
1021 3300046524 Ga0495648_0012605 Ga0495648_0012605_2797_3564 243
1022 3300046648 Ga0495611_0000005 Ga0495611_0000005_160331_161098 243
1023 3300046648 Ga0495611_0000054 Ga0495611_0000054_12514_13281 243
1024 3300046660 Ga0495625_0000066 Ga0495625_0000066_88562_89329 243
1025 3300046660 Ga0495625_0003312 Ga0495625_0003312_11711_12469 243
1026 3300046660 Ga0495625_0022747 Ga0495625_0022747_1034_1801 243
1027 3300046665 Ga0495661_0020306 Ga0495661_0020306_1425_2192 243
1028 3300046691 Ga0495670_0002541 Ga0495670_0002541_371_1129 243
1029 3300046691 Ga0495670_0005929 Ga0495670_0005929_1444_2211 243
1030 3300046692 Ga0495671_0001951 Ga0495671_0001951_7494_8261 243
1031 3300046794 Ga0495589_0000026 Ga0495589_0000026_116350_117117 243
1032 3300046810 Ga0495660_0000277 Ga0495660_0000277_9087_9854 243
1033 3300046810 Ga0495660_0001878 Ga0495660_0001878_1724_2491 243
1034 3300047323 Ga0495683_0000385 Ga0495683_0000385_17744_18502 243
1035 3300047446 Ga0495679_000010 Ga0495679_000010_89386_90153 243
1036 3300047469 Ga0495673_0000038 Ga0495673_0000038_123454_124221 243
1037 3300047469 Ga0495673_0000045 Ga0495673_0000045_82536_83303 243
1038 3300047469 Ga0495673_0002264 Ga0495673_0002264_11000_11767 243
1039 3300047472 Ga0495686_0000320 Ga0495686_0000320_77557_78324 243
1040 3300047472 Ga0495686_0002061 Ga0495686_0002061_6490_7257 243
1041 3300047472 Ga0495686_0003146 Ga0495686_0003146_11950_12708 243
1042 3300047472 Ga0495686_0005435 Ga0495686_0005435_7742_8500 243
1043 3300048904 Ga0496101_0372977 Ga0496101_0372977_294_1064 243
1044 3300048907 Ga0496104_0037257 Ga0496104_0037257_266_1027 243
1045 3300048908 Ga0496105_0028753 Ga0496105_0028753_269_1030 243
1046 3300048909 Ga0496106_0000097 Ga0496106_0000097_59141_59911 243
1047 3300048918 Ga0496115_0111488 Ga0496115_0111488_394_1161 243
1048 3300048919 Ga0496116_0021907 Ga0496116_0021907_1048_1809 243
1049 3300048919 Ga0496116_0115414 Ga0496116_0115414_350_1108 243
1050 3300048920 Ga0496117_0009819 Ga0496117_0009819_5686_6447 243
1051 3300048920 Ga0496117_0083371 Ga0496117_0083371_692_1459 243
1052 3300048921 Ga0496118_0014794 Ga0496118_0014794_905_1666 243
1053 3300048922 Ga0496119_0002696 Ga0496119_0002696_3524_4285 243
1054 3300048923 Ga0496120_0000013 Ga0496120_0000013_69334_70095 243
1055 3300048923 Ga0496120_0000311 Ga0496120_0000311_25923_26681 243
1056 3300048924 Ga0496121_0001168 Ga0496121_0001168_7116_7883 243
1057 3300048924 Ga0496121_0001172 Ga0496121_0001172_15438_16199 243
1058 3300048924 Ga0496121_0001773 Ga0496121_0001773_3512_4270 243
1059 3300048924 Ga0496121_0072075 Ga0496121_0072075_304_1071 243
1060 3300048924 Ga0496121_0346182 Ga0496121_0346182_95_853 243
1061 3300048929 Ga0496126_0005591 Ga0496126_0005591_7725_8492 243
1062 3300048929 Ga0496126_0127247 Ga0496126_0127247_515_1282 243
1063 3300049459 Ga0495678_000672 Ga0495678_000672_30147_30914 243
1064 3300049460 Ga0495682_0003586 Ga0495682_0003586_5801_6568 243
1065 3300050496 nmdc:mga07m45_824_c1 nmdc:mga07m45_824_c1_12275_13081 243
1066 3300053087 Ga0500643_000074 Ga0500643_000074_13656_14423 243
1067 3300053103 Ga0500555_000749 Ga0500555_000749_1036_1803 243
1068 3300053160 Ga0500633_0001819 Ga0500633_0001819_1711_2478 243
1069 3300053730 Ga0500645_002041 Ga0500645_002041_5147_5914 243
1070 3300001989 JGI24739J22299_10002578 JGI24739J22299_100025788 244
1071 3300002737 JGI25162J39368_1001985 JGI25162J39368_10019857 244
1072 3300002737 JGI25162J39368_1002008 JGI25162J39368_10020083 244
1073 3300002737 JGI25162J39368_1008970 JGI25162J39368_10089701 244
1074 3300002772 JGI25164J39214_1000971 JGI25164J39214_10009717 244
1075 3300002772 JGI25164J39214_1000980 JGI25164J39214_10009807 244
1076 3300003214 JGI25165J46597_1001797 JGI25165J46597_10017977 244
1077 3300003214 JGI25165J46597_1002008 JGI25165J46597_10020082 244
1078 3300003215 JGI25153J46596_10011887 JGI25153J46596_100118873 244
1079 3300003323 rootH1_10130296 rootH1_101302962 244
1080 3300003578 Ga0006562J51391_1045663 Ga0006562J51391_10456636 244
1081 3300003578 Ga0006562J51391_1045664 Ga0006562J51391_10456642 244
1082 3300003578 Ga0006562J51391_1059690 Ga0006562J51391_10596902 244
1083 3300003578 Ga0006562J51391_1059691 Ga0006562J51391_105969111 244
1084 3300005262 Ga0065165_1005293 Ga0065165_10052937 244
1085 3300005337 Ga0070682_100018616 Ga0070682_1000186162 244
1086 3300005366 Ga0070659_100005254 Ga0070659_1000052543 244
1087 3300005435 Ga0070714_100023297 Ga0070714_1000232977 244
1088 3300005530 Ga0070679_100252132 Ga0070679_1002521322 244
1089 3300005543 Ga0070672_100021973 Ga0070672_1000219733 244
1090 3300006186 Ga0075369_10023521 Ga0075369_100235213 244
1091 3300009545 Ga0105237_10105227 Ga0105237_101052271 244
1092 3300010375 Ga0105239_10009138 Ga0105239_100091388 244
1093 3300013104 Ga0157370_10000076 Ga0157370_1000007647 244
1094 3300013104 Ga0157370_10000664 Ga0157370_100006649 244
1095 3300013104 Ga0157370_10042132 Ga0157370_100421326 244
1096 3300014497 Ga0182008_10061564 Ga0182008_100615642 244
1097 3300015261 Ga0182006_1065136 Ga0182006_10651362 244
1098 3300015262 Ga0182007_10030957 Ga0182007_100309572 244
1099 3300015265 Ga0182005_1000015 Ga0182005_100001598 244
1100 3300017792 Ga0163161_10073822 Ga0163161_100738223 244
1101 3300021361 Ga0213872_10000313 Ga0213872_1000031316 244
1102 3300025230 Ga0209563_100013 Ga0209563_100013214 244
1103 3300025231 Ga0207427_100068 Ga0207427_100068100 244
1104 3300025231 Ga0207427_100143 Ga0207427_10014375 244
1105 3300025231 Ga0207427_112452 Ga0207427_1124522 244
1106 3300025233 Ga0209437_100005 Ga0209437_100005435 244
1107 3300025233 Ga0209437_100285 Ga0209437_10028522 244
1108 3300025233 Ga0209437_100305 Ga0209437_10030520 244
1109 3300025233 Ga0209437_102036 Ga0209437_1020364 244
1110 3300025254 Ga0209148_1001090 Ga0209148_10010908 244
1111 3300025258 Ga0209129_1002035 Ga0209129_10020359 244
1112 3300025261 Ga0209233_1000011 Ga0209233_1000011507 244
1113 3300025261 Ga0209233_1000172 Ga0209233_100017251 244
1114 3300025297 Ga0209758_1000452 Ga0209758_100045221 244
1115 3300025297 Ga0209758_1006831 Ga0209758_10068315 244
1116 3300025297 Ga0209758_1032810 Ga0209758_10328102 244
1117 3300025915 Ga0207693_10044732 Ga0207693_100447322 244
1118 3300025919 Ga0207657_10031500 Ga0207657_100315005 244
1119 3300025929 Ga0207664_10014209 Ga0207664_100142097 244
1120 3300025960 Ga0207651_10107959 Ga0207651_101079592 244
1121 3300026078 Ga0207702_10131275 Ga0207702_101312753 244
1122 3300026142 Ga0207698_10328999 Ga0207698_103289992 244
1123 3300031239 Ga0265328_10119248 Ga0265328_101192482 244
1124 3300031250 Ga0265331_10009412 Ga0265331_100094127 244
1125 3300031251 Ga0265327_10000012 Ga0265327_10000012206 244
1126 3300039447 Ga0436361_0094944 Ga0436361_0094944_11545_12333 244
1127 3300042012 Ga0439455_0050080 Ga0439455_0050080_250_1026 244
1128 3300042184 Ga0450908_000188 Ga0450908_000188_2274_3032 244
1129 3300044672 Ga0466982_0000024 Ga0466982_0000024_67741_68499 244
1130 3300046501 Ga0495607_0000034 Ga0495607_0000034_45823_46584 244
1131 3300046501 Ga0495607_0035113 Ga0495607_0035113_71_832 244
1132 3300046507 Ga0495606_0003321 Ga0495606_0003321_6668_7426 244
1133 3300046519 Ga0495632_0000005 Ga0495632_0000005_243583_244344 244
1134 3300048903 Ga0496100_0046613 Ga0496100_0046613_633_1391 244
1135 3300048904 Ga0496101_0004439 Ga0496101_0004439_3092_3850 244
1136 3300048919 Ga0496116_0070951 Ga0496116_0070951_1294_2055 244
1137 3300048925 Ga0496122_0018318 Ga0496122_0018318_1503_2279 244
1138 3300048925 Ga0496122_0021701 Ga0496122_0021701_332_1090 244
1139 3300048926 Ga0496123_0024751 Ga0496123_0024751_2979_3746 244
1140 3300048926 Ga0496123_0039717 Ga0496123_0039717_1464_2222 244
1141 3300048927 Ga0496124_0062949 Ga0496124_0062949_42_803 244
1142 3300048928 Ga0496125_0000088 Ga0496125_0000088_130711_131481 244
1143 3300050493 nmdc:mga0k408_107593_c1 nmdc:mga0k408_107593_c1_418_1221 244
1144 3300050516 nmdc:mga0sz30_28493_c1 nmdc:mga0sz30_28493_c1_994_1752 244
1145 3300001904 JGI24736J21556_1000710 JGI24736J21556_10007104 245
1146 3300001990 JGI24737J22298_10001024 JGI24737J22298_100010244 245
1147 3300002067 JGI24735J21928_10011588 JGI24735J21928_100115883 245
1148 3300002075 JGI24738J21930_10003068 JGI24738J21930_100030684 245
1149 3300005335 Ga0070666_10000001 Ga0070666_1000000141 245
1150 3300005344 Ga0070661_100060639 Ga0070661_1000606395 245
1151 3300005347 Ga0070668_100119141 Ga0070668_1001191414 245
1152 3300005367 Ga0070667_100095144 Ga0070667_1000951444 245
1153 3300005455 Ga0070663_100123453 Ga0070663_1001234533 245
1154 3300005456 Ga0070678_100084002 Ga0070678_1000840024 245
1155 3300005466 Ga0070685_10066018 Ga0070685_100660183 245
1156 3300005539 Ga0068853_100269007 Ga0068853_1002690071 245
1157 3300005563 Ga0068855_100171476 Ga0068855_1001714764 245
1158 3300005577 Ga0068857_100001411 Ga0068857_10000141112 245
1159 3300005578 Ga0068854_100312692 Ga0068854_1003126922 245
1160 3300005616 Ga0068852_100033894 Ga0068852_1000338942 245
1161 3300005834 Ga0068851_10002928 Ga0068851_100029283 245
1162 3300005842 Ga0068858_100050627 Ga0068858_1000506272 245
1163 3300009093 Ga0105240_10170660 Ga0105240_101706602 245
1164 3300009545 Ga0105237_10000022 Ga0105237_10000022169 245
1165 3300009551 Ga0105238_10000680 Ga0105238_1000068018 245
1166 3300012500 Ga0157314_1000005 Ga0157314_100000526 245
1167 3300013104 Ga0157370_10238871 Ga0157370_102388712 245
1168 3300013105 Ga0157369_10003428 Ga0157369_1000342813 245
1169 3300013105 Ga0157369_10175636 Ga0157369_101756364 245
1170 3300013306 Ga0163162_10002978 Ga0163162_100029786 245
1171 3300014497 Ga0182008_10002453 Ga0182008_100024536 245
1172 3300015261 Ga0182006_1000161 Ga0182006_100016131 245
1173 3300015265 Ga0182005_1002057 Ga0182005_10020576 245
1174 3300025229 Ga0209147_104519 Ga0209147_1045193 245
1175 3300025303 Ga0209051_1001853 Ga0209051_10018533 245
1176 3300025321 Ga0207656_10022392 Ga0207656_100223923 245
1177 3300025903 Ga0207680_10000003 Ga0207680_1000000392 245
1178 3300025904 Ga0207647_10000005 Ga0207647_10000005128 245
1179 3300025904 Ga0207647_10017619 Ga0207647_100176196 245
1180 3300025909 Ga0207705_10015405 Ga0207705_100154054 245
1181 3300025913 Ga0207695_10000362 Ga0207695_1000036250 245
1182 3300025913 Ga0207695_10029291 Ga0207695_100292911 245
1183 3300025914 Ga0207671_10000009 Ga0207671_10000009462 245
1184 3300025920 Ga0207649_10017714 Ga0207649_100177142 245
1185 3300025924 Ga0207694_10001193 Ga0207694_1000119318 245
1186 3300025933 Ga0207706_10071145 Ga0207706_100711454 245
1187 3300025949 Ga0207667_10000262 Ga0207667_1000026254 245
1188 3300025949 Ga0207667_10000329 Ga0207667_1000032948 245
1189 3300025949 Ga0207667_10277607 Ga0207667_102776072 245
1190 3300025972 Ga0207668_10012530 Ga0207668_100125304 245
1191 3300025981 Ga0207640_10000116 Ga0207640_1000011649 245
1192 3300025981 Ga0207640_10000556 Ga0207640_100005564 245
1193 3300025986 Ga0207658_10025713 Ga0207658_100257134 245
1194 3300026035 Ga0207703_10221920 Ga0207703_102219202 245
1195 3300026067 Ga0207678_10136681 Ga0207678_101366813 245
1196 3300026116 Ga0207674_10000879 Ga0207674_1000087918 245
1197 3300028379 Ga0268266_10000011 Ga0268266_1000001165 245
1198 3300031731 Ga0307405_10171203 Ga0307405_101712032 245
1199 3300031911 Ga0307412_10008980 Ga0307412_100089806 245
1200 3300033180 Ga0307510_10004626 Ga0307510_100046265 245
1201 3300037418 Ga0395900_0000733 Ga0395900_0000733_19318_20100 245
1202 3300037466 Ga0395898_0022841 Ga0395898_0022841_2752_3534 245
1203 3300041404 Ga0439436_0000023 Ga0439436_0000023_47505_48263 245
1204 3300041413 Ga0439465_0000150 Ga0439465_0000150_11333_12091 245
1205 3300046471 Ga0495650_0000852 Ga0495650_0000852_91_861 245
1206 3300046512 Ga0495610_0002535 Ga0495610_0002535_10596_11354 245
1207 3300046691 Ga0495670_0000864 Ga0495670_0000864_160_918 245
1208 3300046694 Ga0495649_0038845 Ga0495649_0038845_839_1597 245
1209 3300048911 Ga0496108_0224696 Ga0496108_0224696_261_1013 245
1210 3300048920 Ga0496117_0021680 Ga0496117_0021680_2062_2814 245
1211 3300048921 Ga0496118_0000815 Ga0496118_0000815_39515_40267 245
1212 3300048921 Ga0496118_0026285 Ga0496118_0026285_673_1425 245
1213 3300048922 Ga0496119_0024024 Ga0496119_0024024_641_1399 245
1214 3300048924 Ga0496121_0001099 Ga0496121_0001099_20469_21221 245
1215 3300048924 Ga0496121_0006624 Ga0496121_0006624_8051_8824 245
1216 3300048926 Ga0496123_0025054 Ga0496123_0025054_294_1046 245
1217 3300048928 Ga0496125_0374634 Ga0496125_0374634_55_825 245
1218 3300048929 Ga0496126_0006494 Ga0496126_0006494_6566_7336 245
1219 3300048929 Ga0496126_0020339 Ga0496126_0020339_120_872 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

21

233

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7275 19 239
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7064 19 239
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.6868 26 233
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.6387 26 233
2jsw-assembly1.cif.gz_A solution structure of the r13 domain of talin 0.3874 66 245
ID Description Score Start End Superfamily
af_P9WJT9_505_699_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.482 65 240 1.20.1640.10
af_P9WJV5_535_729_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4506 66 240 1.20.1640.10
af_Q8N755_102_198_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4467 137 241 1.20.1280.290
af_P9WJT9_505_699_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4427 65 240 1.20.1640.10
af_Q8N755_102_198_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4334 137 241 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A1V4GQT0-F1-model_v4 Sec-independent protein translocase protein TatC 0.8586 14 241 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A1M6XS95-F1-model_v4 Twin arginine targeting (Tat) protein translocase TatC 0.8544 83 238 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A832J8D5-F1-model_v4 Twin-arginine translocase subunit TatC 0.8523 82 241 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A1V4MN96-F1-model_v4 Sec-independent protein translocase protein TatC 0.8522 1 238 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A353XTW4-F1-model_v4 Twin-arginine translocase subunit TatC 0.8513 27 241 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Feature Viewer

pLDDT pTM Quality
60.51 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map