F491686

General Info

Members Datasets Scaffolds Average Seq Length
1208 365 1203 182

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10080924|Ga0157379_100809243
Length 178
Sequence MDQLTLGIGTRLQHTQYGPGVIVGVKYATYLISFINHGVKEIDKNDPKLDEIIPENVTEEIETHSAMEKSLLKILRLWSDSNEIIPLGDRWVGGTMILPKDNSQKPKELPIEAFFHKIVMLRDRLRVMEQQINAHKQMSDEEKINLQQYITRIYGTLTTFNVLFKNKEHWFVGDKSES

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
5 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
6 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
7 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
219 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
220 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
229 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
280 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
281 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
300 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
301 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
302 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
303 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
304 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
305 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
306 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
307 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
308 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
309 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
310 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
311 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
312 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
313 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
314 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
315 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
316 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
317 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
318 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
319 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
320 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
321 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
322 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
327 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
328 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
329 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
330 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
331 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
332 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
333 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
334 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
339 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
348 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
349 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
350 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
356 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
357 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
362 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
363 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 0
Rhizoplane 1.08
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6238227 2162886011 Bacteria 1106
2 CNXas_1002007 3300000545 Bacteria 1393
3 JGI24736J21556_1043293 3300001904 Bacteria 692
4 JGI24751J29686_10001558 3300002459 Bacteria 4737
5 rootL2_10060567 3300003322 Bacteria 4742
6 rootL2_10236104 3300003322 Bacteria 1901
7 rootH1_10224374 3300003323 Bacteria 4107
8 rootH1_10383519 3300003323 Bacteria 1342
9 JGI25160J50197_1005120 3300003354 Bacteria 5517
10 Ga0065714_10125551 3300005288 Bacteria 1299
11 Ga0065714_10171058 3300005288 Bacteria 1004
12 Ga0065704_10124374 3300005289 Bacteria 1718
13 Ga0065712_10006449 3300005290 Bacteria 7351
14 Ga0065712_10009365 3300005290 Bacteria 3927
15 Ga0065712_10094617 3300005290 Bacteria 2248
16 Ga0065712_10118315 3300005290 Bacteria 1708
17 Ga0065712_10144144 3300005290 Unclassified 1423
18 Ga0065715_10021010 3300005293 Bacteria 1417
19 Ga0065715_10328789 3300005293 Bacteria 965
20 Ga0065715_10541247 3300005293 Bacteria 748
21 Ga0065707_10166820 3300005295 Unclassified 1515
22 Ga0065707_10505871 3300005295 Bacteria 753
23 Ga0070658_10159764 3300005327 Unclassified 1890
24 Ga0070658_10487147 3300005327 Bacteria 1064
25 Ga0070658_10549608 3300005327 Bacteria 999
26 Ga0070676_10017601 3300005328 Bacteria 3955
27 Ga0070676_10124852 3300005328 Unclassified 1620
28 Ga0070676_10151051 3300005328 Unclassified 1487
29 Ga0070676_10488270 3300005328 Bacteria 872
30 Ga0070683_100065604 3300005329 Bacteria 3380
31 Ga0070683_100099212 3300005329 Unclassified 2741
32 Ga0070683_100147044 3300005329 Bacteria 2233
33 Ga0070683_100215793 3300005329 Bacteria 1823
34 Ga0070683_100265676 3300005329 Bacteria 1632
35 Ga0070683_100303162 3300005329 Bacteria 1520
36 Ga0070683_100326036 3300005329 Bacteria 1462
37 Ga0070683_100387773 3300005329 Bacteria 1332
38 Ga0070690_100006178 3300005330 Bacteria 6789
39 Ga0070690_100108460 3300005330 Unclassified 1850
40 Ga0070670_100033314 3300005331 Bacteria 4437
41 Ga0070670_100053900 3300005331 Bacteria 3453
42 Ga0070670_100056071 3300005331 Unclassified 3382
43 Ga0070670_100203577 3300005331 Bacteria 1720
44 Ga0070670_100291144 3300005331 Bacteria 1427
45 Ga0070670_100297151 3300005331 Bacteria 1412
46 Ga0070670_100415457 3300005331 Bacteria 1189
47 Ga0070670_100532854 3300005331 Unclassified 1046
48 Ga0070677_10107602 3300005333 Bacteria 1240
49 Ga0070677_10155260 3300005333 Bacteria 1069
50 Ga0070677_10193841 3300005333 Bacteria 976
51 Ga0068869_100012053 3300005334 Bacteria 5696
52 Ga0068869_100030779 3300005334 Unclassified 3770
53 Ga0068869_100052211 3300005334 Unclassified 2968
54 Ga0068869_100057639 3300005334 Unclassified 2836
55 Ga0068869_100084081 3300005334 Bacteria 2381
56 Ga0068869_100089243 3300005334 Bacteria 2315
57 Ga0068869_100120852 3300005334 Bacteria 2003
58 Ga0068869_100248911 3300005334 Bacteria 1419
59 Ga0070666_10000126 3300005335 Bacteria 53667
60 Ga0070666_10111370 3300005335 Bacteria 1893
61 Ga0070666_10155207 3300005335 Unclassified 1598
62 Ga0070666_10330912 3300005335 Bacteria 1088
63 Ga0070666_10483350 3300005335 Bacteria 897
64 Ga0070680_100002240 3300005336 Bacteria 14265
65 Ga0070680_100050135 3300005336 Bacteria 3404
66 Ga0070680_100257059 3300005336 Bacteria 1477
67 Ga0070682_100071311 3300005337 Unclassified 2223
68 Ga0068868_100002609 3300005338 Bacteria 12495
69 Ga0068868_100028711 3300005338 Bacteria 4256
70 Ga0068868_100041820 3300005338 Bacteria 3572
71 Ga0068868_100140009 3300005338 Bacteria 1985
72 Ga0068868_100216883 3300005338 Bacteria 1601
73 Ga0068868_100225796 3300005338 Unclassified 1569
74 Ga0068868_100251313 3300005338 Bacteria 1488
75 Ga0068868_100743718 3300005338 Bacteria 881
76 Ga0070660_100000831 3300005339 Bacteria 20517
77 Ga0070660_100042698 3300005339 Bacteria 3462
78 Ga0070660_100084233 3300005339 Bacteria 2498
79 Ga0070660_100105277 3300005339 Unclassified 2239
80 Ga0070660_100650456 3300005339 Bacteria 883
81 Ga0070689_100004293 3300005340 Bacteria 9615
82 Ga0070689_100060723 3300005340 Unclassified 2940
83 Ga0070689_100108699 3300005340 Bacteria 2203
84 Ga0070689_100193489 3300005340 Bacteria 1657
85 Ga0070689_100756481 3300005340 Bacteria 852
86 Ga0070689_100758079 3300005340 Bacteria 851
87 Ga0070689_100771875 3300005340 Bacteria 844
88 Ga0070687_100008161 3300005343 Bacteria 4416
89 Ga0070687_100011272 3300005343 Bacteria 3906
90 Ga0070687_100040906 3300005343 Unclassified 2338
91 Ga0070687_100054053 3300005343 Bacteria 2091
92 Ga0070687_100174895 3300005343 Bacteria 1281
93 Ga0070661_100023080 3300005344 Unclassified 4458
94 Ga0070661_100100237 3300005344 Unclassified 2153
95 Ga0070661_100190962 3300005344 Bacteria 1562
96 Ga0070661_100212724 3300005344 Bacteria 1480
97 Ga0070668_100065969 3300005347 Bacteria 2808
98 Ga0070668_100118774 3300005347 Bacteria 2111
99 Ga0070668_100346484 3300005347 Bacteria 1256
100 Ga0070668_100444332 3300005347 Bacteria 1114
101 Ga0070668_100470631 3300005347 Unclassified 1084
102 Ga0070668_100660219 3300005347 Bacteria 919
103 Ga0070669_100004117 3300005353 Bacteria 10547
104 Ga0070669_100070003 3300005353 Bacteria 2592
105 Ga0070669_100130083 3300005353 Bacteria 1930
106 Ga0070669_100321842 3300005353 Unclassified 1249
107 Ga0070669_100744282 3300005353 Bacteria 830
108 Ga0070669_100788598 3300005353 Unclassified 807
109 Ga0070675_100045495 3300005354 Bacteria 3591
110 Ga0070675_100060386 3300005354 Bacteria 3130
111 Ga0070675_100081532 3300005354 Bacteria 2698
112 Ga0070675_100201320 3300005354 Bacteria 1728
113 Ga0070675_100254452 3300005354 Unclassified 1538
114 Ga0070675_100450817 3300005354 Bacteria 1154
115 Ga0070675_100524592 3300005354 Unclassified 1069
116 Ga0070675_101558151 3300005354 Bacteria 609
117 Ga0070671_100002262 3300005355 Bacteria 14867
118 Ga0070671_100078810 3300005355 Unclassified 2753
119 Ga0070671_100243619 3300005355 Unclassified 1526
120 Ga0070671_100259235 3300005355 Bacteria 1477
121 Ga0070671_100379652 3300005355 Bacteria 1208
122 Ga0070671_100426794 3300005355 Bacteria 1136
123 Ga0070674_100058777 3300005356 Bacteria 2674
124 Ga0070674_100137176 3300005356 Unclassified 1831
125 Ga0070673_100012036 3300005364 Bacteria 5926
126 Ga0070673_100019242 3300005364 Bacteria 4900
127 Ga0070673_100045464 3300005364 Bacteria 3405
128 Ga0070673_100119196 3300005364 Unclassified 2199
129 Ga0070673_100233137 3300005364 Bacteria 1598
130 Ga0070673_101302826 3300005364 Bacteria 682
131 Ga0070688_100004391 3300005365 Bacteria 7330
132 Ga0070688_100033543 3300005365 Unclassified 3104
133 Ga0070688_100046050 3300005365 Unclassified 2699
134 Ga0070688_100092801 3300005365 Bacteria 1975
135 Ga0070659_100013337 3300005366 Bacteria 6112
136 Ga0070659_100013878 3300005366 Bacteria 6010
137 Ga0070659_100033703 3300005366 Bacteria 3980
138 Ga0070659_100532386 3300005366 Unclassified 1004
139 Ga0070667_100006079 3300005367 Bacteria 10023
140 Ga0070667_100015757 3300005367 Bacteria 6251
141 Ga0070667_100059359 3300005367 Bacteria 3236
142 Ga0070667_100136717 3300005367 Bacteria 2143
143 Ga0070667_100152306 3300005367 Bacteria 2032
144 Ga0070667_100215144 3300005367 Bacteria 1709
145 Ga0070667_100225485 3300005367 Bacteria 1669
146 Ga0070667_100242968 3300005367 Unclassified 1608
147 Ga0070667_100251166 3300005367 Unclassified 1581
148 Ga0070667_100514326 3300005367 Bacteria 1098
149 Ga0070667_100630983 3300005367 Bacteria 988
150 Ga0070713_100195313 3300005436 Bacteria 1825
151 Ga0070701_10011972 3300005438 Bacteria 3896
152 Ga0070701_10144577 3300005438 Unclassified 1363
153 Ga0070701_10171163 3300005438 Unclassified 1265
154 Ga0070701_10194481 3300005438 Unclassified 1195
155 Ga0070700_100019747 3300005441 Unclassified 3893
156 Ga0070700_100036582 3300005441 Bacteria 2978
157 Ga0070708_101071167 3300005445 Bacteria 755
158 Ga0070663_100012747 3300005455 Bacteria 5330
159 Ga0070663_100297913 3300005455 Bacteria 1290
160 Ga0070678_100012186 3300005456 Bacteria 5334
161 Ga0070678_100502067 3300005456 Bacteria 1070
162 Ga0070678_100911580 3300005456 Bacteria 804
163 Ga0070678_100971092 3300005456 Bacteria 780
164 Ga0070678_101191830 3300005456 Bacteria 706
165 Ga0070662_100006695 3300005457 Bacteria 7447
166 Ga0070662_100046912 3300005457 Unclassified 3106
167 Ga0070662_100076849 3300005457 Unclassified 2476
168 Ga0070662_100094771 3300005457 Bacteria 2248
169 Ga0070662_100452488 3300005457 Unclassified 1066
170 Ga0070681_10001251 3300005458 Bacteria 22123
171 Ga0070681_10033532 3300005458 Bacteria 5155
172 Ga0070681_10146444 3300005458 Unclassified 2290
173 Ga0068867_100011375 3300005459 Bacteria 6279
174 Ga0068867_100018002 3300005459 Bacteria 5020
175 Ga0068867_100033276 3300005459 Bacteria 3731
176 Ga0068867_100076582 3300005459 Bacteria 2512
177 Ga0068867_100131964 3300005459 Bacteria 1942
178 Ga0068867_100176714 3300005459 Bacteria 1695
179 Ga0068867_100181767 3300005459 Bacteria 1673
180 Ga0068867_100182828 3300005459 Bacteria 1668
181 Ga0068867_100210426 3300005459 Bacteria 1561
182 Ga0068867_100214269 3300005459 Bacteria 1549
183 Ga0068867_100255227 3300005459 Unclassified 1427
184 Ga0068867_100544389 3300005459 Unclassified 1004
185 Ga0068867_101058134 3300005459 Unclassified 739
186 Ga0070685_10005637 3300005466 Bacteria 6355
187 Ga0070685_10137876 3300005466 Bacteria 1532
188 Ga0070685_10269347 3300005466 Bacteria 1136
189 Ga0070685_10706283 3300005466 Unclassified 736
190 Ga0070698_100001240 3300005471 Bacteria 28441
191 Ga0070698_100015839 3300005471 Bacteria 7962
192 Ga0070698_100515624 3300005471 Bacteria 1134
193 Ga0070699_100020541 3300005518 Bacteria 5697
194 Ga0070679_100003832 3300005530 Bacteria 13804
195 Ga0070679_100004315 3300005530 Bacteria 13126
196 Ga0070679_100043996 3300005530 Bacteria 4447
197 Ga0070679_100061632 3300005530 Bacteria 3739
198 Ga0070679_100399800 3300005530 Bacteria 1320
199 Ga0070679_100911299 3300005530 Bacteria 823
200 Ga0070684_100031867 3300005535 Bacteria 4490
201 Ga0070684_100046297 3300005535 Unclassified 3769
202 Ga0068853_100023714 3300005539 Bacteria 5141
203 Ga0068853_100074541 3300005539 Unclassified 2960
204 Ga0068853_100093581 3300005539 Unclassified 2646
205 Ga0068853_100138229 3300005539 Bacteria 2186
206 Ga0068853_100238495 3300005539 Bacteria 1666
207 Ga0068853_100260834 3300005539 Bacteria 1593
208 Ga0068853_100317379 3300005539 Bacteria 1444
209 Ga0068853_100331519 3300005539 Unclassified 1412
210 Ga0068853_100591046 3300005539 Bacteria 1054
211 Ga0070672_100014325 3300005543 Bacteria 5618
212 Ga0070672_100080482 3300005543 Unclassified 2610
213 Ga0070672_100128676 3300005543 Bacteria 2079
214 Ga0070672_100225638 3300005543 Bacteria 1572
215 Ga0070672_100283597 3300005543 Bacteria 1401
216 Ga0070672_100769382 3300005543 Bacteria 846
217 Ga0070672_100900325 3300005543 Bacteria 781
218 Ga0070686_100166734 3300005544 Bacteria 1555
219 Ga0070686_100238097 3300005544 Bacteria 1324
220 Ga0070695_101090336 3300005545 Bacteria 653
221 Ga0070693_100013908 3300005547 Bacteria 4110
222 Ga0070693_100123855 3300005547 Unclassified 1607
223 Ga0070665_100135417 3300005548 Unclassified 2465
224 Ga0070665_100255545 3300005548 Bacteria 1753
225 Ga0070704_100105820 3300005549 Bacteria 2131
226 Ga0070704_101587768 3300005549 Unclassified 603
227 Ga0068855_100003310 3300005563 Bacteria 19720
228 Ga0068855_100010889 3300005563 Bacteria 10978
229 Ga0068855_100056286 3300005563 Bacteria 4615
230 Ga0068855_100087143 3300005563 Bacteria 3609
231 Ga0068855_100101183 3300005563 Unclassified 3318
232 Ga0070664_100001016 3300005564 Bacteria 22026
233 Ga0070664_100035868 3300005564 Unclassified 4164
234 Ga0070664_100221732 3300005564 Unclassified 1692
235 Ga0070664_100223461 3300005564 Unclassified 1685
236 Ga0070664_100265859 3300005564 Bacteria 1544
237 Ga0070664_100321608 3300005564 Bacteria 1402
238 Ga0070664_100372275 3300005564 Unclassified 1302
239 Ga0070664_100848743 3300005564 Unclassified 855
240 Ga0070664_101092067 3300005564 Bacteria 751
241 Ga0068857_100004400 3300005577 Bacteria 11908
242 Ga0068857_100031579 3300005577 Bacteria 4681
243 Ga0068857_100036932 3300005577 Bacteria 4327
244 Ga0068857_100065276 3300005577 Bacteria 3236
245 Ga0068857_100150447 3300005577 Unclassified 2108
246 Ga0068857_100228595 3300005577 Bacteria 1701
247 Ga0068857_100279401 3300005577 Bacteria 1536
248 Ga0068857_100793250 3300005577 Bacteria 904
249 Ga0068857_100917313 3300005577 Bacteria 840
250 Ga0068857_101444505 3300005577 Bacteria 669
251 Ga0068854_100032539 3300005578 Bacteria 3629
252 Ga0068854_100155004 3300005578 Unclassified 1769
253 Ga0068856_100014455 3300005614 Bacteria 7626
254 Ga0068856_100053446 3300005614 Bacteria 3982
255 Ga0068856_100274202 3300005614 Bacteria 1703
256 Ga0068856_100598241 3300005614 Unclassified 1124
257 Ga0070702_100063336 3300005615 Unclassified 2159
258 Ga0070702_100553722 3300005615 Bacteria 854
259 Ga0068852_100001315 3300005616 Bacteria 16622
260 Ga0068852_100023320 3300005616 Bacteria 4980
261 Ga0068852_100099128 3300005616 Bacteria 2626
262 Ga0068852_100099996 3300005616 Unclassified 2615
263 Ga0068852_100105898 3300005616 Bacteria 2548
264 Ga0068852_100401730 3300005616 Unclassified 1348
265 Ga0068852_101355707 3300005616 Bacteria 733
266 Ga0068859_100000003 3300005617 Bacteria 479218
267 Ga0068859_100024436 3300005617 Bacteria 6061
268 Ga0068859_100077477 3300005617 Unclassified 3365
269 Ga0068859_100078746 3300005617 Bacteria 3336
270 Ga0068859_100080405 3300005617 Bacteria 3300
271 Ga0068859_100143094 3300005617 Bacteria 2465
272 Ga0068859_100215081 3300005617 Bacteria 2009
273 Ga0068859_100256216 3300005617 Unclassified 1840
274 Ga0068859_100327292 3300005617 Bacteria 1626
275 Ga0068864_100001903 3300005618 Bacteria 17129
276 Ga0068864_100003471 3300005618 Bacteria 13018
277 Ga0068864_100028548 3300005618 Bacteria 4718
278 Ga0068864_100267860 3300005618 Bacteria 1591
279 Ga0068864_100395007 3300005618 Bacteria 1313
280 Ga0068864_100496030 3300005618 Unclassified 1174
281 Ga0068864_100772340 3300005618 Unclassified 943
282 Ga0068864_101132327 3300005618 Bacteria 780
283 Ga0068866_10041295 3300005718 Bacteria 2288
284 Ga0068866_10052467 3300005718 Bacteria 2081
285 Ga0068866_10333639 3300005718 Bacteria 958
286 Ga0068866_10412181 3300005718 Bacteria 874
287 Ga0068866_10443337 3300005718 Bacteria 847
288 Ga0068861_100002644 3300005719 Bacteria 11721
289 Ga0068861_100039196 3300005719 Bacteria 3535
290 Ga0068861_100304468 3300005719 Bacteria 1382
291 Ga0068861_100320268 3300005719 Bacteria 1350
292 Ga0068861_100326554 3300005719 Bacteria 1338
293 Ga0068861_100472336 3300005719 Bacteria 1128
294 Ga0068861_100540222 3300005719 Bacteria 1060
295 Ga0068861_100821831 3300005719 Bacteria 874
296 Ga0068851_10068189 3300005834 Bacteria 1836
297 Ga0068851_10076574 3300005834 Bacteria 1740
298 Ga0068851_10143020 3300005834 Unclassified 1302
299 Ga0068870_10020767 3300005840 Unclassified 3204
300 Ga0068870_10529835 3300005840 Bacteria 790
301 Ga0068870_10607351 3300005840 Unclassified 744
302 Ga0068870_10645997 3300005840 Bacteria 724
303 Ga0068863_100013210 3300005841 Bacteria 7964
304 Ga0068863_100024759 3300005841 Bacteria 5725
305 Ga0068863_100066379 3300005841 Bacteria 3413
306 Ga0068863_100068065 3300005841 Bacteria 3368
307 Ga0068863_100136478 3300005841 Unclassified 2343
308 Ga0068863_100373137 3300005841 Bacteria 1392
309 Ga0068863_100529417 3300005841 Bacteria 1162
310 Ga0068863_100549707 3300005841 Bacteria 1140
311 Ga0068863_101431384 3300005841 Bacteria 699
312 Ga0068858_100002526 3300005842 Bacteria 18442
313 Ga0068858_100026873 3300005842 Bacteria 5346
314 Ga0068858_100161513 3300005842 Bacteria 2110
315 Ga0068858_100376103 3300005842 Bacteria 1363
316 Ga0068860_100000024 3300005843 Bacteria 271902
317 Ga0068860_100001337 3300005843 Bacteria 26812
318 Ga0068860_100008404 3300005843 Bacteria 10283
319 Ga0068860_100025145 3300005843 Bacteria 5746
320 Ga0068860_100132731 3300005843 Bacteria 2391
321 Ga0068860_100261277 3300005843 Unclassified 1688
322 Ga0068860_100372626 3300005843 Bacteria 1408
323 Ga0068860_100532007 3300005843 Bacteria 1176
324 Ga0068860_101443390 3300005843 Bacteria 709
325 Ga0068862_100171546 3300005844 Bacteria 1942
326 Ga0068862_100271643 3300005844 Bacteria 1551
327 Ga0068862_100271917 3300005844 Bacteria 1550
328 Ga0081540_1010502 3300005983 Bacteria 6258
329 Ga0081539_10071602 3300005985 Bacteria 1856
330 Ga0070716_100467582 3300006173 Bacteria 923
331 Ga0075366_10150416 3300006195 Bacteria 1409
332 Ga0075366_10218982 3300006195 Unclassified 1160
333 Ga0097621_100000092 3300006237 Bacteria 49439
334 Ga0097621_100003569 3300006237 Bacteria 10751
335 Ga0097621_100089565 3300006237 Unclassified 2573
336 Ga0097621_100177327 3300006237 Bacteria 1840
337 Ga0097621_100195925 3300006237 Unclassified 1752
338 Ga0097621_100217765 3300006237 Bacteria 1663
339 Ga0097621_100239640 3300006237 Bacteria 1585
340 Ga0097621_100245783 3300006237 Bacteria 1565
341 Ga0097621_100247247 3300006237 Unclassified 1561
342 Ga0097621_100429327 3300006237 Bacteria 1187
343 Ga0075370_10382708 3300006353 Bacteria 843
344 Ga0068871_100000032 3300006358 Bacteria 73078
345 Ga0068871_100005675 3300006358 Bacteria 8756
346 Ga0068871_100021440 3300006358 Unclassified 4966
347 Ga0068871_100441513 3300006358 Bacteria 1165
348 Ga0068871_100487174 3300006358 Unclassified 1110
349 Ga0068871_100507618 3300006358 Bacteria 1088
350 Ga0068871_100614242 3300006358 Unclassified 990
351 Ga0068871_100785391 3300006358 Bacteria 877
352 Ga0068871_101070587 3300006358 Bacteria 753
353 Ga0068871_101167891 3300006358 Unclassified 721
354 Ga0068871_101388571 3300006358 Unclassified 662
355 Ga0075428_100004634 3300006844 Bacteria 15211
356 Ga0075428_100054065 3300006844 Bacteria 4400
357 Ga0075431_100143590 3300006847 Bacteria 2460
358 Ga0075434_100358493 3300006871 Bacteria 1479
359 Ga0075434_101012930 3300006871 Unclassified 844
360 Ga0075429_100000407 3300006880 Bacteria 31868
361 Ga0075429_100358983 3300006880 Unclassified 1276
362 Ga0075429_100427382 3300006880 Unclassified 1160
363 Ga0068865_100046619 3300006881 Unclassified 2974
364 Ga0068865_100072468 3300006881 Bacteria 2447
365 Ga0068865_100145381 3300006881 Unclassified 1793
366 Ga0068865_100155506 3300006881 Bacteria 1739
367 Ga0068865_100532613 3300006881 Bacteria 984
368 Ga0097620_100000003 3300006931 Bacteria 479218
369 Ga0097620_100000592 3300006931 Bacteria 36168
370 Ga0097620_100024436 3300006931 Bacteria 6061
371 Ga0097620_100077479 3300006931 Unclassified 3365
372 Ga0097620_100078743 3300006931 Bacteria 3336
373 Ga0097620_100080403 3300006931 Bacteria 3300
374 Ga0097620_100143083 3300006931 Bacteria 2465
375 Ga0097620_100215091 3300006931 Bacteria 2009
376 Ga0097620_100256220 3300006931 Unclassified 1840
377 Ga0097620_100327319 3300006931 Bacteria 1626
378 Ga0105244_10417477 3300009036 Bacteria 617
379 Ga0105240_10000106 3300009093 Bacteria 171825
380 Ga0105240_10002363 3300009093 Bacteria 30416
381 Ga0105240_10002407 3300009093 Bacteria 30067
382 Ga0105240_10017580 3300009093 Bacteria 9634
383 Ga0105240_10068817 3300009093 Bacteria 4384
384 Ga0105240_10073258 3300009093 Bacteria 4229
385 Ga0105240_10085994 3300009093 Bacteria 3852
386 Ga0105240_10086784 3300009093 Unclassified 3833
387 Ga0105240_10188485 3300009093 Bacteria 2427
388 Ga0105240_10711848 3300009093 Bacteria 1095
389 Ga0111539_10033178 3300009094 Bacteria 6269
390 Ga0111539_10107847 3300009094 Unclassified 3268
391 Ga0111539_10280415 3300009094 Bacteria 1939
392 Ga0111539_10528001 3300009094 Bacteria 1375
393 Ga0111539_11304344 3300009094 Bacteria 843
394 Ga0105245_10098230 3300009098 Unclassified 2705
395 Ga0105247_10009494 3300009101 Bacteria 5901
396 Ga0105247_10496278 3300009101 Bacteria 889
397 Ga0105247_10574370 3300009101 Bacteria 832
398 Ga0105247_10664297 3300009101 Bacteria 780
399 Ga0105247_10884422 3300009101 Unclassified 688
400 Ga0114129_10013112 3300009147 Bacteria 11805
401 Ga0105243_10062728 3300009148 Bacteria 2976
402 Ga0105243_10108870 3300009148 Bacteria 2314
403 Ga0105241_10001117 3300009174 Bacteria 20448
404 Ga0105241_10003737 3300009174 Bacteria 11296
405 Ga0105241_10024976 3300009174 Bacteria 4440
406 Ga0105241_10031425 3300009174 Bacteria 3976
407 Ga0105241_10230780 3300009174 Bacteria 1560
408 Ga0105241_10877990 3300009174 Unclassified 831
409 Ga0105241_11136750 3300009174 Unclassified 737
410 Ga0105242_10034241 3300009176 Bacteria 4072
411 Ga0105242_10292707 3300009176 Bacteria 1483
412 Ga0105242_10381257 3300009176 Unclassified 1311
413 Ga0105242_10420555 3300009176 Unclassified 1252
414 Ga0105242_10466078 3300009176 Bacteria 1194
415 Ga0105242_10777338 3300009176 Unclassified 945
416 Ga0105242_10861158 3300009176 Unclassified 903
417 Ga0105248_10113241 3300009177 Bacteria 3059
418 Ga0105248_11154761 3300009177 Bacteria 875
419 Ga0105237_10000561 3300009545 Bacteria 51951
420 Ga0105237_10000855 3300009545 Bacteria 41395
421 Ga0105237_10007863 3300009545 Bacteria 11623
422 Ga0105237_10011076 3300009545 Bacteria 9559
423 Ga0105237_10017239 3300009545 Bacteria 7490
424 Ga0105237_10023760 3300009545 Bacteria 6275
425 Ga0105237_10075351 3300009545 Unclassified 3366
426 Ga0105237_10108821 3300009545 Bacteria 2763
427 Ga0105237_10123305 3300009545 Bacteria 2585
428 Ga0105237_11000144 3300009545 Unclassified 843
429 Ga0105237_11117422 3300009545 Unclassified 795
430 Ga0105238_10001830 3300009551 Bacteria 21319
431 Ga0105238_10006849 3300009551 Bacteria 11379
432 Ga0105238_10009716 3300009551 Bacteria 9633
433 Ga0105238_10141743 3300009551 Bacteria 2380
434 Ga0105238_12020003 3300009551 Bacteria 610
435 Ga0105249_10001205 3300009553 Bacteria 22829
436 Ga0105249_10004606 3300009553 Bacteria 11913
437 Ga0105249_10006402 3300009553 Bacteria 10239
438 Ga0105249_10008771 3300009553 Bacteria 8824
439 Ga0105249_10037856 3300009553 Unclassified 4377
440 Ga0105249_10388402 3300009553 Bacteria 1423
441 Ga0105249_10468092 3300009553 Bacteria 1301
442 Ga0105249_10701465 3300009553 Bacteria 1072
443 Ga0105249_10750421 3300009553 Bacteria 1038
444 Ga0105249_11072455 3300009553 Bacteria 875
445 Ga0105239_10000580 3300010375 Bacteria 52245
446 Ga0105239_10002300 3300010375 Bacteria 24396
447 Ga0105239_10004005 3300010375 Bacteria 17844
448 Ga0105239_10042882 3300010375 Bacteria 4958
449 Ga0105239_10046255 3300010375 Bacteria 4769
450 Ga0105239_10047256 3300010375 Bacteria 4717
451 Ga0105239_10159566 3300010375 Bacteria 2519
452 Ga0105239_10230508 3300010375 Bacteria 2078
453 Ga0105239_11577072 3300010375 Unclassified 759
454 Ga0105239_12081586 3300010375 Bacteria 659
455 Ga0105246_10231064 3300011119 Bacteria 1456
456 Ga0105246_10254680 3300011119 Unclassified 1395
457 Ga0105246_10458217 3300011119 Unclassified 1073
458 Ga0157373_10003094 3300013100 Bacteria 12572
459 Ga0157373_10005705 3300013100 Bacteria 9331
460 Ga0157373_10091788 3300013100 Bacteria 2139
461 Ga0157373_10166367 3300013100 Unclassified 1552
462 Ga0157373_10311017 3300013100 Bacteria 1119
463 Ga0157373_10322312 3300013100 Bacteria 1099
464 Ga0157373_10530749 3300013100 Bacteria 852
465 Ga0157371_10002374 3300013102 Bacteria 18004
466 Ga0157371_10002840 3300013102 Bacteria 16187
467 Ga0157371_10003029 3300013102 Bacteria 15605
468 Ga0157371_10010584 3300013102 Bacteria 7167
469 Ga0157371_10021199 3300013102 Bacteria 4773
470 Ga0157371_10054546 3300013102 Unclassified 2839
471 Ga0157371_10074045 3300013102 Unclassified 2412
472 Ga0157371_10120463 3300013102 Bacteria 1865
473 Ga0157371_10161428 3300013102 Bacteria 1601
474 Ga0157371_10270488 3300013102 Bacteria 1226
475 Ga0157371_10281098 3300013102 Bacteria 1202
476 Ga0157371_10296971 3300013102 Bacteria 1169
477 Ga0157371_10463310 3300013102 Unclassified 933
478 Ga0157371_10612319 3300013102 Bacteria 811
479 Ga0157370_10001361 3300013104 Bacteria 30267
480 Ga0157370_10001381 3300013104 Bacteria 30032
481 Ga0157370_10031168 3300013104 Bacteria 5219
482 Ga0157370_10073553 3300013104 Bacteria 3225
483 Ga0157370_10089903 3300013104 Unclassified 2884
484 Ga0157370_10136467 3300013104 Bacteria 2286
485 Ga0157370_10182471 3300013104 Bacteria 1950
486 Ga0157370_10193606 3300013104 Bacteria 1887
487 Ga0157370_10353373 3300013104 Bacteria 1354
488 Ga0157370_10478026 3300013104 Unclassified 1145
489 Ga0157370_10893635 3300013104 Unclassified 806
490 Ga0157369_10004054 3300013105 Bacteria 17353
491 Ga0157369_10007569 3300013105 Bacteria 12497
492 Ga0157369_10034964 3300013105 Bacteria 5510
493 Ga0157369_10047526 3300013105 Bacteria 4658
494 Ga0157369_10086456 3300013105 Bacteria 3349
495 Ga0157369_10503987 3300013105 Bacteria 1252
496 Ga0157369_10515564 3300013105 Bacteria 1237
497 Ga0157374_10003298 3300013296 Bacteria 13556
498 Ga0157374_10024775 3300013296 Bacteria 5380
499 Ga0157374_10029574 3300013296 Unclassified 4964
500 Ga0157374_10173103 3300013296 Unclassified 2107
501 Ga0157374_10190682 3300013296 Bacteria 2005
502 Ga0157374_10499861 3300013296 Bacteria 1220
503 Ga0157374_10705089 3300013296 Bacteria 1022
504 Ga0157374_10893760 3300013296 Bacteria 906
505 Ga0157378_10022391 3300013297 Bacteria 5563
506 Ga0157378_10030429 3300013297 Bacteria 4770
507 Ga0157378_10036081 3300013297 Unclassified 4376
508 Ga0157378_10067398 3300013297 Unclassified 3207
509 Ga0157378_10082110 3300013297 Bacteria 2914
510 Ga0157378_10094708 3300013297 Bacteria 2719
511 Ga0157378_10219860 3300013297 Bacteria 1805
512 Ga0157378_10362154 3300013297 Unclassified 1419
513 Ga0157378_10367471 3300013297 Bacteria 1409
514 Ga0157378_10386911 3300013297 Bacteria 1375
515 Ga0157378_10656513 3300013297 Bacteria 1065
516 Ga0157378_10747849 3300013297 Bacteria 1000
517 Ga0163162_10000431 3300013306 Bacteria 38724
518 Ga0163162_10002078 3300013306 Bacteria 18820
519 Ga0163162_10002386 3300013306 Bacteria 17658
520 Ga0163162_10016743 3300013306 Bacteria 7165
521 Ga0163162_10064477 3300013306 Bacteria 3708
522 Ga0163162_10130217 3300013306 Unclassified 2624
523 Ga0163162_10220773 3300013306 Bacteria 2025
524 Ga0163162_10366948 3300013306 Bacteria 1573
525 Ga0163162_10537355 3300013306 Unclassified 1298
526 Ga0163162_10854348 3300013306 Bacteria 1025
527 Ga0163162_11222445 3300013306 Bacteria 853
528 Ga0157372_10000171 3300013307 Bacteria 71956
529 Ga0157372_10000463 3300013307 Bacteria 44664
530 Ga0157372_10002128 3300013307 Bacteria 21519
531 Ga0157372_10002594 3300013307 Bacteria 19562
532 Ga0157372_10007410 3300013307 Bacteria 11669
533 Ga0157372_10031523 3300013307 Bacteria 5804
534 Ga0157372_10127319 3300013307 Bacteria 2928
535 Ga0157372_10153094 3300013307 Bacteria 2662
536 Ga0157372_10222669 3300013307 Bacteria 2187
537 Ga0157372_10291934 3300013307 Bacteria 1896
538 Ga0157372_10302966 3300013307 Bacteria 1859
539 Ga0157372_10575993 3300013307 Unclassified 1312
540 Ga0157372_10693454 3300013307 Unclassified 1185
541 Ga0157372_11867278 3300013307 Bacteria 691
542 Ga0157375_10000253 3300013308 Bacteria 48558
543 Ga0157375_10012111 3300013308 Bacteria 7642
544 Ga0157375_10013965 3300013308 Bacteria 7159
545 Ga0157375_10020759 3300013308 Bacteria 6010
546 Ga0157375_10176130 3300013308 Bacteria 2288
547 Ga0157375_10187243 3300013308 Bacteria 2224
548 Ga0157375_10188328 3300013308 Bacteria 2218
549 Ga0157375_10203956 3300013308 Bacteria 2134
550 Ga0157375_10227462 3300013308 Bacteria 2024
551 Ga0157375_10240833 3300013308 Bacteria 1969
552 Ga0157375_10553595 3300013308 Bacteria 1312
553 Ga0157375_10580700 3300013308 Unclassified 1281
554 Ga0157375_10746523 3300013308 Unclassified 1130
555 Ga0157375_10821450 3300013308 Bacteria 1077
556 Ga0157375_11931466 3300013308 Bacteria 701
557 Ga0163163_10001380 3300014325 Bacteria 20505
558 Ga0163163_10005191 3300014325 Bacteria 11232
559 Ga0163163_10006337 3300014325 Bacteria 10331
560 Ga0163163_10096114 3300014325 Bacteria 2983
561 Ga0163163_10110547 3300014325 Bacteria 2777
562 Ga0163163_10270072 3300014325 Unclassified 1752
563 Ga0163163_10316057 3300014325 Bacteria 1615
564 Ga0163163_10384216 3300014325 Bacteria 1462
565 Ga0163163_10498307 3300014325 Bacteria 1280
566 Ga0163163_11402836 3300014325 Bacteria 760
567 Ga0157380_10001704 3300014326 Bacteria 14521
568 Ga0157380_10007415 3300014326 Bacteria 7788
569 Ga0157380_10026790 3300014326 Bacteria 4379
570 Ga0157380_10069446 3300014326 Bacteria 2843
571 Ga0157380_10111984 3300014326 Bacteria 2295
572 Ga0157380_10117013 3300014326 Bacteria 2251
573 Ga0157380_10120191 3300014326 Bacteria 2224
574 Ga0157380_10282621 3300014326 Bacteria 1519
575 Ga0157380_11574868 3300014326 Bacteria 712
576 Ga0157377_10002237 3300014745 Bacteria 8502
577 Ga0157377_10007408 3300014745 Bacteria 5297
578 Ga0157377_10026538 3300014745 Unclassified 3101
579 Ga0157377_10029488 3300014745 Bacteria 2963
580 Ga0157377_10250420 3300014745 Bacteria 1148
581 Ga0157379_10080924 3300014968 Unclassified 2910
582 Ga0157379_10177261 3300014968 Unclassified 1925
583 Ga0157379_10243214 3300014968 Bacteria 1632
584 Ga0157379_10555980 3300014968 Bacteria 1068
585 Ga0157379_10611086 3300014968 Unclassified 1018
586 Ga0157376_10000714 3300014969 Bacteria 21474
587 Ga0157376_10000961 3300014969 Bacteria 18769
588 Ga0157376_10047974 3300014969 Bacteria 3528
589 Ga0157376_10091928 3300014969 Bacteria 2629
590 Ga0157376_10181011 3300014969 Unclassified 1927
591 Ga0157376_10512163 3300014969 Bacteria 1181
592 Ga0157376_10715014 3300014969 Bacteria 1008
593 Ga0157376_10747277 3300014969 Bacteria 987
594 Ga0163161_10008802 3300017792 Bacteria 6978
595 Ga0163161_10026417 3300017792 Bacteria 4112
596 Ga0163161_10028693 3300017792 Unclassified 3953
597 Ga0163161_10030442 3300017792 Bacteria 3842
598 Ga0163161_10042247 3300017792 Bacteria 3278
599 Ga0163161_10398592 3300017792 Bacteria 1103
600 Ga0163161_10413297 3300017792 Bacteria 1084
601 Ga0163161_10743490 3300017792 Bacteria 820
602 Ga0163161_10861656 3300017792 Bacteria 765
603 Ga0209436_100446 3300025208 Bacteria 18568
604 Ga0209646_1002117 3300025246 Bacteria 4622
605 Ga0209130_1004223 3300025284 Bacteria 5591
606 Ga0207426_1000073 3300025302 Bacteria 323756
607 Ga0207697_10160686 3300025315 Bacteria 980
608 Ga0207697_10243428 3300025315 Bacteria 795
609 Ga0207656_10118095 3300025321 Unclassified 1232
610 Ga0207656_10136620 3300025321 Bacteria 1152
611 Ga0207656_10242563 3300025321 Bacteria 881
612 Ga0207656_10258026 3300025321 Unclassified 855
613 Ga0207682_10021399 3300025893 Bacteria 2544
614 Ga0207682_10183195 3300025893 Bacteria 957
615 Ga0207642_10014577 3300025899 Bacteria 2904
616 Ga0207642_10038504 3300025899 Bacteria 2070
617 Ga0207642_10340195 3300025899 Bacteria 882
618 Ga0207710_10003031 3300025900 Bacteria 7565
619 Ga0207688_10105504 3300025901 Bacteria 1631
620 Ga0207688_10187467 3300025901 Bacteria 1236
621 Ga0207680_10000385 3300025903 Bacteria 21073
622 Ga0207680_10025294 3300025903 Unclassified 3273
623 Ga0207680_10140097 3300025903 Unclassified 1603
624 Ga0207680_10174048 3300025903 Bacteria 1451
625 Ga0207680_10365260 3300025903 Bacteria 1015
626 Ga0207647_10000360 3300025904 Bacteria 37076
627 Ga0207647_10077169 3300025904 Unclassified 2003
628 Ga0207647_10181246 3300025904 Unclassified 1223
629 Ga0207645_10016092 3300025907 Unclassified 4952
630 Ga0207645_10025070 3300025907 Bacteria 3862
631 Ga0207645_10086048 3300025907 Bacteria 2019
632 Ga0207645_10155183 3300025907 Bacteria 1495
633 Ga0207645_10156629 3300025907 Unclassified 1488
634 Ga0207645_10198770 3300025907 Unclassified 1318
635 Ga0207643_10003543 3300025908 Bacteria 8404
636 Ga0207643_10016472 3300025908 Unclassified 4033
637 Ga0207643_10054981 3300025908 Bacteria 2263
638 Ga0207643_10199378 3300025908 Unclassified 1218
639 Ga0207705_10001227 3300025909 Bacteria 20676
640 Ga0207705_10034136 3300025909 Bacteria 3637
641 Ga0207705_10155999 3300025909 Bacteria 1713
642 Ga0207705_10530950 3300025909 Bacteria 915
643 Ga0207705_11007677 3300025909 Bacteria 643
644 Ga0207654_10002893 3300025911 Bacteria 8714
645 Ga0207654_10019739 3300025911 Bacteria 3563
646 Ga0207654_10026459 3300025911 Bacteria 3141
647 Ga0207654_10091347 3300025911 Bacteria 1857
648 Ga0207707_10010595 3300025912 Bacteria 8007
649 Ga0207707_10247904 3300025912 Unclassified 1547
650 Ga0207707_11103438 3300025912 Bacteria 646
651 Ga0207695_10001064 3300025913 Bacteria 48020
652 Ga0207695_10004051 3300025913 Bacteria 20148
653 Ga0207695_10019628 3300025913 Bacteria 7777
654 Ga0207695_10309139 3300025913 Unclassified 1471
655 Ga0207695_10390674 3300025913 Bacteria 1276
656 Ga0207695_10408098 3300025913 Bacteria 1243
657 Ga0207695_10501901 3300025913 Bacteria 1095
658 Ga0207671_10001454 3300025914 Bacteria 27338
659 Ga0207671_10002324 3300025914 Bacteria 20513
660 Ga0207671_10006030 3300025914 Bacteria 10943
661 Ga0207671_10012091 3300025914 Bacteria 6970
662 Ga0207671_10018700 3300025914 Bacteria 5309
663 Ga0207671_10134205 3300025914 Bacteria 1902
664 Ga0207660_10009692 3300025917 Bacteria 6234
665 Ga0207660_10221324 3300025917 Bacteria 1485
666 Ga0207660_10520631 3300025917 Bacteria 966
667 Ga0207662_10004557 3300025918 Bacteria 7300
668 Ga0207662_10020460 3300025918 Bacteria 3777
669 Ga0207662_10364309 3300025918 Bacteria 973
670 Ga0207657_10009558 3300025919 Bacteria 9732
671 Ga0207657_10047791 3300025919 Bacteria 3739
672 Ga0207657_10092857 3300025919 Bacteria 2514
673 Ga0207657_10104170 3300025919 Bacteria 2351
674 Ga0207657_10167879 3300025919 Unclassified 1779
675 Ga0207657_10193097 3300025919 Bacteria 1641
676 Ga0207649_10002808 3300025920 Bacteria 9610
677 Ga0207649_10004375 3300025920 Bacteria 7667
678 Ga0207649_10625674 3300025920 Bacteria 830
679 Ga0207649_10769894 3300025920 Bacteria 750
680 Ga0207649_10808636 3300025920 Bacteria 732
681 Ga0207652_10000144 3300025921 Bacteria 76507
682 Ga0207652_10001497 3300025921 Bacteria 20642
683 Ga0207652_10025262 3300025921 Bacteria 4936
684 Ga0207652_10224157 3300025921 Bacteria 1694
685 Ga0207652_10739129 3300025921 Bacteria 876
686 Ga0207681_10034787 3300025923 Bacteria 3315
687 Ga0207681_10169560 3300025923 Bacteria 1653
688 Ga0207681_10592826 3300025923 Unclassified 915
689 Ga0207694_10048568 3300025924 Unclassified 3283
690 Ga0207694_10100200 3300025924 Bacteria 2295
691 Ga0207694_10225936 3300025924 Unclassified 1528
692 Ga0207650_10000886 3300025925 Bacteria 22639
693 Ga0207650_10025239 3300025925 Bacteria 4233
694 Ga0207650_10054122 3300025925 Unclassified 2976
695 Ga0207650_10063847 3300025925 Bacteria 2755
696 Ga0207650_10141158 3300025925 Bacteria 1894
697 Ga0207650_10390211 3300025925 Unclassified 1151
698 Ga0207650_10531116 3300025925 Bacteria 985
699 Ga0207650_11255355 3300025925 Bacteria 631
700 Ga0207659_10047426 3300025926 Bacteria 3039
701 Ga0207659_10060415 3300025926 Bacteria 2728
702 Ga0207659_10143781 3300025926 Unclassified 1854
703 Ga0207659_10148180 3300025926 Bacteria 1830
704 Ga0207659_10202966 3300025926 Bacteria 1584
705 Ga0207700_10173559 3300025928 Bacteria 1800
706 Ga0207644_10189340 3300025931 Bacteria 1617
707 Ga0207644_10469426 3300025931 Bacteria 1035
708 Ga0207644_10982591 3300025931 Unclassified 708
709 Ga0207690_10018918 3300025932 Bacteria 4230
710 Ga0207690_10054218 3300025932 Bacteria 2695
711 Ga0207690_10422486 3300025932 Bacteria 1067
712 Ga0207690_10670583 3300025932 Bacteria 851
713 Ga0207706_10003683 3300025933 Bacteria 14626
714 Ga0207706_10010531 3300025933 Bacteria 8449
715 Ga0207706_10017175 3300025933 Bacteria 6524
716 Ga0207706_10101041 3300025933 Unclassified 2537
717 Ga0207686_10000566 3300025934 Bacteria 23556
718 Ga0207686_10026799 3300025934 Bacteria 3367
719 Ga0207686_10084286 3300025934 Unclassified 2082
720 Ga0207686_10084847 3300025934 Bacteria 2076
721 Ga0207670_10006649 3300025936 Bacteria 6430
722 Ga0207670_10051646 3300025936 Bacteria 2762
723 Ga0207670_10076842 3300025936 Unclassified 2324
724 Ga0207670_10665873 3300025936 Bacteria 859
725 Ga0207669_10036603 3300025937 Bacteria 2807
726 Ga0207704_10059094 3300025938 Unclassified 2365
727 Ga0207704_10119555 3300025938 Bacteria 1800
728 Ga0207704_11263045 3300025938 Bacteria 631
729 Ga0207691_10038799 3300025940 Bacteria 4407
730 Ga0207691_10038981 3300025940 Bacteria 4397
731 Ga0207691_10071677 3300025940 Bacteria 3126
732 Ga0207691_10418132 3300025940 Bacteria 1142
733 Ga0207711_10072884 3300025941 Bacteria 2984
734 Ga0207689_10001807 3300025942 Bacteria 20189
735 Ga0207689_10002381 3300025942 Bacteria 17551
736 Ga0207689_10031443 3300025942 Bacteria 4419
737 Ga0207689_10038046 3300025942 Bacteria 3986
738 Ga0207689_10061252 3300025942 Bacteria 3094
739 Ga0207689_10064252 3300025942 Unclassified 3020
740 Ga0207689_10068029 3300025942 Unclassified 2927
741 Ga0207689_10237167 3300025942 Unclassified 1507
742 Ga0207661_10044753 3300025944 Unclassified 3500
743 Ga0207661_10086625 3300025944 Bacteria 2600
744 Ga0207661_10200568 3300025944 Bacteria 1754
745 Ga0207661_10661475 3300025944 Bacteria 960
746 Ga0207661_11094758 3300025944 Bacteria 734
747 Ga0207679_10035069 3300025945 Bacteria 3546
748 Ga0207679_10208287 3300025945 Bacteria 1638
749 Ga0207679_10281206 3300025945 Bacteria 1427
750 Ga0207679_10989854 3300025945 Bacteria 771
751 Ga0207679_11203457 3300025945 Unclassified 695
752 Ga0207679_11487137 3300025945 Bacteria 621
753 Ga0207667_10000180 3300025949 Bacteria 92094
754 Ga0207667_10001242 3300025949 Bacteria 31953
755 Ga0207667_10010652 3300025949 Bacteria 10730
756 Ga0207667_10037467 3300025949 Bacteria 5182
757 Ga0207667_10136977 3300025949 Unclassified 2521
758 Ga0207667_10298811 3300025949 Unclassified 1645
759 Ga0207667_10503494 3300025949 Bacteria 1228
760 Ga0207667_10897767 3300025949 Bacteria 878
761 Ga0207667_11033621 3300025949 Bacteria 807
762 Ga0207651_10010650 3300025960 Bacteria 5107
763 Ga0207651_10012494 3300025960 Bacteria 4810
764 Ga0207651_10037783 3300025960 Bacteria 3166
765 Ga0207651_10072767 3300025960 Bacteria 2441
766 Ga0207651_10230532 3300025960 Bacteria 1503
767 Ga0207651_10377263 3300025960 Bacteria 1201
768 Ga0207651_11170251 3300025960 Bacteria 690
769 Ga0207712_10005755 3300025961 Bacteria 7814
770 Ga0207712_10006003 3300025961 Bacteria 7665
771 Ga0207712_10006416 3300025961 Bacteria 7422
772 Ga0207712_10027394 3300025961 Unclassified 3805
773 Ga0207712_10187097 3300025961 Bacteria 1631
774 Ga0207712_10250565 3300025961 Bacteria 1431
775 Ga0207712_10534462 3300025961 Bacteria 1006
776 Ga0207712_10608735 3300025961 Unclassified 946
777 Ga0207668_10275550 3300025972 Bacteria 1377
778 Ga0207668_10284483 3300025972 Bacteria 1357
779 Ga0207668_10422123 3300025972 Bacteria 1132
780 Ga0207668_10560571 3300025972 Unclassified 991
781 Ga0207668_10813693 3300025972 Unclassified 828
782 Ga0207640_10094771 3300025981 Unclassified 2077
783 Ga0207640_10270100 3300025981 Unclassified 1330
784 Ga0207640_10588963 3300025981 Unclassified 940
785 Ga0207640_10741026 3300025981 Bacteria 846
786 Ga0207640_10820015 3300025981 Bacteria 807
787 Ga0207658_10010035 3300025986 Bacteria 6433
788 Ga0207658_10013694 3300025986 Bacteria 5547
789 Ga0207658_10015647 3300025986 Bacteria 5208
790 Ga0207658_10085836 3300025986 Bacteria 2425
791 Ga0207658_10533184 3300025986 Bacteria 1049
792 Ga0207658_10534972 3300025986 Bacteria 1047
793 Ga0207658_10674721 3300025986 Bacteria 933
794 Ga0207658_10836335 3300025986 Bacteria 837
795 Ga0207658_10902826 3300025986 Bacteria 804
796 Ga0207677_10034608 3300026023 Unclassified 3273
797 Ga0207677_10121384 3300026023 Unclassified 1966
798 Ga0207677_10331101 3300026023 Bacteria 1269
799 Ga0207677_10402460 3300026023 Bacteria 1161
800 Ga0207677_10469216 3300026023 Bacteria 1082
801 Ga0207703_10011653 3300026035 Bacteria 6838
802 Ga0207703_10166753 3300026035 Bacteria 1933
803 Ga0207703_10171092 3300026035 Unclassified 1911
804 Ga0207703_10173298 3300026035 Bacteria 1899
805 Ga0207703_10353098 3300026035 Bacteria 1354
806 Ga0207703_11219852 3300026035 Bacteria 723
807 Ga0207639_10017754 3300026041 Bacteria 5046
808 Ga0207639_10057967 3300026041 Bacteria 2976
809 Ga0207639_10085656 3300026041 Unclassified 2507
810 Ga0207639_10090305 3300026041 Bacteria 2450
811 Ga0207639_10129991 3300026041 Unclassified 2083
812 Ga0207639_10182169 3300026041 Bacteria 1788
813 Ga0207639_10193318 3300026041 Unclassified 1739
814 Ga0207639_10219741 3300026041 Bacteria 1640
815 Ga0207639_10274230 3300026041 Bacteria 1481
816 Ga0207639_10387197 3300026041 Unclassified 1257
817 Ga0207639_10513991 3300026041 Unclassified 1096
818 Ga0207639_10517415 3300026041 Bacteria 1092
819 Ga0207678_10013249 3300026067 Bacteria 7236
820 Ga0207678_10025297 3300026067 Bacteria 5183
821 Ga0207678_10473976 3300026067 Bacteria 1090
822 Ga0207708_10055201 3300026075 Bacteria 3029
823 Ga0207708_10171334 3300026075 Unclassified 1719
824 Ga0207708_10270332 3300026075 Unclassified 1375
825 Ga0207708_10277100 3300026075 Bacteria 1358
826 Ga0207702_10020186 3300026078 Bacteria 5519
827 Ga0207702_10035062 3300026078 Bacteria 4196
828 Ga0207702_10096906 3300026078 Unclassified 2595
829 Ga0207702_10276068 3300026078 Bacteria 1587
830 Ga0207702_10327443 3300026078 Bacteria 1460
831 Ga0207702_10388892 3300026078 Bacteria 1343
832 Ga0207702_10833731 3300026078 Bacteria 912
833 Ga0207641_10000026 3300026088 Bacteria 245091
834 Ga0207641_10005426 3300026088 Bacteria 10884
835 Ga0207641_10017939 3300026088 Bacteria 5798
836 Ga0207641_10176113 3300026088 Bacteria 1956
837 Ga0207641_11260860 3300026088 Bacteria 739
838 Ga0207648_10001213 3300026089 Bacteria 28877
839 Ga0207648_10007648 3300026089 Bacteria 10579
840 Ga0207648_10014790 3300026089 Bacteria 7200
841 Ga0207648_10030498 3300026089 Bacteria 4775
842 Ga0207648_10041867 3300026089 Bacteria 4022
843 Ga0207648_10061589 3300026089 Unclassified 3272
844 Ga0207648_10074826 3300026089 Bacteria 2952
845 Ga0207648_10159502 3300026089 Unclassified 1992
846 Ga0207648_10228615 3300026089 Bacteria 1654
847 Ga0207648_10257316 3300026089 Bacteria 1557
848 Ga0207648_10271895 3300026089 Unclassified 1514
849 Ga0207648_10341461 3300026089 Bacteria 1348
850 Ga0207648_10435514 3300026089 Bacteria 1192
851 Ga0207676_10003733 3300026095 Bacteria 10770
852 Ga0207676_10022021 3300026095 Bacteria 4683
853 Ga0207676_10110561 3300026095 Unclassified 2299
854 Ga0207676_10165085 3300026095 Unclassified 1923
855 Ga0207676_10197866 3300026095 Bacteria 1773
856 Ga0207676_10250562 3300026095 Unclassified 1594
857 Ga0207676_10255199 3300026095 Bacteria 1580
858 Ga0207676_10367481 3300026095 Bacteria 1335
859 Ga0207676_10828548 3300026095 Unclassified 904
860 Ga0207674_10000453 3300026116 Bacteria 53589
861 Ga0207674_10001740 3300026116 Bacteria 27826
862 Ga0207674_10020171 3300026116 Bacteria 7209
863 Ga0207674_10035333 3300026116 Bacteria 5216
864 Ga0207674_10042617 3300026116 Bacteria 4686
865 Ga0207674_10045794 3300026116 Unclassified 4496
866 Ga0207674_10074285 3300026116 Bacteria 3412
867 Ga0207674_10164728 3300026116 Bacteria 2171
868 Ga0207674_10394279 3300026116 Bacteria 1338
869 Ga0207674_10397971 3300026116 Bacteria 1331
870 Ga0207674_10525345 3300026116 Bacteria 1143
871 Ga0207674_10551368 3300026116 Bacteria 1113
872 Ga0207674_10800051 3300026116 Bacteria 910
873 Ga0207674_11371301 3300026116 Bacteria 676
874 Ga0207675_100022617 3300026118 Bacteria 5852
875 Ga0207675_100033929 3300026118 Bacteria 4756
876 Ga0207675_100036164 3300026118 Bacteria 4606
877 Ga0207675_100038705 3300026118 Bacteria 4450
878 Ga0207675_100109559 3300026118 Bacteria 2605
879 Ga0207675_100155014 3300026118 Unclassified 2183
880 Ga0207675_100306487 3300026118 Bacteria 1548
881 Ga0207675_100409708 3300026118 Bacteria 1337
882 Ga0207675_100571767 3300026118 Bacteria 1131
883 Ga0207683_10025008 3300026121 Bacteria 5148
884 Ga0207683_10126348 3300026121 Bacteria 2298
885 Ga0207683_10218066 3300026121 Bacteria 1738
886 Ga0207683_10260139 3300026121 Unclassified 1585
887 Ga0207683_10682986 3300026121 Bacteria 952
888 Ga0207683_10718741 3300026121 Unclassified 926
889 Ga0207698_10000830 3300026142 Bacteria 17890
890 Ga0207698_10036047 3300026142 Bacteria 3626
891 Ga0207698_10064694 3300026142 Unclassified 2868
892 Ga0207698_10138597 3300026142 Bacteria 2091
893 Ga0207698_10149903 3300026142 Bacteria 2022
894 Ga0207698_10190194 3300026142 Bacteria 1827
895 Ga0207698_10359489 3300026142 Bacteria 1378
896 Ga0207698_10392394 3300026142 Unclassified 1324
897 Ga0207698_10483843 3300026142 Unclassified 1201
898 Ga0207698_10535157 3300026142 Bacteria 1146
899 Ga0207698_10859186 3300026142 Bacteria 913
900 Ga0207698_11613923 3300026142 Bacteria 664
901 Ga0207698_11801735 3300026142 Bacteria 627
902 Ga0209968_1013270 3300027526 Bacteria 1291
903 Ga0209999_1058914 3300027543 Bacteria 730
904 Ga0209974_10022087 3300027876 Bacteria 2107
905 Ga0207428_10030792 3300027907 Unclassified 4433
906 Ga0207428_10074787 3300027907 Unclassified 2656
907 Ga0268266_10000048 3300028379 Bacteria 310336
908 Ga0268266_10081492 3300028379 Unclassified 2822
909 Ga0268265_10151542 3300028380 Bacteria 1956
910 Ga0268265_10329942 3300028380 Bacteria 1385
911 Ga0268265_10821493 3300028380 Bacteria 907
912 Ga0268265_10977022 3300028380 Bacteria 835
913 Ga0268264_10000028 3300028381 Bacteria 426662
914 Ga0268264_10001210 3300028381 Bacteria 24862
915 Ga0268264_10002077 3300028381 Bacteria 17877
916 Ga0268264_10003832 3300028381 Bacteria 12897
917 Ga0268264_10127217 3300028381 Bacteria 2254
918 Ga0268264_10251916 3300028381 Unclassified 1641
919 Ga0268264_10366947 3300028381 Bacteria 1375
920 Ga0268264_10389131 3300028381 Bacteria 1337
921 Ga0307517_10000268 3300028786 Bacteria 89531
922 Ga0307517_10200984 3300028786 Unclassified 1246
923 Ga0307515_10001389 3300028794 Bacteria 54743
924 Ga0307515_10513749 3300028794 Bacteria 808
925 Ga0307511_10001580 3300030521 Bacteria 24156
926 Ga0265340_10064939 3300031247 Bacteria 1739
927 Ga0265331_10244831 3300031250 Unclassified 804
928 Ga0265327_10000013 3300031251 Bacteria 519549
929 Ga0265327_10017630 3300031251 Bacteria 4467
930 Ga0307513_10082237 3300031456 Bacteria 3316
931 Ga0307513_10369580 3300031456 Bacteria 1177
932 Ga0307513_10573527 3300031456 Bacteria 839
933 Ga0307513_10783611 3300031456 Bacteria 659
934 Ga0307508_10000111 3300031616 Bacteria 96733
935 Ga0265314_10058741 3300031711 Bacteria 2635
936 Ga0307516_10000159 3300031730 Bacteria 84553
937 Ga0307416_101432492 3300032002 Unclassified 797
938 Ga0307414_10183423 3300032004 Bacteria 1686
939 Ga0307414_10473802 3300032004 Bacteria 1103
940 Ga0307510_10001684 3300033180 Bacteria 24528
941 Ga0373934_0019498 3300035086 Bacteria 2604
942 Ga0373923_0438285 3300035111 Bacteria 632
943 Ga0373957_0110685 3300035120 Bacteria 1106
944 Ga0373924_0010674 3300035410 Bacteria 3397
945 Ga0373933_0270837 3300035724 Bacteria 1096
946 Ga0373947_0339791 3300035725 Bacteria 1006
947 Ga0373937_0068823 3300036401 Bacteria 3263
948 Ga0373937_0200324 3300036401 Bacteria 1877
949 Ga0373925_0470400 3300037068 Bacteria 1031
950 Ga0395899_0005839 3300037312 Bacteria 9553
951 Ga0395899_0020958 3300037312 Bacteria 4957
952 Ga0395899_0032489 3300037312 Bacteria 3920
953 Ga0395899_0322872 3300037312 Bacteria 1039
954 Ga0395900_0010296 3300037418 Bacteria 9567
955 Ga0395900_0015664 3300037418 Bacteria 7728
956 Ga0395900_0056510 3300037418 Bacteria 4039
957 Ga0395900_0128740 3300037418 Bacteria 2595
958 Ga0395900_0129016 3300037418 Bacteria 2592
959 Ga0395898_0004833 3300037466 Bacteria 14648
960 Ga0395898_0020188 3300037466 Bacteria 6768
961 Ga0395898_0295902 3300037466 Bacteria 1544
962 Ga0395898_0749861 3300037466 Unclassified 918
963 Ga0395905_0010763 3300037471 Bacteria 8868
964 Ga0395905_0020396 3300037471 Bacteria 6280
965 Ga0395901_0002626 3300038443 Bacteria 18173
966 Ga0395901_0014807 3300038443 Bacteria 7925
967 Ga0395901_0025466 3300038443 Bacteria 6074
968 Ga0395901_0549958 3300038443 Unclassified 1170
969 Ga0436365_0497393 3300039437 Bacteria 1532
970 Ga0439436_0012141 3300041404 Bacteria 2615
971 Ga0439439_0024462 3300041406 Bacteria 1516
972 Ga0439439_0054428 3300041406 Bacteria 1054
973 Ga0451797_1199432 3300041453 Bacteria 883
974 Ga0451795_0085537 3300041456 Bacteria 1018
975 Ga0451802_1247859 3300041460 Bacteria 1110
976 Ga0451807_0273900 3300041486 Unclassified 687
977 Ga0451833_0278687 3300041491 Bacteria 757
978 Ga0451839_1215289 3300041496 Bacteria 1114
979 Ga0451851_0050209 3300041507 Unclassified 1173
980 Ga0451851_0676225 3300041507 Bacteria 876
981 Ga0439431_0194051 3300041997 Bacteria 590
982 Ga0439441_058853 3300042001 Bacteria 805
983 Ga0439449_0021289 3300042007 Bacteria 2428
984 Ga0439449_0058701 3300042007 Bacteria 1420
985 Ga0439449_0105950 3300042007 Bacteria 1040
986 Ga0439457_013480 3300042014 Bacteria 1837
987 Ga0439457_035535 3300042014 Unclassified 1108
988 Ga0439457_070358 3300042014 Bacteria 797
989 Ga0439457_121145 3300042014 Bacteria 618
990 Ga0451577_0595004 3300042876 Bacteria 1004
991 Ga0466969_0061025 3300044656 Bacteria 1832
992 Ga0466969_0151608 3300044656 Bacteria 1068
993 Ga0466969_0320374 3300044656 Bacteria 702
994 Ga0466972_0000080 3300044658 Bacteria 89226
995 Ga0466972_0042617 3300044658 Bacteria 2205
996 Ga0466966_0000096 3300044684 Bacteria 54307
997 Ga0466961_0061721 3300044693 Bacteria 2382
998 Ga0466964_0179775 3300044706 Bacteria 1002
999 Ga0453684_0019697 3300044712 Bacteria 10244
1000 Ga0453684_0124567 3300044712 Unclassified 3104
1001 Ga0466971_0023766 3300044719 Bacteria 2732
1002 Ga0466968_0024425 3300044735 Bacteria 2469
1003 Ga0466968_0048687 3300044735 Bacteria 1804
1004 Ga0466968_0084148 3300044735 Bacteria 1402
1005 Ga0466968_0112026 3300044735 Bacteria 1228
1006 Ga0466970_0006114 3300044765 Bacteria 6000
1007 Ga0466970_0247563 3300044765 Bacteria 998
1008 Ga0466970_0580314 3300044765 Unclassified 649
1009 Ga0466957_0001278 3300044842 Bacteria 13115
1010 Ga0466957_0082174 3300044842 Bacteria 2008
1011 Ga0466957_0147062 3300044842 Bacteria 1521
1012 Ga0466959_0000014 3300045049 Bacteria 150962
1013 Ga0466959_0001662 3300045049 Bacteria 13780
1014 Ga0451576_0168670 3300045051 Bacteria 2285
1015 Ga0451576_0493688 3300045051 Bacteria 1286
1016 Ga0451576_1299611 3300045051 Bacteria 758
1017 Ga0466958_0099617 3300045836 Bacteria 1806
1018 Ga0495638_0027719 3300046460 Bacteria 3665
1019 Ga0495638_0045152 3300046460 Unclassified 2773
1020 Ga0495638_0091661 3300046460 Bacteria 1830
1021 Ga0495638_0237698 3300046460 Bacteria 1010
1022 Ga0495653_0046892 3300046463 Bacteria 3344
1023 Ga0495650_0014644 3300046471 Bacteria 4064
1024 Ga0495582_0317533 3300046473 Bacteria 896
1025 Ga0495606_0005929 3300046507 Bacteria 11479
1026 Ga0495628_0288377 3300046516 Bacteria 1217
1027 Ga0495630_0534010 3300046517 Bacteria 899
1028 Ga0495648_0005586 3300046524 Bacteria 10426
1029 Ga0495598_0230881 3300046537 Bacteria 679
1030 Ga0495645_0232387 3300046543 Bacteria 1235
1031 Ga0495667_0038657 3300046559 Bacteria 3177
1032 Ga0495668_0003219 3300046616 Bacteria 12457
1033 Ga0495634_0043429 3300046642 Bacteria 3046
1034 Ga0495611_0000677 3300046648 Bacteria 19441
1035 Ga0495611_0027335 3300046648 Unclassified 2493
1036 Ga0495625_0237882 3300046660 Bacteria 1187
1037 Ga0495625_0650538 3300046660 Bacteria 628
1038 Ga0495635_0245531 3300046663 Bacteria 1208
1039 Ga0495657_0173641 3300046675 Bacteria 1326
1040 Ga0495599_0073930 3300046678 Bacteria 2128
1041 Ga0495613_0212328 3300046689 Bacteria 1361
1042 Ga0495670_0221185 3300046691 Unclassified 1006
1043 Ga0495670_0317142 3300046691 Bacteria 837
1044 Ga0495581_0304871 3300047315 Bacteria 931
1045 Ga0495674_0035491 3300047319 Bacteria 4497
1046 Ga0495672_0009163 3300047320 Bacteria 7209
1047 Ga0495672_0014024 3300047320 Bacteria 5506
1048 Ga0495672_0103729 3300047320 Bacteria 1538
1049 Ga0495676_0144496 3300047321 Bacteria 1701
1050 Ga0495680_0082504 3300047322 Bacteria 2426
1051 Ga0495687_023288 3300047443 Bacteria 2959
1052 Ga0495684_0150059 3300047471 Bacteria 1743
1053 Ga0495684_0413791 3300047471 Bacteria 944
1054 Ga0495686_0000005 3300047472 Bacteria 827143
1055 Ga0496100_0012853 3300048903 Bacteria 4813
1056 Ga0496100_0484399 3300048903 Unclassified 952
1057 Ga0496101_0012680 3300048904 Bacteria 5633
1058 Ga0496101_1150944 3300048904 Bacteria 609
1059 Ga0496104_0174376 3300048907 Unclassified 2061
1060 Ga0496105_0392991 3300048908 Unclassified 1102
1061 Ga0496107_0736356 3300048910 Bacteria 724
1062 Ga0496110_0031968 3300048913 Bacteria 4542
1063 Ga0496112_0269226 3300048915 Unclassified 1652
1064 Ga0501290_001460 3300049513 Unclassified 3230
1065 Ga0501290_006667 3300049513 Bacteria 1446
1066 Ga0501296_024522 3300049519 Unclassified 786
1067 Ga0501298_003874 3300049521 Unclassified 2336
1068 Ga0501031_0004581 3300049568 Bacteria 8967
1069 Ga0501032_0063789 3300049569 Bacteria 2466
1070 Ga0501033_0161184 3300049570 Unclassified 1615
1071 Ga0501033_0201147 3300049570 Bacteria 1423
1072 Ga0501033_0898040 3300049570 Bacteria 596
1073 Ga0501034_0000152 3300049571 Bacteria 130576
1074 Ga0501034_0011131 3300049571 Bacteria 9337
1075 Ga0501034_0015409 3300049571 Bacteria 7857
1076 Ga0501034_0042137 3300049571 Bacteria 4621
1077 Ga0501034_0068545 3300049571 Bacteria 3557
1078 Ga0501034_0687373 3300049571 Bacteria 922
1079 Ga0501036_0000845 3300049572 Bacteria 22806
1080 Ga0501036_0016624 3300049572 Bacteria 6143
1081 Ga0501036_0877770 3300049572 Bacteria 737
1082 Ga0501036_1185225 3300049572 Bacteria 623
1083 Ga0501037_0006935 3300049573 Bacteria 8275
1084 Ga0501037_0122464 3300049573 Bacteria 1869
1085 Ga0501037_0135461 3300049573 Bacteria 1764
1086 Ga0501037_0517378 3300049573 Bacteria 808
1087 Ga0501038_0002256 3300049574 Bacteria 17927
1088 Ga0501038_0037776 3300049574 Bacteria 4233
1089 Ga0501038_0217195 3300049574 Unclassified 1527
1090 Ga0501039_0012691 3300049575 Bacteria 6440
1091 Ga0501039_0015887 3300049575 Bacteria 5763
1092 Ga0501040_0375742 3300049576 Bacteria 1019
1093 Ga0501043_0005938 3300049579 Bacteria 9820
1094 Ga0501043_0010022 3300049579 Bacteria 7432
1095 Ga0501043_0154073 3300049579 Bacteria 1798
1096 Ga0501043_0292015 3300049579 Bacteria 1248
1097 Ga0501046_0045889 3300049580 Bacteria 3468
1098 Ga0501047_0061465 3300049581 Bacteria 3624
1099 Ga0501047_0096960 3300049581 Bacteria 2827
1100 Ga0501047_0099646 3300049581 Bacteria 2785
1101 Ga0501047_0532496 3300049581 Bacteria 1000
1102 Ga0501048_0007829 3300049582 Bacteria 8096
1103 Ga0501068_0038801 3300049584 Bacteria 2854
1104 Ga0501068_0201533 3300049584 Bacteria 1262
1105 Ga0501070_0003721 3300049586 Bacteria 13173
1106 Ga0501073_0065635 3300049589 Bacteria 2530
1107 Ga0501074_0000310 3300049590 Bacteria 28251
1108 Ga0501202_000352 3300049652 Bacteria 6385
1109 Ga0501206_002631 3300049653 Bacteria 2258
1110 Ga0501207_001265 3300049654 Unclassified 3124
1111 Ga0501217_000979 3300049661 Bacteria 5142
1112 Ga0501222_001624 3300049662 Bacteria 3120
1113 Ga0501223_001473 3300049663 Bacteria 5443
1114 Ga0501224_001055 3300049664 Bacteria 3589
1115 Ga0501233_002017 3300049668 Bacteria 3539
1116 Ga0501235_000033 3300049669 Bacteria 22695
1117 Ga0501240_003815 3300049673 Unclassified 1710
1118 Ga0501242_000410 3300049674 Bacteria 3670
1119 Ga0501243_005195 3300049675 Unclassified 1957
1120 Ga0501243_008997 3300049675 Unclassified 1548
1121 Ga0501249_066909 3300049679 Unclassified 837
1122 Ga0501250_000692 3300049680 Bacteria 2430
1123 Ga0501252_025281 3300049682 Unclassified 799
1124 Ga0501253_020816 3300049683 Bacteria 1149
1125 Ga0501257_003324 3300049686 Unclassified 3444
1126 Ga0501259_001264 3300049688 Bacteria 4228
1127 Ga0501259_001910 3300049688 Bacteria 3452
1128 Ga0501261_001114 3300049690 Unclassified 3287
1129 Ga0501221_000390 3300049704 Bacteria 6716
1130 Ga0501225_0001669 3300049705 Bacteria 6939
1131 Ga0501225_0002369 3300049705 Bacteria 5813
1132 Ga0501229_016862 3300049706 Bacteria 952
1133 Ga0501229_033920 3300049706 Unclassified 708
1134 Ga0501234_002103 3300049707 Unclassified 3149
1135 Ga0501234_010646 3300049707 Bacteria 1435
1136 Ga0501245_001585 3300049708 Bacteria 2956
1137 Ga0501245_009929 3300049708 Unclassified 1371
1138 Ga0501079_0012410 3300049741 Bacteria 6501
1139 Ga0501080_0075085 3300049742 Bacteria 3144
1140 Ga0501080_0535982 3300049742 Bacteria 1044
1141 Ga0501083_0059502 3300049744 Bacteria 2555
1142 Ga0501232_006551 3300049757 Unclassified 1201
1143 Ga0501241_005859 3300049758 Bacteria 2280
1144 Ga0501264_001553 3300049761 Bacteria 2404
1145 Ga0501268_085470 3300049765 Unclassified 657
1146 Ga0501270_054774 3300049767 Unclassified 732
1147 Ga0501271_000833 3300049768 Unclassified 2625
1148 Ga0501273_023774 3300049770 Bacteria 843
1149 Ga0501279_003477 3300049775 Unclassified 2057
1150 Ga0501280_040657 3300049776 Unclassified 753
1151 Ga0501035_0001685 3300049822 Bacteria 22357
1152 Ga0501035_0048223 3300049822 Bacteria 3820
1153 Ga0501035_0209333 3300049822 Unclassified 1669
1154 Ga0501035_0215869 3300049822 Bacteria 1640
1155 Ga0501035_0221868 3300049822 Bacteria 1614
1156 Ga0501044_0001606 3300049823 Bacteria 26442
1157 Ga0501044_0010844 3300049823 Bacteria 9887
1158 Ga0501044_0116978 3300049823 Bacteria 2670
1159 Ga0501044_0222518 3300049823 Bacteria 1838
1160 Ga0501044_0240108 3300049823 Unclassified 1756
1161 Ga0501045_0015281 3300049824 Bacteria 5449
1162 Ga0501212_000830 3300049851 Bacteria 3243
1163 Ga0501284_00002 3300050005 Bacteria 220402
1164 nmdc:mga0k408_147843_c1 3300050493 Bacteria 1399
1165 nmdc:mga07m45_362465_c1 3300050496 Bacteria 842
1166 nmdc:mga05p37_3268_c1 3300050507 Bacteria 18878
1167 nmdc:mga09592_1381_c1 3300050508 Bacteria 19424
1168 nmdc:mga06r32_1422834_c1 3300050510 Bacteria 635
1169 nmdc:mga08y16_1066083_c1 3300050511 Bacteria 785
1170 nmdc:mga08y16_111150_c1 3300050511 Bacteria 2853
1171 nmdc:mga08y16_415625_c1 3300050511 Bacteria 1375
1172 nmdc:mga08y16_513560_c1 3300050511 Unclassified 1216
1173 nmdc:mga0n895_1385888_c1 3300050512 Unclassified 672
1174 nmdc:mga0n895_351149_c1 3300050512 Bacteria 1494
1175 nmdc:mga0n895_890779_c1 3300050512 Bacteria 876
1176 Ga0500578_0000325 3300053086 Bacteria 58251
1177 Ga0500578_0448195 3300053086 Bacteria 735
1178 Ga0500644_0028140 3300053088 Bacteria 1755
1179 Ga0500646_0258448 3300053090 Bacteria 615
1180 Ga0500583_0000001 3300053092 Bacteria 241642
1181 Ga0500583_0000611 3300053092 Bacteria 10635
1182 Ga0500583_0000925 3300053092 Bacteria 8389
1183 Ga0500583_0121762 3300053092 Unclassified 1291
1184 Ga0500641_0036500 3300053096 Bacteria 1966
1185 Ga0500650_0064328 3300053098 Bacteria 1714
1186 Ga0500650_0084187 3300053098 Bacteria 1488
1187 Ga0500594_0028447 3300053118 Bacteria 1455
1188 Ga0500642_0023825 3300053130 Bacteria 2464
1189 Ga0500652_106860 3300053131 Bacteria 1170
1190 Ga0500658_0099186 3300053134 Bacteria 1269
1191 Ga0500559_0147057 3300053136 Bacteria 1105
1192 Ga0500568_0000380 3300053139 Bacteria 33995
1193 Ga0500568_0009824 3300053139 Bacteria 4521
1194 Ga0500588_0009145 3300053146 Bacteria 2344
1195 Ga0500588_0121823 3300053146 Bacteria 921
1196 Ga0500616_0092276 3300053153 Bacteria 1497
1197 Ga0500622_0008293 3300053156 Bacteria 5824
1198 Ga0500622_0009755 3300053156 Bacteria 5302
1199 Ga0500622_0069751 3300053156 Bacteria 1779
1200 Ga0500639_017671 3300053163 Bacteria 3765
1201 Ga0500611_000003 3300053727 Bacteria 333431
1202 Ga0501084_0080337 3300054114 Bacteria 2734
1203 Ga0466962_0012015 3300061719 Bacteria 4165

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10105504 Ga0207688_101055042 175
2 3300025919 Ga0207657_10193097 Ga0207657_101930973 176
3 3300044712 Ga0453684_0124567 Ga0453684_0124567_856_1395 176
4 iso_pu_bacteria 2884791551 2884791794 176
5 iso_pu_bacteria 2929177148 2929182376 176
6 iso_pu_bacteria 2945977869 2945978290 176
7 iso_pu_bacteria 2946013367 2946015850 176
8 3300005335 Ga0070666_10330912 Ga0070666_103309122 177
9 3300005338 Ga0068868_100225796 Ga0068868_1002257963 177
10 3300005367 Ga0070667_100242968 Ga0070667_1002429683 177
11 3300005367 Ga0070667_100514326 Ga0070667_1005143262 177
12 3300005618 Ga0068864_100395007 Ga0068864_1003950072 177
13 3300005718 Ga0068866_10333639 Ga0068866_103336392 177
14 3300005843 Ga0068860_100008404 Ga0068860_1000084048 177
15 3300009093 Ga0105240_10017580 Ga0105240_100175803 177
16 3300009545 Ga0105237_10000855 Ga0105237_100008558 177
17 3300010375 Ga0105239_10002300 Ga0105239_1000230012 177
18 3300013297 Ga0157378_10386911 Ga0157378_103869111 177
19 3300025903 Ga0207680_10365260 Ga0207680_103652601 177
20 3300025913 Ga0207695_10309139 Ga0207695_103091392 177
21 3300025914 Ga0207671_10018700 Ga0207671_100187005 177
22 3300025938 Ga0207704_10119555 Ga0207704_101195554 177
23 3300025961 Ga0207712_10187097 Ga0207712_101870972 177
24 3300025986 Ga0207658_10534972 Ga0207658_105349721 177
25 3300025986 Ga0207658_10674721 Ga0207658_106747211 177
26 3300026095 Ga0207676_10367481 Ga0207676_103674811 177
27 3300028381 Ga0268264_10003832 Ga0268264_100038327 177
28 iso_pu_bacteria 2738541278 2738725470 177
29 3300003323 rootH1_10383519 rootH1_103835192 178
30 3300005327 Ga0070658_10159764 Ga0070658_101597642 178
31 3300005327 Ga0070658_10487147 Ga0070658_104871472 178
32 3300005336 Ga0070680_100002240 Ga0070680_1000022408 178
33 3300005366 Ga0070659_100532386 Ga0070659_1005323861 178
34 3300005455 Ga0070663_100012747 Ga0070663_1000127472 178
35 3300005458 Ga0070681_10001251 Ga0070681_1000125110 178
36 3300005530 Ga0070679_100043996 Ga0070679_1000439962 178
37 3300005530 Ga0070679_100911299 Ga0070679_1009112991 178
38 3300005563 Ga0068855_100056286 Ga0068855_1000562862 178
39 3300005578 Ga0068854_100155004 Ga0068854_1001550042 178
40 3300005614 Ga0068856_100014455 Ga0068856_1000144556 178
41 3300009093 Ga0105240_10068817 Ga0105240_100688175 178
42 3300009093 Ga0105240_10085994 Ga0105240_100859943 178
43 3300009545 Ga0105237_10007863 Ga0105237_100078632 178
44 3300009551 Ga0105238_10141743 Ga0105238_101417432 178
45 3300009551 Ga0105238_12020003 Ga0105238_120200031 178
46 3300009553 Ga0105249_10750421 Ga0105249_107504211 178
47 3300010375 Ga0105239_10000580 Ga0105239_1000058018 178
48 3300013102 Ga0157371_10010584 Ga0157371_100105844 178
49 3300013102 Ga0157371_10021199 Ga0157371_100211994 178
50 3300013102 Ga0157371_10612319 Ga0157371_106123191 178
51 3300013104 Ga0157370_10001361 Ga0157370_1000136119 178
52 3300013104 Ga0157370_10089903 Ga0157370_100899032 178
53 3300013105 Ga0157369_10004054 Ga0157369_100040549 178
54 3300013105 Ga0157369_10086456 Ga0157369_100864563 178
55 3300013105 Ga0157369_10503987 Ga0157369_105039871 178
56 3300013296 Ga0157374_10190682 Ga0157374_101906821 178
57 3300013306 Ga0163162_10130217 Ga0163162_101302174 178
58 3300013307 Ga0157372_10000171 Ga0157372_1000017128 178
59 3300013307 Ga0157372_10002128 Ga0157372_100021286 178
60 3300013307 Ga0157372_10031523 Ga0157372_100315234 178
61 3300014968 Ga0157379_10080924 Ga0157379_100809243 178
62 3300014969 Ga0157376_10000961 Ga0157376_100009616 178
63 3300025904 Ga0207647_10181246 Ga0207647_101812462 178
64 3300025909 Ga0207705_10001227 Ga0207705_100012276 178
65 3300025909 Ga0207705_10034136 Ga0207705_100341362 178
66 3300025909 Ga0207705_11007677 Ga0207705_110076771 178
67 3300025912 Ga0207707_10010595 Ga0207707_100105957 178
68 3300025913 Ga0207695_10390674 Ga0207695_103906741 178
69 3300025914 Ga0207671_10006030 Ga0207671_100060309 178
70 3300025917 Ga0207660_10009692 Ga0207660_100096926 178
71 3300025920 Ga0207649_10769894 Ga0207649_107698941 178
72 3300025921 Ga0207652_10001497 Ga0207652_1000149710 178
73 3300025924 Ga0207694_10100200 Ga0207694_101002002 178
74 3300025925 Ga0207650_11255355 Ga0207650_112553551 178
75 3300025949 Ga0207667_10000180 Ga0207667_1000018055 178
76 3300025949 Ga0207667_10298811 Ga0207667_102988112 178
77 3300025949 Ga0207667_10503494 Ga0207667_105034942 178
78 3300025961 Ga0207712_10534462 Ga0207712_105344622 178
79 3300025981 Ga0207640_10270100 Ga0207640_102701002 178
80 3300026067 Ga0207678_10025297 Ga0207678_100252976 178
81 3300026078 Ga0207702_10020186 Ga0207702_100201862 178
82 3300037312 Ga0395899_0032489 Ga0395899_0032489_2370_2918 178
83 3300037418 Ga0395900_0010296 Ga0395900_0010296_8570_9118 178
84 3300037418 Ga0395900_0129016 Ga0395900_0129016_348_896 178
85 3300037466 Ga0395898_0295902 Ga0395898_0295902_276_824 178
86 3300038443 Ga0395901_0014807 Ga0395901_0014807_2602_3150 178
87 3300038443 Ga0395901_0549958 Ga0395901_0549958_503_1039 178
88 3300044656 Ga0466969_0151608 Ga0466969_0151608_109_645 178
89 3300005293 Ga0065715_10541247 Ga0065715_105412471 179
90 3300005329 Ga0070683_100303162 Ga0070683_1003031622 179
91 3300005331 Ga0070670_100053900 Ga0070670_1000539002 179
92 3300005331 Ga0070670_100203577 Ga0070670_1002035772 179
93 3300005331 Ga0070670_100297151 Ga0070670_1002971513 179
94 3300005333 Ga0070677_10107602 Ga0070677_101076022 179
95 3300005338 Ga0068868_100251313 Ga0068868_1002513132 179
96 3300005347 Ga0070668_100346484 Ga0070668_1003464842 179
97 3300005354 Ga0070675_100450817 Ga0070675_1004508172 179
98 3300005355 Ga0070671_100002262 Ga0070671_10000226212 179
99 3300005367 Ga0070667_100006079 Ga0070667_1000060796 179
100 3300005456 Ga0070678_100012186 Ga0070678_1000121862 179
101 3300005459 Ga0068867_100076582 Ga0068867_1000765822 179
102 3300005459 Ga0068867_100214269 Ga0068867_1002142693 179
103 3300005543 Ga0070672_100225638 Ga0070672_1002256382 179
104 3300005718 Ga0068866_10412181 Ga0068866_104121811 179
105 3300005719 Ga0068861_100326554 Ga0068861_1003265542 179
106 3300005841 Ga0068863_100549707 Ga0068863_1005497072 179
107 3300005843 Ga0068860_101443390 Ga0068860_1014433901 179
108 3300005983 Ga0081540_1010502 Ga0081540_10105025 179
109 3300006237 Ga0097621_100000092 Ga0097621_10000009216 179
110 3300006237 Ga0097621_100247247 Ga0097621_1002472471 179
111 3300006358 Ga0068871_100000032 Ga0068871_10000003240 179
112 3300006358 Ga0068871_100487174 Ga0068871_1004871742 179
113 3300006881 Ga0068865_100155506 Ga0068865_1001555061 179
114 3300009101 Ga0105247_10664297 Ga0105247_106642971 179
115 3300009177 Ga0105248_10113241 Ga0105248_101132413 179
116 3300009545 Ga0105237_11000144 Ga0105237_110001441 179
117 3300009553 Ga0105249_10388402 Ga0105249_103884022 179
118 3300009553 Ga0105249_11072455 Ga0105249_110724551 179
119 3300011119 Ga0105246_10458217 Ga0105246_104582172 179
120 3300013297 Ga0157378_10036081 Ga0157378_100360813 179
121 3300013306 Ga0163162_10000431 Ga0163162_1000043123 179
122 3300013306 Ga0163162_10366948 Ga0163162_103669482 179
123 3300013308 Ga0157375_10000253 Ga0157375_1000025314 179
124 3300013308 Ga0157375_10553595 Ga0157375_105535952 179
125 3300014325 Ga0163163_10001380 Ga0163163_100013808 179
126 3300014325 Ga0163163_11402836 Ga0163163_114028362 179
127 3300014326 Ga0157380_10282621 Ga0157380_102826212 179
128 3300014968 Ga0157379_10611086 Ga0157379_106110862 179
129 3300014969 Ga0157376_10000714 Ga0157376_100007146 179
130 3300017792 Ga0163161_10008802 Ga0163161_100088025 179
131 3300025315 Ga0207697_10243428 Ga0207697_102434282 179
132 3300025893 Ga0207682_10021399 Ga0207682_100213992 179
133 3300025899 Ga0207642_10340195 Ga0207642_103401952 179
134 3300025909 Ga0207705_10530950 Ga0207705_105309501 179
135 3300025925 Ga0207650_10063847 Ga0207650_100638473 179
136 3300025925 Ga0207650_10141158 Ga0207650_101411582 179
137 3300025940 Ga0207691_10038981 Ga0207691_100389813 179
138 3300025941 Ga0207711_10072884 Ga0207711_100728842 179
139 3300025944 Ga0207661_11094758 Ga0207661_110947581 179
140 3300025972 Ga0207668_10275550 Ga0207668_102755502 179
141 3300025986 Ga0207658_10013694 Ga0207658_100136944 179
142 3300026023 Ga0207677_10331101 Ga0207677_103311012 179
143 3300026089 Ga0207648_10041867 Ga0207648_100418675 179
144 3300026095 Ga0207676_10255199 Ga0207676_102551992 179
145 3300026118 Ga0207675_100571767 Ga0207675_1005717672 179
146 3300026121 Ga0207683_10126348 Ga0207683_101263482 179
147 3300026121 Ga0207683_10260139 Ga0207683_102601392 179
148 3300031456 Ga0307513_10369580 Ga0307513_103695801 179
149 3300035725 Ga0373947_0339791 Ga0373947_0339791_68_607 179
150 3300041460 Ga0451802_1247859 Ga0451802_1247859_113_682 179
151 3300042001 Ga0439441_058853 Ga0439441_058853_247_786 179
152 3300048903 Ga0496100_0012853 Ga0496100_0012853_3737_4276 179
153 3300048904 Ga0496101_0012680 Ga0496101_0012680_2666_3205 179
154 3300048907 Ga0496104_0174376 Ga0496104_0174376_109_648 179
155 3300049573 Ga0501037_0135461 Ga0501037_0135461_939_1481 179
156 3300000545 CNXas_1002007 CNXas_10020072 180
157 3300002459 JGI24751J29686_10001558 JGI24751J29686_100015584 180
158 3300003322 rootL2_10060567 rootL2_100605671 180
159 3300003322 rootL2_10236104 rootL2_102361041 180
160 3300003354 JGI25160J50197_1005120 JGI25160J50197_10051202 180
161 3300005288 Ga0065714_10125551 Ga0065714_101255512 180
162 3300005289 Ga0065704_10124374 Ga0065704_101243742 180
163 3300005290 Ga0065712_10009365 Ga0065712_100093653 180
164 3300005293 Ga0065715_10021010 Ga0065715_100210101 180
165 3300005293 Ga0065715_10328789 Ga0065715_103287892 180
166 3300005295 Ga0065707_10166820 Ga0065707_101668202 180
167 3300005295 Ga0065707_10505871 Ga0065707_105058711 180
168 3300005328 Ga0070676_10124852 Ga0070676_101248522 180
169 3300005328 Ga0070676_10151051 Ga0070676_101510512 180
170 3300005329 Ga0070683_100387773 Ga0070683_1003877733 180
171 3300005331 Ga0070670_100291144 Ga0070670_1002911442 180
172 3300005331 Ga0070670_100532854 Ga0070670_1005328542 180
173 3300005333 Ga0070677_10193841 Ga0070677_101938412 180
174 3300005334 Ga0068869_100012053 Ga0068869_1000120533 180
175 3300005334 Ga0068869_100248911 Ga0068869_1002489112 180
176 3300005335 Ga0070666_10111370 Ga0070666_101113702 180
177 3300005335 Ga0070666_10155207 Ga0070666_101552072 180
178 3300005336 Ga0070680_100050135 Ga0070680_1000501352 180
179 3300005336 Ga0070680_100257059 Ga0070680_1002570592 180
180 3300005338 Ga0068868_100216883 Ga0068868_1002168831 180
181 3300005339 Ga0070660_100000831 Ga0070660_1000008315 180
182 3300005339 Ga0070660_100042698 Ga0070660_1000426983 180
183 3300005339 Ga0070660_100084233 Ga0070660_1000842332 180
184 3300005340 Ga0070689_100108699 Ga0070689_1001086992 180
185 3300005340 Ga0070689_100193489 Ga0070689_1001934891 180
186 3300005340 Ga0070689_100756481 Ga0070689_1007564812 180
187 3300005343 Ga0070687_100008161 Ga0070687_1000081611 180
188 3300005343 Ga0070687_100011272 Ga0070687_1000112724 180
189 3300005347 Ga0070668_100118774 Ga0070668_1001187741 180
190 3300005347 Ga0070668_100470631 Ga0070668_1004706311 180
191 3300005353 Ga0070669_100070003 Ga0070669_1000700032 180
192 3300005353 Ga0070669_100788598 Ga0070669_1007885981 180
193 3300005354 Ga0070675_100060386 Ga0070675_1000603864 180
194 3300005355 Ga0070671_100078810 Ga0070671_1000788101 180
195 3300005364 Ga0070673_100019242 Ga0070673_1000192426 180
196 3300005365 Ga0070688_100092801 Ga0070688_1000928012 180
197 3300005366 Ga0070659_100013878 Ga0070659_1000138785 180
198 3300005367 Ga0070667_100136717 Ga0070667_1001367172 180
199 3300005438 Ga0070701_10011972 Ga0070701_100119723 180
200 3300005441 Ga0070700_100036582 Ga0070700_1000365821 180
201 3300005458 Ga0070681_10033532 Ga0070681_100335322 180
202 3300005458 Ga0070681_10146444 Ga0070681_101464443 180
203 3300005459 Ga0068867_100018002 Ga0068867_1000180023 180
204 3300005459 Ga0068867_100176714 Ga0068867_1001767142 180
205 3300005459 Ga0068867_100181767 Ga0068867_1001817672 180
206 3300005459 Ga0068867_100544389 Ga0068867_1005443891 180
207 3300005471 Ga0070698_100001240 Ga0070698_1000012403 180
208 3300005471 Ga0070698_100015839 Ga0070698_1000158398 180
209 3300005518 Ga0070699_100020541 Ga0070699_1000205417 180
210 3300005530 Ga0070679_100061632 Ga0070679_1000616324 180
211 3300005530 Ga0070679_100399800 Ga0070679_1003998002 180
212 3300005539 Ga0068853_100023714 Ga0068853_1000237145 180
213 3300005539 Ga0068853_100138229 Ga0068853_1001382292 180
214 3300005539 Ga0068853_100331519 Ga0068853_1003315192 180
215 3300005539 Ga0068853_100591046 Ga0068853_1005910462 180
216 3300005543 Ga0070672_100128676 Ga0070672_1001286762 180
217 3300005543 Ga0070672_100283597 Ga0070672_1002835972 180
218 3300005544 Ga0070686_100166734 Ga0070686_1001667342 180
219 3300005549 Ga0070704_100105820 Ga0070704_1001058202 180
220 3300005549 Ga0070704_101587768 Ga0070704_1015877681 180
221 3300005563 Ga0068855_100003310 Ga0068855_1000033105 180
222 3300005563 Ga0068855_100087143 Ga0068855_1000871434 180
223 3300005563 Ga0068855_100101183 Ga0068855_1001011835 180
224 3300005577 Ga0068857_100031579 Ga0068857_1000315794 180
225 3300005577 Ga0068857_100065276 Ga0068857_1000652762 180
226 3300005577 Ga0068857_100917313 Ga0068857_1009173131 180
227 3300005614 Ga0068856_100053446 Ga0068856_1000534462 180
228 3300005614 Ga0068856_100274202 Ga0068856_1002742022 180
229 3300005616 Ga0068852_100001315 Ga0068852_10000131510 180
230 3300005616 Ga0068852_100023320 Ga0068852_1000233205 180
231 3300005617 Ga0068859_100078746 Ga0068859_1000787462 180
232 3300005617 Ga0068859_100143094 Ga0068859_1001430943 180
233 3300005618 Ga0068864_100028548 Ga0068864_1000285482 180
234 3300005718 Ga0068866_10443337 Ga0068866_104433371 180
235 3300005719 Ga0068861_100039196 Ga0068861_1000391962 180
236 3300005719 Ga0068861_100472336 Ga0068861_1004723362 180
237 3300005719 Ga0068861_100821831 Ga0068861_1008218312 180
238 3300005840 Ga0068870_10529835 Ga0068870_105298351 180
239 3300005841 Ga0068863_100024759 Ga0068863_1000247591 180
240 3300005841 Ga0068863_100373137 Ga0068863_1003731372 180
241 3300005841 Ga0068863_100529417 Ga0068863_1005294172 180
242 3300005843 Ga0068860_100000024 Ga0068860_100000024128 180
243 3300005843 Ga0068860_100132731 Ga0068860_1001327312 180
244 3300005843 Ga0068860_100372626 Ga0068860_1003726262 180
245 3300005844 Ga0068862_100171546 Ga0068862_1001715462 180
246 3300005844 Ga0068862_100271643 Ga0068862_1002716432 180
247 3300006173 Ga0070716_100467582 Ga0070716_1004675822 180
248 3300006237 Ga0097621_100003569 Ga0097621_10000356913 180
249 3300006358 Ga0068871_100005675 Ga0068871_1000056752 180
250 3300006358 Ga0068871_100441513 Ga0068871_1004415132 180
251 3300006358 Ga0068871_101070587 Ga0068871_1010705871 180
252 3300006844 Ga0075428_100004634 Ga0075428_1000046345 180
253 3300006844 Ga0075428_100054065 Ga0075428_1000540654 180
254 3300006847 Ga0075431_100143590 Ga0075431_1001435901 180
255 3300006880 Ga0075429_100000407 Ga0075429_10000040719 180
256 3300006880 Ga0075429_100358983 Ga0075429_1003589832 180
257 3300006881 Ga0068865_100072468 Ga0068865_1000724683 180
258 3300006881 Ga0068865_100532613 Ga0068865_1005326132 180
259 3300006931 Ga0097620_100078743 Ga0097620_1000787432 180
260 3300006931 Ga0097620_100143083 Ga0097620_1001430832 180
261 3300009036 Ga0105244_10417477 Ga0105244_104174771 180
262 3300009093 Ga0105240_10000106 Ga0105240_1000010648 180
263 3300009093 Ga0105240_10002363 Ga0105240_1000236321 180
264 3300009093 Ga0105240_10002407 Ga0105240_100024073 180
265 3300009093 Ga0105240_10073258 Ga0105240_100732583 180
266 3300009093 Ga0105240_10086784 Ga0105240_100867842 180
267 3300009094 Ga0111539_10280415 Ga0111539_102804151 180
268 3300009094 Ga0111539_11304344 Ga0111539_113043441 180
269 3300009101 Ga0105247_10496278 Ga0105247_104962782 180
270 3300009174 Ga0105241_10001117 Ga0105241_1000111721 180
271 3300009174 Ga0105241_10024976 Ga0105241_100249764 180
272 3300009174 Ga0105241_10877990 Ga0105241_108779901 180
273 3300009176 Ga0105242_10034241 Ga0105242_100342415 180
274 3300009176 Ga0105242_10466078 Ga0105242_104660782 180
275 3300009545 Ga0105237_10000561 Ga0105237_1000056116 180
276 3300009545 Ga0105237_10011076 Ga0105237_100110763 180
277 3300009545 Ga0105237_10108821 Ga0105237_101088214 180
278 3300009545 Ga0105237_10123305 Ga0105237_101233051 180
279 3300009551 Ga0105238_10001830 Ga0105238_1000183015 180
280 3300009551 Ga0105238_10006849 Ga0105238_100068495 180
281 3300009553 Ga0105249_10001205 Ga0105249_1000120516 180
282 3300009553 Ga0105249_10006402 Ga0105249_100064028 180
283 3300009553 Ga0105249_10008771 Ga0105249_100087715 180
284 3300009553 Ga0105249_10468092 Ga0105249_104680922 180
285 3300010375 Ga0105239_10042882 Ga0105239_100428824 180
286 3300010375 Ga0105239_10046255 Ga0105239_100462554 180
287 3300010375 Ga0105239_11577072 Ga0105239_115770721 180
288 3300013100 Ga0157373_10003094 Ga0157373_100030947 180
289 3300013100 Ga0157373_10091788 Ga0157373_100917882 180
290 3300013100 Ga0157373_10166367 Ga0157373_101663673 180
291 3300013102 Ga0157371_10002374 Ga0157371_1000237410 180
292 3300013102 Ga0157371_10002840 Ga0157371_100028403 180
293 3300013102 Ga0157371_10003029 Ga0157371_100030295 180
294 3300013102 Ga0157371_10281098 Ga0157371_102810982 180
295 3300013102 Ga0157371_10463310 Ga0157371_104633101 180
296 3300013104 Ga0157370_10001381 Ga0157370_1000138112 180
297 3300013104 Ga0157370_10031168 Ga0157370_100311685 180
298 3300013104 Ga0157370_10073553 Ga0157370_100735532 180
299 3300013104 Ga0157370_10182471 Ga0157370_101824712 180
300 3300013104 Ga0157370_10353373 Ga0157370_103533732 180
301 3300013104 Ga0157370_10478026 Ga0157370_104780261 180
302 3300013105 Ga0157369_10007569 Ga0157369_1000756913 180
303 3300013105 Ga0157369_10034964 Ga0157369_100349642 180
304 3300013105 Ga0157369_10515564 Ga0157369_105155642 180
305 3300013296 Ga0157374_10893760 Ga0157374_108937602 180
306 3300013297 Ga0157378_10030429 Ga0157378_100304292 180
307 3300013297 Ga0157378_10362154 Ga0157378_103621541 180
308 3300013297 Ga0157378_10367471 Ga0157378_103674712 180
309 3300013306 Ga0163162_10064477 Ga0163162_100644772 180
310 3300013306 Ga0163162_10220773 Ga0163162_102207732 180
311 3300013306 Ga0163162_11222445 Ga0163162_112224452 180
312 3300013307 Ga0157372_10000463 Ga0157372_1000046319 180
313 3300013307 Ga0157372_10291934 Ga0157372_102919344 180
314 3300013307 Ga0157372_10693454 Ga0157372_106934542 180
315 3300013308 Ga0157375_10188328 Ga0157375_101883283 180
316 3300013308 Ga0157375_10203956 Ga0157375_102039562 180
317 3300013308 Ga0157375_10240833 Ga0157375_102408331 180
318 3300014325 Ga0163163_10110547 Ga0163163_101105473 180
319 3300014325 Ga0163163_10316057 Ga0163163_103160572 180
320 3300014325 Ga0163163_10498307 Ga0163163_104983073 180
321 3300014326 Ga0157380_10069446 Ga0157380_100694463 180
322 3300014326 Ga0157380_10117013 Ga0157380_101170132 180
323 3300014326 Ga0157380_10120191 Ga0157380_101201913 180
324 3300014745 Ga0157377_10002237 Ga0157377_100022374 180
325 3300014745 Ga0157377_10250420 Ga0157377_102504202 180
326 3300014968 Ga0157379_10243214 Ga0157379_102432142 180
327 3300014969 Ga0157376_10747277 Ga0157376_107472772 180
328 3300017792 Ga0163161_10026417 Ga0163161_100264172 180
329 3300017792 Ga0163161_10042247 Ga0163161_100422473 180
330 3300025208 Ga0209436_100446 Ga0209436_1004464 180
331 3300025284 Ga0209130_1004223 Ga0209130_10042232 180
332 3300025302 Ga0207426_1000073 Ga0207426_1000073210 180
333 3300025321 Ga0207656_10258026 Ga0207656_102580261 180
334 3300025893 Ga0207682_10183195 Ga0207682_101831951 180
335 3300025903 Ga0207680_10140097 Ga0207680_101400972 180
336 3300025903 Ga0207680_10174048 Ga0207680_101740482 180
337 3300025907 Ga0207645_10016092 Ga0207645_100160922 180
338 3300025907 Ga0207645_10155183 Ga0207645_101551832 180
339 3300025907 Ga0207645_10156629 Ga0207645_101566292 180
340 3300025908 Ga0207643_10003543 Ga0207643_100035437 180
341 3300025908 Ga0207643_10054981 Ga0207643_100549813 180
342 3300025911 Ga0207654_10019739 Ga0207654_100197392 180
343 3300025911 Ga0207654_10091347 Ga0207654_100913472 180
344 3300025912 Ga0207707_10247904 Ga0207707_102479042 180
345 3300025912 Ga0207707_11103438 Ga0207707_111034381 180
346 3300025913 Ga0207695_10001064 Ga0207695_1000106422 180
347 3300025913 Ga0207695_10004051 Ga0207695_100040513 180
348 3300025913 Ga0207695_10019628 Ga0207695_100196285 180
349 3300025913 Ga0207695_10408098 Ga0207695_104080982 180
350 3300025914 Ga0207671_10002324 Ga0207671_100023242 180
351 3300025914 Ga0207671_10012091 Ga0207671_100120913 180
352 3300025917 Ga0207660_10221324 Ga0207660_102213242 180
353 3300025917 Ga0207660_10520631 Ga0207660_105206311 180
354 3300025918 Ga0207662_10020460 Ga0207662_100204604 180
355 3300025919 Ga0207657_10009558 Ga0207657_100095584 180
356 3300025919 Ga0207657_10092857 Ga0207657_100928573 180
357 3300025919 Ga0207657_10167879 Ga0207657_101678791 180
358 3300025921 Ga0207652_10224157 Ga0207652_102241572 180
359 3300025921 Ga0207652_10739129 Ga0207652_107391292 180
360 3300025923 Ga0207681_10034787 Ga0207681_100347875 180
361 3300025923 Ga0207681_10592826 Ga0207681_105928262 180
362 3300025924 Ga0207694_10048568 Ga0207694_100485682 180
363 3300025924 Ga0207694_10225936 Ga0207694_102259362 180
364 3300025925 Ga0207650_10025239 Ga0207650_100252392 180
365 3300025931 Ga0207644_10469426 Ga0207644_104694261 180
366 3300025934 Ga0207686_10000566 Ga0207686_100005665 180
367 3300025934 Ga0207686_10084847 Ga0207686_100848474 180
368 3300025936 Ga0207670_10051646 Ga0207670_100516464 180
369 3300025938 Ga0207704_11263045 Ga0207704_112630451 180
370 3300025940 Ga0207691_10038799 Ga0207691_100387995 180
371 3300025940 Ga0207691_10418132 Ga0207691_104181321 180
372 3300025942 Ga0207689_10002381 Ga0207689_1000238112 180
373 3300025942 Ga0207689_10031443 Ga0207689_100314434 180
374 3300025949 Ga0207667_10001242 Ga0207667_100012422 180
375 3300025949 Ga0207667_10010652 Ga0207667_1001065213 180
376 3300025949 Ga0207667_10037467 Ga0207667_100374672 180
377 3300025949 Ga0207667_10136977 Ga0207667_101369771 180
378 3300025949 Ga0207667_11033621 Ga0207667_110336211 180
379 3300025960 Ga0207651_10072767 Ga0207651_100727674 180
380 3300025960 Ga0207651_10230532 Ga0207651_102305322 180
381 3300025961 Ga0207712_10005755 Ga0207712_100057558 180
382 3300025961 Ga0207712_10006003 Ga0207712_100060033 180
383 3300025961 Ga0207712_10006416 Ga0207712_100064162 180
384 3300025961 Ga0207712_10027394 Ga0207712_100273943 180
385 3300025972 Ga0207668_10813693 Ga0207668_108136931 180
386 3300025986 Ga0207658_10836335 Ga0207658_108363351 180
387 3300026041 Ga0207639_10057967 Ga0207639_100579672 180
388 3300026041 Ga0207639_10085656 Ga0207639_100856563 180
389 3300026041 Ga0207639_10090305 Ga0207639_100903052 180
390 3300026041 Ga0207639_10129991 Ga0207639_101299911 180
391 3300026041 Ga0207639_10182169 Ga0207639_101821692 180
392 3300026041 Ga0207639_10219741 Ga0207639_102197412 180
393 3300026041 Ga0207639_10387197 Ga0207639_103871971 180
394 3300026041 Ga0207639_10513991 Ga0207639_105139912 180
395 3300026075 Ga0207708_10055201 Ga0207708_100552014 180
396 3300026075 Ga0207708_10171334 Ga0207708_101713342 180
397 3300026078 Ga0207702_10035062 Ga0207702_100350624 180
398 3300026078 Ga0207702_10276068 Ga0207702_102760682 180
399 3300026078 Ga0207702_10327443 Ga0207702_103274432 180
400 3300026078 Ga0207702_10388892 Ga0207702_103888921 180
401 3300026088 Ga0207641_10005426 Ga0207641_100054268 180
402 3300026088 Ga0207641_10017939 Ga0207641_100179391 180
403 3300026089 Ga0207648_10030498 Ga0207648_100304982 180
404 3300026089 Ga0207648_10061589 Ga0207648_100615892 180
405 3300026089 Ga0207648_10074826 Ga0207648_100748262 180
406 3300026089 Ga0207648_10159502 Ga0207648_101595022 180
407 3300026089 Ga0207648_10228615 Ga0207648_102286152 180
408 3300026089 Ga0207648_10271895 Ga0207648_102718952 180
409 3300026095 Ga0207676_10022021 Ga0207676_100220214 180
410 3300026095 Ga0207676_10197866 Ga0207676_101978662 180
411 3300026116 Ga0207674_10000453 Ga0207674_1000045331 180
412 3300026116 Ga0207674_10020171 Ga0207674_100201716 180
413 3300026116 Ga0207674_10042617 Ga0207674_100426174 180
414 3300026116 Ga0207674_10397971 Ga0207674_103979711 180
415 3300026116 Ga0207674_10551368 Ga0207674_105513681 180
416 3300026116 Ga0207674_10800051 Ga0207674_108000512 180
417 3300026118 Ga0207675_100033929 Ga0207675_1000339294 180
418 3300026118 Ga0207675_100036164 Ga0207675_1000361643 180
419 3300026118 Ga0207675_100038705 Ga0207675_1000387055 180
420 3300026142 Ga0207698_10036047 Ga0207698_100360473 180
421 3300026142 Ga0207698_10064694 Ga0207698_100646941 180
422 3300026142 Ga0207698_10149903 Ga0207698_101499032 180
423 3300026142 Ga0207698_10190194 Ga0207698_101901942 180
424 3300027526 Ga0209968_1013270 Ga0209968_10132702 180
425 3300027907 Ga0207428_10030792 Ga0207428_100307922 180
426 3300028379 Ga0268266_10000048 Ga0268266_10000048152 180
427 3300028380 Ga0268265_10151542 Ga0268265_101515422 180
428 3300028380 Ga0268265_10821493 Ga0268265_108214931 180
429 3300028380 Ga0268265_10977022 Ga0268265_109770221 180
430 3300028381 Ga0268264_10000028 Ga0268264_10000028309 180
431 3300028381 Ga0268264_10127217 Ga0268264_101272172 180
432 3300028381 Ga0268264_10366947 Ga0268264_103669471 180
433 3300028786 Ga0307517_10000268 Ga0307517_1000026862 180
434 3300028786 Ga0307517_10200984 Ga0307517_102009842 180
435 3300030521 Ga0307511_10001580 Ga0307511_100015809 180
436 3300031251 Ga0265327_10017630 Ga0265327_100176304 180
437 3300031730 Ga0307516_10000159 Ga0307516_1000015934 180
438 3300032002 Ga0307416_101432492 Ga0307416_1014324922 180
439 3300037312 Ga0395899_0005839 Ga0395899_0005839_4289_4834 180
440 3300037418 Ga0395900_0015664 Ga0395900_0015664_4167_4712 180
441 3300037466 Ga0395898_0004833 Ga0395898_0004833_4856_5401 180
442 3300037466 Ga0395898_0749861 Ga0395898_0749861_112_654 180
443 3300037471 Ga0395905_0010763 Ga0395905_0010763_937_1479 180
444 3300037471 Ga0395905_0020396 Ga0395905_0020396_936_1478 180
445 3300038443 Ga0395901_0002626 Ga0395901_0002626_7281_7826 180
446 3300041453 Ga0451797_1199432 Ga0451797_1199432_168_710 180
447 3300041486 Ga0451807_0273900 Ga0451807_0273900_79_621 180
448 3300041507 Ga0451851_0676225 Ga0451851_0676225_126_668 180
449 3300042876 Ga0451577_0595004 Ga0451577_0595004_33_575 180
450 3300044656 Ga0466969_0061025 Ga0466969_0061025_460_1002 180
451 3300044656 Ga0466969_0320374 Ga0466969_0320374_49_591 180
452 3300044693 Ga0466961_0061721 Ga0466961_0061721_1308_1850 180
453 3300044706 Ga0466964_0179775 Ga0466964_0179775_187_729 180
454 3300044719 Ga0466971_0023766 Ga0466971_0023766_1574_2116 180
455 3300044735 Ga0466968_0048687 Ga0466968_0048687_789_1331 180
456 3300044765 Ga0466970_0006114 Ga0466970_0006114_4215_4757 180
457 3300044765 Ga0466970_0247563 Ga0466970_0247563_298_840 180
458 3300044842 Ga0466957_0082174 Ga0466957_0082174_309_851 180
459 3300045049 Ga0466959_0001662 Ga0466959_0001662_6950_7492 180
460 3300045051 Ga0451576_1299611 Ga0451576_1299611_111_653 180
461 3300045836 Ga0466958_0099617 Ga0466958_0099617_801_1343 180
462 3300046460 Ga0495638_0027719 Ga0495638_0027719_1424_1966 180
463 3300046460 Ga0495638_0045152 Ga0495638_0045152_750_1292 180
464 3300046460 Ga0495638_0237698 Ga0495638_0237698_307_849 180
465 3300046507 Ga0495606_0005929 Ga0495606_0005929_10158_10700 180
466 3300046524 Ga0495648_0005586 Ga0495648_0005586_9475_10017 180
467 3300046537 Ga0495598_0230881 Ga0495598_0230881_127_669 180
468 3300046648 Ga0495611_0000677 Ga0495611_0000677_10760_11302 180
469 3300046648 Ga0495611_0027335 Ga0495611_0027335_403_945 180
470 3300046660 Ga0495625_0237882 Ga0495625_0237882_371_913 180
471 3300046691 Ga0495670_0221185 Ga0495670_0221185_435_977 180
472 3300046691 Ga0495670_0317142 Ga0495670_0317142_241_783 180
473 3300047320 Ga0495672_0103729 Ga0495672_0103729_869_1411 180
474 3300047443 Ga0495687_023288 Ga0495687_023288_42_584 180
475 3300047472 Ga0495686_0000005 Ga0495686_0000005_632452_632994 180
476 3300048908 Ga0496105_0392991 Ga0496105_0392991_413_955 180
477 3300049513 Ga0501290_006667 Ga0501290_006667_838_1380 180
478 3300049568 Ga0501031_0004581 Ga0501031_0004581_4219_4761 180
479 3300049570 Ga0501033_0161184 Ga0501033_0161184_389_931 180
480 3300049570 Ga0501033_0898040 Ga0501033_0898040_18_560 180
481 3300049571 Ga0501034_0015409 Ga0501034_0015409_6391_6933 180
482 3300049571 Ga0501034_0042137 Ga0501034_0042137_2980_3522 180
483 3300049572 Ga0501036_0016624 Ga0501036_0016624_2509_3051 180
484 3300049573 Ga0501037_0122464 Ga0501037_0122464_40_582 180
485 3300049574 Ga0501038_0002256 Ga0501038_0002256_16765_17307 180
486 3300049574 Ga0501038_0217195 Ga0501038_0217195_45_587 180
487 3300049575 Ga0501039_0015887 Ga0501039_0015887_968_1510 180
488 3300049576 Ga0501040_0375742 Ga0501040_0375742_435_977 180
489 3300049579 Ga0501043_0010022 Ga0501043_0010022_4142_4684 180
490 3300049581 Ga0501047_0096960 Ga0501047_0096960_683_1225 180
491 3300049584 Ga0501068_0201533 Ga0501068_0201533_651_1193 180
492 3300049675 Ga0501243_008997 Ga0501243_008997_546_1088 180
493 3300049680 Ga0501250_000692 Ga0501250_000692_1287_1829 180
494 3300049683 Ga0501253_020816 Ga0501253_020816_410_952 180
495 3300049688 Ga0501259_001264 Ga0501259_001264_198_740 180
496 3300049707 Ga0501234_010646 Ga0501234_010646_64_606 180
497 3300049708 Ga0501245_009929 Ga0501245_009929_316_858 180
498 3300049758 Ga0501241_005859 Ga0501241_005859_1643_2185 180
499 3300049770 Ga0501273_023774 Ga0501273_023774_206_748 180
500 3300049822 Ga0501035_0048223 Ga0501035_0048223_2102_2644 180
501 3300049822 Ga0501035_0209333 Ga0501035_0209333_1043_1585 180
502 3300049823 Ga0501044_0010844 Ga0501044_0010844_3302_3844 180
503 3300049823 Ga0501044_0240108 Ga0501044_0240108_79_636 180
504 3300050005 Ga0501284_00002 Ga0501284_00002_142467_143009 180
505 3300050508 nmdc:mga09592_1381_c1 nmdc:mga09592_1381_c1_10812_11354 180
506 3300050510 nmdc:mga06r32_1422834_c1 nmdc:mga06r32_1422834_c1_55_597 180
507 3300050511 nmdc:mga08y16_1066083_c1 nmdc:mga08y16_1066083_c1_66_608 180
508 3300053092 Ga0500583_0000925 Ga0500583_0000925_4829_5371 180
509 3300053092 Ga0500583_0121762 Ga0500583_0121762_723_1265 180
510 3300053130 Ga0500642_0023825 Ga0500642_0023825_107_649 180
511 3300053139 Ga0500568_0009824 Ga0500568_0009824_578_1120 180
512 3300053146 Ga0500588_0009145 Ga0500588_0009145_1481_2023 180
513 3300053156 Ga0500622_0008293 Ga0500622_0008293_2055_2597 180
514 3300061719 Ga0466962_0012015 Ga0466962_0012015_2449_2991 180
515 2162886011 MRS1b_contig_6238227 MRS1b_0503.00001580 181
516 3300001904 JGI24736J21556_1043293 JGI24736J21556_10432931 181
517 3300003323 rootH1_10224374 rootH1_102243743 181
518 3300005288 Ga0065714_10171058 Ga0065714_101710582 181
519 3300005290 Ga0065712_10006449 Ga0065712_100064496 181
520 3300005290 Ga0065712_10094617 Ga0065712_100946172 181
521 3300005290 Ga0065712_10118315 Ga0065712_101183152 181
522 3300005290 Ga0065712_10144144 Ga0065712_101441441 181
523 3300005327 Ga0070658_10549608 Ga0070658_105496082 181
524 3300005328 Ga0070676_10017601 Ga0070676_100176012 181
525 3300005328 Ga0070676_10488270 Ga0070676_104882701 181
526 3300005329 Ga0070683_100065604 Ga0070683_1000656045 181
527 3300005329 Ga0070683_100099212 Ga0070683_1000992122 181
528 3300005329 Ga0070683_100147044 Ga0070683_1001470442 181
529 3300005329 Ga0070683_100215793 Ga0070683_1002157932 181
530 3300005329 Ga0070683_100265676 Ga0070683_1002656762 181
531 3300005329 Ga0070683_100326036 Ga0070683_1003260362 181
532 3300005330 Ga0070690_100006178 Ga0070690_1000061782 181
533 3300005330 Ga0070690_100108460 Ga0070690_1001084602 181
534 3300005331 Ga0070670_100033314 Ga0070670_1000333142 181
535 3300005331 Ga0070670_100056071 Ga0070670_1000560712 181
536 3300005331 Ga0070670_100415457 Ga0070670_1004154572 181
537 3300005333 Ga0070677_10155260 Ga0070677_101552601 181
538 3300005334 Ga0068869_100030779 Ga0068869_1000307794 181
539 3300005334 Ga0068869_100052211 Ga0068869_1000522111 181
540 3300005334 Ga0068869_100057639 Ga0068869_1000576394 181
541 3300005334 Ga0068869_100084081 Ga0068869_1000840811 181
542 3300005334 Ga0068869_100089243 Ga0068869_1000892432 181
543 3300005334 Ga0068869_100120852 Ga0068869_1001208522 181
544 3300005335 Ga0070666_10000126 Ga0070666_1000012623 181
545 3300005335 Ga0070666_10483350 Ga0070666_104833502 181
546 3300005337 Ga0070682_100071311 Ga0070682_1000713112 181
547 3300005338 Ga0068868_100002609 Ga0068868_10000260912 181
548 3300005338 Ga0068868_100028711 Ga0068868_1000287114 181
549 3300005338 Ga0068868_100041820 Ga0068868_1000418204 181
550 3300005338 Ga0068868_100140009 Ga0068868_1001400092 181
551 3300005338 Ga0068868_100743718 Ga0068868_1007437181 181
552 3300005339 Ga0070660_100105277 Ga0070660_1001052772 181
553 3300005339 Ga0070660_100650456 Ga0070660_1006504561 181
554 3300005340 Ga0070689_100004293 Ga0070689_1000042934 181
555 3300005340 Ga0070689_100060723 Ga0070689_1000607233 181
556 3300005340 Ga0070689_100758079 Ga0070689_1007580791 181
557 3300005340 Ga0070689_100771875 Ga0070689_1007718751 181
558 3300005343 Ga0070687_100040906 Ga0070687_1000409062 181
559 3300005343 Ga0070687_100054053 Ga0070687_1000540531 181
560 3300005343 Ga0070687_100174895 Ga0070687_1001748952 181
561 3300005344 Ga0070661_100023080 Ga0070661_1000230804 181
562 3300005344 Ga0070661_100100237 Ga0070661_1001002373 181
563 3300005344 Ga0070661_100190962 Ga0070661_1001909621 181
564 3300005344 Ga0070661_100212724 Ga0070661_1002127241 181
565 3300005347 Ga0070668_100065969 Ga0070668_1000659691 181
566 3300005347 Ga0070668_100444332 Ga0070668_1004443321 181
567 3300005347 Ga0070668_100660219 Ga0070668_1006602191 181
568 3300005353 Ga0070669_100004117 Ga0070669_1000041178 181
569 3300005353 Ga0070669_100130083 Ga0070669_1001300832 181
570 3300005353 Ga0070669_100321842 Ga0070669_1003218422 181
571 3300005353 Ga0070669_100744282 Ga0070669_1007442821 181
572 3300005354 Ga0070675_100045495 Ga0070675_1000454954 181
573 3300005354 Ga0070675_100081532 Ga0070675_1000815323 181
574 3300005354 Ga0070675_100201320 Ga0070675_1002013201 181
575 3300005354 Ga0070675_100254452 Ga0070675_1002544521 181
576 3300005354 Ga0070675_100524592 Ga0070675_1005245922 181
577 3300005354 Ga0070675_101558151 Ga0070675_1015581511 181
578 3300005355 Ga0070671_100243619 Ga0070671_1002436192 181
579 3300005355 Ga0070671_100259235 Ga0070671_1002592352 181
580 3300005355 Ga0070671_100379652 Ga0070671_1003796522 181
581 3300005355 Ga0070671_100426794 Ga0070671_1004267942 181
582 3300005356 Ga0070674_100058777 Ga0070674_1000587772 181
583 3300005356 Ga0070674_100137176 Ga0070674_1001371761 181
584 3300005364 Ga0070673_100012036 Ga0070673_1000120369 181
585 3300005364 Ga0070673_100045464 Ga0070673_1000454643 181
586 3300005364 Ga0070673_100119196 Ga0070673_1001191962 181
587 3300005364 Ga0070673_100233137 Ga0070673_1002331372 181
588 3300005364 Ga0070673_101302826 Ga0070673_1013028261 181
589 3300005365 Ga0070688_100004391 Ga0070688_1000043917 181
590 3300005365 Ga0070688_100033543 Ga0070688_1000335432 181
591 3300005365 Ga0070688_100046050 Ga0070688_1000460504 181
592 3300005366 Ga0070659_100013337 Ga0070659_1000133375 181
593 3300005366 Ga0070659_100033703 Ga0070659_1000337033 181
594 3300005367 Ga0070667_100015757 Ga0070667_1000157574 181
595 3300005367 Ga0070667_100059359 Ga0070667_1000593594 181
596 3300005367 Ga0070667_100152306 Ga0070667_1001523061 181
597 3300005367 Ga0070667_100215144 Ga0070667_1002151442 181
598 3300005367 Ga0070667_100225485 Ga0070667_1002254851 181
599 3300005367 Ga0070667_100251166 Ga0070667_1002511663 181
600 3300005367 Ga0070667_100630983 Ga0070667_1006309831 181
601 3300005436 Ga0070713_100195313 Ga0070713_1001953132 181
602 3300005438 Ga0070701_10144577 Ga0070701_101445771 181
603 3300005438 Ga0070701_10171163 Ga0070701_101711632 181
604 3300005438 Ga0070701_10194481 Ga0070701_101944811 181
605 3300005441 Ga0070700_100019747 Ga0070700_1000197471 181
606 3300005445 Ga0070708_101071167 Ga0070708_1010711671 181
607 3300005455 Ga0070663_100297913 Ga0070663_1002979132 181
608 3300005456 Ga0070678_100502067 Ga0070678_1005020672 181
609 3300005456 Ga0070678_100911580 Ga0070678_1009115801 181
610 3300005456 Ga0070678_100971092 Ga0070678_1009710922 181
611 3300005456 Ga0070678_101191830 Ga0070678_1011918301 181
612 3300005457 Ga0070662_100006695 Ga0070662_10000669510 181
613 3300005457 Ga0070662_100046912 Ga0070662_1000469122 181
614 3300005457 Ga0070662_100076849 Ga0070662_1000768492 181
615 3300005457 Ga0070662_100094771 Ga0070662_1000947712 181
616 3300005457 Ga0070662_100452488 Ga0070662_1004524882 181
617 3300005459 Ga0068867_100011375 Ga0068867_1000113756 181
618 3300005459 Ga0068867_100033276 Ga0068867_1000332763 181
619 3300005459 Ga0068867_100131964 Ga0068867_1001319642 181
620 3300005459 Ga0068867_100182828 Ga0068867_1001828282 181
621 3300005459 Ga0068867_100210426 Ga0068867_1002104261 181
622 3300005459 Ga0068867_100255227 Ga0068867_1002552272 181
623 3300005459 Ga0068867_101058134 Ga0068867_1010581341 181
624 3300005466 Ga0070685_10005637 Ga0070685_100056373 181
625 3300005466 Ga0070685_10137876 Ga0070685_101378762 181
626 3300005466 Ga0070685_10269347 Ga0070685_102693473 181
627 3300005466 Ga0070685_10706283 Ga0070685_107062831 181
628 3300005471 Ga0070698_100515624 Ga0070698_1005156241 181
629 3300005530 Ga0070679_100003832 Ga0070679_1000038323 181
630 3300005530 Ga0070679_100004315 Ga0070679_10000431512 181
631 3300005535 Ga0070684_100031867 Ga0070684_1000318676 181
632 3300005535 Ga0070684_100046297 Ga0070684_1000462972 181
633 3300005539 Ga0068853_100074541 Ga0068853_1000745412 181
634 3300005539 Ga0068853_100093581 Ga0068853_1000935815 181
635 3300005539 Ga0068853_100238495 Ga0068853_1002384953 181
636 3300005539 Ga0068853_100260834 Ga0068853_1002608341 181
637 3300005539 Ga0068853_100317379 Ga0068853_1003173792 181
638 3300005543 Ga0070672_100014325 Ga0070672_1000143252 181
639 3300005543 Ga0070672_100080482 Ga0070672_1000804822 181
640 3300005543 Ga0070672_100769382 Ga0070672_1007693821 181
641 3300005543 Ga0070672_100900325 Ga0070672_1009003251 181
642 3300005544 Ga0070686_100238097 Ga0070686_1002380971 181
643 3300005545 Ga0070695_101090336 Ga0070695_1010903361 181
644 3300005547 Ga0070693_100013908 Ga0070693_1000139085 181
645 3300005547 Ga0070693_100123855 Ga0070693_1001238552 181
646 3300005548 Ga0070665_100135417 Ga0070665_1001354174 181
647 3300005548 Ga0070665_100255545 Ga0070665_1002555452 181
648 3300005563 Ga0068855_100010889 Ga0068855_1000108899 181
649 3300005564 Ga0070664_100001016 Ga0070664_1000010167 181
650 3300005564 Ga0070664_100035868 Ga0070664_1000358684 181
651 3300005564 Ga0070664_100221732 Ga0070664_1002217321 181
652 3300005564 Ga0070664_100223461 Ga0070664_1002234612 181
653 3300005564 Ga0070664_100265859 Ga0070664_1002658592 181
654 3300005564 Ga0070664_100321608 Ga0070664_1003216082 181
655 3300005564 Ga0070664_100372275 Ga0070664_1003722752 181
656 3300005564 Ga0070664_100848743 Ga0070664_1008487432 181
657 3300005564 Ga0070664_101092067 Ga0070664_1010920671 181
658 3300005577 Ga0068857_100004400 Ga0068857_1000044009 181
659 3300005577 Ga0068857_100036932 Ga0068857_1000369324 181
660 3300005577 Ga0068857_100150447 Ga0068857_1001504472 181
661 3300005577 Ga0068857_100228595 Ga0068857_1002285951 181
662 3300005577 Ga0068857_100279401 Ga0068857_1002794014 181
663 3300005577 Ga0068857_100793250 Ga0068857_1007932502 181
664 3300005577 Ga0068857_101444505 Ga0068857_1014445052 181
665 3300005578 Ga0068854_100032539 Ga0068854_1000325394 181
666 3300005614 Ga0068856_100598241 Ga0068856_1005982411 181
667 3300005615 Ga0070702_100063336 Ga0070702_1000633362 181
668 3300005615 Ga0070702_100553722 Ga0070702_1005537222 181
669 3300005616 Ga0068852_100099128 Ga0068852_1000991282 181
670 3300005616 Ga0068852_100099996 Ga0068852_1000999962 181
671 3300005616 Ga0068852_100105898 Ga0068852_1001058982 181
672 3300005616 Ga0068852_100401730 Ga0068852_1004017302 181
673 3300005616 Ga0068852_101355707 Ga0068852_1013557071 181
674 3300005617 Ga0068859_100000003 Ga0068859_10000000359 181
675 3300005617 Ga0068859_100024436 Ga0068859_1000244362 181
676 3300005617 Ga0068859_100077477 Ga0068859_1000774776 181
677 3300005617 Ga0068859_100080405 Ga0068859_1000804054 181
678 3300005617 Ga0068859_100215081 Ga0068859_1002150813 181
679 3300005617 Ga0068859_100256216 Ga0068859_1002562162 181
680 3300005617 Ga0068859_100327292 Ga0068859_1003272922 181
681 3300005618 Ga0068864_100001903 Ga0068864_10000190315 181
682 3300005618 Ga0068864_100003471 Ga0068864_1000034714 181
683 3300005618 Ga0068864_100267860 Ga0068864_1002678602 181
684 3300005618 Ga0068864_100496030 Ga0068864_1004960302 181
685 3300005618 Ga0068864_100772340 Ga0068864_1007723402 181
686 3300005618 Ga0068864_101132327 Ga0068864_1011323271 181
687 3300005718 Ga0068866_10041295 Ga0068866_100412953 181
688 3300005718 Ga0068866_10052467 Ga0068866_100524673 181
689 3300005719 Ga0068861_100002644 Ga0068861_1000026447 181
690 3300005719 Ga0068861_100304468 Ga0068861_1003044682 181
691 3300005719 Ga0068861_100320268 Ga0068861_1003202682 181
692 3300005719 Ga0068861_100540222 Ga0068861_1005402222 181
693 3300005834 Ga0068851_10068189 Ga0068851_100681892 181
694 3300005834 Ga0068851_10076574 Ga0068851_100765741 181
695 3300005834 Ga0068851_10143020 Ga0068851_101430202 181
696 3300005840 Ga0068870_10020767 Ga0068870_100207672 181
697 3300005840 Ga0068870_10607351 Ga0068870_106073512 181
698 3300005840 Ga0068870_10645997 Ga0068870_106459971 181
699 3300005841 Ga0068863_100013210 Ga0068863_1000132107 181
700 3300005841 Ga0068863_100066379 Ga0068863_1000663792 181
701 3300005841 Ga0068863_100068065 Ga0068863_1000680653 181
702 3300005841 Ga0068863_100136478 Ga0068863_1001364782 181
703 3300005841 Ga0068863_101431384 Ga0068863_1014313841 181
704 3300005842 Ga0068858_100002526 Ga0068858_1000025261 181
705 3300005842 Ga0068858_100026873 Ga0068858_1000268732 181
706 3300005842 Ga0068858_100161513 Ga0068858_1001615131 181
707 3300005842 Ga0068858_100376103 Ga0068858_1003761032 181
708 3300005843 Ga0068860_100001337 Ga0068860_1000013379 181
709 3300005843 Ga0068860_100025145 Ga0068860_1000251453 181
710 3300005843 Ga0068860_100261277 Ga0068860_1002612772 181
711 3300005843 Ga0068860_100532007 Ga0068860_1005320072 181
712 3300005844 Ga0068862_100271917 Ga0068862_1002719171 181
713 3300005985 Ga0081539_10071602 Ga0081539_100716023 181
714 3300006195 Ga0075366_10150416 Ga0075366_101504162 181
715 3300006195 Ga0075366_10218982 Ga0075366_102189822 181
716 3300006237 Ga0097621_100089565 Ga0097621_1000895652 181
717 3300006237 Ga0097621_100177327 Ga0097621_1001773272 181
718 3300006237 Ga0097621_100195925 Ga0097621_1001959252 181
719 3300006237 Ga0097621_100217765 Ga0097621_1002177653 181
720 3300006237 Ga0097621_100239640 Ga0097621_1002396402 181
721 3300006237 Ga0097621_100245783 Ga0097621_1002457832 181
722 3300006237 Ga0097621_100429327 Ga0097621_1004293271 181
723 3300006353 Ga0075370_10382708 Ga0075370_103827082 181
724 3300006358 Ga0068871_100021440 Ga0068871_1000214406 181
725 3300006358 Ga0068871_100507618 Ga0068871_1005076182 181
726 3300006358 Ga0068871_100614242 Ga0068871_1006142421 181
727 3300006358 Ga0068871_100785391 Ga0068871_1007853912 181
728 3300006358 Ga0068871_101167891 Ga0068871_1011678911 181
729 3300006358 Ga0068871_101388571 Ga0068871_1013885711 181
730 3300006871 Ga0075434_100358493 Ga0075434_1003584932 181
731 3300006871 Ga0075434_101012930 Ga0075434_1010129301 181
732 3300006880 Ga0075429_100427382 Ga0075429_1004273822 181
733 3300006881 Ga0068865_100046619 Ga0068865_1000466193 181
734 3300006881 Ga0068865_100145381 Ga0068865_1001453813 181
735 3300006931 Ga0097620_100000003 Ga0097620_10000000359 181
736 3300006931 Ga0097620_100000592 Ga0097620_10000059211 181
737 3300006931 Ga0097620_100024436 Ga0097620_1000244362 181
738 3300006931 Ga0097620_100077479 Ga0097620_1000774796 181
739 3300006931 Ga0097620_100080403 Ga0097620_1000804032 181
740 3300006931 Ga0097620_100215091 Ga0097620_1002150913 181
741 3300006931 Ga0097620_100256220 Ga0097620_1002562202 181
742 3300006931 Ga0097620_100327319 Ga0097620_1003273192 181
743 3300009093 Ga0105240_10188485 Ga0105240_101884854 181
744 3300009093 Ga0105240_10711848 Ga0105240_107118482 181
745 3300009094 Ga0111539_10033178 Ga0111539_100331783 181
746 3300009094 Ga0111539_10107847 Ga0111539_101078473 181
747 3300009094 Ga0111539_10528001 Ga0111539_105280011 181
748 3300009098 Ga0105245_10098230 Ga0105245_100982302 181
749 3300009101 Ga0105247_10009494 Ga0105247_100094944 181
750 3300009101 Ga0105247_10574370 Ga0105247_105743702 181
751 3300009101 Ga0105247_10884422 Ga0105247_108844222 181
752 3300009147 Ga0114129_10013112 Ga0114129_100131127 181
753 3300009148 Ga0105243_10062728 Ga0105243_100627282 181
754 3300009148 Ga0105243_10108870 Ga0105243_101088703 181
755 3300009174 Ga0105241_10003737 Ga0105241_100037373 181
756 3300009174 Ga0105241_10031425 Ga0105241_100314254 181
757 3300009174 Ga0105241_10230780 Ga0105241_102307802 181
758 3300009174 Ga0105241_11136750 Ga0105241_111367501 181
759 3300009176 Ga0105242_10292707 Ga0105242_102927071 181
760 3300009176 Ga0105242_10381257 Ga0105242_103812571 181
761 3300009176 Ga0105242_10420555 Ga0105242_104205552 181
762 3300009176 Ga0105242_10777338 Ga0105242_107773382 181
763 3300009176 Ga0105242_10861158 Ga0105242_108611582 181
764 3300009177 Ga0105248_11154761 Ga0105248_111547612 181
765 3300009545 Ga0105237_10017239 Ga0105237_100172393 181
766 3300009545 Ga0105237_10023760 Ga0105237_100237602 181
767 3300009545 Ga0105237_10075351 Ga0105237_100753512 181
768 3300009545 Ga0105237_11117422 Ga0105237_111174221 181
769 3300009551 Ga0105238_10009716 Ga0105238_100097167 181
770 3300009553 Ga0105249_10004606 Ga0105249_100046064 181
771 3300009553 Ga0105249_10037856 Ga0105249_100378561 181
772 3300009553 Ga0105249_10701465 Ga0105249_107014652 181
773 3300010375 Ga0105239_10004005 Ga0105239_100040058 181
774 3300010375 Ga0105239_10047256 Ga0105239_100472563 181
775 3300010375 Ga0105239_10159566 Ga0105239_101595664 181
776 3300010375 Ga0105239_10230508 Ga0105239_102305083 181
777 3300010375 Ga0105239_12081586 Ga0105239_120815861 181
778 3300011119 Ga0105246_10231064 Ga0105246_102310642 181
779 3300011119 Ga0105246_10254680 Ga0105246_102546802 181
780 3300013100 Ga0157373_10005705 Ga0157373_1000570510 181
781 3300013100 Ga0157373_10311017 Ga0157373_103110172 181
782 3300013100 Ga0157373_10322312 Ga0157373_103223122 181
783 3300013100 Ga0157373_10530749 Ga0157373_105307492 181
784 3300013102 Ga0157371_10054546 Ga0157371_100545462 181
785 3300013102 Ga0157371_10074045 Ga0157371_100740452 181
786 3300013102 Ga0157371_10120463 Ga0157371_101204633 181
787 3300013102 Ga0157371_10161428 Ga0157371_101614282 181
788 3300013102 Ga0157371_10270488 Ga0157371_102704882 181
789 3300013102 Ga0157371_10296971 Ga0157371_102969712 181
790 3300013104 Ga0157370_10136467 Ga0157370_101364672 181
791 3300013104 Ga0157370_10193606 Ga0157370_101936062 181
792 3300013104 Ga0157370_10893635 Ga0157370_108936351 181
793 3300013105 Ga0157369_10047526 Ga0157369_100475264 181
794 3300013296 Ga0157374_10003298 Ga0157374_100032985 181
795 3300013296 Ga0157374_10024775 Ga0157374_100247756 181
796 3300013296 Ga0157374_10029574 Ga0157374_100295743 181
797 3300013296 Ga0157374_10173103 Ga0157374_101731032 181
798 3300013296 Ga0157374_10499861 Ga0157374_104998612 181
799 3300013296 Ga0157374_10705089 Ga0157374_107050891 181
800 3300013297 Ga0157378_10022391 Ga0157378_100223914 181
801 3300013297 Ga0157378_10067398 Ga0157378_100673981 181
802 3300013297 Ga0157378_10082110 Ga0157378_100821102 181
803 3300013297 Ga0157378_10094708 Ga0157378_100947082 181
804 3300013297 Ga0157378_10219860 Ga0157378_102198602 181
805 3300013297 Ga0157378_10656513 Ga0157378_106565131 181
806 3300013297 Ga0157378_10747849 Ga0157378_107478492 181
807 3300013306 Ga0163162_10002078 Ga0163162_1000207812 181
808 3300013306 Ga0163162_10002386 Ga0163162_100023867 181
809 3300013306 Ga0163162_10016743 Ga0163162_100167435 181
810 3300013306 Ga0163162_10537355 Ga0163162_105373552 181
811 3300013306 Ga0163162_10854348 Ga0163162_108543482 181
812 3300013307 Ga0157372_10002594 Ga0157372_100025943 181
813 3300013307 Ga0157372_10007410 Ga0157372_100074103 181
814 3300013307 Ga0157372_10127319 Ga0157372_101273194 181
815 3300013307 Ga0157372_10153094 Ga0157372_101530943 181
816 3300013307 Ga0157372_10222669 Ga0157372_102226693 181
817 3300013307 Ga0157372_10302966 Ga0157372_103029663 181
818 3300013307 Ga0157372_10575993 Ga0157372_105759932 181
819 3300013307 Ga0157372_11867278 Ga0157372_118672781 181
820 3300013308 Ga0157375_10012111 Ga0157375_100121117 181
821 3300013308 Ga0157375_10013965 Ga0157375_100139652 181
822 3300013308 Ga0157375_10020759 Ga0157375_100207597 181
823 3300013308 Ga0157375_10176130 Ga0157375_101761302 181
824 3300013308 Ga0157375_10187243 Ga0157375_101872432 181
825 3300013308 Ga0157375_10227462 Ga0157375_102274622 181
826 3300013308 Ga0157375_10580700 Ga0157375_105807002 181
827 3300013308 Ga0157375_10746523 Ga0157375_107465231 181
828 3300013308 Ga0157375_10821450 Ga0157375_108214502 181
829 3300013308 Ga0157375_11931466 Ga0157375_119314661 181
830 3300014325 Ga0163163_10005191 Ga0163163_1000519111 181
831 3300014325 Ga0163163_10006337 Ga0163163_100063374 181
832 3300014325 Ga0163163_10096114 Ga0163163_100961145 181
833 3300014325 Ga0163163_10270072 Ga0163163_102700722 181
834 3300014325 Ga0163163_10384216 Ga0163163_103842162 181
835 3300014326 Ga0157380_10001704 Ga0157380_100017049 181
836 3300014326 Ga0157380_10007415 Ga0157380_100074153 181
837 3300014326 Ga0157380_10026790 Ga0157380_100267903 181
838 3300014326 Ga0157380_10111984 Ga0157380_101119842 181
839 3300014326 Ga0157380_11574868 Ga0157380_115748682 181
840 3300014745 Ga0157377_10007408 Ga0157377_100074083 181
841 3300014745 Ga0157377_10026538 Ga0157377_100265383 181
842 3300014745 Ga0157377_10029488 Ga0157377_100294882 181
843 3300014968 Ga0157379_10177261 Ga0157379_101772612 181
844 3300014968 Ga0157379_10555980 Ga0157379_105559802 181
845 3300014969 Ga0157376_10047974 Ga0157376_100479746 181
846 3300014969 Ga0157376_10091928 Ga0157376_100919283 181
847 3300014969 Ga0157376_10181011 Ga0157376_101810112 181
848 3300014969 Ga0157376_10512163 Ga0157376_105121631 181
849 3300014969 Ga0157376_10715014 Ga0157376_107150142 181
850 3300017792 Ga0163161_10028693 Ga0163161_100286932 181
851 3300017792 Ga0163161_10030442 Ga0163161_100304422 181
852 3300017792 Ga0163161_10398592 Ga0163161_103985922 181
853 3300017792 Ga0163161_10413297 Ga0163161_104132972 181
854 3300017792 Ga0163161_10743490 Ga0163161_107434902 181
855 3300017792 Ga0163161_10861656 Ga0163161_108616561 181
856 3300025246 Ga0209646_1002117 Ga0209646_10021174 181
857 3300025315 Ga0207697_10160686 Ga0207697_101606862 181
858 3300025321 Ga0207656_10118095 Ga0207656_101180952 181
859 3300025321 Ga0207656_10136620 Ga0207656_101366202 181
860 3300025321 Ga0207656_10242563 Ga0207656_102425631 181
861 3300025899 Ga0207642_10014577 Ga0207642_100145772 181
862 3300025899 Ga0207642_10038504 Ga0207642_100385042 181
863 3300025900 Ga0207710_10003031 Ga0207710_100030314 181
864 3300025901 Ga0207688_10187467 Ga0207688_101874671 181
865 3300025903 Ga0207680_10000385 Ga0207680_1000038516 181
866 3300025903 Ga0207680_10025294 Ga0207680_100252942 181
867 3300025904 Ga0207647_10000360 Ga0207647_1000036035 181
868 3300025904 Ga0207647_10077169 Ga0207647_100771692 181
869 3300025907 Ga0207645_10025070 Ga0207645_100250702 181
870 3300025907 Ga0207645_10086048 Ga0207645_100860482 181
871 3300025907 Ga0207645_10198770 Ga0207645_101987701 181
872 3300025908 Ga0207643_10016472 Ga0207643_100164723 181
873 3300025908 Ga0207643_10199378 Ga0207643_101993781 181
874 3300025909 Ga0207705_10155999 Ga0207705_101559992 181
875 3300025911 Ga0207654_10002893 Ga0207654_100028935 181
876 3300025911 Ga0207654_10026459 Ga0207654_100264594 181
877 3300025913 Ga0207695_10501901 Ga0207695_105019012 181
878 3300025914 Ga0207671_10001454 Ga0207671_1000145421 181
879 3300025914 Ga0207671_10134205 Ga0207671_101342053 181
880 3300025918 Ga0207662_10004557 Ga0207662_100045578 181
881 3300025918 Ga0207662_10364309 Ga0207662_103643092 181
882 3300025919 Ga0207657_10047791 Ga0207657_100477912 181
883 3300025919 Ga0207657_10104170 Ga0207657_101041702 181
884 3300025920 Ga0207649_10002808 Ga0207649_1000280810 181
885 3300025920 Ga0207649_10004375 Ga0207649_100043757 181
886 3300025920 Ga0207649_10625674 Ga0207649_106256742 181
887 3300025920 Ga0207649_10808636 Ga0207649_108086362 181
888 3300025921 Ga0207652_10000144 Ga0207652_1000014441 181
889 3300025921 Ga0207652_10025262 Ga0207652_100252622 181
890 3300025923 Ga0207681_10169560 Ga0207681_101695602 181
891 3300025925 Ga0207650_10000886 Ga0207650_100008866 181
892 3300025925 Ga0207650_10054122 Ga0207650_100541224 181
893 3300025925 Ga0207650_10390211 Ga0207650_103902112 181
894 3300025925 Ga0207650_10531116 Ga0207650_105311161 181
895 3300025926 Ga0207659_10047426 Ga0207659_100474264 181
896 3300025926 Ga0207659_10060415 Ga0207659_100604155 181
897 3300025926 Ga0207659_10143781 Ga0207659_101437812 181
898 3300025926 Ga0207659_10148180 Ga0207659_101481802 181
899 3300025926 Ga0207659_10202966 Ga0207659_102029662 181
900 3300025928 Ga0207700_10173559 Ga0207700_101735592 181
901 3300025931 Ga0207644_10189340 Ga0207644_101893402 181
902 3300025931 Ga0207644_10982591 Ga0207644_109825912 181
903 3300025932 Ga0207690_10018918 Ga0207690_100189182 181
904 3300025932 Ga0207690_10054218 Ga0207690_100542183 181
905 3300025932 Ga0207690_10422486 Ga0207690_104224861 181
906 3300025932 Ga0207690_10670583 Ga0207690_106705832 181
907 3300025933 Ga0207706_10003683 Ga0207706_100036838 181
908 3300025933 Ga0207706_10010531 Ga0207706_100105312 181
909 3300025933 Ga0207706_10017175 Ga0207706_100171755 181
910 3300025933 Ga0207706_10101041 Ga0207706_101010412 181
911 3300025934 Ga0207686_10026799 Ga0207686_100267992 181
912 3300025934 Ga0207686_10084286 Ga0207686_100842862 181
913 3300025936 Ga0207670_10006649 Ga0207670_100066494 181
914 3300025936 Ga0207670_10076842 Ga0207670_100768422 181
915 3300025936 Ga0207670_10665873 Ga0207670_106658732 181
916 3300025937 Ga0207669_10036603 Ga0207669_100366032 181
917 3300025938 Ga0207704_10059094 Ga0207704_100590944 181
918 3300025940 Ga0207691_10071677 Ga0207691_100716773 181
919 3300025942 Ga0207689_10001807 Ga0207689_100018073 181
920 3300025942 Ga0207689_10038046 Ga0207689_100380461 181
921 3300025942 Ga0207689_10061252 Ga0207689_100612524 181
922 3300025942 Ga0207689_10064252 Ga0207689_100642522 181
923 3300025942 Ga0207689_10068029 Ga0207689_100680293 181
924 3300025942 Ga0207689_10237167 Ga0207689_102371672 181
925 3300025944 Ga0207661_10044753 Ga0207661_100447532 181
926 3300025944 Ga0207661_10086625 Ga0207661_100866253 181
927 3300025944 Ga0207661_10200568 Ga0207661_102005682 181
928 3300025944 Ga0207661_10661475 Ga0207661_106614751 181
929 3300025945 Ga0207679_10035069 Ga0207679_100350692 181
930 3300025945 Ga0207679_10208287 Ga0207679_102082872 181
931 3300025945 Ga0207679_10281206 Ga0207679_102812062 181
932 3300025945 Ga0207679_10989854 Ga0207679_109898541 181
933 3300025945 Ga0207679_11203457 Ga0207679_112034571 181
934 3300025945 Ga0207679_11487137 Ga0207679_114871371 181
935 3300025949 Ga0207667_10897767 Ga0207667_108977672 181
936 3300025960 Ga0207651_10010650 Ga0207651_100106502 181
937 3300025960 Ga0207651_10012494 Ga0207651_100124944 181
938 3300025960 Ga0207651_10037783 Ga0207651_100377833 181
939 3300025960 Ga0207651_10377263 Ga0207651_103772632 181
940 3300025960 Ga0207651_11170251 Ga0207651_111702511 181
941 3300025961 Ga0207712_10250565 Ga0207712_102505651 181
942 3300025961 Ga0207712_10608735 Ga0207712_106087352 181
943 3300025972 Ga0207668_10284483 Ga0207668_102844832 181
944 3300025972 Ga0207668_10422123 Ga0207668_104221231 181
945 3300025972 Ga0207668_10560571 Ga0207668_105605711 181
946 3300025981 Ga0207640_10094771 Ga0207640_100947712 181
947 3300025981 Ga0207640_10588963 Ga0207640_105889631 181
948 3300025981 Ga0207640_10741026 Ga0207640_107410262 181
949 3300025981 Ga0207640_10820015 Ga0207640_108200151 181
950 3300025986 Ga0207658_10010035 Ga0207658_100100357 181
951 3300025986 Ga0207658_10015647 Ga0207658_100156475 181
952 3300025986 Ga0207658_10085836 Ga0207658_100858362 181
953 3300025986 Ga0207658_10533184 Ga0207658_105331841 181
954 3300025986 Ga0207658_10902826 Ga0207658_109028262 181
955 3300026023 Ga0207677_10034608 Ga0207677_100346083 181
956 3300026023 Ga0207677_10121384 Ga0207677_101213842 181
957 3300026023 Ga0207677_10402460 Ga0207677_104024601 181
958 3300026023 Ga0207677_10469216 Ga0207677_104692161 181
959 3300026035 Ga0207703_10011653 Ga0207703_100116534 181
960 3300026035 Ga0207703_10166753 Ga0207703_101667532 181
961 3300026035 Ga0207703_10171092 Ga0207703_101710922 181
962 3300026035 Ga0207703_10173298 Ga0207703_101732982 181
963 3300026035 Ga0207703_10353098 Ga0207703_103530981 181
964 3300026035 Ga0207703_11219852 Ga0207703_112198521 181
965 3300026041 Ga0207639_10017754 Ga0207639_100177548 181
966 3300026041 Ga0207639_10193318 Ga0207639_101933183 181
967 3300026041 Ga0207639_10274230 Ga0207639_102742303 181
968 3300026041 Ga0207639_10517415 Ga0207639_105174152 181
969 3300026067 Ga0207678_10013249 Ga0207678_100132496 181
970 3300026067 Ga0207678_10473976 Ga0207678_104739762 181
971 3300026075 Ga0207708_10270332 Ga0207708_102703322 181
972 3300026075 Ga0207708_10277100 Ga0207708_102771002 181
973 3300026078 Ga0207702_10096906 Ga0207702_100969062 181
974 3300026078 Ga0207702_10833731 Ga0207702_108337311 181
975 3300026088 Ga0207641_10000026 Ga0207641_1000002651 181
976 3300026088 Ga0207641_10176113 Ga0207641_101761132 181
977 3300026088 Ga0207641_11260860 Ga0207641_112608602 181
978 3300026089 Ga0207648_10001213 Ga0207648_1000121325 181
979 3300026089 Ga0207648_10007648 Ga0207648_100076488 181
980 3300026089 Ga0207648_10014790 Ga0207648_100147904 181
981 3300026089 Ga0207648_10257316 Ga0207648_102573161 181
982 3300026089 Ga0207648_10341461 Ga0207648_103414611 181
983 3300026089 Ga0207648_10435514 Ga0207648_104355141 181
984 3300026095 Ga0207676_10003733 Ga0207676_1000373311 181
985 3300026095 Ga0207676_10110561 Ga0207676_101105612 181
986 3300026095 Ga0207676_10165085 Ga0207676_101650852 181
987 3300026095 Ga0207676_10250562 Ga0207676_102505622 181
988 3300026095 Ga0207676_10828548 Ga0207676_108285481 181
989 3300026116 Ga0207674_10001740 Ga0207674_1000174022 181
990 3300026116 Ga0207674_10035333 Ga0207674_100353335 181
991 3300026116 Ga0207674_10045794 Ga0207674_100457942 181
992 3300026116 Ga0207674_10074285 Ga0207674_100742851 181
993 3300026116 Ga0207674_10164728 Ga0207674_101647282 181
994 3300026116 Ga0207674_10394279 Ga0207674_103942792 181
995 3300026116 Ga0207674_10525345 Ga0207674_105253452 181
996 3300026116 Ga0207674_11371301 Ga0207674_113713011 181
997 3300026118 Ga0207675_100022617 Ga0207675_1000226175 181
998 3300026118 Ga0207675_100109559 Ga0207675_1001095593 181
999 3300026118 Ga0207675_100155014 Ga0207675_1001550142 181
1000 3300026118 Ga0207675_100306487 Ga0207675_1003064872 181
1001 3300026118 Ga0207675_100409708 Ga0207675_1004097082 181
1002 3300026121 Ga0207683_10025008 Ga0207683_100250082 181
1003 3300026121 Ga0207683_10218066 Ga0207683_102180661 181
1004 3300026121 Ga0207683_10682986 Ga0207683_106829862 181
1005 3300026121 Ga0207683_10718741 Ga0207683_107187412 181
1006 3300026142 Ga0207698_10000830 Ga0207698_100008307 181
1007 3300026142 Ga0207698_10138597 Ga0207698_101385972 181
1008 3300026142 Ga0207698_10359489 Ga0207698_103594892 181
1009 3300026142 Ga0207698_10392394 Ga0207698_103923942 181
1010 3300026142 Ga0207698_10483843 Ga0207698_104838431 181
1011 3300026142 Ga0207698_10535157 Ga0207698_105351571 181
1012 3300026142 Ga0207698_10859186 Ga0207698_108591861 181
1013 3300026142 Ga0207698_11613923 Ga0207698_116139231 181
1014 3300026142 Ga0207698_11801735 Ga0207698_118017351 181
1015 3300027543 Ga0209999_1058914 Ga0209999_10589142 181
1016 3300027876 Ga0209974_10022087 Ga0209974_100220873 181
1017 3300027907 Ga0207428_10074787 Ga0207428_100747873 181
1018 3300028379 Ga0268266_10081492 Ga0268266_100814922 181
1019 3300028380 Ga0268265_10329942 Ga0268265_103299422 181
1020 3300028381 Ga0268264_10001210 Ga0268264_1000121012 181
1021 3300028381 Ga0268264_10002077 Ga0268264_1000207715 181
1022 3300028381 Ga0268264_10251916 Ga0268264_102519162 181
1023 3300028381 Ga0268264_10389131 Ga0268264_103891312 181
1024 3300028794 Ga0307515_10001389 Ga0307515_100013894 181
1025 3300028794 Ga0307515_10513749 Ga0307515_105137492 181
1026 3300031247 Ga0265340_10064939 Ga0265340_100649392 181
1027 3300031250 Ga0265331_10244831 Ga0265331_102448311 181
1028 3300031251 Ga0265327_10000013 Ga0265327_10000013412 181
1029 3300031456 Ga0307513_10082237 Ga0307513_100822375 181
1030 3300031456 Ga0307513_10573527 Ga0307513_105735271 181
1031 3300031456 Ga0307513_10783611 Ga0307513_107836111 181
1032 3300031616 Ga0307508_10000111 Ga0307508_1000011141 181
1033 3300031711 Ga0265314_10058741 Ga0265314_100587413 181
1034 3300032004 Ga0307414_10183423 Ga0307414_101834232 181
1035 3300032004 Ga0307414_10473802 Ga0307414_104738022 181
1036 3300033180 Ga0307510_10001684 Ga0307510_1000168412 181
1037 3300035086 Ga0373934_0019498 Ga0373934_0019498_105_656 181
1038 3300035111 Ga0373923_0438285 Ga0373923_0438285_47_598 181
1039 3300035120 Ga0373957_0110685 Ga0373957_0110685_509_1060 181
1040 3300035410 Ga0373924_0010674 Ga0373924_0010674_226_777 181
1041 3300035724 Ga0373933_0270837 Ga0373933_0270837_128_679 181
1042 3300036401 Ga0373937_0068823 Ga0373937_0068823_2487_3038 181
1043 3300036401 Ga0373937_0200324 Ga0373937_0200324_1271_1816 181
1044 3300037068 Ga0373925_0470400 Ga0373925_0470400_417_962 181
1045 3300037312 Ga0395899_0020958 Ga0395899_0020958_927_1475 181
1046 3300037312 Ga0395899_0322872 Ga0395899_0322872_141_689 181
1047 3300037418 Ga0395900_0056510 Ga0395900_0056510_581_1129 181
1048 3300037418 Ga0395900_0128740 Ga0395900_0128740_1500_2048 181
1049 3300037466 Ga0395898_0020188 Ga0395898_0020188_2865_3413 181
1050 3300038443 Ga0395901_0025466 Ga0395901_0025466_1176_1724 181
1051 3300039437 Ga0436365_0497393 Ga0436365_0497393_155_700 181
1052 3300041404 Ga0439436_0012141 Ga0439436_0012141_1661_2206 181
1053 3300041406 Ga0439439_0024462 Ga0439439_0024462_350_895 181
1054 3300041406 Ga0439439_0054428 Ga0439439_0054428_40_585 181
1055 3300041456 Ga0451795_0085537 Ga0451795_0085537_448_993 181
1056 3300041491 Ga0451833_0278687 Ga0451833_0278687_43_588 181
1057 3300041496 Ga0451839_1215289 Ga0451839_1215289_46_597 181
1058 3300041507 Ga0451851_0050209 Ga0451851_0050209_513_1058 181
1059 3300041997 Ga0439431_0194051 Ga0439431_0194051_23_568 181
1060 3300042007 Ga0439449_0021289 Ga0439449_0021289_1095_1640 181
1061 3300042007 Ga0439449_0058701 Ga0439449_0058701_762_1307 181
1062 3300042007 Ga0439449_0105950 Ga0439449_0105950_250_795 181
1063 3300042014 Ga0439457_013480 Ga0439457_013480_563_1108 181
1064 3300042014 Ga0439457_035535 Ga0439457_035535_89_634 181
1065 3300042014 Ga0439457_070358 Ga0439457_070358_14_559 181
1066 3300042014 Ga0439457_121145 Ga0439457_121145_37_582 181
1067 3300044658 Ga0466972_0000080 Ga0466972_0000080_16148_16693 181
1068 3300044658 Ga0466972_0042617 Ga0466972_0042617_1053_1598 181
1069 3300044684 Ga0466966_0000096 Ga0466966_0000096_26291_26836 181
1070 3300044712 Ga0453684_0019697 Ga0453684_0019697_5619_6164 181
1071 3300044735 Ga0466968_0024425 Ga0466968_0024425_95_640 181
1072 3300044735 Ga0466968_0084148 Ga0466968_0084148_683_1228 181
1073 3300044735 Ga0466968_0112026 Ga0466968_0112026_142_687 181
1074 3300044765 Ga0466970_0580314 Ga0466970_0580314_18_563 181
1075 3300044842 Ga0466957_0001278 Ga0466957_0001278_6944_7489 181
1076 3300044842 Ga0466957_0147062 Ga0466957_0147062_842_1387 181
1077 3300045049 Ga0466959_0000014 Ga0466959_0000014_30489_31034 181
1078 3300045051 Ga0451576_0168670 Ga0451576_0168670_334_879 181
1079 3300045051 Ga0451576_0493688 Ga0451576_0493688_358_903 181
1080 3300046460 Ga0495638_0091661 Ga0495638_0091661_799_1344 181
1081 3300046463 Ga0495653_0046892 Ga0495653_0046892_2605_3156 181
1082 3300046471 Ga0495650_0014644 Ga0495650_0014644_1154_1699 181
1083 3300046473 Ga0495582_0317533 Ga0495582_0317533_81_632 181
1084 3300046516 Ga0495628_0288377 Ga0495628_0288377_418_969 181
1085 3300046517 Ga0495630_0534010 Ga0495630_0534010_222_773 181
1086 3300046543 Ga0495645_0232387 Ga0495645_0232387_163_714 181
1087 3300046559 Ga0495667_0038657 Ga0495667_0038657_1149_1700 181
1088 3300046616 Ga0495668_0003219 Ga0495668_0003219_8453_8998 181
1089 3300046642 Ga0495634_0043429 Ga0495634_0043429_2169_2720 181
1090 3300046660 Ga0495625_0650538 Ga0495625_0650538_18_563 181
1091 3300046663 Ga0495635_0245531 Ga0495635_0245531_149_700 181
1092 3300046675 Ga0495657_0173641 Ga0495657_0173641_765_1316 181
1093 3300046678 Ga0495599_0073930 Ga0495599_0073930_136_687 181
1094 3300046689 Ga0495613_0212328 Ga0495613_0212328_758_1309 181
1095 3300047315 Ga0495581_0304871 Ga0495581_0304871_117_785 181
1096 3300047319 Ga0495674_0035491 Ga0495674_0035491_151_702 181
1097 3300047320 Ga0495672_0009163 Ga0495672_0009163_973_1518 181
1098 3300047320 Ga0495672_0014024 Ga0495672_0014024_2484_3029 181
1099 3300047321 Ga0495676_0144496 Ga0495676_0144496_102_653 181
1100 3300047322 Ga0495680_0082504 Ga0495680_0082504_753_1304 181
1101 3300047471 Ga0495684_0150059 Ga0495684_0150059_162_713 181
1102 3300047471 Ga0495684_0413791 Ga0495684_0413791_154_699 181
1103 3300048903 Ga0496100_0484399 Ga0496100_0484399_120_671 181
1104 3300048904 Ga0496101_1150944 Ga0496101_1150944_32_583 181
1105 3300048910 Ga0496107_0736356 Ga0496107_0736356_107_658 181
1106 3300048913 Ga0496110_0031968 Ga0496110_0031968_3748_4323 181
1107 3300048915 Ga0496112_0269226 Ga0496112_0269226_625_1200 181
1108 3300049513 Ga0501290_001460 Ga0501290_001460_896_1441 181
1109 3300049519 Ga0501296_024522 Ga0501296_024522_133_678 181
1110 3300049521 Ga0501298_003874 Ga0501298_003874_1259_1804 181
1111 3300049569 Ga0501032_0063789 Ga0501032_0063789_967_1512 181
1112 3300049570 Ga0501033_0201147 Ga0501033_0201147_26_577 181
1113 3300049571 Ga0501034_0000152 Ga0501034_0000152_86764_87315 181
1114 3300049571 Ga0501034_0011131 Ga0501034_0011131_7973_8518 181
1115 3300049571 Ga0501034_0068545 Ga0501034_0068545_1836_2381 181
1116 3300049571 Ga0501034_0687373 Ga0501034_0687373_93_638 181
1117 3300049572 Ga0501036_0000845 Ga0501036_0000845_19467_20012 181
1118 3300049572 Ga0501036_0877770 Ga0501036_0877770_64_609 181
1119 3300049572 Ga0501036_1185225 Ga0501036_1185225_68_613 181
1120 3300049573 Ga0501037_0006935 Ga0501037_0006935_4143_4688 181
1121 3300049573 Ga0501037_0517378 Ga0501037_0517378_179_724 181
1122 3300049574 Ga0501038_0037776 Ga0501038_0037776_1302_1847 181
1123 3300049575 Ga0501039_0012691 Ga0501039_0012691_5327_5872 181
1124 3300049579 Ga0501043_0005938 Ga0501043_0005938_7973_8518 181
1125 3300049579 Ga0501043_0154073 Ga0501043_0154073_386_931 181
1126 3300049579 Ga0501043_0292015 Ga0501043_0292015_10_555 181
1127 3300049580 Ga0501046_0045889 Ga0501046_0045889_883_1428 181
1128 3300049581 Ga0501047_0061465 Ga0501047_0061465_1794_2339 181
1129 3300049581 Ga0501047_0099646 Ga0501047_0099646_132_677 181
1130 3300049581 Ga0501047_0532496 Ga0501047_0532496_196_741 181
1131 3300049582 Ga0501048_0007829 Ga0501048_0007829_6029_6574 181
1132 3300049584 Ga0501068_0038801 Ga0501068_0038801_1288_1833 181
1133 3300049586 Ga0501070_0003721 Ga0501070_0003721_8178_8723 181
1134 3300049589 Ga0501073_0065635 Ga0501073_0065635_416_961 181
1135 3300049590 Ga0501074_0000310 Ga0501074_0000310_22437_22982 181
1136 3300049652 Ga0501202_000352 Ga0501202_000352_1431_1976 181
1137 3300049653 Ga0501206_002631 Ga0501206_002631_1649_2194 181
1138 3300049654 Ga0501207_001265 Ga0501207_001265_1832_2377 181
1139 3300049661 Ga0501217_000979 Ga0501217_000979_1541_2086 181
1140 3300049662 Ga0501222_001624 Ga0501222_001624_1099_1644 181
1141 3300049663 Ga0501223_001473 Ga0501223_001473_1874_2419 181
1142 3300049664 Ga0501224_001055 Ga0501224_001055_1219_1764 181
1143 3300049668 Ga0501233_002017 Ga0501233_002017_1161_1706 181
1144 3300049669 Ga0501235_000033 Ga0501235_000033_1219_1764 181
1145 3300049673 Ga0501240_003815 Ga0501240_003815_202_747 181
1146 3300049674 Ga0501242_000410 Ga0501242_000410_1344_1889 181
1147 3300049675 Ga0501243_005195 Ga0501243_005195_1103_1648 181
1148 3300049679 Ga0501249_066909 Ga0501249_066909_234_779 181
1149 3300049682 Ga0501252_025281 Ga0501252_025281_48_593 181
1150 3300049686 Ga0501257_003324 Ga0501257_003324_1758_2303 181
1151 3300049688 Ga0501259_001910 Ga0501259_001910_1303_1848 181
1152 3300049690 Ga0501261_001114 Ga0501261_001114_869_1414 181
1153 3300049704 Ga0501221_000390 Ga0501221_000390_5002_5547 181
1154 3300049705 Ga0501225_0001669 Ga0501225_0001669_936_1481 181
1155 3300049705 Ga0501225_0002369 Ga0501225_0002369_318_863 181
1156 3300049706 Ga0501229_016862 Ga0501229_016862_141_686 181
1157 3300049706 Ga0501229_033920 Ga0501229_033920_127_672 181
1158 3300049707 Ga0501234_002103 Ga0501234_002103_1035_1580 181
1159 3300049708 Ga0501245_001585 Ga0501245_001585_1104_1649 181
1160 3300049741 Ga0501079_0012410 Ga0501079_0012410_3960_4505 181
1161 3300049742 Ga0501080_0075085 Ga0501080_0075085_2184_2729 181
1162 3300049742 Ga0501080_0535982 Ga0501080_0535982_98_643 181
1163 3300049744 Ga0501083_0059502 Ga0501083_0059502_557_1102 181
1164 3300049757 Ga0501232_006551 Ga0501232_006551_337_882 181
1165 3300049761 Ga0501264_001553 Ga0501264_001553_1576_2121 181
1166 3300049765 Ga0501268_085470 Ga0501268_085470_46_591 181
1167 3300049767 Ga0501270_054774 Ga0501270_054774_121_666 181
1168 3300049768 Ga0501271_000833 Ga0501271_000833_1491_2036 181
1169 3300049775 Ga0501279_003477 Ga0501279_003477_1496_2041 181
1170 3300049776 Ga0501280_040657 Ga0501280_040657_134_679 181
1171 3300049822 Ga0501035_0001685 Ga0501035_0001685_369_914 181
1172 3300049822 Ga0501035_0215869 Ga0501035_0215869_693_1238 181
1173 3300049822 Ga0501035_0221868 Ga0501035_0221868_232_777 181
1174 3300049823 Ga0501044_0001606 Ga0501044_0001606_21420_21965 181
1175 3300049823 Ga0501044_0116978 Ga0501044_0116978_1061_1606 181
1176 3300049823 Ga0501044_0222518 Ga0501044_0222518_127_672 181
1177 3300049824 Ga0501045_0015281 Ga0501045_0015281_865_1410 181
1178 3300049851 Ga0501212_000830 Ga0501212_000830_1572_2117 181
1179 3300050493 nmdc:mga0k408_147843_c1 nmdc:mga0k408_147843_c1_31_576 181
1180 3300050496 nmdc:mga07m45_362465_c1 nmdc:mga07m45_362465_c1_98_643 181
1181 3300050507 nmdc:mga05p37_3268_c1 nmdc:mga05p37_3268_c1_13807_14352 181
1182 3300050511 nmdc:mga08y16_111150_c1 nmdc:mga08y16_111150_c1_310_855 181
1183 3300050511 nmdc:mga08y16_415625_c1 nmdc:mga08y16_415625_c1_82_627 181
1184 3300050511 nmdc:mga08y16_513560_c1 nmdc:mga08y16_513560_c1_468_1013 181
1185 3300050512 nmdc:mga0n895_1385888_c1 nmdc:mga0n895_1385888_c1_90_635 181
1186 3300050512 nmdc:mga0n895_351149_c1 nmdc:mga0n895_351149_c1_223_768 181
1187 3300050512 nmdc:mga0n895_890779_c1 nmdc:mga0n895_890779_c1_311_862 181
1188 3300053086 Ga0500578_0000325 Ga0500578_0000325_40912_41457 181
1189 3300053086 Ga0500578_0448195 Ga0500578_0448195_105_650 181
1190 3300053088 Ga0500644_0028140 Ga0500644_0028140_1072_1617 181
1191 3300053090 Ga0500646_0258448 Ga0500646_0258448_54_599 181
1192 3300053092 Ga0500583_0000001 Ga0500583_0000001_21268_21813 181
1193 3300053092 Ga0500583_0000611 Ga0500583_0000611_2641_3186 181
1194 3300053096 Ga0500641_0036500 Ga0500641_0036500_839_1384 181
1195 3300053098 Ga0500650_0064328 Ga0500650_0064328_494_1039 181
1196 3300053098 Ga0500650_0084187 Ga0500650_0084187_325_870 181
1197 3300053118 Ga0500594_0028447 Ga0500594_0028447_266_811 181
1198 3300053131 Ga0500652_106860 Ga0500652_106860_374_919 181
1199 3300053134 Ga0500658_0099186 Ga0500658_0099186_381_926 181
1200 3300053136 Ga0500559_0147057 Ga0500559_0147057_176_721 181
1201 3300053139 Ga0500568_0000380 Ga0500568_0000380_18378_18923 181
1202 3300053146 Ga0500588_0121823 Ga0500588_0121823_232_777 181
1203 3300053153 Ga0500616_0092276 Ga0500616_0092276_865_1410 181
1204 3300053156 Ga0500622_0009755 Ga0500622_0009755_549_1094 181
1205 3300053156 Ga0500622_0069751 Ga0500622_0069751_875_1420 181
1206 3300053163 Ga0500639_017671 Ga0500639_017671_1569_2120 181
1207 3300053727 Ga0500611_000003 Ga0500611_000003_210432_210977 181
1208 3300054114 Ga0501084_0080337 Ga0501084_0080337_1302_1847 181

Feature Viewer

pLDDT pTM Quality
71.85 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map