F491686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1208 | 365 | 1203 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10080924|Ga0157379_100809243 |
| Length | 178 |
| Sequence | MDQLTLGIGTRLQHTQYGPGVIVGVKYATYLISFINHGVKEIDKNDPKLDEIIPENVTEEIETHSAMEKSLLKILRLWSDSNEIIPLGDRWVGGTMILPKDNSQKPKELPIEAFFHKIVMLRDRLRVMEQQINAHKQMSDEEKINLQQYITRIYGTLTTFNVLFKNKEHWFVGDKSES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 4 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 5 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 6 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 7 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 8 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 218 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 219 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 224 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 225 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 228 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 229 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 280 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 281 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 300 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 301 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 302 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 303 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 304 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 309 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 311 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 313 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 315 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 319 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 321 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 327 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 329 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 330 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 333 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 334 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 339 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 348 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 350 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 353 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 356 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 362 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 363 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.9 |
| Nodule | 0 |
| Rhizoplane | 1.08 |
| Rhizosphere | 93.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_6238227 | 2162886011 | Bacteria | 1106 |
| 2 | CNXas_1002007 | 3300000545 | Bacteria | 1393 |
| 3 | JGI24736J21556_1043293 | 3300001904 | Bacteria | 692 |
| 4 | JGI24751J29686_10001558 | 3300002459 | Bacteria | 4737 |
| 5 | rootL2_10060567 | 3300003322 | Bacteria | 4742 |
| 6 | rootL2_10236104 | 3300003322 | Bacteria | 1901 |
| 7 | rootH1_10224374 | 3300003323 | Bacteria | 4107 |
| 8 | rootH1_10383519 | 3300003323 | Bacteria | 1342 |
| 9 | JGI25160J50197_1005120 | 3300003354 | Bacteria | 5517 |
| 10 | Ga0065714_10125551 | 3300005288 | Bacteria | 1299 |
| 11 | Ga0065714_10171058 | 3300005288 | Bacteria | 1004 |
| 12 | Ga0065704_10124374 | 3300005289 | Bacteria | 1718 |
| 13 | Ga0065712_10006449 | 3300005290 | Bacteria | 7351 |
| 14 | Ga0065712_10009365 | 3300005290 | Bacteria | 3927 |
| 15 | Ga0065712_10094617 | 3300005290 | Bacteria | 2248 |
| 16 | Ga0065712_10118315 | 3300005290 | Bacteria | 1708 |
| 17 | Ga0065712_10144144 | 3300005290 | Unclassified | 1423 |
| 18 | Ga0065715_10021010 | 3300005293 | Bacteria | 1417 |
| 19 | Ga0065715_10328789 | 3300005293 | Bacteria | 965 |
| 20 | Ga0065715_10541247 | 3300005293 | Bacteria | 748 |
| 21 | Ga0065707_10166820 | 3300005295 | Unclassified | 1515 |
| 22 | Ga0065707_10505871 | 3300005295 | Bacteria | 753 |
| 23 | Ga0070658_10159764 | 3300005327 | Unclassified | 1890 |
| 24 | Ga0070658_10487147 | 3300005327 | Bacteria | 1064 |
| 25 | Ga0070658_10549608 | 3300005327 | Bacteria | 999 |
| 26 | Ga0070676_10017601 | 3300005328 | Bacteria | 3955 |
| 27 | Ga0070676_10124852 | 3300005328 | Unclassified | 1620 |
| 28 | Ga0070676_10151051 | 3300005328 | Unclassified | 1487 |
| 29 | Ga0070676_10488270 | 3300005328 | Bacteria | 872 |
| 30 | Ga0070683_100065604 | 3300005329 | Bacteria | 3380 |
| 31 | Ga0070683_100099212 | 3300005329 | Unclassified | 2741 |
| 32 | Ga0070683_100147044 | 3300005329 | Bacteria | 2233 |
| 33 | Ga0070683_100215793 | 3300005329 | Bacteria | 1823 |
| 34 | Ga0070683_100265676 | 3300005329 | Bacteria | 1632 |
| 35 | Ga0070683_100303162 | 3300005329 | Bacteria | 1520 |
| 36 | Ga0070683_100326036 | 3300005329 | Bacteria | 1462 |
| 37 | Ga0070683_100387773 | 3300005329 | Bacteria | 1332 |
| 38 | Ga0070690_100006178 | 3300005330 | Bacteria | 6789 |
| 39 | Ga0070690_100108460 | 3300005330 | Unclassified | 1850 |
| 40 | Ga0070670_100033314 | 3300005331 | Bacteria | 4437 |
| 41 | Ga0070670_100053900 | 3300005331 | Bacteria | 3453 |
| 42 | Ga0070670_100056071 | 3300005331 | Unclassified | 3382 |
| 43 | Ga0070670_100203577 | 3300005331 | Bacteria | 1720 |
| 44 | Ga0070670_100291144 | 3300005331 | Bacteria | 1427 |
| 45 | Ga0070670_100297151 | 3300005331 | Bacteria | 1412 |
| 46 | Ga0070670_100415457 | 3300005331 | Bacteria | 1189 |
| 47 | Ga0070670_100532854 | 3300005331 | Unclassified | 1046 |
| 48 | Ga0070677_10107602 | 3300005333 | Bacteria | 1240 |
| 49 | Ga0070677_10155260 | 3300005333 | Bacteria | 1069 |
| 50 | Ga0070677_10193841 | 3300005333 | Bacteria | 976 |
| 51 | Ga0068869_100012053 | 3300005334 | Bacteria | 5696 |
| 52 | Ga0068869_100030779 | 3300005334 | Unclassified | 3770 |
| 53 | Ga0068869_100052211 | 3300005334 | Unclassified | 2968 |
| 54 | Ga0068869_100057639 | 3300005334 | Unclassified | 2836 |
| 55 | Ga0068869_100084081 | 3300005334 | Bacteria | 2381 |
| 56 | Ga0068869_100089243 | 3300005334 | Bacteria | 2315 |
| 57 | Ga0068869_100120852 | 3300005334 | Bacteria | 2003 |
| 58 | Ga0068869_100248911 | 3300005334 | Bacteria | 1419 |
| 59 | Ga0070666_10000126 | 3300005335 | Bacteria | 53667 |
| 60 | Ga0070666_10111370 | 3300005335 | Bacteria | 1893 |
| 61 | Ga0070666_10155207 | 3300005335 | Unclassified | 1598 |
| 62 | Ga0070666_10330912 | 3300005335 | Bacteria | 1088 |
| 63 | Ga0070666_10483350 | 3300005335 | Bacteria | 897 |
| 64 | Ga0070680_100002240 | 3300005336 | Bacteria | 14265 |
| 65 | Ga0070680_100050135 | 3300005336 | Bacteria | 3404 |
| 66 | Ga0070680_100257059 | 3300005336 | Bacteria | 1477 |
| 67 | Ga0070682_100071311 | 3300005337 | Unclassified | 2223 |
| 68 | Ga0068868_100002609 | 3300005338 | Bacteria | 12495 |
| 69 | Ga0068868_100028711 | 3300005338 | Bacteria | 4256 |
| 70 | Ga0068868_100041820 | 3300005338 | Bacteria | 3572 |
| 71 | Ga0068868_100140009 | 3300005338 | Bacteria | 1985 |
| 72 | Ga0068868_100216883 | 3300005338 | Bacteria | 1601 |
| 73 | Ga0068868_100225796 | 3300005338 | Unclassified | 1569 |
| 74 | Ga0068868_100251313 | 3300005338 | Bacteria | 1488 |
| 75 | Ga0068868_100743718 | 3300005338 | Bacteria | 881 |
| 76 | Ga0070660_100000831 | 3300005339 | Bacteria | 20517 |
| 77 | Ga0070660_100042698 | 3300005339 | Bacteria | 3462 |
| 78 | Ga0070660_100084233 | 3300005339 | Bacteria | 2498 |
| 79 | Ga0070660_100105277 | 3300005339 | Unclassified | 2239 |
| 80 | Ga0070660_100650456 | 3300005339 | Bacteria | 883 |
| 81 | Ga0070689_100004293 | 3300005340 | Bacteria | 9615 |
| 82 | Ga0070689_100060723 | 3300005340 | Unclassified | 2940 |
| 83 | Ga0070689_100108699 | 3300005340 | Bacteria | 2203 |
| 84 | Ga0070689_100193489 | 3300005340 | Bacteria | 1657 |
| 85 | Ga0070689_100756481 | 3300005340 | Bacteria | 852 |
| 86 | Ga0070689_100758079 | 3300005340 | Bacteria | 851 |
| 87 | Ga0070689_100771875 | 3300005340 | Bacteria | 844 |
| 88 | Ga0070687_100008161 | 3300005343 | Bacteria | 4416 |
| 89 | Ga0070687_100011272 | 3300005343 | Bacteria | 3906 |
| 90 | Ga0070687_100040906 | 3300005343 | Unclassified | 2338 |
| 91 | Ga0070687_100054053 | 3300005343 | Bacteria | 2091 |
| 92 | Ga0070687_100174895 | 3300005343 | Bacteria | 1281 |
| 93 | Ga0070661_100023080 | 3300005344 | Unclassified | 4458 |
| 94 | Ga0070661_100100237 | 3300005344 | Unclassified | 2153 |
| 95 | Ga0070661_100190962 | 3300005344 | Bacteria | 1562 |
| 96 | Ga0070661_100212724 | 3300005344 | Bacteria | 1480 |
| 97 | Ga0070668_100065969 | 3300005347 | Bacteria | 2808 |
| 98 | Ga0070668_100118774 | 3300005347 | Bacteria | 2111 |
| 99 | Ga0070668_100346484 | 3300005347 | Bacteria | 1256 |
| 100 | Ga0070668_100444332 | 3300005347 | Bacteria | 1114 |
| 101 | Ga0070668_100470631 | 3300005347 | Unclassified | 1084 |
| 102 | Ga0070668_100660219 | 3300005347 | Bacteria | 919 |
| 103 | Ga0070669_100004117 | 3300005353 | Bacteria | 10547 |
| 104 | Ga0070669_100070003 | 3300005353 | Bacteria | 2592 |
| 105 | Ga0070669_100130083 | 3300005353 | Bacteria | 1930 |
| 106 | Ga0070669_100321842 | 3300005353 | Unclassified | 1249 |
| 107 | Ga0070669_100744282 | 3300005353 | Bacteria | 830 |
| 108 | Ga0070669_100788598 | 3300005353 | Unclassified | 807 |
| 109 | Ga0070675_100045495 | 3300005354 | Bacteria | 3591 |
| 110 | Ga0070675_100060386 | 3300005354 | Bacteria | 3130 |
| 111 | Ga0070675_100081532 | 3300005354 | Bacteria | 2698 |
| 112 | Ga0070675_100201320 | 3300005354 | Bacteria | 1728 |
| 113 | Ga0070675_100254452 | 3300005354 | Unclassified | 1538 |
| 114 | Ga0070675_100450817 | 3300005354 | Bacteria | 1154 |
| 115 | Ga0070675_100524592 | 3300005354 | Unclassified | 1069 |
| 116 | Ga0070675_101558151 | 3300005354 | Bacteria | 609 |
| 117 | Ga0070671_100002262 | 3300005355 | Bacteria | 14867 |
| 118 | Ga0070671_100078810 | 3300005355 | Unclassified | 2753 |
| 119 | Ga0070671_100243619 | 3300005355 | Unclassified | 1526 |
| 120 | Ga0070671_100259235 | 3300005355 | Bacteria | 1477 |
| 121 | Ga0070671_100379652 | 3300005355 | Bacteria | 1208 |
| 122 | Ga0070671_100426794 | 3300005355 | Bacteria | 1136 |
| 123 | Ga0070674_100058777 | 3300005356 | Bacteria | 2674 |
| 124 | Ga0070674_100137176 | 3300005356 | Unclassified | 1831 |
| 125 | Ga0070673_100012036 | 3300005364 | Bacteria | 5926 |
| 126 | Ga0070673_100019242 | 3300005364 | Bacteria | 4900 |
| 127 | Ga0070673_100045464 | 3300005364 | Bacteria | 3405 |
| 128 | Ga0070673_100119196 | 3300005364 | Unclassified | 2199 |
| 129 | Ga0070673_100233137 | 3300005364 | Bacteria | 1598 |
| 130 | Ga0070673_101302826 | 3300005364 | Bacteria | 682 |
| 131 | Ga0070688_100004391 | 3300005365 | Bacteria | 7330 |
| 132 | Ga0070688_100033543 | 3300005365 | Unclassified | 3104 |
| 133 | Ga0070688_100046050 | 3300005365 | Unclassified | 2699 |
| 134 | Ga0070688_100092801 | 3300005365 | Bacteria | 1975 |
| 135 | Ga0070659_100013337 | 3300005366 | Bacteria | 6112 |
| 136 | Ga0070659_100013878 | 3300005366 | Bacteria | 6010 |
| 137 | Ga0070659_100033703 | 3300005366 | Bacteria | 3980 |
| 138 | Ga0070659_100532386 | 3300005366 | Unclassified | 1004 |
| 139 | Ga0070667_100006079 | 3300005367 | Bacteria | 10023 |
| 140 | Ga0070667_100015757 | 3300005367 | Bacteria | 6251 |
| 141 | Ga0070667_100059359 | 3300005367 | Bacteria | 3236 |
| 142 | Ga0070667_100136717 | 3300005367 | Bacteria | 2143 |
| 143 | Ga0070667_100152306 | 3300005367 | Bacteria | 2032 |
| 144 | Ga0070667_100215144 | 3300005367 | Bacteria | 1709 |
| 145 | Ga0070667_100225485 | 3300005367 | Bacteria | 1669 |
| 146 | Ga0070667_100242968 | 3300005367 | Unclassified | 1608 |
| 147 | Ga0070667_100251166 | 3300005367 | Unclassified | 1581 |
| 148 | Ga0070667_100514326 | 3300005367 | Bacteria | 1098 |
| 149 | Ga0070667_100630983 | 3300005367 | Bacteria | 988 |
| 150 | Ga0070713_100195313 | 3300005436 | Bacteria | 1825 |
| 151 | Ga0070701_10011972 | 3300005438 | Bacteria | 3896 |
| 152 | Ga0070701_10144577 | 3300005438 | Unclassified | 1363 |
| 153 | Ga0070701_10171163 | 3300005438 | Unclassified | 1265 |
| 154 | Ga0070701_10194481 | 3300005438 | Unclassified | 1195 |
| 155 | Ga0070700_100019747 | 3300005441 | Unclassified | 3893 |
| 156 | Ga0070700_100036582 | 3300005441 | Bacteria | 2978 |
| 157 | Ga0070708_101071167 | 3300005445 | Bacteria | 755 |
| 158 | Ga0070663_100012747 | 3300005455 | Bacteria | 5330 |
| 159 | Ga0070663_100297913 | 3300005455 | Bacteria | 1290 |
| 160 | Ga0070678_100012186 | 3300005456 | Bacteria | 5334 |
| 161 | Ga0070678_100502067 | 3300005456 | Bacteria | 1070 |
| 162 | Ga0070678_100911580 | 3300005456 | Bacteria | 804 |
| 163 | Ga0070678_100971092 | 3300005456 | Bacteria | 780 |
| 164 | Ga0070678_101191830 | 3300005456 | Bacteria | 706 |
| 165 | Ga0070662_100006695 | 3300005457 | Bacteria | 7447 |
| 166 | Ga0070662_100046912 | 3300005457 | Unclassified | 3106 |
| 167 | Ga0070662_100076849 | 3300005457 | Unclassified | 2476 |
| 168 | Ga0070662_100094771 | 3300005457 | Bacteria | 2248 |
| 169 | Ga0070662_100452488 | 3300005457 | Unclassified | 1066 |
| 170 | Ga0070681_10001251 | 3300005458 | Bacteria | 22123 |
| 171 | Ga0070681_10033532 | 3300005458 | Bacteria | 5155 |
| 172 | Ga0070681_10146444 | 3300005458 | Unclassified | 2290 |
| 173 | Ga0068867_100011375 | 3300005459 | Bacteria | 6279 |
| 174 | Ga0068867_100018002 | 3300005459 | Bacteria | 5020 |
| 175 | Ga0068867_100033276 | 3300005459 | Bacteria | 3731 |
| 176 | Ga0068867_100076582 | 3300005459 | Bacteria | 2512 |
| 177 | Ga0068867_100131964 | 3300005459 | Bacteria | 1942 |
| 178 | Ga0068867_100176714 | 3300005459 | Bacteria | 1695 |
| 179 | Ga0068867_100181767 | 3300005459 | Bacteria | 1673 |
| 180 | Ga0068867_100182828 | 3300005459 | Bacteria | 1668 |
| 181 | Ga0068867_100210426 | 3300005459 | Bacteria | 1561 |
| 182 | Ga0068867_100214269 | 3300005459 | Bacteria | 1549 |
| 183 | Ga0068867_100255227 | 3300005459 | Unclassified | 1427 |
| 184 | Ga0068867_100544389 | 3300005459 | Unclassified | 1004 |
| 185 | Ga0068867_101058134 | 3300005459 | Unclassified | 739 |
| 186 | Ga0070685_10005637 | 3300005466 | Bacteria | 6355 |
| 187 | Ga0070685_10137876 | 3300005466 | Bacteria | 1532 |
| 188 | Ga0070685_10269347 | 3300005466 | Bacteria | 1136 |
| 189 | Ga0070685_10706283 | 3300005466 | Unclassified | 736 |
| 190 | Ga0070698_100001240 | 3300005471 | Bacteria | 28441 |
| 191 | Ga0070698_100015839 | 3300005471 | Bacteria | 7962 |
| 192 | Ga0070698_100515624 | 3300005471 | Bacteria | 1134 |
| 193 | Ga0070699_100020541 | 3300005518 | Bacteria | 5697 |
| 194 | Ga0070679_100003832 | 3300005530 | Bacteria | 13804 |
| 195 | Ga0070679_100004315 | 3300005530 | Bacteria | 13126 |
| 196 | Ga0070679_100043996 | 3300005530 | Bacteria | 4447 |
| 197 | Ga0070679_100061632 | 3300005530 | Bacteria | 3739 |
| 198 | Ga0070679_100399800 | 3300005530 | Bacteria | 1320 |
| 199 | Ga0070679_100911299 | 3300005530 | Bacteria | 823 |
| 200 | Ga0070684_100031867 | 3300005535 | Bacteria | 4490 |
| 201 | Ga0070684_100046297 | 3300005535 | Unclassified | 3769 |
| 202 | Ga0068853_100023714 | 3300005539 | Bacteria | 5141 |
| 203 | Ga0068853_100074541 | 3300005539 | Unclassified | 2960 |
| 204 | Ga0068853_100093581 | 3300005539 | Unclassified | 2646 |
| 205 | Ga0068853_100138229 | 3300005539 | Bacteria | 2186 |
| 206 | Ga0068853_100238495 | 3300005539 | Bacteria | 1666 |
| 207 | Ga0068853_100260834 | 3300005539 | Bacteria | 1593 |
| 208 | Ga0068853_100317379 | 3300005539 | Bacteria | 1444 |
| 209 | Ga0068853_100331519 | 3300005539 | Unclassified | 1412 |
| 210 | Ga0068853_100591046 | 3300005539 | Bacteria | 1054 |
| 211 | Ga0070672_100014325 | 3300005543 | Bacteria | 5618 |
| 212 | Ga0070672_100080482 | 3300005543 | Unclassified | 2610 |
| 213 | Ga0070672_100128676 | 3300005543 | Bacteria | 2079 |
| 214 | Ga0070672_100225638 | 3300005543 | Bacteria | 1572 |
| 215 | Ga0070672_100283597 | 3300005543 | Bacteria | 1401 |
| 216 | Ga0070672_100769382 | 3300005543 | Bacteria | 846 |
| 217 | Ga0070672_100900325 | 3300005543 | Bacteria | 781 |
| 218 | Ga0070686_100166734 | 3300005544 | Bacteria | 1555 |
| 219 | Ga0070686_100238097 | 3300005544 | Bacteria | 1324 |
| 220 | Ga0070695_101090336 | 3300005545 | Bacteria | 653 |
| 221 | Ga0070693_100013908 | 3300005547 | Bacteria | 4110 |
| 222 | Ga0070693_100123855 | 3300005547 | Unclassified | 1607 |
| 223 | Ga0070665_100135417 | 3300005548 | Unclassified | 2465 |
| 224 | Ga0070665_100255545 | 3300005548 | Bacteria | 1753 |
| 225 | Ga0070704_100105820 | 3300005549 | Bacteria | 2131 |
| 226 | Ga0070704_101587768 | 3300005549 | Unclassified | 603 |
| 227 | Ga0068855_100003310 | 3300005563 | Bacteria | 19720 |
| 228 | Ga0068855_100010889 | 3300005563 | Bacteria | 10978 |
| 229 | Ga0068855_100056286 | 3300005563 | Bacteria | 4615 |
| 230 | Ga0068855_100087143 | 3300005563 | Bacteria | 3609 |
| 231 | Ga0068855_100101183 | 3300005563 | Unclassified | 3318 |
| 232 | Ga0070664_100001016 | 3300005564 | Bacteria | 22026 |
| 233 | Ga0070664_100035868 | 3300005564 | Unclassified | 4164 |
| 234 | Ga0070664_100221732 | 3300005564 | Unclassified | 1692 |
| 235 | Ga0070664_100223461 | 3300005564 | Unclassified | 1685 |
| 236 | Ga0070664_100265859 | 3300005564 | Bacteria | 1544 |
| 237 | Ga0070664_100321608 | 3300005564 | Bacteria | 1402 |
| 238 | Ga0070664_100372275 | 3300005564 | Unclassified | 1302 |
| 239 | Ga0070664_100848743 | 3300005564 | Unclassified | 855 |
| 240 | Ga0070664_101092067 | 3300005564 | Bacteria | 751 |
| 241 | Ga0068857_100004400 | 3300005577 | Bacteria | 11908 |
| 242 | Ga0068857_100031579 | 3300005577 | Bacteria | 4681 |
| 243 | Ga0068857_100036932 | 3300005577 | Bacteria | 4327 |
| 244 | Ga0068857_100065276 | 3300005577 | Bacteria | 3236 |
| 245 | Ga0068857_100150447 | 3300005577 | Unclassified | 2108 |
| 246 | Ga0068857_100228595 | 3300005577 | Bacteria | 1701 |
| 247 | Ga0068857_100279401 | 3300005577 | Bacteria | 1536 |
| 248 | Ga0068857_100793250 | 3300005577 | Bacteria | 904 |
| 249 | Ga0068857_100917313 | 3300005577 | Bacteria | 840 |
| 250 | Ga0068857_101444505 | 3300005577 | Bacteria | 669 |
| 251 | Ga0068854_100032539 | 3300005578 | Bacteria | 3629 |
| 252 | Ga0068854_100155004 | 3300005578 | Unclassified | 1769 |
| 253 | Ga0068856_100014455 | 3300005614 | Bacteria | 7626 |
| 254 | Ga0068856_100053446 | 3300005614 | Bacteria | 3982 |
| 255 | Ga0068856_100274202 | 3300005614 | Bacteria | 1703 |
| 256 | Ga0068856_100598241 | 3300005614 | Unclassified | 1124 |
| 257 | Ga0070702_100063336 | 3300005615 | Unclassified | 2159 |
| 258 | Ga0070702_100553722 | 3300005615 | Bacteria | 854 |
| 259 | Ga0068852_100001315 | 3300005616 | Bacteria | 16622 |
| 260 | Ga0068852_100023320 | 3300005616 | Bacteria | 4980 |
| 261 | Ga0068852_100099128 | 3300005616 | Bacteria | 2626 |
| 262 | Ga0068852_100099996 | 3300005616 | Unclassified | 2615 |
| 263 | Ga0068852_100105898 | 3300005616 | Bacteria | 2548 |
| 264 | Ga0068852_100401730 | 3300005616 | Unclassified | 1348 |
| 265 | Ga0068852_101355707 | 3300005616 | Bacteria | 733 |
| 266 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 267 | Ga0068859_100024436 | 3300005617 | Bacteria | 6061 |
| 268 | Ga0068859_100077477 | 3300005617 | Unclassified | 3365 |
| 269 | Ga0068859_100078746 | 3300005617 | Bacteria | 3336 |
| 270 | Ga0068859_100080405 | 3300005617 | Bacteria | 3300 |
| 271 | Ga0068859_100143094 | 3300005617 | Bacteria | 2465 |
| 272 | Ga0068859_100215081 | 3300005617 | Bacteria | 2009 |
| 273 | Ga0068859_100256216 | 3300005617 | Unclassified | 1840 |
| 274 | Ga0068859_100327292 | 3300005617 | Bacteria | 1626 |
| 275 | Ga0068864_100001903 | 3300005618 | Bacteria | 17129 |
| 276 | Ga0068864_100003471 | 3300005618 | Bacteria | 13018 |
| 277 | Ga0068864_100028548 | 3300005618 | Bacteria | 4718 |
| 278 | Ga0068864_100267860 | 3300005618 | Bacteria | 1591 |
| 279 | Ga0068864_100395007 | 3300005618 | Bacteria | 1313 |
| 280 | Ga0068864_100496030 | 3300005618 | Unclassified | 1174 |
| 281 | Ga0068864_100772340 | 3300005618 | Unclassified | 943 |
| 282 | Ga0068864_101132327 | 3300005618 | Bacteria | 780 |
| 283 | Ga0068866_10041295 | 3300005718 | Bacteria | 2288 |
| 284 | Ga0068866_10052467 | 3300005718 | Bacteria | 2081 |
| 285 | Ga0068866_10333639 | 3300005718 | Bacteria | 958 |
| 286 | Ga0068866_10412181 | 3300005718 | Bacteria | 874 |
| 287 | Ga0068866_10443337 | 3300005718 | Bacteria | 847 |
| 288 | Ga0068861_100002644 | 3300005719 | Bacteria | 11721 |
| 289 | Ga0068861_100039196 | 3300005719 | Bacteria | 3535 |
| 290 | Ga0068861_100304468 | 3300005719 | Bacteria | 1382 |
| 291 | Ga0068861_100320268 | 3300005719 | Bacteria | 1350 |
| 292 | Ga0068861_100326554 | 3300005719 | Bacteria | 1338 |
| 293 | Ga0068861_100472336 | 3300005719 | Bacteria | 1128 |
| 294 | Ga0068861_100540222 | 3300005719 | Bacteria | 1060 |
| 295 | Ga0068861_100821831 | 3300005719 | Bacteria | 874 |
| 296 | Ga0068851_10068189 | 3300005834 | Bacteria | 1836 |
| 297 | Ga0068851_10076574 | 3300005834 | Bacteria | 1740 |
| 298 | Ga0068851_10143020 | 3300005834 | Unclassified | 1302 |
| 299 | Ga0068870_10020767 | 3300005840 | Unclassified | 3204 |
| 300 | Ga0068870_10529835 | 3300005840 | Bacteria | 790 |
| 301 | Ga0068870_10607351 | 3300005840 | Unclassified | 744 |
| 302 | Ga0068870_10645997 | 3300005840 | Bacteria | 724 |
| 303 | Ga0068863_100013210 | 3300005841 | Bacteria | 7964 |
| 304 | Ga0068863_100024759 | 3300005841 | Bacteria | 5725 |
| 305 | Ga0068863_100066379 | 3300005841 | Bacteria | 3413 |
| 306 | Ga0068863_100068065 | 3300005841 | Bacteria | 3368 |
| 307 | Ga0068863_100136478 | 3300005841 | Unclassified | 2343 |
| 308 | Ga0068863_100373137 | 3300005841 | Bacteria | 1392 |
| 309 | Ga0068863_100529417 | 3300005841 | Bacteria | 1162 |
| 310 | Ga0068863_100549707 | 3300005841 | Bacteria | 1140 |
| 311 | Ga0068863_101431384 | 3300005841 | Bacteria | 699 |
| 312 | Ga0068858_100002526 | 3300005842 | Bacteria | 18442 |
| 313 | Ga0068858_100026873 | 3300005842 | Bacteria | 5346 |
| 314 | Ga0068858_100161513 | 3300005842 | Bacteria | 2110 |
| 315 | Ga0068858_100376103 | 3300005842 | Bacteria | 1363 |
| 316 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 317 | Ga0068860_100001337 | 3300005843 | Bacteria | 26812 |
| 318 | Ga0068860_100008404 | 3300005843 | Bacteria | 10283 |
| 319 | Ga0068860_100025145 | 3300005843 | Bacteria | 5746 |
| 320 | Ga0068860_100132731 | 3300005843 | Bacteria | 2391 |
| 321 | Ga0068860_100261277 | 3300005843 | Unclassified | 1688 |
| 322 | Ga0068860_100372626 | 3300005843 | Bacteria | 1408 |
| 323 | Ga0068860_100532007 | 3300005843 | Bacteria | 1176 |
| 324 | Ga0068860_101443390 | 3300005843 | Bacteria | 709 |
| 325 | Ga0068862_100171546 | 3300005844 | Bacteria | 1942 |
| 326 | Ga0068862_100271643 | 3300005844 | Bacteria | 1551 |
| 327 | Ga0068862_100271917 | 3300005844 | Bacteria | 1550 |
| 328 | Ga0081540_1010502 | 3300005983 | Bacteria | 6258 |
| 329 | Ga0081539_10071602 | 3300005985 | Bacteria | 1856 |
| 330 | Ga0070716_100467582 | 3300006173 | Bacteria | 923 |
| 331 | Ga0075366_10150416 | 3300006195 | Bacteria | 1409 |
| 332 | Ga0075366_10218982 | 3300006195 | Unclassified | 1160 |
| 333 | Ga0097621_100000092 | 3300006237 | Bacteria | 49439 |
| 334 | Ga0097621_100003569 | 3300006237 | Bacteria | 10751 |
| 335 | Ga0097621_100089565 | 3300006237 | Unclassified | 2573 |
| 336 | Ga0097621_100177327 | 3300006237 | Bacteria | 1840 |
| 337 | Ga0097621_100195925 | 3300006237 | Unclassified | 1752 |
| 338 | Ga0097621_100217765 | 3300006237 | Bacteria | 1663 |
| 339 | Ga0097621_100239640 | 3300006237 | Bacteria | 1585 |
| 340 | Ga0097621_100245783 | 3300006237 | Bacteria | 1565 |
| 341 | Ga0097621_100247247 | 3300006237 | Unclassified | 1561 |
| 342 | Ga0097621_100429327 | 3300006237 | Bacteria | 1187 |
| 343 | Ga0075370_10382708 | 3300006353 | Bacteria | 843 |
| 344 | Ga0068871_100000032 | 3300006358 | Bacteria | 73078 |
| 345 | Ga0068871_100005675 | 3300006358 | Bacteria | 8756 |
| 346 | Ga0068871_100021440 | 3300006358 | Unclassified | 4966 |
| 347 | Ga0068871_100441513 | 3300006358 | Bacteria | 1165 |
| 348 | Ga0068871_100487174 | 3300006358 | Unclassified | 1110 |
| 349 | Ga0068871_100507618 | 3300006358 | Bacteria | 1088 |
| 350 | Ga0068871_100614242 | 3300006358 | Unclassified | 990 |
| 351 | Ga0068871_100785391 | 3300006358 | Bacteria | 877 |
| 352 | Ga0068871_101070587 | 3300006358 | Bacteria | 753 |
| 353 | Ga0068871_101167891 | 3300006358 | Unclassified | 721 |
| 354 | Ga0068871_101388571 | 3300006358 | Unclassified | 662 |
| 355 | Ga0075428_100004634 | 3300006844 | Bacteria | 15211 |
| 356 | Ga0075428_100054065 | 3300006844 | Bacteria | 4400 |
| 357 | Ga0075431_100143590 | 3300006847 | Bacteria | 2460 |
| 358 | Ga0075434_100358493 | 3300006871 | Bacteria | 1479 |
| 359 | Ga0075434_101012930 | 3300006871 | Unclassified | 844 |
| 360 | Ga0075429_100000407 | 3300006880 | Bacteria | 31868 |
| 361 | Ga0075429_100358983 | 3300006880 | Unclassified | 1276 |
| 362 | Ga0075429_100427382 | 3300006880 | Unclassified | 1160 |
| 363 | Ga0068865_100046619 | 3300006881 | Unclassified | 2974 |
| 364 | Ga0068865_100072468 | 3300006881 | Bacteria | 2447 |
| 365 | Ga0068865_100145381 | 3300006881 | Unclassified | 1793 |
| 366 | Ga0068865_100155506 | 3300006881 | Bacteria | 1739 |
| 367 | Ga0068865_100532613 | 3300006881 | Bacteria | 984 |
| 368 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 369 | Ga0097620_100000592 | 3300006931 | Bacteria | 36168 |
| 370 | Ga0097620_100024436 | 3300006931 | Bacteria | 6061 |
| 371 | Ga0097620_100077479 | 3300006931 | Unclassified | 3365 |
| 372 | Ga0097620_100078743 | 3300006931 | Bacteria | 3336 |
| 373 | Ga0097620_100080403 | 3300006931 | Bacteria | 3300 |
| 374 | Ga0097620_100143083 | 3300006931 | Bacteria | 2465 |
| 375 | Ga0097620_100215091 | 3300006931 | Bacteria | 2009 |
| 376 | Ga0097620_100256220 | 3300006931 | Unclassified | 1840 |
| 377 | Ga0097620_100327319 | 3300006931 | Bacteria | 1626 |
| 378 | Ga0105244_10417477 | 3300009036 | Bacteria | 617 |
| 379 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 380 | Ga0105240_10002363 | 3300009093 | Bacteria | 30416 |
| 381 | Ga0105240_10002407 | 3300009093 | Bacteria | 30067 |
| 382 | Ga0105240_10017580 | 3300009093 | Bacteria | 9634 |
| 383 | Ga0105240_10068817 | 3300009093 | Bacteria | 4384 |
| 384 | Ga0105240_10073258 | 3300009093 | Bacteria | 4229 |
| 385 | Ga0105240_10085994 | 3300009093 | Bacteria | 3852 |
| 386 | Ga0105240_10086784 | 3300009093 | Unclassified | 3833 |
| 387 | Ga0105240_10188485 | 3300009093 | Bacteria | 2427 |
| 388 | Ga0105240_10711848 | 3300009093 | Bacteria | 1095 |
| 389 | Ga0111539_10033178 | 3300009094 | Bacteria | 6269 |
| 390 | Ga0111539_10107847 | 3300009094 | Unclassified | 3268 |
| 391 | Ga0111539_10280415 | 3300009094 | Bacteria | 1939 |
| 392 | Ga0111539_10528001 | 3300009094 | Bacteria | 1375 |
| 393 | Ga0111539_11304344 | 3300009094 | Bacteria | 843 |
| 394 | Ga0105245_10098230 | 3300009098 | Unclassified | 2705 |
| 395 | Ga0105247_10009494 | 3300009101 | Bacteria | 5901 |
| 396 | Ga0105247_10496278 | 3300009101 | Bacteria | 889 |
| 397 | Ga0105247_10574370 | 3300009101 | Bacteria | 832 |
| 398 | Ga0105247_10664297 | 3300009101 | Bacteria | 780 |
| 399 | Ga0105247_10884422 | 3300009101 | Unclassified | 688 |
| 400 | Ga0114129_10013112 | 3300009147 | Bacteria | 11805 |
| 401 | Ga0105243_10062728 | 3300009148 | Bacteria | 2976 |
| 402 | Ga0105243_10108870 | 3300009148 | Bacteria | 2314 |
| 403 | Ga0105241_10001117 | 3300009174 | Bacteria | 20448 |
| 404 | Ga0105241_10003737 | 3300009174 | Bacteria | 11296 |
| 405 | Ga0105241_10024976 | 3300009174 | Bacteria | 4440 |
| 406 | Ga0105241_10031425 | 3300009174 | Bacteria | 3976 |
| 407 | Ga0105241_10230780 | 3300009174 | Bacteria | 1560 |
| 408 | Ga0105241_10877990 | 3300009174 | Unclassified | 831 |
| 409 | Ga0105241_11136750 | 3300009174 | Unclassified | 737 |
| 410 | Ga0105242_10034241 | 3300009176 | Bacteria | 4072 |
| 411 | Ga0105242_10292707 | 3300009176 | Bacteria | 1483 |
| 412 | Ga0105242_10381257 | 3300009176 | Unclassified | 1311 |
| 413 | Ga0105242_10420555 | 3300009176 | Unclassified | 1252 |
| 414 | Ga0105242_10466078 | 3300009176 | Bacteria | 1194 |
| 415 | Ga0105242_10777338 | 3300009176 | Unclassified | 945 |
| 416 | Ga0105242_10861158 | 3300009176 | Unclassified | 903 |
| 417 | Ga0105248_10113241 | 3300009177 | Bacteria | 3059 |
| 418 | Ga0105248_11154761 | 3300009177 | Bacteria | 875 |
| 419 | Ga0105237_10000561 | 3300009545 | Bacteria | 51951 |
| 420 | Ga0105237_10000855 | 3300009545 | Bacteria | 41395 |
| 421 | Ga0105237_10007863 | 3300009545 | Bacteria | 11623 |
| 422 | Ga0105237_10011076 | 3300009545 | Bacteria | 9559 |
| 423 | Ga0105237_10017239 | 3300009545 | Bacteria | 7490 |
| 424 | Ga0105237_10023760 | 3300009545 | Bacteria | 6275 |
| 425 | Ga0105237_10075351 | 3300009545 | Unclassified | 3366 |
| 426 | Ga0105237_10108821 | 3300009545 | Bacteria | 2763 |
| 427 | Ga0105237_10123305 | 3300009545 | Bacteria | 2585 |
| 428 | Ga0105237_11000144 | 3300009545 | Unclassified | 843 |
| 429 | Ga0105237_11117422 | 3300009545 | Unclassified | 795 |
| 430 | Ga0105238_10001830 | 3300009551 | Bacteria | 21319 |
| 431 | Ga0105238_10006849 | 3300009551 | Bacteria | 11379 |
| 432 | Ga0105238_10009716 | 3300009551 | Bacteria | 9633 |
| 433 | Ga0105238_10141743 | 3300009551 | Bacteria | 2380 |
| 434 | Ga0105238_12020003 | 3300009551 | Bacteria | 610 |
| 435 | Ga0105249_10001205 | 3300009553 | Bacteria | 22829 |
| 436 | Ga0105249_10004606 | 3300009553 | Bacteria | 11913 |
| 437 | Ga0105249_10006402 | 3300009553 | Bacteria | 10239 |
| 438 | Ga0105249_10008771 | 3300009553 | Bacteria | 8824 |
| 439 | Ga0105249_10037856 | 3300009553 | Unclassified | 4377 |
| 440 | Ga0105249_10388402 | 3300009553 | Bacteria | 1423 |
| 441 | Ga0105249_10468092 | 3300009553 | Bacteria | 1301 |
| 442 | Ga0105249_10701465 | 3300009553 | Bacteria | 1072 |
| 443 | Ga0105249_10750421 | 3300009553 | Bacteria | 1038 |
| 444 | Ga0105249_11072455 | 3300009553 | Bacteria | 875 |
| 445 | Ga0105239_10000580 | 3300010375 | Bacteria | 52245 |
| 446 | Ga0105239_10002300 | 3300010375 | Bacteria | 24396 |
| 447 | Ga0105239_10004005 | 3300010375 | Bacteria | 17844 |
| 448 | Ga0105239_10042882 | 3300010375 | Bacteria | 4958 |
| 449 | Ga0105239_10046255 | 3300010375 | Bacteria | 4769 |
| 450 | Ga0105239_10047256 | 3300010375 | Bacteria | 4717 |
| 451 | Ga0105239_10159566 | 3300010375 | Bacteria | 2519 |
| 452 | Ga0105239_10230508 | 3300010375 | Bacteria | 2078 |
| 453 | Ga0105239_11577072 | 3300010375 | Unclassified | 759 |
| 454 | Ga0105239_12081586 | 3300010375 | Bacteria | 659 |
| 455 | Ga0105246_10231064 | 3300011119 | Bacteria | 1456 |
| 456 | Ga0105246_10254680 | 3300011119 | Unclassified | 1395 |
| 457 | Ga0105246_10458217 | 3300011119 | Unclassified | 1073 |
| 458 | Ga0157373_10003094 | 3300013100 | Bacteria | 12572 |
| 459 | Ga0157373_10005705 | 3300013100 | Bacteria | 9331 |
| 460 | Ga0157373_10091788 | 3300013100 | Bacteria | 2139 |
| 461 | Ga0157373_10166367 | 3300013100 | Unclassified | 1552 |
| 462 | Ga0157373_10311017 | 3300013100 | Bacteria | 1119 |
| 463 | Ga0157373_10322312 | 3300013100 | Bacteria | 1099 |
| 464 | Ga0157373_10530749 | 3300013100 | Bacteria | 852 |
| 465 | Ga0157371_10002374 | 3300013102 | Bacteria | 18004 |
| 466 | Ga0157371_10002840 | 3300013102 | Bacteria | 16187 |
| 467 | Ga0157371_10003029 | 3300013102 | Bacteria | 15605 |
| 468 | Ga0157371_10010584 | 3300013102 | Bacteria | 7167 |
| 469 | Ga0157371_10021199 | 3300013102 | Bacteria | 4773 |
| 470 | Ga0157371_10054546 | 3300013102 | Unclassified | 2839 |
| 471 | Ga0157371_10074045 | 3300013102 | Unclassified | 2412 |
| 472 | Ga0157371_10120463 | 3300013102 | Bacteria | 1865 |
| 473 | Ga0157371_10161428 | 3300013102 | Bacteria | 1601 |
| 474 | Ga0157371_10270488 | 3300013102 | Bacteria | 1226 |
| 475 | Ga0157371_10281098 | 3300013102 | Bacteria | 1202 |
| 476 | Ga0157371_10296971 | 3300013102 | Bacteria | 1169 |
| 477 | Ga0157371_10463310 | 3300013102 | Unclassified | 933 |
| 478 | Ga0157371_10612319 | 3300013102 | Bacteria | 811 |
| 479 | Ga0157370_10001361 | 3300013104 | Bacteria | 30267 |
| 480 | Ga0157370_10001381 | 3300013104 | Bacteria | 30032 |
| 481 | Ga0157370_10031168 | 3300013104 | Bacteria | 5219 |
| 482 | Ga0157370_10073553 | 3300013104 | Bacteria | 3225 |
| 483 | Ga0157370_10089903 | 3300013104 | Unclassified | 2884 |
| 484 | Ga0157370_10136467 | 3300013104 | Bacteria | 2286 |
| 485 | Ga0157370_10182471 | 3300013104 | Bacteria | 1950 |
| 486 | Ga0157370_10193606 | 3300013104 | Bacteria | 1887 |
| 487 | Ga0157370_10353373 | 3300013104 | Bacteria | 1354 |
| 488 | Ga0157370_10478026 | 3300013104 | Unclassified | 1145 |
| 489 | Ga0157370_10893635 | 3300013104 | Unclassified | 806 |
| 490 | Ga0157369_10004054 | 3300013105 | Bacteria | 17353 |
| 491 | Ga0157369_10007569 | 3300013105 | Bacteria | 12497 |
| 492 | Ga0157369_10034964 | 3300013105 | Bacteria | 5510 |
| 493 | Ga0157369_10047526 | 3300013105 | Bacteria | 4658 |
| 494 | Ga0157369_10086456 | 3300013105 | Bacteria | 3349 |
| 495 | Ga0157369_10503987 | 3300013105 | Bacteria | 1252 |
| 496 | Ga0157369_10515564 | 3300013105 | Bacteria | 1237 |
| 497 | Ga0157374_10003298 | 3300013296 | Bacteria | 13556 |
| 498 | Ga0157374_10024775 | 3300013296 | Bacteria | 5380 |
| 499 | Ga0157374_10029574 | 3300013296 | Unclassified | 4964 |
| 500 | Ga0157374_10173103 | 3300013296 | Unclassified | 2107 |
| 501 | Ga0157374_10190682 | 3300013296 | Bacteria | 2005 |
| 502 | Ga0157374_10499861 | 3300013296 | Bacteria | 1220 |
| 503 | Ga0157374_10705089 | 3300013296 | Bacteria | 1022 |
| 504 | Ga0157374_10893760 | 3300013296 | Bacteria | 906 |
| 505 | Ga0157378_10022391 | 3300013297 | Bacteria | 5563 |
| 506 | Ga0157378_10030429 | 3300013297 | Bacteria | 4770 |
| 507 | Ga0157378_10036081 | 3300013297 | Unclassified | 4376 |
| 508 | Ga0157378_10067398 | 3300013297 | Unclassified | 3207 |
| 509 | Ga0157378_10082110 | 3300013297 | Bacteria | 2914 |
| 510 | Ga0157378_10094708 | 3300013297 | Bacteria | 2719 |
| 511 | Ga0157378_10219860 | 3300013297 | Bacteria | 1805 |
| 512 | Ga0157378_10362154 | 3300013297 | Unclassified | 1419 |
| 513 | Ga0157378_10367471 | 3300013297 | Bacteria | 1409 |
| 514 | Ga0157378_10386911 | 3300013297 | Bacteria | 1375 |
| 515 | Ga0157378_10656513 | 3300013297 | Bacteria | 1065 |
| 516 | Ga0157378_10747849 | 3300013297 | Bacteria | 1000 |
| 517 | Ga0163162_10000431 | 3300013306 | Bacteria | 38724 |
| 518 | Ga0163162_10002078 | 3300013306 | Bacteria | 18820 |
| 519 | Ga0163162_10002386 | 3300013306 | Bacteria | 17658 |
| 520 | Ga0163162_10016743 | 3300013306 | Bacteria | 7165 |
| 521 | Ga0163162_10064477 | 3300013306 | Bacteria | 3708 |
| 522 | Ga0163162_10130217 | 3300013306 | Unclassified | 2624 |
| 523 | Ga0163162_10220773 | 3300013306 | Bacteria | 2025 |
| 524 | Ga0163162_10366948 | 3300013306 | Bacteria | 1573 |
| 525 | Ga0163162_10537355 | 3300013306 | Unclassified | 1298 |
| 526 | Ga0163162_10854348 | 3300013306 | Bacteria | 1025 |
| 527 | Ga0163162_11222445 | 3300013306 | Bacteria | 853 |
| 528 | Ga0157372_10000171 | 3300013307 | Bacteria | 71956 |
| 529 | Ga0157372_10000463 | 3300013307 | Bacteria | 44664 |
| 530 | Ga0157372_10002128 | 3300013307 | Bacteria | 21519 |
| 531 | Ga0157372_10002594 | 3300013307 | Bacteria | 19562 |
| 532 | Ga0157372_10007410 | 3300013307 | Bacteria | 11669 |
| 533 | Ga0157372_10031523 | 3300013307 | Bacteria | 5804 |
| 534 | Ga0157372_10127319 | 3300013307 | Bacteria | 2928 |
| 535 | Ga0157372_10153094 | 3300013307 | Bacteria | 2662 |
| 536 | Ga0157372_10222669 | 3300013307 | Bacteria | 2187 |
| 537 | Ga0157372_10291934 | 3300013307 | Bacteria | 1896 |
| 538 | Ga0157372_10302966 | 3300013307 | Bacteria | 1859 |
| 539 | Ga0157372_10575993 | 3300013307 | Unclassified | 1312 |
| 540 | Ga0157372_10693454 | 3300013307 | Unclassified | 1185 |
| 541 | Ga0157372_11867278 | 3300013307 | Bacteria | 691 |
| 542 | Ga0157375_10000253 | 3300013308 | Bacteria | 48558 |
| 543 | Ga0157375_10012111 | 3300013308 | Bacteria | 7642 |
| 544 | Ga0157375_10013965 | 3300013308 | Bacteria | 7159 |
| 545 | Ga0157375_10020759 | 3300013308 | Bacteria | 6010 |
| 546 | Ga0157375_10176130 | 3300013308 | Bacteria | 2288 |
| 547 | Ga0157375_10187243 | 3300013308 | Bacteria | 2224 |
| 548 | Ga0157375_10188328 | 3300013308 | Bacteria | 2218 |
| 549 | Ga0157375_10203956 | 3300013308 | Bacteria | 2134 |
| 550 | Ga0157375_10227462 | 3300013308 | Bacteria | 2024 |
| 551 | Ga0157375_10240833 | 3300013308 | Bacteria | 1969 |
| 552 | Ga0157375_10553595 | 3300013308 | Bacteria | 1312 |
| 553 | Ga0157375_10580700 | 3300013308 | Unclassified | 1281 |
| 554 | Ga0157375_10746523 | 3300013308 | Unclassified | 1130 |
| 555 | Ga0157375_10821450 | 3300013308 | Bacteria | 1077 |
| 556 | Ga0157375_11931466 | 3300013308 | Bacteria | 701 |
| 557 | Ga0163163_10001380 | 3300014325 | Bacteria | 20505 |
| 558 | Ga0163163_10005191 | 3300014325 | Bacteria | 11232 |
| 559 | Ga0163163_10006337 | 3300014325 | Bacteria | 10331 |
| 560 | Ga0163163_10096114 | 3300014325 | Bacteria | 2983 |
| 561 | Ga0163163_10110547 | 3300014325 | Bacteria | 2777 |
| 562 | Ga0163163_10270072 | 3300014325 | Unclassified | 1752 |
| 563 | Ga0163163_10316057 | 3300014325 | Bacteria | 1615 |
| 564 | Ga0163163_10384216 | 3300014325 | Bacteria | 1462 |
| 565 | Ga0163163_10498307 | 3300014325 | Bacteria | 1280 |
| 566 | Ga0163163_11402836 | 3300014325 | Bacteria | 760 |
| 567 | Ga0157380_10001704 | 3300014326 | Bacteria | 14521 |
| 568 | Ga0157380_10007415 | 3300014326 | Bacteria | 7788 |
| 569 | Ga0157380_10026790 | 3300014326 | Bacteria | 4379 |
| 570 | Ga0157380_10069446 | 3300014326 | Bacteria | 2843 |
| 571 | Ga0157380_10111984 | 3300014326 | Bacteria | 2295 |
| 572 | Ga0157380_10117013 | 3300014326 | Bacteria | 2251 |
| 573 | Ga0157380_10120191 | 3300014326 | Bacteria | 2224 |
| 574 | Ga0157380_10282621 | 3300014326 | Bacteria | 1519 |
| 575 | Ga0157380_11574868 | 3300014326 | Bacteria | 712 |
| 576 | Ga0157377_10002237 | 3300014745 | Bacteria | 8502 |
| 577 | Ga0157377_10007408 | 3300014745 | Bacteria | 5297 |
| 578 | Ga0157377_10026538 | 3300014745 | Unclassified | 3101 |
| 579 | Ga0157377_10029488 | 3300014745 | Bacteria | 2963 |
| 580 | Ga0157377_10250420 | 3300014745 | Bacteria | 1148 |
| 581 | Ga0157379_10080924 | 3300014968 | Unclassified | 2910 |
| 582 | Ga0157379_10177261 | 3300014968 | Unclassified | 1925 |
| 583 | Ga0157379_10243214 | 3300014968 | Bacteria | 1632 |
| 584 | Ga0157379_10555980 | 3300014968 | Bacteria | 1068 |
| 585 | Ga0157379_10611086 | 3300014968 | Unclassified | 1018 |
| 586 | Ga0157376_10000714 | 3300014969 | Bacteria | 21474 |
| 587 | Ga0157376_10000961 | 3300014969 | Bacteria | 18769 |
| 588 | Ga0157376_10047974 | 3300014969 | Bacteria | 3528 |
| 589 | Ga0157376_10091928 | 3300014969 | Bacteria | 2629 |
| 590 | Ga0157376_10181011 | 3300014969 | Unclassified | 1927 |
| 591 | Ga0157376_10512163 | 3300014969 | Bacteria | 1181 |
| 592 | Ga0157376_10715014 | 3300014969 | Bacteria | 1008 |
| 593 | Ga0157376_10747277 | 3300014969 | Bacteria | 987 |
| 594 | Ga0163161_10008802 | 3300017792 | Bacteria | 6978 |
| 595 | Ga0163161_10026417 | 3300017792 | Bacteria | 4112 |
| 596 | Ga0163161_10028693 | 3300017792 | Unclassified | 3953 |
| 597 | Ga0163161_10030442 | 3300017792 | Bacteria | 3842 |
| 598 | Ga0163161_10042247 | 3300017792 | Bacteria | 3278 |
| 599 | Ga0163161_10398592 | 3300017792 | Bacteria | 1103 |
| 600 | Ga0163161_10413297 | 3300017792 | Bacteria | 1084 |
| 601 | Ga0163161_10743490 | 3300017792 | Bacteria | 820 |
| 602 | Ga0163161_10861656 | 3300017792 | Bacteria | 765 |
| 603 | Ga0209436_100446 | 3300025208 | Bacteria | 18568 |
| 604 | Ga0209646_1002117 | 3300025246 | Bacteria | 4622 |
| 605 | Ga0209130_1004223 | 3300025284 | Bacteria | 5591 |
| 606 | Ga0207426_1000073 | 3300025302 | Bacteria | 323756 |
| 607 | Ga0207697_10160686 | 3300025315 | Bacteria | 980 |
| 608 | Ga0207697_10243428 | 3300025315 | Bacteria | 795 |
| 609 | Ga0207656_10118095 | 3300025321 | Unclassified | 1232 |
| 610 | Ga0207656_10136620 | 3300025321 | Bacteria | 1152 |
| 611 | Ga0207656_10242563 | 3300025321 | Bacteria | 881 |
| 612 | Ga0207656_10258026 | 3300025321 | Unclassified | 855 |
| 613 | Ga0207682_10021399 | 3300025893 | Bacteria | 2544 |
| 614 | Ga0207682_10183195 | 3300025893 | Bacteria | 957 |
| 615 | Ga0207642_10014577 | 3300025899 | Bacteria | 2904 |
| 616 | Ga0207642_10038504 | 3300025899 | Bacteria | 2070 |
| 617 | Ga0207642_10340195 | 3300025899 | Bacteria | 882 |
| 618 | Ga0207710_10003031 | 3300025900 | Bacteria | 7565 |
| 619 | Ga0207688_10105504 | 3300025901 | Bacteria | 1631 |
| 620 | Ga0207688_10187467 | 3300025901 | Bacteria | 1236 |
| 621 | Ga0207680_10000385 | 3300025903 | Bacteria | 21073 |
| 622 | Ga0207680_10025294 | 3300025903 | Unclassified | 3273 |
| 623 | Ga0207680_10140097 | 3300025903 | Unclassified | 1603 |
| 624 | Ga0207680_10174048 | 3300025903 | Bacteria | 1451 |
| 625 | Ga0207680_10365260 | 3300025903 | Bacteria | 1015 |
| 626 | Ga0207647_10000360 | 3300025904 | Bacteria | 37076 |
| 627 | Ga0207647_10077169 | 3300025904 | Unclassified | 2003 |
| 628 | Ga0207647_10181246 | 3300025904 | Unclassified | 1223 |
| 629 | Ga0207645_10016092 | 3300025907 | Unclassified | 4952 |
| 630 | Ga0207645_10025070 | 3300025907 | Bacteria | 3862 |
| 631 | Ga0207645_10086048 | 3300025907 | Bacteria | 2019 |
| 632 | Ga0207645_10155183 | 3300025907 | Bacteria | 1495 |
| 633 | Ga0207645_10156629 | 3300025907 | Unclassified | 1488 |
| 634 | Ga0207645_10198770 | 3300025907 | Unclassified | 1318 |
| 635 | Ga0207643_10003543 | 3300025908 | Bacteria | 8404 |
| 636 | Ga0207643_10016472 | 3300025908 | Unclassified | 4033 |
| 637 | Ga0207643_10054981 | 3300025908 | Bacteria | 2263 |
| 638 | Ga0207643_10199378 | 3300025908 | Unclassified | 1218 |
| 639 | Ga0207705_10001227 | 3300025909 | Bacteria | 20676 |
| 640 | Ga0207705_10034136 | 3300025909 | Bacteria | 3637 |
| 641 | Ga0207705_10155999 | 3300025909 | Bacteria | 1713 |
| 642 | Ga0207705_10530950 | 3300025909 | Bacteria | 915 |
| 643 | Ga0207705_11007677 | 3300025909 | Bacteria | 643 |
| 644 | Ga0207654_10002893 | 3300025911 | Bacteria | 8714 |
| 645 | Ga0207654_10019739 | 3300025911 | Bacteria | 3563 |
| 646 | Ga0207654_10026459 | 3300025911 | Bacteria | 3141 |
| 647 | Ga0207654_10091347 | 3300025911 | Bacteria | 1857 |
| 648 | Ga0207707_10010595 | 3300025912 | Bacteria | 8007 |
| 649 | Ga0207707_10247904 | 3300025912 | Unclassified | 1547 |
| 650 | Ga0207707_11103438 | 3300025912 | Bacteria | 646 |
| 651 | Ga0207695_10001064 | 3300025913 | Bacteria | 48020 |
| 652 | Ga0207695_10004051 | 3300025913 | Bacteria | 20148 |
| 653 | Ga0207695_10019628 | 3300025913 | Bacteria | 7777 |
| 654 | Ga0207695_10309139 | 3300025913 | Unclassified | 1471 |
| 655 | Ga0207695_10390674 | 3300025913 | Bacteria | 1276 |
| 656 | Ga0207695_10408098 | 3300025913 | Bacteria | 1243 |
| 657 | Ga0207695_10501901 | 3300025913 | Bacteria | 1095 |
| 658 | Ga0207671_10001454 | 3300025914 | Bacteria | 27338 |
| 659 | Ga0207671_10002324 | 3300025914 | Bacteria | 20513 |
| 660 | Ga0207671_10006030 | 3300025914 | Bacteria | 10943 |
| 661 | Ga0207671_10012091 | 3300025914 | Bacteria | 6970 |
| 662 | Ga0207671_10018700 | 3300025914 | Bacteria | 5309 |
| 663 | Ga0207671_10134205 | 3300025914 | Bacteria | 1902 |
| 664 | Ga0207660_10009692 | 3300025917 | Bacteria | 6234 |
| 665 | Ga0207660_10221324 | 3300025917 | Bacteria | 1485 |
| 666 | Ga0207660_10520631 | 3300025917 | Bacteria | 966 |
| 667 | Ga0207662_10004557 | 3300025918 | Bacteria | 7300 |
| 668 | Ga0207662_10020460 | 3300025918 | Bacteria | 3777 |
| 669 | Ga0207662_10364309 | 3300025918 | Bacteria | 973 |
| 670 | Ga0207657_10009558 | 3300025919 | Bacteria | 9732 |
| 671 | Ga0207657_10047791 | 3300025919 | Bacteria | 3739 |
| 672 | Ga0207657_10092857 | 3300025919 | Bacteria | 2514 |
| 673 | Ga0207657_10104170 | 3300025919 | Bacteria | 2351 |
| 674 | Ga0207657_10167879 | 3300025919 | Unclassified | 1779 |
| 675 | Ga0207657_10193097 | 3300025919 | Bacteria | 1641 |
| 676 | Ga0207649_10002808 | 3300025920 | Bacteria | 9610 |
| 677 | Ga0207649_10004375 | 3300025920 | Bacteria | 7667 |
| 678 | Ga0207649_10625674 | 3300025920 | Bacteria | 830 |
| 679 | Ga0207649_10769894 | 3300025920 | Bacteria | 750 |
| 680 | Ga0207649_10808636 | 3300025920 | Bacteria | 732 |
| 681 | Ga0207652_10000144 | 3300025921 | Bacteria | 76507 |
| 682 | Ga0207652_10001497 | 3300025921 | Bacteria | 20642 |
| 683 | Ga0207652_10025262 | 3300025921 | Bacteria | 4936 |
| 684 | Ga0207652_10224157 | 3300025921 | Bacteria | 1694 |
| 685 | Ga0207652_10739129 | 3300025921 | Bacteria | 876 |
| 686 | Ga0207681_10034787 | 3300025923 | Bacteria | 3315 |
| 687 | Ga0207681_10169560 | 3300025923 | Bacteria | 1653 |
| 688 | Ga0207681_10592826 | 3300025923 | Unclassified | 915 |
| 689 | Ga0207694_10048568 | 3300025924 | Unclassified | 3283 |
| 690 | Ga0207694_10100200 | 3300025924 | Bacteria | 2295 |
| 691 | Ga0207694_10225936 | 3300025924 | Unclassified | 1528 |
| 692 | Ga0207650_10000886 | 3300025925 | Bacteria | 22639 |
| 693 | Ga0207650_10025239 | 3300025925 | Bacteria | 4233 |
| 694 | Ga0207650_10054122 | 3300025925 | Unclassified | 2976 |
| 695 | Ga0207650_10063847 | 3300025925 | Bacteria | 2755 |
| 696 | Ga0207650_10141158 | 3300025925 | Bacteria | 1894 |
| 697 | Ga0207650_10390211 | 3300025925 | Unclassified | 1151 |
| 698 | Ga0207650_10531116 | 3300025925 | Bacteria | 985 |
| 699 | Ga0207650_11255355 | 3300025925 | Bacteria | 631 |
| 700 | Ga0207659_10047426 | 3300025926 | Bacteria | 3039 |
| 701 | Ga0207659_10060415 | 3300025926 | Bacteria | 2728 |
| 702 | Ga0207659_10143781 | 3300025926 | Unclassified | 1854 |
| 703 | Ga0207659_10148180 | 3300025926 | Bacteria | 1830 |
| 704 | Ga0207659_10202966 | 3300025926 | Bacteria | 1584 |
| 705 | Ga0207700_10173559 | 3300025928 | Bacteria | 1800 |
| 706 | Ga0207644_10189340 | 3300025931 | Bacteria | 1617 |
| 707 | Ga0207644_10469426 | 3300025931 | Bacteria | 1035 |
| 708 | Ga0207644_10982591 | 3300025931 | Unclassified | 708 |
| 709 | Ga0207690_10018918 | 3300025932 | Bacteria | 4230 |
| 710 | Ga0207690_10054218 | 3300025932 | Bacteria | 2695 |
| 711 | Ga0207690_10422486 | 3300025932 | Bacteria | 1067 |
| 712 | Ga0207690_10670583 | 3300025932 | Bacteria | 851 |
| 713 | Ga0207706_10003683 | 3300025933 | Bacteria | 14626 |
| 714 | Ga0207706_10010531 | 3300025933 | Bacteria | 8449 |
| 715 | Ga0207706_10017175 | 3300025933 | Bacteria | 6524 |
| 716 | Ga0207706_10101041 | 3300025933 | Unclassified | 2537 |
| 717 | Ga0207686_10000566 | 3300025934 | Bacteria | 23556 |
| 718 | Ga0207686_10026799 | 3300025934 | Bacteria | 3367 |
| 719 | Ga0207686_10084286 | 3300025934 | Unclassified | 2082 |
| 720 | Ga0207686_10084847 | 3300025934 | Bacteria | 2076 |
| 721 | Ga0207670_10006649 | 3300025936 | Bacteria | 6430 |
| 722 | Ga0207670_10051646 | 3300025936 | Bacteria | 2762 |
| 723 | Ga0207670_10076842 | 3300025936 | Unclassified | 2324 |
| 724 | Ga0207670_10665873 | 3300025936 | Bacteria | 859 |
| 725 | Ga0207669_10036603 | 3300025937 | Bacteria | 2807 |
| 726 | Ga0207704_10059094 | 3300025938 | Unclassified | 2365 |
| 727 | Ga0207704_10119555 | 3300025938 | Bacteria | 1800 |
| 728 | Ga0207704_11263045 | 3300025938 | Bacteria | 631 |
| 729 | Ga0207691_10038799 | 3300025940 | Bacteria | 4407 |
| 730 | Ga0207691_10038981 | 3300025940 | Bacteria | 4397 |
| 731 | Ga0207691_10071677 | 3300025940 | Bacteria | 3126 |
| 732 | Ga0207691_10418132 | 3300025940 | Bacteria | 1142 |
| 733 | Ga0207711_10072884 | 3300025941 | Bacteria | 2984 |
| 734 | Ga0207689_10001807 | 3300025942 | Bacteria | 20189 |
| 735 | Ga0207689_10002381 | 3300025942 | Bacteria | 17551 |
| 736 | Ga0207689_10031443 | 3300025942 | Bacteria | 4419 |
| 737 | Ga0207689_10038046 | 3300025942 | Bacteria | 3986 |
| 738 | Ga0207689_10061252 | 3300025942 | Bacteria | 3094 |
| 739 | Ga0207689_10064252 | 3300025942 | Unclassified | 3020 |
| 740 | Ga0207689_10068029 | 3300025942 | Unclassified | 2927 |
| 741 | Ga0207689_10237167 | 3300025942 | Unclassified | 1507 |
| 742 | Ga0207661_10044753 | 3300025944 | Unclassified | 3500 |
| 743 | Ga0207661_10086625 | 3300025944 | Bacteria | 2600 |
| 744 | Ga0207661_10200568 | 3300025944 | Bacteria | 1754 |
| 745 | Ga0207661_10661475 | 3300025944 | Bacteria | 960 |
| 746 | Ga0207661_11094758 | 3300025944 | Bacteria | 734 |
| 747 | Ga0207679_10035069 | 3300025945 | Bacteria | 3546 |
| 748 | Ga0207679_10208287 | 3300025945 | Bacteria | 1638 |
| 749 | Ga0207679_10281206 | 3300025945 | Bacteria | 1427 |
| 750 | Ga0207679_10989854 | 3300025945 | Bacteria | 771 |
| 751 | Ga0207679_11203457 | 3300025945 | Unclassified | 695 |
| 752 | Ga0207679_11487137 | 3300025945 | Bacteria | 621 |
| 753 | Ga0207667_10000180 | 3300025949 | Bacteria | 92094 |
| 754 | Ga0207667_10001242 | 3300025949 | Bacteria | 31953 |
| 755 | Ga0207667_10010652 | 3300025949 | Bacteria | 10730 |
| 756 | Ga0207667_10037467 | 3300025949 | Bacteria | 5182 |
| 757 | Ga0207667_10136977 | 3300025949 | Unclassified | 2521 |
| 758 | Ga0207667_10298811 | 3300025949 | Unclassified | 1645 |
| 759 | Ga0207667_10503494 | 3300025949 | Bacteria | 1228 |
| 760 | Ga0207667_10897767 | 3300025949 | Bacteria | 878 |
| 761 | Ga0207667_11033621 | 3300025949 | Bacteria | 807 |
| 762 | Ga0207651_10010650 | 3300025960 | Bacteria | 5107 |
| 763 | Ga0207651_10012494 | 3300025960 | Bacteria | 4810 |
| 764 | Ga0207651_10037783 | 3300025960 | Bacteria | 3166 |
| 765 | Ga0207651_10072767 | 3300025960 | Bacteria | 2441 |
| 766 | Ga0207651_10230532 | 3300025960 | Bacteria | 1503 |
| 767 | Ga0207651_10377263 | 3300025960 | Bacteria | 1201 |
| 768 | Ga0207651_11170251 | 3300025960 | Bacteria | 690 |
| 769 | Ga0207712_10005755 | 3300025961 | Bacteria | 7814 |
| 770 | Ga0207712_10006003 | 3300025961 | Bacteria | 7665 |
| 771 | Ga0207712_10006416 | 3300025961 | Bacteria | 7422 |
| 772 | Ga0207712_10027394 | 3300025961 | Unclassified | 3805 |
| 773 | Ga0207712_10187097 | 3300025961 | Bacteria | 1631 |
| 774 | Ga0207712_10250565 | 3300025961 | Bacteria | 1431 |
| 775 | Ga0207712_10534462 | 3300025961 | Bacteria | 1006 |
| 776 | Ga0207712_10608735 | 3300025961 | Unclassified | 946 |
| 777 | Ga0207668_10275550 | 3300025972 | Bacteria | 1377 |
| 778 | Ga0207668_10284483 | 3300025972 | Bacteria | 1357 |
| 779 | Ga0207668_10422123 | 3300025972 | Bacteria | 1132 |
| 780 | Ga0207668_10560571 | 3300025972 | Unclassified | 991 |
| 781 | Ga0207668_10813693 | 3300025972 | Unclassified | 828 |
| 782 | Ga0207640_10094771 | 3300025981 | Unclassified | 2077 |
| 783 | Ga0207640_10270100 | 3300025981 | Unclassified | 1330 |
| 784 | Ga0207640_10588963 | 3300025981 | Unclassified | 940 |
| 785 | Ga0207640_10741026 | 3300025981 | Bacteria | 846 |
| 786 | Ga0207640_10820015 | 3300025981 | Bacteria | 807 |
| 787 | Ga0207658_10010035 | 3300025986 | Bacteria | 6433 |
| 788 | Ga0207658_10013694 | 3300025986 | Bacteria | 5547 |
| 789 | Ga0207658_10015647 | 3300025986 | Bacteria | 5208 |
| 790 | Ga0207658_10085836 | 3300025986 | Bacteria | 2425 |
| 791 | Ga0207658_10533184 | 3300025986 | Bacteria | 1049 |
| 792 | Ga0207658_10534972 | 3300025986 | Bacteria | 1047 |
| 793 | Ga0207658_10674721 | 3300025986 | Bacteria | 933 |
| 794 | Ga0207658_10836335 | 3300025986 | Bacteria | 837 |
| 795 | Ga0207658_10902826 | 3300025986 | Bacteria | 804 |
| 796 | Ga0207677_10034608 | 3300026023 | Unclassified | 3273 |
| 797 | Ga0207677_10121384 | 3300026023 | Unclassified | 1966 |
| 798 | Ga0207677_10331101 | 3300026023 | Bacteria | 1269 |
| 799 | Ga0207677_10402460 | 3300026023 | Bacteria | 1161 |
| 800 | Ga0207677_10469216 | 3300026023 | Bacteria | 1082 |
| 801 | Ga0207703_10011653 | 3300026035 | Bacteria | 6838 |
| 802 | Ga0207703_10166753 | 3300026035 | Bacteria | 1933 |
| 803 | Ga0207703_10171092 | 3300026035 | Unclassified | 1911 |
| 804 | Ga0207703_10173298 | 3300026035 | Bacteria | 1899 |
| 805 | Ga0207703_10353098 | 3300026035 | Bacteria | 1354 |
| 806 | Ga0207703_11219852 | 3300026035 | Bacteria | 723 |
| 807 | Ga0207639_10017754 | 3300026041 | Bacteria | 5046 |
| 808 | Ga0207639_10057967 | 3300026041 | Bacteria | 2976 |
| 809 | Ga0207639_10085656 | 3300026041 | Unclassified | 2507 |
| 810 | Ga0207639_10090305 | 3300026041 | Bacteria | 2450 |
| 811 | Ga0207639_10129991 | 3300026041 | Unclassified | 2083 |
| 812 | Ga0207639_10182169 | 3300026041 | Bacteria | 1788 |
| 813 | Ga0207639_10193318 | 3300026041 | Unclassified | 1739 |
| 814 | Ga0207639_10219741 | 3300026041 | Bacteria | 1640 |
| 815 | Ga0207639_10274230 | 3300026041 | Bacteria | 1481 |
| 816 | Ga0207639_10387197 | 3300026041 | Unclassified | 1257 |
| 817 | Ga0207639_10513991 | 3300026041 | Unclassified | 1096 |
| 818 | Ga0207639_10517415 | 3300026041 | Bacteria | 1092 |
| 819 | Ga0207678_10013249 | 3300026067 | Bacteria | 7236 |
| 820 | Ga0207678_10025297 | 3300026067 | Bacteria | 5183 |
| 821 | Ga0207678_10473976 | 3300026067 | Bacteria | 1090 |
| 822 | Ga0207708_10055201 | 3300026075 | Bacteria | 3029 |
| 823 | Ga0207708_10171334 | 3300026075 | Unclassified | 1719 |
| 824 | Ga0207708_10270332 | 3300026075 | Unclassified | 1375 |
| 825 | Ga0207708_10277100 | 3300026075 | Bacteria | 1358 |
| 826 | Ga0207702_10020186 | 3300026078 | Bacteria | 5519 |
| 827 | Ga0207702_10035062 | 3300026078 | Bacteria | 4196 |
| 828 | Ga0207702_10096906 | 3300026078 | Unclassified | 2595 |
| 829 | Ga0207702_10276068 | 3300026078 | Bacteria | 1587 |
| 830 | Ga0207702_10327443 | 3300026078 | Bacteria | 1460 |
| 831 | Ga0207702_10388892 | 3300026078 | Bacteria | 1343 |
| 832 | Ga0207702_10833731 | 3300026078 | Bacteria | 912 |
| 833 | Ga0207641_10000026 | 3300026088 | Bacteria | 245091 |
| 834 | Ga0207641_10005426 | 3300026088 | Bacteria | 10884 |
| 835 | Ga0207641_10017939 | 3300026088 | Bacteria | 5798 |
| 836 | Ga0207641_10176113 | 3300026088 | Bacteria | 1956 |
| 837 | Ga0207641_11260860 | 3300026088 | Bacteria | 739 |
| 838 | Ga0207648_10001213 | 3300026089 | Bacteria | 28877 |
| 839 | Ga0207648_10007648 | 3300026089 | Bacteria | 10579 |
| 840 | Ga0207648_10014790 | 3300026089 | Bacteria | 7200 |
| 841 | Ga0207648_10030498 | 3300026089 | Bacteria | 4775 |
| 842 | Ga0207648_10041867 | 3300026089 | Bacteria | 4022 |
| 843 | Ga0207648_10061589 | 3300026089 | Unclassified | 3272 |
| 844 | Ga0207648_10074826 | 3300026089 | Bacteria | 2952 |
| 845 | Ga0207648_10159502 | 3300026089 | Unclassified | 1992 |
| 846 | Ga0207648_10228615 | 3300026089 | Bacteria | 1654 |
| 847 | Ga0207648_10257316 | 3300026089 | Bacteria | 1557 |
| 848 | Ga0207648_10271895 | 3300026089 | Unclassified | 1514 |
| 849 | Ga0207648_10341461 | 3300026089 | Bacteria | 1348 |
| 850 | Ga0207648_10435514 | 3300026089 | Bacteria | 1192 |
| 851 | Ga0207676_10003733 | 3300026095 | Bacteria | 10770 |
| 852 | Ga0207676_10022021 | 3300026095 | Bacteria | 4683 |
| 853 | Ga0207676_10110561 | 3300026095 | Unclassified | 2299 |
| 854 | Ga0207676_10165085 | 3300026095 | Unclassified | 1923 |
| 855 | Ga0207676_10197866 | 3300026095 | Bacteria | 1773 |
| 856 | Ga0207676_10250562 | 3300026095 | Unclassified | 1594 |
| 857 | Ga0207676_10255199 | 3300026095 | Bacteria | 1580 |
| 858 | Ga0207676_10367481 | 3300026095 | Bacteria | 1335 |
| 859 | Ga0207676_10828548 | 3300026095 | Unclassified | 904 |
| 860 | Ga0207674_10000453 | 3300026116 | Bacteria | 53589 |
| 861 | Ga0207674_10001740 | 3300026116 | Bacteria | 27826 |
| 862 | Ga0207674_10020171 | 3300026116 | Bacteria | 7209 |
| 863 | Ga0207674_10035333 | 3300026116 | Bacteria | 5216 |
| 864 | Ga0207674_10042617 | 3300026116 | Bacteria | 4686 |
| 865 | Ga0207674_10045794 | 3300026116 | Unclassified | 4496 |
| 866 | Ga0207674_10074285 | 3300026116 | Bacteria | 3412 |
| 867 | Ga0207674_10164728 | 3300026116 | Bacteria | 2171 |
| 868 | Ga0207674_10394279 | 3300026116 | Bacteria | 1338 |
| 869 | Ga0207674_10397971 | 3300026116 | Bacteria | 1331 |
| 870 | Ga0207674_10525345 | 3300026116 | Bacteria | 1143 |
| 871 | Ga0207674_10551368 | 3300026116 | Bacteria | 1113 |
| 872 | Ga0207674_10800051 | 3300026116 | Bacteria | 910 |
| 873 | Ga0207674_11371301 | 3300026116 | Bacteria | 676 |
| 874 | Ga0207675_100022617 | 3300026118 | Bacteria | 5852 |
| 875 | Ga0207675_100033929 | 3300026118 | Bacteria | 4756 |
| 876 | Ga0207675_100036164 | 3300026118 | Bacteria | 4606 |
| 877 | Ga0207675_100038705 | 3300026118 | Bacteria | 4450 |
| 878 | Ga0207675_100109559 | 3300026118 | Bacteria | 2605 |
| 879 | Ga0207675_100155014 | 3300026118 | Unclassified | 2183 |
| 880 | Ga0207675_100306487 | 3300026118 | Bacteria | 1548 |
| 881 | Ga0207675_100409708 | 3300026118 | Bacteria | 1337 |
| 882 | Ga0207675_100571767 | 3300026118 | Bacteria | 1131 |
| 883 | Ga0207683_10025008 | 3300026121 | Bacteria | 5148 |
| 884 | Ga0207683_10126348 | 3300026121 | Bacteria | 2298 |
| 885 | Ga0207683_10218066 | 3300026121 | Bacteria | 1738 |
| 886 | Ga0207683_10260139 | 3300026121 | Unclassified | 1585 |
| 887 | Ga0207683_10682986 | 3300026121 | Bacteria | 952 |
| 888 | Ga0207683_10718741 | 3300026121 | Unclassified | 926 |
| 889 | Ga0207698_10000830 | 3300026142 | Bacteria | 17890 |
| 890 | Ga0207698_10036047 | 3300026142 | Bacteria | 3626 |
| 891 | Ga0207698_10064694 | 3300026142 | Unclassified | 2868 |
| 892 | Ga0207698_10138597 | 3300026142 | Bacteria | 2091 |
| 893 | Ga0207698_10149903 | 3300026142 | Bacteria | 2022 |
| 894 | Ga0207698_10190194 | 3300026142 | Bacteria | 1827 |
| 895 | Ga0207698_10359489 | 3300026142 | Bacteria | 1378 |
| 896 | Ga0207698_10392394 | 3300026142 | Unclassified | 1324 |
| 897 | Ga0207698_10483843 | 3300026142 | Unclassified | 1201 |
| 898 | Ga0207698_10535157 | 3300026142 | Bacteria | 1146 |
| 899 | Ga0207698_10859186 | 3300026142 | Bacteria | 913 |
| 900 | Ga0207698_11613923 | 3300026142 | Bacteria | 664 |
| 901 | Ga0207698_11801735 | 3300026142 | Bacteria | 627 |
| 902 | Ga0209968_1013270 | 3300027526 | Bacteria | 1291 |
| 903 | Ga0209999_1058914 | 3300027543 | Bacteria | 730 |
| 904 | Ga0209974_10022087 | 3300027876 | Bacteria | 2107 |
| 905 | Ga0207428_10030792 | 3300027907 | Unclassified | 4433 |
| 906 | Ga0207428_10074787 | 3300027907 | Unclassified | 2656 |
| 907 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 908 | Ga0268266_10081492 | 3300028379 | Unclassified | 2822 |
| 909 | Ga0268265_10151542 | 3300028380 | Bacteria | 1956 |
| 910 | Ga0268265_10329942 | 3300028380 | Bacteria | 1385 |
| 911 | Ga0268265_10821493 | 3300028380 | Bacteria | 907 |
| 912 | Ga0268265_10977022 | 3300028380 | Bacteria | 835 |
| 913 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 914 | Ga0268264_10001210 | 3300028381 | Bacteria | 24862 |
| 915 | Ga0268264_10002077 | 3300028381 | Bacteria | 17877 |
| 916 | Ga0268264_10003832 | 3300028381 | Bacteria | 12897 |
| 917 | Ga0268264_10127217 | 3300028381 | Bacteria | 2254 |
| 918 | Ga0268264_10251916 | 3300028381 | Unclassified | 1641 |
| 919 | Ga0268264_10366947 | 3300028381 | Bacteria | 1375 |
| 920 | Ga0268264_10389131 | 3300028381 | Bacteria | 1337 |
| 921 | Ga0307517_10000268 | 3300028786 | Bacteria | 89531 |
| 922 | Ga0307517_10200984 | 3300028786 | Unclassified | 1246 |
| 923 | Ga0307515_10001389 | 3300028794 | Bacteria | 54743 |
| 924 | Ga0307515_10513749 | 3300028794 | Bacteria | 808 |
| 925 | Ga0307511_10001580 | 3300030521 | Bacteria | 24156 |
| 926 | Ga0265340_10064939 | 3300031247 | Bacteria | 1739 |
| 927 | Ga0265331_10244831 | 3300031250 | Unclassified | 804 |
| 928 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 929 | Ga0265327_10017630 | 3300031251 | Bacteria | 4467 |
| 930 | Ga0307513_10082237 | 3300031456 | Bacteria | 3316 |
| 931 | Ga0307513_10369580 | 3300031456 | Bacteria | 1177 |
| 932 | Ga0307513_10573527 | 3300031456 | Bacteria | 839 |
| 933 | Ga0307513_10783611 | 3300031456 | Bacteria | 659 |
| 934 | Ga0307508_10000111 | 3300031616 | Bacteria | 96733 |
| 935 | Ga0265314_10058741 | 3300031711 | Bacteria | 2635 |
| 936 | Ga0307516_10000159 | 3300031730 | Bacteria | 84553 |
| 937 | Ga0307416_101432492 | 3300032002 | Unclassified | 797 |
| 938 | Ga0307414_10183423 | 3300032004 | Bacteria | 1686 |
| 939 | Ga0307414_10473802 | 3300032004 | Bacteria | 1103 |
| 940 | Ga0307510_10001684 | 3300033180 | Bacteria | 24528 |
| 941 | Ga0373934_0019498 | 3300035086 | Bacteria | 2604 |
| 942 | Ga0373923_0438285 | 3300035111 | Bacteria | 632 |
| 943 | Ga0373957_0110685 | 3300035120 | Bacteria | 1106 |
| 944 | Ga0373924_0010674 | 3300035410 | Bacteria | 3397 |
| 945 | Ga0373933_0270837 | 3300035724 | Bacteria | 1096 |
| 946 | Ga0373947_0339791 | 3300035725 | Bacteria | 1006 |
| 947 | Ga0373937_0068823 | 3300036401 | Bacteria | 3263 |
| 948 | Ga0373937_0200324 | 3300036401 | Bacteria | 1877 |
| 949 | Ga0373925_0470400 | 3300037068 | Bacteria | 1031 |
| 950 | Ga0395899_0005839 | 3300037312 | Bacteria | 9553 |
| 951 | Ga0395899_0020958 | 3300037312 | Bacteria | 4957 |
| 952 | Ga0395899_0032489 | 3300037312 | Bacteria | 3920 |
| 953 | Ga0395899_0322872 | 3300037312 | Bacteria | 1039 |
| 954 | Ga0395900_0010296 | 3300037418 | Bacteria | 9567 |
| 955 | Ga0395900_0015664 | 3300037418 | Bacteria | 7728 |
| 956 | Ga0395900_0056510 | 3300037418 | Bacteria | 4039 |
| 957 | Ga0395900_0128740 | 3300037418 | Bacteria | 2595 |
| 958 | Ga0395900_0129016 | 3300037418 | Bacteria | 2592 |
| 959 | Ga0395898_0004833 | 3300037466 | Bacteria | 14648 |
| 960 | Ga0395898_0020188 | 3300037466 | Bacteria | 6768 |
| 961 | Ga0395898_0295902 | 3300037466 | Bacteria | 1544 |
| 962 | Ga0395898_0749861 | 3300037466 | Unclassified | 918 |
| 963 | Ga0395905_0010763 | 3300037471 | Bacteria | 8868 |
| 964 | Ga0395905_0020396 | 3300037471 | Bacteria | 6280 |
| 965 | Ga0395901_0002626 | 3300038443 | Bacteria | 18173 |
| 966 | Ga0395901_0014807 | 3300038443 | Bacteria | 7925 |
| 967 | Ga0395901_0025466 | 3300038443 | Bacteria | 6074 |
| 968 | Ga0395901_0549958 | 3300038443 | Unclassified | 1170 |
| 969 | Ga0436365_0497393 | 3300039437 | Bacteria | 1532 |
| 970 | Ga0439436_0012141 | 3300041404 | Bacteria | 2615 |
| 971 | Ga0439439_0024462 | 3300041406 | Bacteria | 1516 |
| 972 | Ga0439439_0054428 | 3300041406 | Bacteria | 1054 |
| 973 | Ga0451797_1199432 | 3300041453 | Bacteria | 883 |
| 974 | Ga0451795_0085537 | 3300041456 | Bacteria | 1018 |
| 975 | Ga0451802_1247859 | 3300041460 | Bacteria | 1110 |
| 976 | Ga0451807_0273900 | 3300041486 | Unclassified | 687 |
| 977 | Ga0451833_0278687 | 3300041491 | Bacteria | 757 |
| 978 | Ga0451839_1215289 | 3300041496 | Bacteria | 1114 |
| 979 | Ga0451851_0050209 | 3300041507 | Unclassified | 1173 |
| 980 | Ga0451851_0676225 | 3300041507 | Bacteria | 876 |
| 981 | Ga0439431_0194051 | 3300041997 | Bacteria | 590 |
| 982 | Ga0439441_058853 | 3300042001 | Bacteria | 805 |
| 983 | Ga0439449_0021289 | 3300042007 | Bacteria | 2428 |
| 984 | Ga0439449_0058701 | 3300042007 | Bacteria | 1420 |
| 985 | Ga0439449_0105950 | 3300042007 | Bacteria | 1040 |
| 986 | Ga0439457_013480 | 3300042014 | Bacteria | 1837 |
| 987 | Ga0439457_035535 | 3300042014 | Unclassified | 1108 |
| 988 | Ga0439457_070358 | 3300042014 | Bacteria | 797 |
| 989 | Ga0439457_121145 | 3300042014 | Bacteria | 618 |
| 990 | Ga0451577_0595004 | 3300042876 | Bacteria | 1004 |
| 991 | Ga0466969_0061025 | 3300044656 | Bacteria | 1832 |
| 992 | Ga0466969_0151608 | 3300044656 | Bacteria | 1068 |
| 993 | Ga0466969_0320374 | 3300044656 | Bacteria | 702 |
| 994 | Ga0466972_0000080 | 3300044658 | Bacteria | 89226 |
| 995 | Ga0466972_0042617 | 3300044658 | Bacteria | 2205 |
| 996 | Ga0466966_0000096 | 3300044684 | Bacteria | 54307 |
| 997 | Ga0466961_0061721 | 3300044693 | Bacteria | 2382 |
| 998 | Ga0466964_0179775 | 3300044706 | Bacteria | 1002 |
| 999 | Ga0453684_0019697 | 3300044712 | Bacteria | 10244 |
| 1000 | Ga0453684_0124567 | 3300044712 | Unclassified | 3104 |
| 1001 | Ga0466971_0023766 | 3300044719 | Bacteria | 2732 |
| 1002 | Ga0466968_0024425 | 3300044735 | Bacteria | 2469 |
| 1003 | Ga0466968_0048687 | 3300044735 | Bacteria | 1804 |
| 1004 | Ga0466968_0084148 | 3300044735 | Bacteria | 1402 |
| 1005 | Ga0466968_0112026 | 3300044735 | Bacteria | 1228 |
| 1006 | Ga0466970_0006114 | 3300044765 | Bacteria | 6000 |
| 1007 | Ga0466970_0247563 | 3300044765 | Bacteria | 998 |
| 1008 | Ga0466970_0580314 | 3300044765 | Unclassified | 649 |
| 1009 | Ga0466957_0001278 | 3300044842 | Bacteria | 13115 |
| 1010 | Ga0466957_0082174 | 3300044842 | Bacteria | 2008 |
| 1011 | Ga0466957_0147062 | 3300044842 | Bacteria | 1521 |
| 1012 | Ga0466959_0000014 | 3300045049 | Bacteria | 150962 |
| 1013 | Ga0466959_0001662 | 3300045049 | Bacteria | 13780 |
| 1014 | Ga0451576_0168670 | 3300045051 | Bacteria | 2285 |
| 1015 | Ga0451576_0493688 | 3300045051 | Bacteria | 1286 |
| 1016 | Ga0451576_1299611 | 3300045051 | Bacteria | 758 |
| 1017 | Ga0466958_0099617 | 3300045836 | Bacteria | 1806 |
| 1018 | Ga0495638_0027719 | 3300046460 | Bacteria | 3665 |
| 1019 | Ga0495638_0045152 | 3300046460 | Unclassified | 2773 |
| 1020 | Ga0495638_0091661 | 3300046460 | Bacteria | 1830 |
| 1021 | Ga0495638_0237698 | 3300046460 | Bacteria | 1010 |
| 1022 | Ga0495653_0046892 | 3300046463 | Bacteria | 3344 |
| 1023 | Ga0495650_0014644 | 3300046471 | Bacteria | 4064 |
| 1024 | Ga0495582_0317533 | 3300046473 | Bacteria | 896 |
| 1025 | Ga0495606_0005929 | 3300046507 | Bacteria | 11479 |
| 1026 | Ga0495628_0288377 | 3300046516 | Bacteria | 1217 |
| 1027 | Ga0495630_0534010 | 3300046517 | Bacteria | 899 |
| 1028 | Ga0495648_0005586 | 3300046524 | Bacteria | 10426 |
| 1029 | Ga0495598_0230881 | 3300046537 | Bacteria | 679 |
| 1030 | Ga0495645_0232387 | 3300046543 | Bacteria | 1235 |
| 1031 | Ga0495667_0038657 | 3300046559 | Bacteria | 3177 |
| 1032 | Ga0495668_0003219 | 3300046616 | Bacteria | 12457 |
| 1033 | Ga0495634_0043429 | 3300046642 | Bacteria | 3046 |
| 1034 | Ga0495611_0000677 | 3300046648 | Bacteria | 19441 |
| 1035 | Ga0495611_0027335 | 3300046648 | Unclassified | 2493 |
| 1036 | Ga0495625_0237882 | 3300046660 | Bacteria | 1187 |
| 1037 | Ga0495625_0650538 | 3300046660 | Bacteria | 628 |
| 1038 | Ga0495635_0245531 | 3300046663 | Bacteria | 1208 |
| 1039 | Ga0495657_0173641 | 3300046675 | Bacteria | 1326 |
| 1040 | Ga0495599_0073930 | 3300046678 | Bacteria | 2128 |
| 1041 | Ga0495613_0212328 | 3300046689 | Bacteria | 1361 |
| 1042 | Ga0495670_0221185 | 3300046691 | Unclassified | 1006 |
| 1043 | Ga0495670_0317142 | 3300046691 | Bacteria | 837 |
| 1044 | Ga0495581_0304871 | 3300047315 | Bacteria | 931 |
| 1045 | Ga0495674_0035491 | 3300047319 | Bacteria | 4497 |
| 1046 | Ga0495672_0009163 | 3300047320 | Bacteria | 7209 |
| 1047 | Ga0495672_0014024 | 3300047320 | Bacteria | 5506 |
| 1048 | Ga0495672_0103729 | 3300047320 | Bacteria | 1538 |
| 1049 | Ga0495676_0144496 | 3300047321 | Bacteria | 1701 |
| 1050 | Ga0495680_0082504 | 3300047322 | Bacteria | 2426 |
| 1051 | Ga0495687_023288 | 3300047443 | Bacteria | 2959 |
| 1052 | Ga0495684_0150059 | 3300047471 | Bacteria | 1743 |
| 1053 | Ga0495684_0413791 | 3300047471 | Bacteria | 944 |
| 1054 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 1055 | Ga0496100_0012853 | 3300048903 | Bacteria | 4813 |
| 1056 | Ga0496100_0484399 | 3300048903 | Unclassified | 952 |
| 1057 | Ga0496101_0012680 | 3300048904 | Bacteria | 5633 |
| 1058 | Ga0496101_1150944 | 3300048904 | Bacteria | 609 |
| 1059 | Ga0496104_0174376 | 3300048907 | Unclassified | 2061 |
| 1060 | Ga0496105_0392991 | 3300048908 | Unclassified | 1102 |
| 1061 | Ga0496107_0736356 | 3300048910 | Bacteria | 724 |
| 1062 | Ga0496110_0031968 | 3300048913 | Bacteria | 4542 |
| 1063 | Ga0496112_0269226 | 3300048915 | Unclassified | 1652 |
| 1064 | Ga0501290_001460 | 3300049513 | Unclassified | 3230 |
| 1065 | Ga0501290_006667 | 3300049513 | Bacteria | 1446 |
| 1066 | Ga0501296_024522 | 3300049519 | Unclassified | 786 |
| 1067 | Ga0501298_003874 | 3300049521 | Unclassified | 2336 |
| 1068 | Ga0501031_0004581 | 3300049568 | Bacteria | 8967 |
| 1069 | Ga0501032_0063789 | 3300049569 | Bacteria | 2466 |
| 1070 | Ga0501033_0161184 | 3300049570 | Unclassified | 1615 |
| 1071 | Ga0501033_0201147 | 3300049570 | Bacteria | 1423 |
| 1072 | Ga0501033_0898040 | 3300049570 | Bacteria | 596 |
| 1073 | Ga0501034_0000152 | 3300049571 | Bacteria | 130576 |
| 1074 | Ga0501034_0011131 | 3300049571 | Bacteria | 9337 |
| 1075 | Ga0501034_0015409 | 3300049571 | Bacteria | 7857 |
| 1076 | Ga0501034_0042137 | 3300049571 | Bacteria | 4621 |
| 1077 | Ga0501034_0068545 | 3300049571 | Bacteria | 3557 |
| 1078 | Ga0501034_0687373 | 3300049571 | Bacteria | 922 |
| 1079 | Ga0501036_0000845 | 3300049572 | Bacteria | 22806 |
| 1080 | Ga0501036_0016624 | 3300049572 | Bacteria | 6143 |
| 1081 | Ga0501036_0877770 | 3300049572 | Bacteria | 737 |
| 1082 | Ga0501036_1185225 | 3300049572 | Bacteria | 623 |
| 1083 | Ga0501037_0006935 | 3300049573 | Bacteria | 8275 |
| 1084 | Ga0501037_0122464 | 3300049573 | Bacteria | 1869 |
| 1085 | Ga0501037_0135461 | 3300049573 | Bacteria | 1764 |
| 1086 | Ga0501037_0517378 | 3300049573 | Bacteria | 808 |
| 1087 | Ga0501038_0002256 | 3300049574 | Bacteria | 17927 |
| 1088 | Ga0501038_0037776 | 3300049574 | Bacteria | 4233 |
| 1089 | Ga0501038_0217195 | 3300049574 | Unclassified | 1527 |
| 1090 | Ga0501039_0012691 | 3300049575 | Bacteria | 6440 |
| 1091 | Ga0501039_0015887 | 3300049575 | Bacteria | 5763 |
| 1092 | Ga0501040_0375742 | 3300049576 | Bacteria | 1019 |
| 1093 | Ga0501043_0005938 | 3300049579 | Bacteria | 9820 |
| 1094 | Ga0501043_0010022 | 3300049579 | Bacteria | 7432 |
| 1095 | Ga0501043_0154073 | 3300049579 | Bacteria | 1798 |
| 1096 | Ga0501043_0292015 | 3300049579 | Bacteria | 1248 |
| 1097 | Ga0501046_0045889 | 3300049580 | Bacteria | 3468 |
| 1098 | Ga0501047_0061465 | 3300049581 | Bacteria | 3624 |
| 1099 | Ga0501047_0096960 | 3300049581 | Bacteria | 2827 |
| 1100 | Ga0501047_0099646 | 3300049581 | Bacteria | 2785 |
| 1101 | Ga0501047_0532496 | 3300049581 | Bacteria | 1000 |
| 1102 | Ga0501048_0007829 | 3300049582 | Bacteria | 8096 |
| 1103 | Ga0501068_0038801 | 3300049584 | Bacteria | 2854 |
| 1104 | Ga0501068_0201533 | 3300049584 | Bacteria | 1262 |
| 1105 | Ga0501070_0003721 | 3300049586 | Bacteria | 13173 |
| 1106 | Ga0501073_0065635 | 3300049589 | Bacteria | 2530 |
| 1107 | Ga0501074_0000310 | 3300049590 | Bacteria | 28251 |
| 1108 | Ga0501202_000352 | 3300049652 | Bacteria | 6385 |
| 1109 | Ga0501206_002631 | 3300049653 | Bacteria | 2258 |
| 1110 | Ga0501207_001265 | 3300049654 | Unclassified | 3124 |
| 1111 | Ga0501217_000979 | 3300049661 | Bacteria | 5142 |
| 1112 | Ga0501222_001624 | 3300049662 | Bacteria | 3120 |
| 1113 | Ga0501223_001473 | 3300049663 | Bacteria | 5443 |
| 1114 | Ga0501224_001055 | 3300049664 | Bacteria | 3589 |
| 1115 | Ga0501233_002017 | 3300049668 | Bacteria | 3539 |
| 1116 | Ga0501235_000033 | 3300049669 | Bacteria | 22695 |
| 1117 | Ga0501240_003815 | 3300049673 | Unclassified | 1710 |
| 1118 | Ga0501242_000410 | 3300049674 | Bacteria | 3670 |
| 1119 | Ga0501243_005195 | 3300049675 | Unclassified | 1957 |
| 1120 | Ga0501243_008997 | 3300049675 | Unclassified | 1548 |
| 1121 | Ga0501249_066909 | 3300049679 | Unclassified | 837 |
| 1122 | Ga0501250_000692 | 3300049680 | Bacteria | 2430 |
| 1123 | Ga0501252_025281 | 3300049682 | Unclassified | 799 |
| 1124 | Ga0501253_020816 | 3300049683 | Bacteria | 1149 |
| 1125 | Ga0501257_003324 | 3300049686 | Unclassified | 3444 |
| 1126 | Ga0501259_001264 | 3300049688 | Bacteria | 4228 |
| 1127 | Ga0501259_001910 | 3300049688 | Bacteria | 3452 |
| 1128 | Ga0501261_001114 | 3300049690 | Unclassified | 3287 |
| 1129 | Ga0501221_000390 | 3300049704 | Bacteria | 6716 |
| 1130 | Ga0501225_0001669 | 3300049705 | Bacteria | 6939 |
| 1131 | Ga0501225_0002369 | 3300049705 | Bacteria | 5813 |
| 1132 | Ga0501229_016862 | 3300049706 | Bacteria | 952 |
| 1133 | Ga0501229_033920 | 3300049706 | Unclassified | 708 |
| 1134 | Ga0501234_002103 | 3300049707 | Unclassified | 3149 |
| 1135 | Ga0501234_010646 | 3300049707 | Bacteria | 1435 |
| 1136 | Ga0501245_001585 | 3300049708 | Bacteria | 2956 |
| 1137 | Ga0501245_009929 | 3300049708 | Unclassified | 1371 |
| 1138 | Ga0501079_0012410 | 3300049741 | Bacteria | 6501 |
| 1139 | Ga0501080_0075085 | 3300049742 | Bacteria | 3144 |
| 1140 | Ga0501080_0535982 | 3300049742 | Bacteria | 1044 |
| 1141 | Ga0501083_0059502 | 3300049744 | Bacteria | 2555 |
| 1142 | Ga0501232_006551 | 3300049757 | Unclassified | 1201 |
| 1143 | Ga0501241_005859 | 3300049758 | Bacteria | 2280 |
| 1144 | Ga0501264_001553 | 3300049761 | Bacteria | 2404 |
| 1145 | Ga0501268_085470 | 3300049765 | Unclassified | 657 |
| 1146 | Ga0501270_054774 | 3300049767 | Unclassified | 732 |
| 1147 | Ga0501271_000833 | 3300049768 | Unclassified | 2625 |
| 1148 | Ga0501273_023774 | 3300049770 | Bacteria | 843 |
| 1149 | Ga0501279_003477 | 3300049775 | Unclassified | 2057 |
| 1150 | Ga0501280_040657 | 3300049776 | Unclassified | 753 |
| 1151 | Ga0501035_0001685 | 3300049822 | Bacteria | 22357 |
| 1152 | Ga0501035_0048223 | 3300049822 | Bacteria | 3820 |
| 1153 | Ga0501035_0209333 | 3300049822 | Unclassified | 1669 |
| 1154 | Ga0501035_0215869 | 3300049822 | Bacteria | 1640 |
| 1155 | Ga0501035_0221868 | 3300049822 | Bacteria | 1614 |
| 1156 | Ga0501044_0001606 | 3300049823 | Bacteria | 26442 |
| 1157 | Ga0501044_0010844 | 3300049823 | Bacteria | 9887 |
| 1158 | Ga0501044_0116978 | 3300049823 | Bacteria | 2670 |
| 1159 | Ga0501044_0222518 | 3300049823 | Bacteria | 1838 |
| 1160 | Ga0501044_0240108 | 3300049823 | Unclassified | 1756 |
| 1161 | Ga0501045_0015281 | 3300049824 | Bacteria | 5449 |
| 1162 | Ga0501212_000830 | 3300049851 | Bacteria | 3243 |
| 1163 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 1164 | nmdc:mga0k408_147843_c1 | 3300050493 | Bacteria | 1399 |
| 1165 | nmdc:mga07m45_362465_c1 | 3300050496 | Bacteria | 842 |
| 1166 | nmdc:mga05p37_3268_c1 | 3300050507 | Bacteria | 18878 |
| 1167 | nmdc:mga09592_1381_c1 | 3300050508 | Bacteria | 19424 |
| 1168 | nmdc:mga06r32_1422834_c1 | 3300050510 | Bacteria | 635 |
| 1169 | nmdc:mga08y16_1066083_c1 | 3300050511 | Bacteria | 785 |
| 1170 | nmdc:mga08y16_111150_c1 | 3300050511 | Bacteria | 2853 |
| 1171 | nmdc:mga08y16_415625_c1 | 3300050511 | Bacteria | 1375 |
| 1172 | nmdc:mga08y16_513560_c1 | 3300050511 | Unclassified | 1216 |
| 1173 | nmdc:mga0n895_1385888_c1 | 3300050512 | Unclassified | 672 |
| 1174 | nmdc:mga0n895_351149_c1 | 3300050512 | Bacteria | 1494 |
| 1175 | nmdc:mga0n895_890779_c1 | 3300050512 | Bacteria | 876 |
| 1176 | Ga0500578_0000325 | 3300053086 | Bacteria | 58251 |
| 1177 | Ga0500578_0448195 | 3300053086 | Bacteria | 735 |
| 1178 | Ga0500644_0028140 | 3300053088 | Bacteria | 1755 |
| 1179 | Ga0500646_0258448 | 3300053090 | Bacteria | 615 |
| 1180 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 1181 | Ga0500583_0000611 | 3300053092 | Bacteria | 10635 |
| 1182 | Ga0500583_0000925 | 3300053092 | Bacteria | 8389 |
| 1183 | Ga0500583_0121762 | 3300053092 | Unclassified | 1291 |
| 1184 | Ga0500641_0036500 | 3300053096 | Bacteria | 1966 |
| 1185 | Ga0500650_0064328 | 3300053098 | Bacteria | 1714 |
| 1186 | Ga0500650_0084187 | 3300053098 | Bacteria | 1488 |
| 1187 | Ga0500594_0028447 | 3300053118 | Bacteria | 1455 |
| 1188 | Ga0500642_0023825 | 3300053130 | Bacteria | 2464 |
| 1189 | Ga0500652_106860 | 3300053131 | Bacteria | 1170 |
| 1190 | Ga0500658_0099186 | 3300053134 | Bacteria | 1269 |
| 1191 | Ga0500559_0147057 | 3300053136 | Bacteria | 1105 |
| 1192 | Ga0500568_0000380 | 3300053139 | Bacteria | 33995 |
| 1193 | Ga0500568_0009824 | 3300053139 | Bacteria | 4521 |
| 1194 | Ga0500588_0009145 | 3300053146 | Bacteria | 2344 |
| 1195 | Ga0500588_0121823 | 3300053146 | Bacteria | 921 |
| 1196 | Ga0500616_0092276 | 3300053153 | Bacteria | 1497 |
| 1197 | Ga0500622_0008293 | 3300053156 | Bacteria | 5824 |
| 1198 | Ga0500622_0009755 | 3300053156 | Bacteria | 5302 |
| 1199 | Ga0500622_0069751 | 3300053156 | Bacteria | 1779 |
| 1200 | Ga0500639_017671 | 3300053163 | Bacteria | 3765 |
| 1201 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 1202 | Ga0501084_0080337 | 3300054114 | Bacteria | 2734 |
| 1203 | Ga0466962_0012015 | 3300061719 | Bacteria | 4165 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025901 | Ga0207688_10105504 | Ga0207688_101055042 | 175 |
| 2 | 3300025919 | Ga0207657_10193097 | Ga0207657_101930973 | 176 |
| 3 | 3300044712 | Ga0453684_0124567 | Ga0453684_0124567_856_1395 | 176 |
| 4 | iso_pu_bacteria | 2884791551 | 2884791794 | 176 |
| 5 | iso_pu_bacteria | 2929177148 | 2929182376 | 176 |
| 6 | iso_pu_bacteria | 2945977869 | 2945978290 | 176 |
| 7 | iso_pu_bacteria | 2946013367 | 2946015850 | 176 |
| 8 | 3300005335 | Ga0070666_10330912 | Ga0070666_103309122 | 177 |
| 9 | 3300005338 | Ga0068868_100225796 | Ga0068868_1002257963 | 177 |
| 10 | 3300005367 | Ga0070667_100242968 | Ga0070667_1002429683 | 177 |
| 11 | 3300005367 | Ga0070667_100514326 | Ga0070667_1005143262 | 177 |
| 12 | 3300005618 | Ga0068864_100395007 | Ga0068864_1003950072 | 177 |
| 13 | 3300005718 | Ga0068866_10333639 | Ga0068866_103336392 | 177 |
| 14 | 3300005843 | Ga0068860_100008404 | Ga0068860_1000084048 | 177 |
| 15 | 3300009093 | Ga0105240_10017580 | Ga0105240_100175803 | 177 |
| 16 | 3300009545 | Ga0105237_10000855 | Ga0105237_100008558 | 177 |
| 17 | 3300010375 | Ga0105239_10002300 | Ga0105239_1000230012 | 177 |
| 18 | 3300013297 | Ga0157378_10386911 | Ga0157378_103869111 | 177 |
| 19 | 3300025903 | Ga0207680_10365260 | Ga0207680_103652601 | 177 |
| 20 | 3300025913 | Ga0207695_10309139 | Ga0207695_103091392 | 177 |
| 21 | 3300025914 | Ga0207671_10018700 | Ga0207671_100187005 | 177 |
| 22 | 3300025938 | Ga0207704_10119555 | Ga0207704_101195554 | 177 |
| 23 | 3300025961 | Ga0207712_10187097 | Ga0207712_101870972 | 177 |
| 24 | 3300025986 | Ga0207658_10534972 | Ga0207658_105349721 | 177 |
| 25 | 3300025986 | Ga0207658_10674721 | Ga0207658_106747211 | 177 |
| 26 | 3300026095 | Ga0207676_10367481 | Ga0207676_103674811 | 177 |
| 27 | 3300028381 | Ga0268264_10003832 | Ga0268264_100038327 | 177 |
| 28 | iso_pu_bacteria | 2738541278 | 2738725470 | 177 |
| 29 | 3300003323 | rootH1_10383519 | rootH1_103835192 | 178 |
| 30 | 3300005327 | Ga0070658_10159764 | Ga0070658_101597642 | 178 |
| 31 | 3300005327 | Ga0070658_10487147 | Ga0070658_104871472 | 178 |
| 32 | 3300005336 | Ga0070680_100002240 | Ga0070680_1000022408 | 178 |
| 33 | 3300005366 | Ga0070659_100532386 | Ga0070659_1005323861 | 178 |
| 34 | 3300005455 | Ga0070663_100012747 | Ga0070663_1000127472 | 178 |
| 35 | 3300005458 | Ga0070681_10001251 | Ga0070681_1000125110 | 178 |
| 36 | 3300005530 | Ga0070679_100043996 | Ga0070679_1000439962 | 178 |
| 37 | 3300005530 | Ga0070679_100911299 | Ga0070679_1009112991 | 178 |
| 38 | 3300005563 | Ga0068855_100056286 | Ga0068855_1000562862 | 178 |
| 39 | 3300005578 | Ga0068854_100155004 | Ga0068854_1001550042 | 178 |
| 40 | 3300005614 | Ga0068856_100014455 | Ga0068856_1000144556 | 178 |
| 41 | 3300009093 | Ga0105240_10068817 | Ga0105240_100688175 | 178 |
| 42 | 3300009093 | Ga0105240_10085994 | Ga0105240_100859943 | 178 |
| 43 | 3300009545 | Ga0105237_10007863 | Ga0105237_100078632 | 178 |
| 44 | 3300009551 | Ga0105238_10141743 | Ga0105238_101417432 | 178 |
| 45 | 3300009551 | Ga0105238_12020003 | Ga0105238_120200031 | 178 |
| 46 | 3300009553 | Ga0105249_10750421 | Ga0105249_107504211 | 178 |
| 47 | 3300010375 | Ga0105239_10000580 | Ga0105239_1000058018 | 178 |
| 48 | 3300013102 | Ga0157371_10010584 | Ga0157371_100105844 | 178 |
| 49 | 3300013102 | Ga0157371_10021199 | Ga0157371_100211994 | 178 |
| 50 | 3300013102 | Ga0157371_10612319 | Ga0157371_106123191 | 178 |
| 51 | 3300013104 | Ga0157370_10001361 | Ga0157370_1000136119 | 178 |
| 52 | 3300013104 | Ga0157370_10089903 | Ga0157370_100899032 | 178 |
| 53 | 3300013105 | Ga0157369_10004054 | Ga0157369_100040549 | 178 |
| 54 | 3300013105 | Ga0157369_10086456 | Ga0157369_100864563 | 178 |
| 55 | 3300013105 | Ga0157369_10503987 | Ga0157369_105039871 | 178 |
| 56 | 3300013296 | Ga0157374_10190682 | Ga0157374_101906821 | 178 |
| 57 | 3300013306 | Ga0163162_10130217 | Ga0163162_101302174 | 178 |
| 58 | 3300013307 | Ga0157372_10000171 | Ga0157372_1000017128 | 178 |
| 59 | 3300013307 | Ga0157372_10002128 | Ga0157372_100021286 | 178 |
| 60 | 3300013307 | Ga0157372_10031523 | Ga0157372_100315234 | 178 |
| 61 | 3300014968 | Ga0157379_10080924 | Ga0157379_100809243 | 178 |
| 62 | 3300014969 | Ga0157376_10000961 | Ga0157376_100009616 | 178 |
| 63 | 3300025904 | Ga0207647_10181246 | Ga0207647_101812462 | 178 |
| 64 | 3300025909 | Ga0207705_10001227 | Ga0207705_100012276 | 178 |
| 65 | 3300025909 | Ga0207705_10034136 | Ga0207705_100341362 | 178 |
| 66 | 3300025909 | Ga0207705_11007677 | Ga0207705_110076771 | 178 |
| 67 | 3300025912 | Ga0207707_10010595 | Ga0207707_100105957 | 178 |
| 68 | 3300025913 | Ga0207695_10390674 | Ga0207695_103906741 | 178 |
| 69 | 3300025914 | Ga0207671_10006030 | Ga0207671_100060309 | 178 |
| 70 | 3300025917 | Ga0207660_10009692 | Ga0207660_100096926 | 178 |
| 71 | 3300025920 | Ga0207649_10769894 | Ga0207649_107698941 | 178 |
| 72 | 3300025921 | Ga0207652_10001497 | Ga0207652_1000149710 | 178 |
| 73 | 3300025924 | Ga0207694_10100200 | Ga0207694_101002002 | 178 |
| 74 | 3300025925 | Ga0207650_11255355 | Ga0207650_112553551 | 178 |
| 75 | 3300025949 | Ga0207667_10000180 | Ga0207667_1000018055 | 178 |
| 76 | 3300025949 | Ga0207667_10298811 | Ga0207667_102988112 | 178 |
| 77 | 3300025949 | Ga0207667_10503494 | Ga0207667_105034942 | 178 |
| 78 | 3300025961 | Ga0207712_10534462 | Ga0207712_105344622 | 178 |
| 79 | 3300025981 | Ga0207640_10270100 | Ga0207640_102701002 | 178 |
| 80 | 3300026067 | Ga0207678_10025297 | Ga0207678_100252976 | 178 |
| 81 | 3300026078 | Ga0207702_10020186 | Ga0207702_100201862 | 178 |
| 82 | 3300037312 | Ga0395899_0032489 | Ga0395899_0032489_2370_2918 | 178 |
| 83 | 3300037418 | Ga0395900_0010296 | Ga0395900_0010296_8570_9118 | 178 |
| 84 | 3300037418 | Ga0395900_0129016 | Ga0395900_0129016_348_896 | 178 |
| 85 | 3300037466 | Ga0395898_0295902 | Ga0395898_0295902_276_824 | 178 |
| 86 | 3300038443 | Ga0395901_0014807 | Ga0395901_0014807_2602_3150 | 178 |
| 87 | 3300038443 | Ga0395901_0549958 | Ga0395901_0549958_503_1039 | 178 |
| 88 | 3300044656 | Ga0466969_0151608 | Ga0466969_0151608_109_645 | 178 |
| 89 | 3300005293 | Ga0065715_10541247 | Ga0065715_105412471 | 179 |
| 90 | 3300005329 | Ga0070683_100303162 | Ga0070683_1003031622 | 179 |
| 91 | 3300005331 | Ga0070670_100053900 | Ga0070670_1000539002 | 179 |
| 92 | 3300005331 | Ga0070670_100203577 | Ga0070670_1002035772 | 179 |
| 93 | 3300005331 | Ga0070670_100297151 | Ga0070670_1002971513 | 179 |
| 94 | 3300005333 | Ga0070677_10107602 | Ga0070677_101076022 | 179 |
| 95 | 3300005338 | Ga0068868_100251313 | Ga0068868_1002513132 | 179 |
| 96 | 3300005347 | Ga0070668_100346484 | Ga0070668_1003464842 | 179 |
| 97 | 3300005354 | Ga0070675_100450817 | Ga0070675_1004508172 | 179 |
| 98 | 3300005355 | Ga0070671_100002262 | Ga0070671_10000226212 | 179 |
| 99 | 3300005367 | Ga0070667_100006079 | Ga0070667_1000060796 | 179 |
| 100 | 3300005456 | Ga0070678_100012186 | Ga0070678_1000121862 | 179 |
| 101 | 3300005459 | Ga0068867_100076582 | Ga0068867_1000765822 | 179 |
| 102 | 3300005459 | Ga0068867_100214269 | Ga0068867_1002142693 | 179 |
| 103 | 3300005543 | Ga0070672_100225638 | Ga0070672_1002256382 | 179 |
| 104 | 3300005718 | Ga0068866_10412181 | Ga0068866_104121811 | 179 |
| 105 | 3300005719 | Ga0068861_100326554 | Ga0068861_1003265542 | 179 |
| 106 | 3300005841 | Ga0068863_100549707 | Ga0068863_1005497072 | 179 |
| 107 | 3300005843 | Ga0068860_101443390 | Ga0068860_1014433901 | 179 |
| 108 | 3300005983 | Ga0081540_1010502 | Ga0081540_10105025 | 179 |
| 109 | 3300006237 | Ga0097621_100000092 | Ga0097621_10000009216 | 179 |
| 110 | 3300006237 | Ga0097621_100247247 | Ga0097621_1002472471 | 179 |
| 111 | 3300006358 | Ga0068871_100000032 | Ga0068871_10000003240 | 179 |
| 112 | 3300006358 | Ga0068871_100487174 | Ga0068871_1004871742 | 179 |
| 113 | 3300006881 | Ga0068865_100155506 | Ga0068865_1001555061 | 179 |
| 114 | 3300009101 | Ga0105247_10664297 | Ga0105247_106642971 | 179 |
| 115 | 3300009177 | Ga0105248_10113241 | Ga0105248_101132413 | 179 |
| 116 | 3300009545 | Ga0105237_11000144 | Ga0105237_110001441 | 179 |
| 117 | 3300009553 | Ga0105249_10388402 | Ga0105249_103884022 | 179 |
| 118 | 3300009553 | Ga0105249_11072455 | Ga0105249_110724551 | 179 |
| 119 | 3300011119 | Ga0105246_10458217 | Ga0105246_104582172 | 179 |
| 120 | 3300013297 | Ga0157378_10036081 | Ga0157378_100360813 | 179 |
| 121 | 3300013306 | Ga0163162_10000431 | Ga0163162_1000043123 | 179 |
| 122 | 3300013306 | Ga0163162_10366948 | Ga0163162_103669482 | 179 |
| 123 | 3300013308 | Ga0157375_10000253 | Ga0157375_1000025314 | 179 |
| 124 | 3300013308 | Ga0157375_10553595 | Ga0157375_105535952 | 179 |
| 125 | 3300014325 | Ga0163163_10001380 | Ga0163163_100013808 | 179 |
| 126 | 3300014325 | Ga0163163_11402836 | Ga0163163_114028362 | 179 |
| 127 | 3300014326 | Ga0157380_10282621 | Ga0157380_102826212 | 179 |
| 128 | 3300014968 | Ga0157379_10611086 | Ga0157379_106110862 | 179 |
| 129 | 3300014969 | Ga0157376_10000714 | Ga0157376_100007146 | 179 |
| 130 | 3300017792 | Ga0163161_10008802 | Ga0163161_100088025 | 179 |
| 131 | 3300025315 | Ga0207697_10243428 | Ga0207697_102434282 | 179 |
| 132 | 3300025893 | Ga0207682_10021399 | Ga0207682_100213992 | 179 |
| 133 | 3300025899 | Ga0207642_10340195 | Ga0207642_103401952 | 179 |
| 134 | 3300025909 | Ga0207705_10530950 | Ga0207705_105309501 | 179 |
| 135 | 3300025925 | Ga0207650_10063847 | Ga0207650_100638473 | 179 |
| 136 | 3300025925 | Ga0207650_10141158 | Ga0207650_101411582 | 179 |
| 137 | 3300025940 | Ga0207691_10038981 | Ga0207691_100389813 | 179 |
| 138 | 3300025941 | Ga0207711_10072884 | Ga0207711_100728842 | 179 |
| 139 | 3300025944 | Ga0207661_11094758 | Ga0207661_110947581 | 179 |
| 140 | 3300025972 | Ga0207668_10275550 | Ga0207668_102755502 | 179 |
| 141 | 3300025986 | Ga0207658_10013694 | Ga0207658_100136944 | 179 |
| 142 | 3300026023 | Ga0207677_10331101 | Ga0207677_103311012 | 179 |
| 143 | 3300026089 | Ga0207648_10041867 | Ga0207648_100418675 | 179 |
| 144 | 3300026095 | Ga0207676_10255199 | Ga0207676_102551992 | 179 |
| 145 | 3300026118 | Ga0207675_100571767 | Ga0207675_1005717672 | 179 |
| 146 | 3300026121 | Ga0207683_10126348 | Ga0207683_101263482 | 179 |
| 147 | 3300026121 | Ga0207683_10260139 | Ga0207683_102601392 | 179 |
| 148 | 3300031456 | Ga0307513_10369580 | Ga0307513_103695801 | 179 |
| 149 | 3300035725 | Ga0373947_0339791 | Ga0373947_0339791_68_607 | 179 |
| 150 | 3300041460 | Ga0451802_1247859 | Ga0451802_1247859_113_682 | 179 |
| 151 | 3300042001 | Ga0439441_058853 | Ga0439441_058853_247_786 | 179 |
| 152 | 3300048903 | Ga0496100_0012853 | Ga0496100_0012853_3737_4276 | 179 |
| 153 | 3300048904 | Ga0496101_0012680 | Ga0496101_0012680_2666_3205 | 179 |
| 154 | 3300048907 | Ga0496104_0174376 | Ga0496104_0174376_109_648 | 179 |
| 155 | 3300049573 | Ga0501037_0135461 | Ga0501037_0135461_939_1481 | 179 |
| 156 | 3300000545 | CNXas_1002007 | CNXas_10020072 | 180 |
| 157 | 3300002459 | JGI24751J29686_10001558 | JGI24751J29686_100015584 | 180 |
| 158 | 3300003322 | rootL2_10060567 | rootL2_100605671 | 180 |
| 159 | 3300003322 | rootL2_10236104 | rootL2_102361041 | 180 |
| 160 | 3300003354 | JGI25160J50197_1005120 | JGI25160J50197_10051202 | 180 |
| 161 | 3300005288 | Ga0065714_10125551 | Ga0065714_101255512 | 180 |
| 162 | 3300005289 | Ga0065704_10124374 | Ga0065704_101243742 | 180 |
| 163 | 3300005290 | Ga0065712_10009365 | Ga0065712_100093653 | 180 |
| 164 | 3300005293 | Ga0065715_10021010 | Ga0065715_100210101 | 180 |
| 165 | 3300005293 | Ga0065715_10328789 | Ga0065715_103287892 | 180 |
| 166 | 3300005295 | Ga0065707_10166820 | Ga0065707_101668202 | 180 |
| 167 | 3300005295 | Ga0065707_10505871 | Ga0065707_105058711 | 180 |
| 168 | 3300005328 | Ga0070676_10124852 | Ga0070676_101248522 | 180 |
| 169 | 3300005328 | Ga0070676_10151051 | Ga0070676_101510512 | 180 |
| 170 | 3300005329 | Ga0070683_100387773 | Ga0070683_1003877733 | 180 |
| 171 | 3300005331 | Ga0070670_100291144 | Ga0070670_1002911442 | 180 |
| 172 | 3300005331 | Ga0070670_100532854 | Ga0070670_1005328542 | 180 |
| 173 | 3300005333 | Ga0070677_10193841 | Ga0070677_101938412 | 180 |
| 174 | 3300005334 | Ga0068869_100012053 | Ga0068869_1000120533 | 180 |
| 175 | 3300005334 | Ga0068869_100248911 | Ga0068869_1002489112 | 180 |
| 176 | 3300005335 | Ga0070666_10111370 | Ga0070666_101113702 | 180 |
| 177 | 3300005335 | Ga0070666_10155207 | Ga0070666_101552072 | 180 |
| 178 | 3300005336 | Ga0070680_100050135 | Ga0070680_1000501352 | 180 |
| 179 | 3300005336 | Ga0070680_100257059 | Ga0070680_1002570592 | 180 |
| 180 | 3300005338 | Ga0068868_100216883 | Ga0068868_1002168831 | 180 |
| 181 | 3300005339 | Ga0070660_100000831 | Ga0070660_1000008315 | 180 |
| 182 | 3300005339 | Ga0070660_100042698 | Ga0070660_1000426983 | 180 |
| 183 | 3300005339 | Ga0070660_100084233 | Ga0070660_1000842332 | 180 |
| 184 | 3300005340 | Ga0070689_100108699 | Ga0070689_1001086992 | 180 |
| 185 | 3300005340 | Ga0070689_100193489 | Ga0070689_1001934891 | 180 |
| 186 | 3300005340 | Ga0070689_100756481 | Ga0070689_1007564812 | 180 |
| 187 | 3300005343 | Ga0070687_100008161 | Ga0070687_1000081611 | 180 |
| 188 | 3300005343 | Ga0070687_100011272 | Ga0070687_1000112724 | 180 |
| 189 | 3300005347 | Ga0070668_100118774 | Ga0070668_1001187741 | 180 |
| 190 | 3300005347 | Ga0070668_100470631 | Ga0070668_1004706311 | 180 |
| 191 | 3300005353 | Ga0070669_100070003 | Ga0070669_1000700032 | 180 |
| 192 | 3300005353 | Ga0070669_100788598 | Ga0070669_1007885981 | 180 |
| 193 | 3300005354 | Ga0070675_100060386 | Ga0070675_1000603864 | 180 |
| 194 | 3300005355 | Ga0070671_100078810 | Ga0070671_1000788101 | 180 |
| 195 | 3300005364 | Ga0070673_100019242 | Ga0070673_1000192426 | 180 |
| 196 | 3300005365 | Ga0070688_100092801 | Ga0070688_1000928012 | 180 |
| 197 | 3300005366 | Ga0070659_100013878 | Ga0070659_1000138785 | 180 |
| 198 | 3300005367 | Ga0070667_100136717 | Ga0070667_1001367172 | 180 |
| 199 | 3300005438 | Ga0070701_10011972 | Ga0070701_100119723 | 180 |
| 200 | 3300005441 | Ga0070700_100036582 | Ga0070700_1000365821 | 180 |
| 201 | 3300005458 | Ga0070681_10033532 | Ga0070681_100335322 | 180 |
| 202 | 3300005458 | Ga0070681_10146444 | Ga0070681_101464443 | 180 |
| 203 | 3300005459 | Ga0068867_100018002 | Ga0068867_1000180023 | 180 |
| 204 | 3300005459 | Ga0068867_100176714 | Ga0068867_1001767142 | 180 |
| 205 | 3300005459 | Ga0068867_100181767 | Ga0068867_1001817672 | 180 |
| 206 | 3300005459 | Ga0068867_100544389 | Ga0068867_1005443891 | 180 |
| 207 | 3300005471 | Ga0070698_100001240 | Ga0070698_1000012403 | 180 |
| 208 | 3300005471 | Ga0070698_100015839 | Ga0070698_1000158398 | 180 |
| 209 | 3300005518 | Ga0070699_100020541 | Ga0070699_1000205417 | 180 |
| 210 | 3300005530 | Ga0070679_100061632 | Ga0070679_1000616324 | 180 |
| 211 | 3300005530 | Ga0070679_100399800 | Ga0070679_1003998002 | 180 |
| 212 | 3300005539 | Ga0068853_100023714 | Ga0068853_1000237145 | 180 |
| 213 | 3300005539 | Ga0068853_100138229 | Ga0068853_1001382292 | 180 |
| 214 | 3300005539 | Ga0068853_100331519 | Ga0068853_1003315192 | 180 |
| 215 | 3300005539 | Ga0068853_100591046 | Ga0068853_1005910462 | 180 |
| 216 | 3300005543 | Ga0070672_100128676 | Ga0070672_1001286762 | 180 |
| 217 | 3300005543 | Ga0070672_100283597 | Ga0070672_1002835972 | 180 |
| 218 | 3300005544 | Ga0070686_100166734 | Ga0070686_1001667342 | 180 |
| 219 | 3300005549 | Ga0070704_100105820 | Ga0070704_1001058202 | 180 |
| 220 | 3300005549 | Ga0070704_101587768 | Ga0070704_1015877681 | 180 |
| 221 | 3300005563 | Ga0068855_100003310 | Ga0068855_1000033105 | 180 |
| 222 | 3300005563 | Ga0068855_100087143 | Ga0068855_1000871434 | 180 |
| 223 | 3300005563 | Ga0068855_100101183 | Ga0068855_1001011835 | 180 |
| 224 | 3300005577 | Ga0068857_100031579 | Ga0068857_1000315794 | 180 |
| 225 | 3300005577 | Ga0068857_100065276 | Ga0068857_1000652762 | 180 |
| 226 | 3300005577 | Ga0068857_100917313 | Ga0068857_1009173131 | 180 |
| 227 | 3300005614 | Ga0068856_100053446 | Ga0068856_1000534462 | 180 |
| 228 | 3300005614 | Ga0068856_100274202 | Ga0068856_1002742022 | 180 |
| 229 | 3300005616 | Ga0068852_100001315 | Ga0068852_10000131510 | 180 |
| 230 | 3300005616 | Ga0068852_100023320 | Ga0068852_1000233205 | 180 |
| 231 | 3300005617 | Ga0068859_100078746 | Ga0068859_1000787462 | 180 |
| 232 | 3300005617 | Ga0068859_100143094 | Ga0068859_1001430943 | 180 |
| 233 | 3300005618 | Ga0068864_100028548 | Ga0068864_1000285482 | 180 |
| 234 | 3300005718 | Ga0068866_10443337 | Ga0068866_104433371 | 180 |
| 235 | 3300005719 | Ga0068861_100039196 | Ga0068861_1000391962 | 180 |
| 236 | 3300005719 | Ga0068861_100472336 | Ga0068861_1004723362 | 180 |
| 237 | 3300005719 | Ga0068861_100821831 | Ga0068861_1008218312 | 180 |
| 238 | 3300005840 | Ga0068870_10529835 | Ga0068870_105298351 | 180 |
| 239 | 3300005841 | Ga0068863_100024759 | Ga0068863_1000247591 | 180 |
| 240 | 3300005841 | Ga0068863_100373137 | Ga0068863_1003731372 | 180 |
| 241 | 3300005841 | Ga0068863_100529417 | Ga0068863_1005294172 | 180 |
| 242 | 3300005843 | Ga0068860_100000024 | Ga0068860_100000024128 | 180 |
| 243 | 3300005843 | Ga0068860_100132731 | Ga0068860_1001327312 | 180 |
| 244 | 3300005843 | Ga0068860_100372626 | Ga0068860_1003726262 | 180 |
| 245 | 3300005844 | Ga0068862_100171546 | Ga0068862_1001715462 | 180 |
| 246 | 3300005844 | Ga0068862_100271643 | Ga0068862_1002716432 | 180 |
| 247 | 3300006173 | Ga0070716_100467582 | Ga0070716_1004675822 | 180 |
| 248 | 3300006237 | Ga0097621_100003569 | Ga0097621_10000356913 | 180 |
| 249 | 3300006358 | Ga0068871_100005675 | Ga0068871_1000056752 | 180 |
| 250 | 3300006358 | Ga0068871_100441513 | Ga0068871_1004415132 | 180 |
| 251 | 3300006358 | Ga0068871_101070587 | Ga0068871_1010705871 | 180 |
| 252 | 3300006844 | Ga0075428_100004634 | Ga0075428_1000046345 | 180 |
| 253 | 3300006844 | Ga0075428_100054065 | Ga0075428_1000540654 | 180 |
| 254 | 3300006847 | Ga0075431_100143590 | Ga0075431_1001435901 | 180 |
| 255 | 3300006880 | Ga0075429_100000407 | Ga0075429_10000040719 | 180 |
| 256 | 3300006880 | Ga0075429_100358983 | Ga0075429_1003589832 | 180 |
| 257 | 3300006881 | Ga0068865_100072468 | Ga0068865_1000724683 | 180 |
| 258 | 3300006881 | Ga0068865_100532613 | Ga0068865_1005326132 | 180 |
| 259 | 3300006931 | Ga0097620_100078743 | Ga0097620_1000787432 | 180 |
| 260 | 3300006931 | Ga0097620_100143083 | Ga0097620_1001430832 | 180 |
| 261 | 3300009036 | Ga0105244_10417477 | Ga0105244_104174771 | 180 |
| 262 | 3300009093 | Ga0105240_10000106 | Ga0105240_1000010648 | 180 |
| 263 | 3300009093 | Ga0105240_10002363 | Ga0105240_1000236321 | 180 |
| 264 | 3300009093 | Ga0105240_10002407 | Ga0105240_100024073 | 180 |
| 265 | 3300009093 | Ga0105240_10073258 | Ga0105240_100732583 | 180 |
| 266 | 3300009093 | Ga0105240_10086784 | Ga0105240_100867842 | 180 |
| 267 | 3300009094 | Ga0111539_10280415 | Ga0111539_102804151 | 180 |
| 268 | 3300009094 | Ga0111539_11304344 | Ga0111539_113043441 | 180 |
| 269 | 3300009101 | Ga0105247_10496278 | Ga0105247_104962782 | 180 |
| 270 | 3300009174 | Ga0105241_10001117 | Ga0105241_1000111721 | 180 |
| 271 | 3300009174 | Ga0105241_10024976 | Ga0105241_100249764 | 180 |
| 272 | 3300009174 | Ga0105241_10877990 | Ga0105241_108779901 | 180 |
| 273 | 3300009176 | Ga0105242_10034241 | Ga0105242_100342415 | 180 |
| 274 | 3300009176 | Ga0105242_10466078 | Ga0105242_104660782 | 180 |
| 275 | 3300009545 | Ga0105237_10000561 | Ga0105237_1000056116 | 180 |
| 276 | 3300009545 | Ga0105237_10011076 | Ga0105237_100110763 | 180 |
| 277 | 3300009545 | Ga0105237_10108821 | Ga0105237_101088214 | 180 |
| 278 | 3300009545 | Ga0105237_10123305 | Ga0105237_101233051 | 180 |
| 279 | 3300009551 | Ga0105238_10001830 | Ga0105238_1000183015 | 180 |
| 280 | 3300009551 | Ga0105238_10006849 | Ga0105238_100068495 | 180 |
| 281 | 3300009553 | Ga0105249_10001205 | Ga0105249_1000120516 | 180 |
| 282 | 3300009553 | Ga0105249_10006402 | Ga0105249_100064028 | 180 |
| 283 | 3300009553 | Ga0105249_10008771 | Ga0105249_100087715 | 180 |
| 284 | 3300009553 | Ga0105249_10468092 | Ga0105249_104680922 | 180 |
| 285 | 3300010375 | Ga0105239_10042882 | Ga0105239_100428824 | 180 |
| 286 | 3300010375 | Ga0105239_10046255 | Ga0105239_100462554 | 180 |
| 287 | 3300010375 | Ga0105239_11577072 | Ga0105239_115770721 | 180 |
| 288 | 3300013100 | Ga0157373_10003094 | Ga0157373_100030947 | 180 |
| 289 | 3300013100 | Ga0157373_10091788 | Ga0157373_100917882 | 180 |
| 290 | 3300013100 | Ga0157373_10166367 | Ga0157373_101663673 | 180 |
| 291 | 3300013102 | Ga0157371_10002374 | Ga0157371_1000237410 | 180 |
| 292 | 3300013102 | Ga0157371_10002840 | Ga0157371_100028403 | 180 |
| 293 | 3300013102 | Ga0157371_10003029 | Ga0157371_100030295 | 180 |
| 294 | 3300013102 | Ga0157371_10281098 | Ga0157371_102810982 | 180 |
| 295 | 3300013102 | Ga0157371_10463310 | Ga0157371_104633101 | 180 |
| 296 | 3300013104 | Ga0157370_10001381 | Ga0157370_1000138112 | 180 |
| 297 | 3300013104 | Ga0157370_10031168 | Ga0157370_100311685 | 180 |
| 298 | 3300013104 | Ga0157370_10073553 | Ga0157370_100735532 | 180 |
| 299 | 3300013104 | Ga0157370_10182471 | Ga0157370_101824712 | 180 |
| 300 | 3300013104 | Ga0157370_10353373 | Ga0157370_103533732 | 180 |
| 301 | 3300013104 | Ga0157370_10478026 | Ga0157370_104780261 | 180 |
| 302 | 3300013105 | Ga0157369_10007569 | Ga0157369_1000756913 | 180 |
| 303 | 3300013105 | Ga0157369_10034964 | Ga0157369_100349642 | 180 |
| 304 | 3300013105 | Ga0157369_10515564 | Ga0157369_105155642 | 180 |
| 305 | 3300013296 | Ga0157374_10893760 | Ga0157374_108937602 | 180 |
| 306 | 3300013297 | Ga0157378_10030429 | Ga0157378_100304292 | 180 |
| 307 | 3300013297 | Ga0157378_10362154 | Ga0157378_103621541 | 180 |
| 308 | 3300013297 | Ga0157378_10367471 | Ga0157378_103674712 | 180 |
| 309 | 3300013306 | Ga0163162_10064477 | Ga0163162_100644772 | 180 |
| 310 | 3300013306 | Ga0163162_10220773 | Ga0163162_102207732 | 180 |
| 311 | 3300013306 | Ga0163162_11222445 | Ga0163162_112224452 | 180 |
| 312 | 3300013307 | Ga0157372_10000463 | Ga0157372_1000046319 | 180 |
| 313 | 3300013307 | Ga0157372_10291934 | Ga0157372_102919344 | 180 |
| 314 | 3300013307 | Ga0157372_10693454 | Ga0157372_106934542 | 180 |
| 315 | 3300013308 | Ga0157375_10188328 | Ga0157375_101883283 | 180 |
| 316 | 3300013308 | Ga0157375_10203956 | Ga0157375_102039562 | 180 |
| 317 | 3300013308 | Ga0157375_10240833 | Ga0157375_102408331 | 180 |
| 318 | 3300014325 | Ga0163163_10110547 | Ga0163163_101105473 | 180 |
| 319 | 3300014325 | Ga0163163_10316057 | Ga0163163_103160572 | 180 |
| 320 | 3300014325 | Ga0163163_10498307 | Ga0163163_104983073 | 180 |
| 321 | 3300014326 | Ga0157380_10069446 | Ga0157380_100694463 | 180 |
| 322 | 3300014326 | Ga0157380_10117013 | Ga0157380_101170132 | 180 |
| 323 | 3300014326 | Ga0157380_10120191 | Ga0157380_101201913 | 180 |
| 324 | 3300014745 | Ga0157377_10002237 | Ga0157377_100022374 | 180 |
| 325 | 3300014745 | Ga0157377_10250420 | Ga0157377_102504202 | 180 |
| 326 | 3300014968 | Ga0157379_10243214 | Ga0157379_102432142 | 180 |
| 327 | 3300014969 | Ga0157376_10747277 | Ga0157376_107472772 | 180 |
| 328 | 3300017792 | Ga0163161_10026417 | Ga0163161_100264172 | 180 |
| 329 | 3300017792 | Ga0163161_10042247 | Ga0163161_100422473 | 180 |
| 330 | 3300025208 | Ga0209436_100446 | Ga0209436_1004464 | 180 |
| 331 | 3300025284 | Ga0209130_1004223 | Ga0209130_10042232 | 180 |
| 332 | 3300025302 | Ga0207426_1000073 | Ga0207426_1000073210 | 180 |
| 333 | 3300025321 | Ga0207656_10258026 | Ga0207656_102580261 | 180 |
| 334 | 3300025893 | Ga0207682_10183195 | Ga0207682_101831951 | 180 |
| 335 | 3300025903 | Ga0207680_10140097 | Ga0207680_101400972 | 180 |
| 336 | 3300025903 | Ga0207680_10174048 | Ga0207680_101740482 | 180 |
| 337 | 3300025907 | Ga0207645_10016092 | Ga0207645_100160922 | 180 |
| 338 | 3300025907 | Ga0207645_10155183 | Ga0207645_101551832 | 180 |
| 339 | 3300025907 | Ga0207645_10156629 | Ga0207645_101566292 | 180 |
| 340 | 3300025908 | Ga0207643_10003543 | Ga0207643_100035437 | 180 |
| 341 | 3300025908 | Ga0207643_10054981 | Ga0207643_100549813 | 180 |
| 342 | 3300025911 | Ga0207654_10019739 | Ga0207654_100197392 | 180 |
| 343 | 3300025911 | Ga0207654_10091347 | Ga0207654_100913472 | 180 |
| 344 | 3300025912 | Ga0207707_10247904 | Ga0207707_102479042 | 180 |
| 345 | 3300025912 | Ga0207707_11103438 | Ga0207707_111034381 | 180 |
| 346 | 3300025913 | Ga0207695_10001064 | Ga0207695_1000106422 | 180 |
| 347 | 3300025913 | Ga0207695_10004051 | Ga0207695_100040513 | 180 |
| 348 | 3300025913 | Ga0207695_10019628 | Ga0207695_100196285 | 180 |
| 349 | 3300025913 | Ga0207695_10408098 | Ga0207695_104080982 | 180 |
| 350 | 3300025914 | Ga0207671_10002324 | Ga0207671_100023242 | 180 |
| 351 | 3300025914 | Ga0207671_10012091 | Ga0207671_100120913 | 180 |
| 352 | 3300025917 | Ga0207660_10221324 | Ga0207660_102213242 | 180 |
| 353 | 3300025917 | Ga0207660_10520631 | Ga0207660_105206311 | 180 |
| 354 | 3300025918 | Ga0207662_10020460 | Ga0207662_100204604 | 180 |
| 355 | 3300025919 | Ga0207657_10009558 | Ga0207657_100095584 | 180 |
| 356 | 3300025919 | Ga0207657_10092857 | Ga0207657_100928573 | 180 |
| 357 | 3300025919 | Ga0207657_10167879 | Ga0207657_101678791 | 180 |
| 358 | 3300025921 | Ga0207652_10224157 | Ga0207652_102241572 | 180 |
| 359 | 3300025921 | Ga0207652_10739129 | Ga0207652_107391292 | 180 |
| 360 | 3300025923 | Ga0207681_10034787 | Ga0207681_100347875 | 180 |
| 361 | 3300025923 | Ga0207681_10592826 | Ga0207681_105928262 | 180 |
| 362 | 3300025924 | Ga0207694_10048568 | Ga0207694_100485682 | 180 |
| 363 | 3300025924 | Ga0207694_10225936 | Ga0207694_102259362 | 180 |
| 364 | 3300025925 | Ga0207650_10025239 | Ga0207650_100252392 | 180 |
| 365 | 3300025931 | Ga0207644_10469426 | Ga0207644_104694261 | 180 |
| 366 | 3300025934 | Ga0207686_10000566 | Ga0207686_100005665 | 180 |
| 367 | 3300025934 | Ga0207686_10084847 | Ga0207686_100848474 | 180 |
| 368 | 3300025936 | Ga0207670_10051646 | Ga0207670_100516464 | 180 |
| 369 | 3300025938 | Ga0207704_11263045 | Ga0207704_112630451 | 180 |
| 370 | 3300025940 | Ga0207691_10038799 | Ga0207691_100387995 | 180 |
| 371 | 3300025940 | Ga0207691_10418132 | Ga0207691_104181321 | 180 |
| 372 | 3300025942 | Ga0207689_10002381 | Ga0207689_1000238112 | 180 |
| 373 | 3300025942 | Ga0207689_10031443 | Ga0207689_100314434 | 180 |
| 374 | 3300025949 | Ga0207667_10001242 | Ga0207667_100012422 | 180 |
| 375 | 3300025949 | Ga0207667_10010652 | Ga0207667_1001065213 | 180 |
| 376 | 3300025949 | Ga0207667_10037467 | Ga0207667_100374672 | 180 |
| 377 | 3300025949 | Ga0207667_10136977 | Ga0207667_101369771 | 180 |
| 378 | 3300025949 | Ga0207667_11033621 | Ga0207667_110336211 | 180 |
| 379 | 3300025960 | Ga0207651_10072767 | Ga0207651_100727674 | 180 |
| 380 | 3300025960 | Ga0207651_10230532 | Ga0207651_102305322 | 180 |
| 381 | 3300025961 | Ga0207712_10005755 | Ga0207712_100057558 | 180 |
| 382 | 3300025961 | Ga0207712_10006003 | Ga0207712_100060033 | 180 |
| 383 | 3300025961 | Ga0207712_10006416 | Ga0207712_100064162 | 180 |
| 384 | 3300025961 | Ga0207712_10027394 | Ga0207712_100273943 | 180 |
| 385 | 3300025972 | Ga0207668_10813693 | Ga0207668_108136931 | 180 |
| 386 | 3300025986 | Ga0207658_10836335 | Ga0207658_108363351 | 180 |
| 387 | 3300026041 | Ga0207639_10057967 | Ga0207639_100579672 | 180 |
| 388 | 3300026041 | Ga0207639_10085656 | Ga0207639_100856563 | 180 |
| 389 | 3300026041 | Ga0207639_10090305 | Ga0207639_100903052 | 180 |
| 390 | 3300026041 | Ga0207639_10129991 | Ga0207639_101299911 | 180 |
| 391 | 3300026041 | Ga0207639_10182169 | Ga0207639_101821692 | 180 |
| 392 | 3300026041 | Ga0207639_10219741 | Ga0207639_102197412 | 180 |
| 393 | 3300026041 | Ga0207639_10387197 | Ga0207639_103871971 | 180 |
| 394 | 3300026041 | Ga0207639_10513991 | Ga0207639_105139912 | 180 |
| 395 | 3300026075 | Ga0207708_10055201 | Ga0207708_100552014 | 180 |
| 396 | 3300026075 | Ga0207708_10171334 | Ga0207708_101713342 | 180 |
| 397 | 3300026078 | Ga0207702_10035062 | Ga0207702_100350624 | 180 |
| 398 | 3300026078 | Ga0207702_10276068 | Ga0207702_102760682 | 180 |
| 399 | 3300026078 | Ga0207702_10327443 | Ga0207702_103274432 | 180 |
| 400 | 3300026078 | Ga0207702_10388892 | Ga0207702_103888921 | 180 |
| 401 | 3300026088 | Ga0207641_10005426 | Ga0207641_100054268 | 180 |
| 402 | 3300026088 | Ga0207641_10017939 | Ga0207641_100179391 | 180 |
| 403 | 3300026089 | Ga0207648_10030498 | Ga0207648_100304982 | 180 |
| 404 | 3300026089 | Ga0207648_10061589 | Ga0207648_100615892 | 180 |
| 405 | 3300026089 | Ga0207648_10074826 | Ga0207648_100748262 | 180 |
| 406 | 3300026089 | Ga0207648_10159502 | Ga0207648_101595022 | 180 |
| 407 | 3300026089 | Ga0207648_10228615 | Ga0207648_102286152 | 180 |
| 408 | 3300026089 | Ga0207648_10271895 | Ga0207648_102718952 | 180 |
| 409 | 3300026095 | Ga0207676_10022021 | Ga0207676_100220214 | 180 |
| 410 | 3300026095 | Ga0207676_10197866 | Ga0207676_101978662 | 180 |
| 411 | 3300026116 | Ga0207674_10000453 | Ga0207674_1000045331 | 180 |
| 412 | 3300026116 | Ga0207674_10020171 | Ga0207674_100201716 | 180 |
| 413 | 3300026116 | Ga0207674_10042617 | Ga0207674_100426174 | 180 |
| 414 | 3300026116 | Ga0207674_10397971 | Ga0207674_103979711 | 180 |
| 415 | 3300026116 | Ga0207674_10551368 | Ga0207674_105513681 | 180 |
| 416 | 3300026116 | Ga0207674_10800051 | Ga0207674_108000512 | 180 |
| 417 | 3300026118 | Ga0207675_100033929 | Ga0207675_1000339294 | 180 |
| 418 | 3300026118 | Ga0207675_100036164 | Ga0207675_1000361643 | 180 |
| 419 | 3300026118 | Ga0207675_100038705 | Ga0207675_1000387055 | 180 |
| 420 | 3300026142 | Ga0207698_10036047 | Ga0207698_100360473 | 180 |
| 421 | 3300026142 | Ga0207698_10064694 | Ga0207698_100646941 | 180 |
| 422 | 3300026142 | Ga0207698_10149903 | Ga0207698_101499032 | 180 |
| 423 | 3300026142 | Ga0207698_10190194 | Ga0207698_101901942 | 180 |
| 424 | 3300027526 | Ga0209968_1013270 | Ga0209968_10132702 | 180 |
| 425 | 3300027907 | Ga0207428_10030792 | Ga0207428_100307922 | 180 |
| 426 | 3300028379 | Ga0268266_10000048 | Ga0268266_10000048152 | 180 |
| 427 | 3300028380 | Ga0268265_10151542 | Ga0268265_101515422 | 180 |
| 428 | 3300028380 | Ga0268265_10821493 | Ga0268265_108214931 | 180 |
| 429 | 3300028380 | Ga0268265_10977022 | Ga0268265_109770221 | 180 |
| 430 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028309 | 180 |
| 431 | 3300028381 | Ga0268264_10127217 | Ga0268264_101272172 | 180 |
| 432 | 3300028381 | Ga0268264_10366947 | Ga0268264_103669471 | 180 |
| 433 | 3300028786 | Ga0307517_10000268 | Ga0307517_1000026862 | 180 |
| 434 | 3300028786 | Ga0307517_10200984 | Ga0307517_102009842 | 180 |
| 435 | 3300030521 | Ga0307511_10001580 | Ga0307511_100015809 | 180 |
| 436 | 3300031251 | Ga0265327_10017630 | Ga0265327_100176304 | 180 |
| 437 | 3300031730 | Ga0307516_10000159 | Ga0307516_1000015934 | 180 |
| 438 | 3300032002 | Ga0307416_101432492 | Ga0307416_1014324922 | 180 |
| 439 | 3300037312 | Ga0395899_0005839 | Ga0395899_0005839_4289_4834 | 180 |
| 440 | 3300037418 | Ga0395900_0015664 | Ga0395900_0015664_4167_4712 | 180 |
| 441 | 3300037466 | Ga0395898_0004833 | Ga0395898_0004833_4856_5401 | 180 |
| 442 | 3300037466 | Ga0395898_0749861 | Ga0395898_0749861_112_654 | 180 |
| 443 | 3300037471 | Ga0395905_0010763 | Ga0395905_0010763_937_1479 | 180 |
| 444 | 3300037471 | Ga0395905_0020396 | Ga0395905_0020396_936_1478 | 180 |
| 445 | 3300038443 | Ga0395901_0002626 | Ga0395901_0002626_7281_7826 | 180 |
| 446 | 3300041453 | Ga0451797_1199432 | Ga0451797_1199432_168_710 | 180 |
| 447 | 3300041486 | Ga0451807_0273900 | Ga0451807_0273900_79_621 | 180 |
| 448 | 3300041507 | Ga0451851_0676225 | Ga0451851_0676225_126_668 | 180 |
| 449 | 3300042876 | Ga0451577_0595004 | Ga0451577_0595004_33_575 | 180 |
| 450 | 3300044656 | Ga0466969_0061025 | Ga0466969_0061025_460_1002 | 180 |
| 451 | 3300044656 | Ga0466969_0320374 | Ga0466969_0320374_49_591 | 180 |
| 452 | 3300044693 | Ga0466961_0061721 | Ga0466961_0061721_1308_1850 | 180 |
| 453 | 3300044706 | Ga0466964_0179775 | Ga0466964_0179775_187_729 | 180 |
| 454 | 3300044719 | Ga0466971_0023766 | Ga0466971_0023766_1574_2116 | 180 |
| 455 | 3300044735 | Ga0466968_0048687 | Ga0466968_0048687_789_1331 | 180 |
| 456 | 3300044765 | Ga0466970_0006114 | Ga0466970_0006114_4215_4757 | 180 |
| 457 | 3300044765 | Ga0466970_0247563 | Ga0466970_0247563_298_840 | 180 |
| 458 | 3300044842 | Ga0466957_0082174 | Ga0466957_0082174_309_851 | 180 |
| 459 | 3300045049 | Ga0466959_0001662 | Ga0466959_0001662_6950_7492 | 180 |
| 460 | 3300045051 | Ga0451576_1299611 | Ga0451576_1299611_111_653 | 180 |
| 461 | 3300045836 | Ga0466958_0099617 | Ga0466958_0099617_801_1343 | 180 |
| 462 | 3300046460 | Ga0495638_0027719 | Ga0495638_0027719_1424_1966 | 180 |
| 463 | 3300046460 | Ga0495638_0045152 | Ga0495638_0045152_750_1292 | 180 |
| 464 | 3300046460 | Ga0495638_0237698 | Ga0495638_0237698_307_849 | 180 |
| 465 | 3300046507 | Ga0495606_0005929 | Ga0495606_0005929_10158_10700 | 180 |
| 466 | 3300046524 | Ga0495648_0005586 | Ga0495648_0005586_9475_10017 | 180 |
| 467 | 3300046537 | Ga0495598_0230881 | Ga0495598_0230881_127_669 | 180 |
| 468 | 3300046648 | Ga0495611_0000677 | Ga0495611_0000677_10760_11302 | 180 |
| 469 | 3300046648 | Ga0495611_0027335 | Ga0495611_0027335_403_945 | 180 |
| 470 | 3300046660 | Ga0495625_0237882 | Ga0495625_0237882_371_913 | 180 |
| 471 | 3300046691 | Ga0495670_0221185 | Ga0495670_0221185_435_977 | 180 |
| 472 | 3300046691 | Ga0495670_0317142 | Ga0495670_0317142_241_783 | 180 |
| 473 | 3300047320 | Ga0495672_0103729 | Ga0495672_0103729_869_1411 | 180 |
| 474 | 3300047443 | Ga0495687_023288 | Ga0495687_023288_42_584 | 180 |
| 475 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_632452_632994 | 180 |
| 476 | 3300048908 | Ga0496105_0392991 | Ga0496105_0392991_413_955 | 180 |
| 477 | 3300049513 | Ga0501290_006667 | Ga0501290_006667_838_1380 | 180 |
| 478 | 3300049568 | Ga0501031_0004581 | Ga0501031_0004581_4219_4761 | 180 |
| 479 | 3300049570 | Ga0501033_0161184 | Ga0501033_0161184_389_931 | 180 |
| 480 | 3300049570 | Ga0501033_0898040 | Ga0501033_0898040_18_560 | 180 |
| 481 | 3300049571 | Ga0501034_0015409 | Ga0501034_0015409_6391_6933 | 180 |
| 482 | 3300049571 | Ga0501034_0042137 | Ga0501034_0042137_2980_3522 | 180 |
| 483 | 3300049572 | Ga0501036_0016624 | Ga0501036_0016624_2509_3051 | 180 |
| 484 | 3300049573 | Ga0501037_0122464 | Ga0501037_0122464_40_582 | 180 |
| 485 | 3300049574 | Ga0501038_0002256 | Ga0501038_0002256_16765_17307 | 180 |
| 486 | 3300049574 | Ga0501038_0217195 | Ga0501038_0217195_45_587 | 180 |
| 487 | 3300049575 | Ga0501039_0015887 | Ga0501039_0015887_968_1510 | 180 |
| 488 | 3300049576 | Ga0501040_0375742 | Ga0501040_0375742_435_977 | 180 |
| 489 | 3300049579 | Ga0501043_0010022 | Ga0501043_0010022_4142_4684 | 180 |
| 490 | 3300049581 | Ga0501047_0096960 | Ga0501047_0096960_683_1225 | 180 |
| 491 | 3300049584 | Ga0501068_0201533 | Ga0501068_0201533_651_1193 | 180 |
| 492 | 3300049675 | Ga0501243_008997 | Ga0501243_008997_546_1088 | 180 |
| 493 | 3300049680 | Ga0501250_000692 | Ga0501250_000692_1287_1829 | 180 |
| 494 | 3300049683 | Ga0501253_020816 | Ga0501253_020816_410_952 | 180 |
| 495 | 3300049688 | Ga0501259_001264 | Ga0501259_001264_198_740 | 180 |
| 496 | 3300049707 | Ga0501234_010646 | Ga0501234_010646_64_606 | 180 |
| 497 | 3300049708 | Ga0501245_009929 | Ga0501245_009929_316_858 | 180 |
| 498 | 3300049758 | Ga0501241_005859 | Ga0501241_005859_1643_2185 | 180 |
| 499 | 3300049770 | Ga0501273_023774 | Ga0501273_023774_206_748 | 180 |
| 500 | 3300049822 | Ga0501035_0048223 | Ga0501035_0048223_2102_2644 | 180 |
| 501 | 3300049822 | Ga0501035_0209333 | Ga0501035_0209333_1043_1585 | 180 |
| 502 | 3300049823 | Ga0501044_0010844 | Ga0501044_0010844_3302_3844 | 180 |
| 503 | 3300049823 | Ga0501044_0240108 | Ga0501044_0240108_79_636 | 180 |
| 504 | 3300050005 | Ga0501284_00002 | Ga0501284_00002_142467_143009 | 180 |
| 505 | 3300050508 | nmdc:mga09592_1381_c1 | nmdc:mga09592_1381_c1_10812_11354 | 180 |
| 506 | 3300050510 | nmdc:mga06r32_1422834_c1 | nmdc:mga06r32_1422834_c1_55_597 | 180 |
| 507 | 3300050511 | nmdc:mga08y16_1066083_c1 | nmdc:mga08y16_1066083_c1_66_608 | 180 |
| 508 | 3300053092 | Ga0500583_0000925 | Ga0500583_0000925_4829_5371 | 180 |
| 509 | 3300053092 | Ga0500583_0121762 | Ga0500583_0121762_723_1265 | 180 |
| 510 | 3300053130 | Ga0500642_0023825 | Ga0500642_0023825_107_649 | 180 |
| 511 | 3300053139 | Ga0500568_0009824 | Ga0500568_0009824_578_1120 | 180 |
| 512 | 3300053146 | Ga0500588_0009145 | Ga0500588_0009145_1481_2023 | 180 |
| 513 | 3300053156 | Ga0500622_0008293 | Ga0500622_0008293_2055_2597 | 180 |
| 514 | 3300061719 | Ga0466962_0012015 | Ga0466962_0012015_2449_2991 | 180 |
| 515 | 2162886011 | MRS1b_contig_6238227 | MRS1b_0503.00001580 | 181 |
| 516 | 3300001904 | JGI24736J21556_1043293 | JGI24736J21556_10432931 | 181 |
| 517 | 3300003323 | rootH1_10224374 | rootH1_102243743 | 181 |
| 518 | 3300005288 | Ga0065714_10171058 | Ga0065714_101710582 | 181 |
| 519 | 3300005290 | Ga0065712_10006449 | Ga0065712_100064496 | 181 |
| 520 | 3300005290 | Ga0065712_10094617 | Ga0065712_100946172 | 181 |
| 521 | 3300005290 | Ga0065712_10118315 | Ga0065712_101183152 | 181 |
| 522 | 3300005290 | Ga0065712_10144144 | Ga0065712_101441441 | 181 |
| 523 | 3300005327 | Ga0070658_10549608 | Ga0070658_105496082 | 181 |
| 524 | 3300005328 | Ga0070676_10017601 | Ga0070676_100176012 | 181 |
| 525 | 3300005328 | Ga0070676_10488270 | Ga0070676_104882701 | 181 |
| 526 | 3300005329 | Ga0070683_100065604 | Ga0070683_1000656045 | 181 |
| 527 | 3300005329 | Ga0070683_100099212 | Ga0070683_1000992122 | 181 |
| 528 | 3300005329 | Ga0070683_100147044 | Ga0070683_1001470442 | 181 |
| 529 | 3300005329 | Ga0070683_100215793 | Ga0070683_1002157932 | 181 |
| 530 | 3300005329 | Ga0070683_100265676 | Ga0070683_1002656762 | 181 |
| 531 | 3300005329 | Ga0070683_100326036 | Ga0070683_1003260362 | 181 |
| 532 | 3300005330 | Ga0070690_100006178 | Ga0070690_1000061782 | 181 |
| 533 | 3300005330 | Ga0070690_100108460 | Ga0070690_1001084602 | 181 |
| 534 | 3300005331 | Ga0070670_100033314 | Ga0070670_1000333142 | 181 |
| 535 | 3300005331 | Ga0070670_100056071 | Ga0070670_1000560712 | 181 |
| 536 | 3300005331 | Ga0070670_100415457 | Ga0070670_1004154572 | 181 |
| 537 | 3300005333 | Ga0070677_10155260 | Ga0070677_101552601 | 181 |
| 538 | 3300005334 | Ga0068869_100030779 | Ga0068869_1000307794 | 181 |
| 539 | 3300005334 | Ga0068869_100052211 | Ga0068869_1000522111 | 181 |
| 540 | 3300005334 | Ga0068869_100057639 | Ga0068869_1000576394 | 181 |
| 541 | 3300005334 | Ga0068869_100084081 | Ga0068869_1000840811 | 181 |
| 542 | 3300005334 | Ga0068869_100089243 | Ga0068869_1000892432 | 181 |
| 543 | 3300005334 | Ga0068869_100120852 | Ga0068869_1001208522 | 181 |
| 544 | 3300005335 | Ga0070666_10000126 | Ga0070666_1000012623 | 181 |
| 545 | 3300005335 | Ga0070666_10483350 | Ga0070666_104833502 | 181 |
| 546 | 3300005337 | Ga0070682_100071311 | Ga0070682_1000713112 | 181 |
| 547 | 3300005338 | Ga0068868_100002609 | Ga0068868_10000260912 | 181 |
| 548 | 3300005338 | Ga0068868_100028711 | Ga0068868_1000287114 | 181 |
| 549 | 3300005338 | Ga0068868_100041820 | Ga0068868_1000418204 | 181 |
| 550 | 3300005338 | Ga0068868_100140009 | Ga0068868_1001400092 | 181 |
| 551 | 3300005338 | Ga0068868_100743718 | Ga0068868_1007437181 | 181 |
| 552 | 3300005339 | Ga0070660_100105277 | Ga0070660_1001052772 | 181 |
| 553 | 3300005339 | Ga0070660_100650456 | Ga0070660_1006504561 | 181 |
| 554 | 3300005340 | Ga0070689_100004293 | Ga0070689_1000042934 | 181 |
| 555 | 3300005340 | Ga0070689_100060723 | Ga0070689_1000607233 | 181 |
| 556 | 3300005340 | Ga0070689_100758079 | Ga0070689_1007580791 | 181 |
| 557 | 3300005340 | Ga0070689_100771875 | Ga0070689_1007718751 | 181 |
| 558 | 3300005343 | Ga0070687_100040906 | Ga0070687_1000409062 | 181 |
| 559 | 3300005343 | Ga0070687_100054053 | Ga0070687_1000540531 | 181 |
| 560 | 3300005343 | Ga0070687_100174895 | Ga0070687_1001748952 | 181 |
| 561 | 3300005344 | Ga0070661_100023080 | Ga0070661_1000230804 | 181 |
| 562 | 3300005344 | Ga0070661_100100237 | Ga0070661_1001002373 | 181 |
| 563 | 3300005344 | Ga0070661_100190962 | Ga0070661_1001909621 | 181 |
| 564 | 3300005344 | Ga0070661_100212724 | Ga0070661_1002127241 | 181 |
| 565 | 3300005347 | Ga0070668_100065969 | Ga0070668_1000659691 | 181 |
| 566 | 3300005347 | Ga0070668_100444332 | Ga0070668_1004443321 | 181 |
| 567 | 3300005347 | Ga0070668_100660219 | Ga0070668_1006602191 | 181 |
| 568 | 3300005353 | Ga0070669_100004117 | Ga0070669_1000041178 | 181 |
| 569 | 3300005353 | Ga0070669_100130083 | Ga0070669_1001300832 | 181 |
| 570 | 3300005353 | Ga0070669_100321842 | Ga0070669_1003218422 | 181 |
| 571 | 3300005353 | Ga0070669_100744282 | Ga0070669_1007442821 | 181 |
| 572 | 3300005354 | Ga0070675_100045495 | Ga0070675_1000454954 | 181 |
| 573 | 3300005354 | Ga0070675_100081532 | Ga0070675_1000815323 | 181 |
| 574 | 3300005354 | Ga0070675_100201320 | Ga0070675_1002013201 | 181 |
| 575 | 3300005354 | Ga0070675_100254452 | Ga0070675_1002544521 | 181 |
| 576 | 3300005354 | Ga0070675_100524592 | Ga0070675_1005245922 | 181 |
| 577 | 3300005354 | Ga0070675_101558151 | Ga0070675_1015581511 | 181 |
| 578 | 3300005355 | Ga0070671_100243619 | Ga0070671_1002436192 | 181 |
| 579 | 3300005355 | Ga0070671_100259235 | Ga0070671_1002592352 | 181 |
| 580 | 3300005355 | Ga0070671_100379652 | Ga0070671_1003796522 | 181 |
| 581 | 3300005355 | Ga0070671_100426794 | Ga0070671_1004267942 | 181 |
| 582 | 3300005356 | Ga0070674_100058777 | Ga0070674_1000587772 | 181 |
| 583 | 3300005356 | Ga0070674_100137176 | Ga0070674_1001371761 | 181 |
| 584 | 3300005364 | Ga0070673_100012036 | Ga0070673_1000120369 | 181 |
| 585 | 3300005364 | Ga0070673_100045464 | Ga0070673_1000454643 | 181 |
| 586 | 3300005364 | Ga0070673_100119196 | Ga0070673_1001191962 | 181 |
| 587 | 3300005364 | Ga0070673_100233137 | Ga0070673_1002331372 | 181 |
| 588 | 3300005364 | Ga0070673_101302826 | Ga0070673_1013028261 | 181 |
| 589 | 3300005365 | Ga0070688_100004391 | Ga0070688_1000043917 | 181 |
| 590 | 3300005365 | Ga0070688_100033543 | Ga0070688_1000335432 | 181 |
| 591 | 3300005365 | Ga0070688_100046050 | Ga0070688_1000460504 | 181 |
| 592 | 3300005366 | Ga0070659_100013337 | Ga0070659_1000133375 | 181 |
| 593 | 3300005366 | Ga0070659_100033703 | Ga0070659_1000337033 | 181 |
| 594 | 3300005367 | Ga0070667_100015757 | Ga0070667_1000157574 | 181 |
| 595 | 3300005367 | Ga0070667_100059359 | Ga0070667_1000593594 | 181 |
| 596 | 3300005367 | Ga0070667_100152306 | Ga0070667_1001523061 | 181 |
| 597 | 3300005367 | Ga0070667_100215144 | Ga0070667_1002151442 | 181 |
| 598 | 3300005367 | Ga0070667_100225485 | Ga0070667_1002254851 | 181 |
| 599 | 3300005367 | Ga0070667_100251166 | Ga0070667_1002511663 | 181 |
| 600 | 3300005367 | Ga0070667_100630983 | Ga0070667_1006309831 | 181 |
| 601 | 3300005436 | Ga0070713_100195313 | Ga0070713_1001953132 | 181 |
| 602 | 3300005438 | Ga0070701_10144577 | Ga0070701_101445771 | 181 |
| 603 | 3300005438 | Ga0070701_10171163 | Ga0070701_101711632 | 181 |
| 604 | 3300005438 | Ga0070701_10194481 | Ga0070701_101944811 | 181 |
| 605 | 3300005441 | Ga0070700_100019747 | Ga0070700_1000197471 | 181 |
| 606 | 3300005445 | Ga0070708_101071167 | Ga0070708_1010711671 | 181 |
| 607 | 3300005455 | Ga0070663_100297913 | Ga0070663_1002979132 | 181 |
| 608 | 3300005456 | Ga0070678_100502067 | Ga0070678_1005020672 | 181 |
| 609 | 3300005456 | Ga0070678_100911580 | Ga0070678_1009115801 | 181 |
| 610 | 3300005456 | Ga0070678_100971092 | Ga0070678_1009710922 | 181 |
| 611 | 3300005456 | Ga0070678_101191830 | Ga0070678_1011918301 | 181 |
| 612 | 3300005457 | Ga0070662_100006695 | Ga0070662_10000669510 | 181 |
| 613 | 3300005457 | Ga0070662_100046912 | Ga0070662_1000469122 | 181 |
| 614 | 3300005457 | Ga0070662_100076849 | Ga0070662_1000768492 | 181 |
| 615 | 3300005457 | Ga0070662_100094771 | Ga0070662_1000947712 | 181 |
| 616 | 3300005457 | Ga0070662_100452488 | Ga0070662_1004524882 | 181 |
| 617 | 3300005459 | Ga0068867_100011375 | Ga0068867_1000113756 | 181 |
| 618 | 3300005459 | Ga0068867_100033276 | Ga0068867_1000332763 | 181 |
| 619 | 3300005459 | Ga0068867_100131964 | Ga0068867_1001319642 | 181 |
| 620 | 3300005459 | Ga0068867_100182828 | Ga0068867_1001828282 | 181 |
| 621 | 3300005459 | Ga0068867_100210426 | Ga0068867_1002104261 | 181 |
| 622 | 3300005459 | Ga0068867_100255227 | Ga0068867_1002552272 | 181 |
| 623 | 3300005459 | Ga0068867_101058134 | Ga0068867_1010581341 | 181 |
| 624 | 3300005466 | Ga0070685_10005637 | Ga0070685_100056373 | 181 |
| 625 | 3300005466 | Ga0070685_10137876 | Ga0070685_101378762 | 181 |
| 626 | 3300005466 | Ga0070685_10269347 | Ga0070685_102693473 | 181 |
| 627 | 3300005466 | Ga0070685_10706283 | Ga0070685_107062831 | 181 |
| 628 | 3300005471 | Ga0070698_100515624 | Ga0070698_1005156241 | 181 |
| 629 | 3300005530 | Ga0070679_100003832 | Ga0070679_1000038323 | 181 |
| 630 | 3300005530 | Ga0070679_100004315 | Ga0070679_10000431512 | 181 |
| 631 | 3300005535 | Ga0070684_100031867 | Ga0070684_1000318676 | 181 |
| 632 | 3300005535 | Ga0070684_100046297 | Ga0070684_1000462972 | 181 |
| 633 | 3300005539 | Ga0068853_100074541 | Ga0068853_1000745412 | 181 |
| 634 | 3300005539 | Ga0068853_100093581 | Ga0068853_1000935815 | 181 |
| 635 | 3300005539 | Ga0068853_100238495 | Ga0068853_1002384953 | 181 |
| 636 | 3300005539 | Ga0068853_100260834 | Ga0068853_1002608341 | 181 |
| 637 | 3300005539 | Ga0068853_100317379 | Ga0068853_1003173792 | 181 |
| 638 | 3300005543 | Ga0070672_100014325 | Ga0070672_1000143252 | 181 |
| 639 | 3300005543 | Ga0070672_100080482 | Ga0070672_1000804822 | 181 |
| 640 | 3300005543 | Ga0070672_100769382 | Ga0070672_1007693821 | 181 |
| 641 | 3300005543 | Ga0070672_100900325 | Ga0070672_1009003251 | 181 |
| 642 | 3300005544 | Ga0070686_100238097 | Ga0070686_1002380971 | 181 |
| 643 | 3300005545 | Ga0070695_101090336 | Ga0070695_1010903361 | 181 |
| 644 | 3300005547 | Ga0070693_100013908 | Ga0070693_1000139085 | 181 |
| 645 | 3300005547 | Ga0070693_100123855 | Ga0070693_1001238552 | 181 |
| 646 | 3300005548 | Ga0070665_100135417 | Ga0070665_1001354174 | 181 |
| 647 | 3300005548 | Ga0070665_100255545 | Ga0070665_1002555452 | 181 |
| 648 | 3300005563 | Ga0068855_100010889 | Ga0068855_1000108899 | 181 |
| 649 | 3300005564 | Ga0070664_100001016 | Ga0070664_1000010167 | 181 |
| 650 | 3300005564 | Ga0070664_100035868 | Ga0070664_1000358684 | 181 |
| 651 | 3300005564 | Ga0070664_100221732 | Ga0070664_1002217321 | 181 |
| 652 | 3300005564 | Ga0070664_100223461 | Ga0070664_1002234612 | 181 |
| 653 | 3300005564 | Ga0070664_100265859 | Ga0070664_1002658592 | 181 |
| 654 | 3300005564 | Ga0070664_100321608 | Ga0070664_1003216082 | 181 |
| 655 | 3300005564 | Ga0070664_100372275 | Ga0070664_1003722752 | 181 |
| 656 | 3300005564 | Ga0070664_100848743 | Ga0070664_1008487432 | 181 |
| 657 | 3300005564 | Ga0070664_101092067 | Ga0070664_1010920671 | 181 |
| 658 | 3300005577 | Ga0068857_100004400 | Ga0068857_1000044009 | 181 |
| 659 | 3300005577 | Ga0068857_100036932 | Ga0068857_1000369324 | 181 |
| 660 | 3300005577 | Ga0068857_100150447 | Ga0068857_1001504472 | 181 |
| 661 | 3300005577 | Ga0068857_100228595 | Ga0068857_1002285951 | 181 |
| 662 | 3300005577 | Ga0068857_100279401 | Ga0068857_1002794014 | 181 |
| 663 | 3300005577 | Ga0068857_100793250 | Ga0068857_1007932502 | 181 |
| 664 | 3300005577 | Ga0068857_101444505 | Ga0068857_1014445052 | 181 |
| 665 | 3300005578 | Ga0068854_100032539 | Ga0068854_1000325394 | 181 |
| 666 | 3300005614 | Ga0068856_100598241 | Ga0068856_1005982411 | 181 |
| 667 | 3300005615 | Ga0070702_100063336 | Ga0070702_1000633362 | 181 |
| 668 | 3300005615 | Ga0070702_100553722 | Ga0070702_1005537222 | 181 |
| 669 | 3300005616 | Ga0068852_100099128 | Ga0068852_1000991282 | 181 |
| 670 | 3300005616 | Ga0068852_100099996 | Ga0068852_1000999962 | 181 |
| 671 | 3300005616 | Ga0068852_100105898 | Ga0068852_1001058982 | 181 |
| 672 | 3300005616 | Ga0068852_100401730 | Ga0068852_1004017302 | 181 |
| 673 | 3300005616 | Ga0068852_101355707 | Ga0068852_1013557071 | 181 |
| 674 | 3300005617 | Ga0068859_100000003 | Ga0068859_10000000359 | 181 |
| 675 | 3300005617 | Ga0068859_100024436 | Ga0068859_1000244362 | 181 |
| 676 | 3300005617 | Ga0068859_100077477 | Ga0068859_1000774776 | 181 |
| 677 | 3300005617 | Ga0068859_100080405 | Ga0068859_1000804054 | 181 |
| 678 | 3300005617 | Ga0068859_100215081 | Ga0068859_1002150813 | 181 |
| 679 | 3300005617 | Ga0068859_100256216 | Ga0068859_1002562162 | 181 |
| 680 | 3300005617 | Ga0068859_100327292 | Ga0068859_1003272922 | 181 |
| 681 | 3300005618 | Ga0068864_100001903 | Ga0068864_10000190315 | 181 |
| 682 | 3300005618 | Ga0068864_100003471 | Ga0068864_1000034714 | 181 |
| 683 | 3300005618 | Ga0068864_100267860 | Ga0068864_1002678602 | 181 |
| 684 | 3300005618 | Ga0068864_100496030 | Ga0068864_1004960302 | 181 |
| 685 | 3300005618 | Ga0068864_100772340 | Ga0068864_1007723402 | 181 |
| 686 | 3300005618 | Ga0068864_101132327 | Ga0068864_1011323271 | 181 |
| 687 | 3300005718 | Ga0068866_10041295 | Ga0068866_100412953 | 181 |
| 688 | 3300005718 | Ga0068866_10052467 | Ga0068866_100524673 | 181 |
| 689 | 3300005719 | Ga0068861_100002644 | Ga0068861_1000026447 | 181 |
| 690 | 3300005719 | Ga0068861_100304468 | Ga0068861_1003044682 | 181 |
| 691 | 3300005719 | Ga0068861_100320268 | Ga0068861_1003202682 | 181 |
| 692 | 3300005719 | Ga0068861_100540222 | Ga0068861_1005402222 | 181 |
| 693 | 3300005834 | Ga0068851_10068189 | Ga0068851_100681892 | 181 |
| 694 | 3300005834 | Ga0068851_10076574 | Ga0068851_100765741 | 181 |
| 695 | 3300005834 | Ga0068851_10143020 | Ga0068851_101430202 | 181 |
| 696 | 3300005840 | Ga0068870_10020767 | Ga0068870_100207672 | 181 |
| 697 | 3300005840 | Ga0068870_10607351 | Ga0068870_106073512 | 181 |
| 698 | 3300005840 | Ga0068870_10645997 | Ga0068870_106459971 | 181 |
| 699 | 3300005841 | Ga0068863_100013210 | Ga0068863_1000132107 | 181 |
| 700 | 3300005841 | Ga0068863_100066379 | Ga0068863_1000663792 | 181 |
| 701 | 3300005841 | Ga0068863_100068065 | Ga0068863_1000680653 | 181 |
| 702 | 3300005841 | Ga0068863_100136478 | Ga0068863_1001364782 | 181 |
| 703 | 3300005841 | Ga0068863_101431384 | Ga0068863_1014313841 | 181 |
| 704 | 3300005842 | Ga0068858_100002526 | Ga0068858_1000025261 | 181 |
| 705 | 3300005842 | Ga0068858_100026873 | Ga0068858_1000268732 | 181 |
| 706 | 3300005842 | Ga0068858_100161513 | Ga0068858_1001615131 | 181 |
| 707 | 3300005842 | Ga0068858_100376103 | Ga0068858_1003761032 | 181 |
| 708 | 3300005843 | Ga0068860_100001337 | Ga0068860_1000013379 | 181 |
| 709 | 3300005843 | Ga0068860_100025145 | Ga0068860_1000251453 | 181 |
| 710 | 3300005843 | Ga0068860_100261277 | Ga0068860_1002612772 | 181 |
| 711 | 3300005843 | Ga0068860_100532007 | Ga0068860_1005320072 | 181 |
| 712 | 3300005844 | Ga0068862_100271917 | Ga0068862_1002719171 | 181 |
| 713 | 3300005985 | Ga0081539_10071602 | Ga0081539_100716023 | 181 |
| 714 | 3300006195 | Ga0075366_10150416 | Ga0075366_101504162 | 181 |
| 715 | 3300006195 | Ga0075366_10218982 | Ga0075366_102189822 | 181 |
| 716 | 3300006237 | Ga0097621_100089565 | Ga0097621_1000895652 | 181 |
| 717 | 3300006237 | Ga0097621_100177327 | Ga0097621_1001773272 | 181 |
| 718 | 3300006237 | Ga0097621_100195925 | Ga0097621_1001959252 | 181 |
| 719 | 3300006237 | Ga0097621_100217765 | Ga0097621_1002177653 | 181 |
| 720 | 3300006237 | Ga0097621_100239640 | Ga0097621_1002396402 | 181 |
| 721 | 3300006237 | Ga0097621_100245783 | Ga0097621_1002457832 | 181 |
| 722 | 3300006237 | Ga0097621_100429327 | Ga0097621_1004293271 | 181 |
| 723 | 3300006353 | Ga0075370_10382708 | Ga0075370_103827082 | 181 |
| 724 | 3300006358 | Ga0068871_100021440 | Ga0068871_1000214406 | 181 |
| 725 | 3300006358 | Ga0068871_100507618 | Ga0068871_1005076182 | 181 |
| 726 | 3300006358 | Ga0068871_100614242 | Ga0068871_1006142421 | 181 |
| 727 | 3300006358 | Ga0068871_100785391 | Ga0068871_1007853912 | 181 |
| 728 | 3300006358 | Ga0068871_101167891 | Ga0068871_1011678911 | 181 |
| 729 | 3300006358 | Ga0068871_101388571 | Ga0068871_1013885711 | 181 |
| 730 | 3300006871 | Ga0075434_100358493 | Ga0075434_1003584932 | 181 |
| 731 | 3300006871 | Ga0075434_101012930 | Ga0075434_1010129301 | 181 |
| 732 | 3300006880 | Ga0075429_100427382 | Ga0075429_1004273822 | 181 |
| 733 | 3300006881 | Ga0068865_100046619 | Ga0068865_1000466193 | 181 |
| 734 | 3300006881 | Ga0068865_100145381 | Ga0068865_1001453813 | 181 |
| 735 | 3300006931 | Ga0097620_100000003 | Ga0097620_10000000359 | 181 |
| 736 | 3300006931 | Ga0097620_100000592 | Ga0097620_10000059211 | 181 |
| 737 | 3300006931 | Ga0097620_100024436 | Ga0097620_1000244362 | 181 |
| 738 | 3300006931 | Ga0097620_100077479 | Ga0097620_1000774796 | 181 |
| 739 | 3300006931 | Ga0097620_100080403 | Ga0097620_1000804032 | 181 |
| 740 | 3300006931 | Ga0097620_100215091 | Ga0097620_1002150913 | 181 |
| 741 | 3300006931 | Ga0097620_100256220 | Ga0097620_1002562202 | 181 |
| 742 | 3300006931 | Ga0097620_100327319 | Ga0097620_1003273192 | 181 |
| 743 | 3300009093 | Ga0105240_10188485 | Ga0105240_101884854 | 181 |
| 744 | 3300009093 | Ga0105240_10711848 | Ga0105240_107118482 | 181 |
| 745 | 3300009094 | Ga0111539_10033178 | Ga0111539_100331783 | 181 |
| 746 | 3300009094 | Ga0111539_10107847 | Ga0111539_101078473 | 181 |
| 747 | 3300009094 | Ga0111539_10528001 | Ga0111539_105280011 | 181 |
| 748 | 3300009098 | Ga0105245_10098230 | Ga0105245_100982302 | 181 |
| 749 | 3300009101 | Ga0105247_10009494 | Ga0105247_100094944 | 181 |
| 750 | 3300009101 | Ga0105247_10574370 | Ga0105247_105743702 | 181 |
| 751 | 3300009101 | Ga0105247_10884422 | Ga0105247_108844222 | 181 |
| 752 | 3300009147 | Ga0114129_10013112 | Ga0114129_100131127 | 181 |
| 753 | 3300009148 | Ga0105243_10062728 | Ga0105243_100627282 | 181 |
| 754 | 3300009148 | Ga0105243_10108870 | Ga0105243_101088703 | 181 |
| 755 | 3300009174 | Ga0105241_10003737 | Ga0105241_100037373 | 181 |
| 756 | 3300009174 | Ga0105241_10031425 | Ga0105241_100314254 | 181 |
| 757 | 3300009174 | Ga0105241_10230780 | Ga0105241_102307802 | 181 |
| 758 | 3300009174 | Ga0105241_11136750 | Ga0105241_111367501 | 181 |
| 759 | 3300009176 | Ga0105242_10292707 | Ga0105242_102927071 | 181 |
| 760 | 3300009176 | Ga0105242_10381257 | Ga0105242_103812571 | 181 |
| 761 | 3300009176 | Ga0105242_10420555 | Ga0105242_104205552 | 181 |
| 762 | 3300009176 | Ga0105242_10777338 | Ga0105242_107773382 | 181 |
| 763 | 3300009176 | Ga0105242_10861158 | Ga0105242_108611582 | 181 |
| 764 | 3300009177 | Ga0105248_11154761 | Ga0105248_111547612 | 181 |
| 765 | 3300009545 | Ga0105237_10017239 | Ga0105237_100172393 | 181 |
| 766 | 3300009545 | Ga0105237_10023760 | Ga0105237_100237602 | 181 |
| 767 | 3300009545 | Ga0105237_10075351 | Ga0105237_100753512 | 181 |
| 768 | 3300009545 | Ga0105237_11117422 | Ga0105237_111174221 | 181 |
| 769 | 3300009551 | Ga0105238_10009716 | Ga0105238_100097167 | 181 |
| 770 | 3300009553 | Ga0105249_10004606 | Ga0105249_100046064 | 181 |
| 771 | 3300009553 | Ga0105249_10037856 | Ga0105249_100378561 | 181 |
| 772 | 3300009553 | Ga0105249_10701465 | Ga0105249_107014652 | 181 |
| 773 | 3300010375 | Ga0105239_10004005 | Ga0105239_100040058 | 181 |
| 774 | 3300010375 | Ga0105239_10047256 | Ga0105239_100472563 | 181 |
| 775 | 3300010375 | Ga0105239_10159566 | Ga0105239_101595664 | 181 |
| 776 | 3300010375 | Ga0105239_10230508 | Ga0105239_102305083 | 181 |
| 777 | 3300010375 | Ga0105239_12081586 | Ga0105239_120815861 | 181 |
| 778 | 3300011119 | Ga0105246_10231064 | Ga0105246_102310642 | 181 |
| 779 | 3300011119 | Ga0105246_10254680 | Ga0105246_102546802 | 181 |
| 780 | 3300013100 | Ga0157373_10005705 | Ga0157373_1000570510 | 181 |
| 781 | 3300013100 | Ga0157373_10311017 | Ga0157373_103110172 | 181 |
| 782 | 3300013100 | Ga0157373_10322312 | Ga0157373_103223122 | 181 |
| 783 | 3300013100 | Ga0157373_10530749 | Ga0157373_105307492 | 181 |
| 784 | 3300013102 | Ga0157371_10054546 | Ga0157371_100545462 | 181 |
| 785 | 3300013102 | Ga0157371_10074045 | Ga0157371_100740452 | 181 |
| 786 | 3300013102 | Ga0157371_10120463 | Ga0157371_101204633 | 181 |
| 787 | 3300013102 | Ga0157371_10161428 | Ga0157371_101614282 | 181 |
| 788 | 3300013102 | Ga0157371_10270488 | Ga0157371_102704882 | 181 |
| 789 | 3300013102 | Ga0157371_10296971 | Ga0157371_102969712 | 181 |
| 790 | 3300013104 | Ga0157370_10136467 | Ga0157370_101364672 | 181 |
| 791 | 3300013104 | Ga0157370_10193606 | Ga0157370_101936062 | 181 |
| 792 | 3300013104 | Ga0157370_10893635 | Ga0157370_108936351 | 181 |
| 793 | 3300013105 | Ga0157369_10047526 | Ga0157369_100475264 | 181 |
| 794 | 3300013296 | Ga0157374_10003298 | Ga0157374_100032985 | 181 |
| 795 | 3300013296 | Ga0157374_10024775 | Ga0157374_100247756 | 181 |
| 796 | 3300013296 | Ga0157374_10029574 | Ga0157374_100295743 | 181 |
| 797 | 3300013296 | Ga0157374_10173103 | Ga0157374_101731032 | 181 |
| 798 | 3300013296 | Ga0157374_10499861 | Ga0157374_104998612 | 181 |
| 799 | 3300013296 | Ga0157374_10705089 | Ga0157374_107050891 | 181 |
| 800 | 3300013297 | Ga0157378_10022391 | Ga0157378_100223914 | 181 |
| 801 | 3300013297 | Ga0157378_10067398 | Ga0157378_100673981 | 181 |
| 802 | 3300013297 | Ga0157378_10082110 | Ga0157378_100821102 | 181 |
| 803 | 3300013297 | Ga0157378_10094708 | Ga0157378_100947082 | 181 |
| 804 | 3300013297 | Ga0157378_10219860 | Ga0157378_102198602 | 181 |
| 805 | 3300013297 | Ga0157378_10656513 | Ga0157378_106565131 | 181 |
| 806 | 3300013297 | Ga0157378_10747849 | Ga0157378_107478492 | 181 |
| 807 | 3300013306 | Ga0163162_10002078 | Ga0163162_1000207812 | 181 |
| 808 | 3300013306 | Ga0163162_10002386 | Ga0163162_100023867 | 181 |
| 809 | 3300013306 | Ga0163162_10016743 | Ga0163162_100167435 | 181 |
| 810 | 3300013306 | Ga0163162_10537355 | Ga0163162_105373552 | 181 |
| 811 | 3300013306 | Ga0163162_10854348 | Ga0163162_108543482 | 181 |
| 812 | 3300013307 | Ga0157372_10002594 | Ga0157372_100025943 | 181 |
| 813 | 3300013307 | Ga0157372_10007410 | Ga0157372_100074103 | 181 |
| 814 | 3300013307 | Ga0157372_10127319 | Ga0157372_101273194 | 181 |
| 815 | 3300013307 | Ga0157372_10153094 | Ga0157372_101530943 | 181 |
| 816 | 3300013307 | Ga0157372_10222669 | Ga0157372_102226693 | 181 |
| 817 | 3300013307 | Ga0157372_10302966 | Ga0157372_103029663 | 181 |
| 818 | 3300013307 | Ga0157372_10575993 | Ga0157372_105759932 | 181 |
| 819 | 3300013307 | Ga0157372_11867278 | Ga0157372_118672781 | 181 |
| 820 | 3300013308 | Ga0157375_10012111 | Ga0157375_100121117 | 181 |
| 821 | 3300013308 | Ga0157375_10013965 | Ga0157375_100139652 | 181 |
| 822 | 3300013308 | Ga0157375_10020759 | Ga0157375_100207597 | 181 |
| 823 | 3300013308 | Ga0157375_10176130 | Ga0157375_101761302 | 181 |
| 824 | 3300013308 | Ga0157375_10187243 | Ga0157375_101872432 | 181 |
| 825 | 3300013308 | Ga0157375_10227462 | Ga0157375_102274622 | 181 |
| 826 | 3300013308 | Ga0157375_10580700 | Ga0157375_105807002 | 181 |
| 827 | 3300013308 | Ga0157375_10746523 | Ga0157375_107465231 | 181 |
| 828 | 3300013308 | Ga0157375_10821450 | Ga0157375_108214502 | 181 |
| 829 | 3300013308 | Ga0157375_11931466 | Ga0157375_119314661 | 181 |
| 830 | 3300014325 | Ga0163163_10005191 | Ga0163163_1000519111 | 181 |
| 831 | 3300014325 | Ga0163163_10006337 | Ga0163163_100063374 | 181 |
| 832 | 3300014325 | Ga0163163_10096114 | Ga0163163_100961145 | 181 |
| 833 | 3300014325 | Ga0163163_10270072 | Ga0163163_102700722 | 181 |
| 834 | 3300014325 | Ga0163163_10384216 | Ga0163163_103842162 | 181 |
| 835 | 3300014326 | Ga0157380_10001704 | Ga0157380_100017049 | 181 |
| 836 | 3300014326 | Ga0157380_10007415 | Ga0157380_100074153 | 181 |
| 837 | 3300014326 | Ga0157380_10026790 | Ga0157380_100267903 | 181 |
| 838 | 3300014326 | Ga0157380_10111984 | Ga0157380_101119842 | 181 |
| 839 | 3300014326 | Ga0157380_11574868 | Ga0157380_115748682 | 181 |
| 840 | 3300014745 | Ga0157377_10007408 | Ga0157377_100074083 | 181 |
| 841 | 3300014745 | Ga0157377_10026538 | Ga0157377_100265383 | 181 |
| 842 | 3300014745 | Ga0157377_10029488 | Ga0157377_100294882 | 181 |
| 843 | 3300014968 | Ga0157379_10177261 | Ga0157379_101772612 | 181 |
| 844 | 3300014968 | Ga0157379_10555980 | Ga0157379_105559802 | 181 |
| 845 | 3300014969 | Ga0157376_10047974 | Ga0157376_100479746 | 181 |
| 846 | 3300014969 | Ga0157376_10091928 | Ga0157376_100919283 | 181 |
| 847 | 3300014969 | Ga0157376_10181011 | Ga0157376_101810112 | 181 |
| 848 | 3300014969 | Ga0157376_10512163 | Ga0157376_105121631 | 181 |
| 849 | 3300014969 | Ga0157376_10715014 | Ga0157376_107150142 | 181 |
| 850 | 3300017792 | Ga0163161_10028693 | Ga0163161_100286932 | 181 |
| 851 | 3300017792 | Ga0163161_10030442 | Ga0163161_100304422 | 181 |
| 852 | 3300017792 | Ga0163161_10398592 | Ga0163161_103985922 | 181 |
| 853 | 3300017792 | Ga0163161_10413297 | Ga0163161_104132972 | 181 |
| 854 | 3300017792 | Ga0163161_10743490 | Ga0163161_107434902 | 181 |
| 855 | 3300017792 | Ga0163161_10861656 | Ga0163161_108616561 | 181 |
| 856 | 3300025246 | Ga0209646_1002117 | Ga0209646_10021174 | 181 |
| 857 | 3300025315 | Ga0207697_10160686 | Ga0207697_101606862 | 181 |
| 858 | 3300025321 | Ga0207656_10118095 | Ga0207656_101180952 | 181 |
| 859 | 3300025321 | Ga0207656_10136620 | Ga0207656_101366202 | 181 |
| 860 | 3300025321 | Ga0207656_10242563 | Ga0207656_102425631 | 181 |
| 861 | 3300025899 | Ga0207642_10014577 | Ga0207642_100145772 | 181 |
| 862 | 3300025899 | Ga0207642_10038504 | Ga0207642_100385042 | 181 |
| 863 | 3300025900 | Ga0207710_10003031 | Ga0207710_100030314 | 181 |
| 864 | 3300025901 | Ga0207688_10187467 | Ga0207688_101874671 | 181 |
| 865 | 3300025903 | Ga0207680_10000385 | Ga0207680_1000038516 | 181 |
| 866 | 3300025903 | Ga0207680_10025294 | Ga0207680_100252942 | 181 |
| 867 | 3300025904 | Ga0207647_10000360 | Ga0207647_1000036035 | 181 |
| 868 | 3300025904 | Ga0207647_10077169 | Ga0207647_100771692 | 181 |
| 869 | 3300025907 | Ga0207645_10025070 | Ga0207645_100250702 | 181 |
| 870 | 3300025907 | Ga0207645_10086048 | Ga0207645_100860482 | 181 |
| 871 | 3300025907 | Ga0207645_10198770 | Ga0207645_101987701 | 181 |
| 872 | 3300025908 | Ga0207643_10016472 | Ga0207643_100164723 | 181 |
| 873 | 3300025908 | Ga0207643_10199378 | Ga0207643_101993781 | 181 |
| 874 | 3300025909 | Ga0207705_10155999 | Ga0207705_101559992 | 181 |
| 875 | 3300025911 | Ga0207654_10002893 | Ga0207654_100028935 | 181 |
| 876 | 3300025911 | Ga0207654_10026459 | Ga0207654_100264594 | 181 |
| 877 | 3300025913 | Ga0207695_10501901 | Ga0207695_105019012 | 181 |
| 878 | 3300025914 | Ga0207671_10001454 | Ga0207671_1000145421 | 181 |
| 879 | 3300025914 | Ga0207671_10134205 | Ga0207671_101342053 | 181 |
| 880 | 3300025918 | Ga0207662_10004557 | Ga0207662_100045578 | 181 |
| 881 | 3300025918 | Ga0207662_10364309 | Ga0207662_103643092 | 181 |
| 882 | 3300025919 | Ga0207657_10047791 | Ga0207657_100477912 | 181 |
| 883 | 3300025919 | Ga0207657_10104170 | Ga0207657_101041702 | 181 |
| 884 | 3300025920 | Ga0207649_10002808 | Ga0207649_1000280810 | 181 |
| 885 | 3300025920 | Ga0207649_10004375 | Ga0207649_100043757 | 181 |
| 886 | 3300025920 | Ga0207649_10625674 | Ga0207649_106256742 | 181 |
| 887 | 3300025920 | Ga0207649_10808636 | Ga0207649_108086362 | 181 |
| 888 | 3300025921 | Ga0207652_10000144 | Ga0207652_1000014441 | 181 |
| 889 | 3300025921 | Ga0207652_10025262 | Ga0207652_100252622 | 181 |
| 890 | 3300025923 | Ga0207681_10169560 | Ga0207681_101695602 | 181 |
| 891 | 3300025925 | Ga0207650_10000886 | Ga0207650_100008866 | 181 |
| 892 | 3300025925 | Ga0207650_10054122 | Ga0207650_100541224 | 181 |
| 893 | 3300025925 | Ga0207650_10390211 | Ga0207650_103902112 | 181 |
| 894 | 3300025925 | Ga0207650_10531116 | Ga0207650_105311161 | 181 |
| 895 | 3300025926 | Ga0207659_10047426 | Ga0207659_100474264 | 181 |
| 896 | 3300025926 | Ga0207659_10060415 | Ga0207659_100604155 | 181 |
| 897 | 3300025926 | Ga0207659_10143781 | Ga0207659_101437812 | 181 |
| 898 | 3300025926 | Ga0207659_10148180 | Ga0207659_101481802 | 181 |
| 899 | 3300025926 | Ga0207659_10202966 | Ga0207659_102029662 | 181 |
| 900 | 3300025928 | Ga0207700_10173559 | Ga0207700_101735592 | 181 |
| 901 | 3300025931 | Ga0207644_10189340 | Ga0207644_101893402 | 181 |
| 902 | 3300025931 | Ga0207644_10982591 | Ga0207644_109825912 | 181 |
| 903 | 3300025932 | Ga0207690_10018918 | Ga0207690_100189182 | 181 |
| 904 | 3300025932 | Ga0207690_10054218 | Ga0207690_100542183 | 181 |
| 905 | 3300025932 | Ga0207690_10422486 | Ga0207690_104224861 | 181 |
| 906 | 3300025932 | Ga0207690_10670583 | Ga0207690_106705832 | 181 |
| 907 | 3300025933 | Ga0207706_10003683 | Ga0207706_100036838 | 181 |
| 908 | 3300025933 | Ga0207706_10010531 | Ga0207706_100105312 | 181 |
| 909 | 3300025933 | Ga0207706_10017175 | Ga0207706_100171755 | 181 |
| 910 | 3300025933 | Ga0207706_10101041 | Ga0207706_101010412 | 181 |
| 911 | 3300025934 | Ga0207686_10026799 | Ga0207686_100267992 | 181 |
| 912 | 3300025934 | Ga0207686_10084286 | Ga0207686_100842862 | 181 |
| 913 | 3300025936 | Ga0207670_10006649 | Ga0207670_100066494 | 181 |
| 914 | 3300025936 | Ga0207670_10076842 | Ga0207670_100768422 | 181 |
| 915 | 3300025936 | Ga0207670_10665873 | Ga0207670_106658732 | 181 |
| 916 | 3300025937 | Ga0207669_10036603 | Ga0207669_100366032 | 181 |
| 917 | 3300025938 | Ga0207704_10059094 | Ga0207704_100590944 | 181 |
| 918 | 3300025940 | Ga0207691_10071677 | Ga0207691_100716773 | 181 |
| 919 | 3300025942 | Ga0207689_10001807 | Ga0207689_100018073 | 181 |
| 920 | 3300025942 | Ga0207689_10038046 | Ga0207689_100380461 | 181 |
| 921 | 3300025942 | Ga0207689_10061252 | Ga0207689_100612524 | 181 |
| 922 | 3300025942 | Ga0207689_10064252 | Ga0207689_100642522 | 181 |
| 923 | 3300025942 | Ga0207689_10068029 | Ga0207689_100680293 | 181 |
| 924 | 3300025942 | Ga0207689_10237167 | Ga0207689_102371672 | 181 |
| 925 | 3300025944 | Ga0207661_10044753 | Ga0207661_100447532 | 181 |
| 926 | 3300025944 | Ga0207661_10086625 | Ga0207661_100866253 | 181 |
| 927 | 3300025944 | Ga0207661_10200568 | Ga0207661_102005682 | 181 |
| 928 | 3300025944 | Ga0207661_10661475 | Ga0207661_106614751 | 181 |
| 929 | 3300025945 | Ga0207679_10035069 | Ga0207679_100350692 | 181 |
| 930 | 3300025945 | Ga0207679_10208287 | Ga0207679_102082872 | 181 |
| 931 | 3300025945 | Ga0207679_10281206 | Ga0207679_102812062 | 181 |
| 932 | 3300025945 | Ga0207679_10989854 | Ga0207679_109898541 | 181 |
| 933 | 3300025945 | Ga0207679_11203457 | Ga0207679_112034571 | 181 |
| 934 | 3300025945 | Ga0207679_11487137 | Ga0207679_114871371 | 181 |
| 935 | 3300025949 | Ga0207667_10897767 | Ga0207667_108977672 | 181 |
| 936 | 3300025960 | Ga0207651_10010650 | Ga0207651_100106502 | 181 |
| 937 | 3300025960 | Ga0207651_10012494 | Ga0207651_100124944 | 181 |
| 938 | 3300025960 | Ga0207651_10037783 | Ga0207651_100377833 | 181 |
| 939 | 3300025960 | Ga0207651_10377263 | Ga0207651_103772632 | 181 |
| 940 | 3300025960 | Ga0207651_11170251 | Ga0207651_111702511 | 181 |
| 941 | 3300025961 | Ga0207712_10250565 | Ga0207712_102505651 | 181 |
| 942 | 3300025961 | Ga0207712_10608735 | Ga0207712_106087352 | 181 |
| 943 | 3300025972 | Ga0207668_10284483 | Ga0207668_102844832 | 181 |
| 944 | 3300025972 | Ga0207668_10422123 | Ga0207668_104221231 | 181 |
| 945 | 3300025972 | Ga0207668_10560571 | Ga0207668_105605711 | 181 |
| 946 | 3300025981 | Ga0207640_10094771 | Ga0207640_100947712 | 181 |
| 947 | 3300025981 | Ga0207640_10588963 | Ga0207640_105889631 | 181 |
| 948 | 3300025981 | Ga0207640_10741026 | Ga0207640_107410262 | 181 |
| 949 | 3300025981 | Ga0207640_10820015 | Ga0207640_108200151 | 181 |
| 950 | 3300025986 | Ga0207658_10010035 | Ga0207658_100100357 | 181 |
| 951 | 3300025986 | Ga0207658_10015647 | Ga0207658_100156475 | 181 |
| 952 | 3300025986 | Ga0207658_10085836 | Ga0207658_100858362 | 181 |
| 953 | 3300025986 | Ga0207658_10533184 | Ga0207658_105331841 | 181 |
| 954 | 3300025986 | Ga0207658_10902826 | Ga0207658_109028262 | 181 |
| 955 | 3300026023 | Ga0207677_10034608 | Ga0207677_100346083 | 181 |
| 956 | 3300026023 | Ga0207677_10121384 | Ga0207677_101213842 | 181 |
| 957 | 3300026023 | Ga0207677_10402460 | Ga0207677_104024601 | 181 |
| 958 | 3300026023 | Ga0207677_10469216 | Ga0207677_104692161 | 181 |
| 959 | 3300026035 | Ga0207703_10011653 | Ga0207703_100116534 | 181 |
| 960 | 3300026035 | Ga0207703_10166753 | Ga0207703_101667532 | 181 |
| 961 | 3300026035 | Ga0207703_10171092 | Ga0207703_101710922 | 181 |
| 962 | 3300026035 | Ga0207703_10173298 | Ga0207703_101732982 | 181 |
| 963 | 3300026035 | Ga0207703_10353098 | Ga0207703_103530981 | 181 |
| 964 | 3300026035 | Ga0207703_11219852 | Ga0207703_112198521 | 181 |
| 965 | 3300026041 | Ga0207639_10017754 | Ga0207639_100177548 | 181 |
| 966 | 3300026041 | Ga0207639_10193318 | Ga0207639_101933183 | 181 |
| 967 | 3300026041 | Ga0207639_10274230 | Ga0207639_102742303 | 181 |
| 968 | 3300026041 | Ga0207639_10517415 | Ga0207639_105174152 | 181 |
| 969 | 3300026067 | Ga0207678_10013249 | Ga0207678_100132496 | 181 |
| 970 | 3300026067 | Ga0207678_10473976 | Ga0207678_104739762 | 181 |
| 971 | 3300026075 | Ga0207708_10270332 | Ga0207708_102703322 | 181 |
| 972 | 3300026075 | Ga0207708_10277100 | Ga0207708_102771002 | 181 |
| 973 | 3300026078 | Ga0207702_10096906 | Ga0207702_100969062 | 181 |
| 974 | 3300026078 | Ga0207702_10833731 | Ga0207702_108337311 | 181 |
| 975 | 3300026088 | Ga0207641_10000026 | Ga0207641_1000002651 | 181 |
| 976 | 3300026088 | Ga0207641_10176113 | Ga0207641_101761132 | 181 |
| 977 | 3300026088 | Ga0207641_11260860 | Ga0207641_112608602 | 181 |
| 978 | 3300026089 | Ga0207648_10001213 | Ga0207648_1000121325 | 181 |
| 979 | 3300026089 | Ga0207648_10007648 | Ga0207648_100076488 | 181 |
| 980 | 3300026089 | Ga0207648_10014790 | Ga0207648_100147904 | 181 |
| 981 | 3300026089 | Ga0207648_10257316 | Ga0207648_102573161 | 181 |
| 982 | 3300026089 | Ga0207648_10341461 | Ga0207648_103414611 | 181 |
| 983 | 3300026089 | Ga0207648_10435514 | Ga0207648_104355141 | 181 |
| 984 | 3300026095 | Ga0207676_10003733 | Ga0207676_1000373311 | 181 |
| 985 | 3300026095 | Ga0207676_10110561 | Ga0207676_101105612 | 181 |
| 986 | 3300026095 | Ga0207676_10165085 | Ga0207676_101650852 | 181 |
| 987 | 3300026095 | Ga0207676_10250562 | Ga0207676_102505622 | 181 |
| 988 | 3300026095 | Ga0207676_10828548 | Ga0207676_108285481 | 181 |
| 989 | 3300026116 | Ga0207674_10001740 | Ga0207674_1000174022 | 181 |
| 990 | 3300026116 | Ga0207674_10035333 | Ga0207674_100353335 | 181 |
| 991 | 3300026116 | Ga0207674_10045794 | Ga0207674_100457942 | 181 |
| 992 | 3300026116 | Ga0207674_10074285 | Ga0207674_100742851 | 181 |
| 993 | 3300026116 | Ga0207674_10164728 | Ga0207674_101647282 | 181 |
| 994 | 3300026116 | Ga0207674_10394279 | Ga0207674_103942792 | 181 |
| 995 | 3300026116 | Ga0207674_10525345 | Ga0207674_105253452 | 181 |
| 996 | 3300026116 | Ga0207674_11371301 | Ga0207674_113713011 | 181 |
| 997 | 3300026118 | Ga0207675_100022617 | Ga0207675_1000226175 | 181 |
| 998 | 3300026118 | Ga0207675_100109559 | Ga0207675_1001095593 | 181 |
| 999 | 3300026118 | Ga0207675_100155014 | Ga0207675_1001550142 | 181 |
| 1000 | 3300026118 | Ga0207675_100306487 | Ga0207675_1003064872 | 181 |
| 1001 | 3300026118 | Ga0207675_100409708 | Ga0207675_1004097082 | 181 |
| 1002 | 3300026121 | Ga0207683_10025008 | Ga0207683_100250082 | 181 |
| 1003 | 3300026121 | Ga0207683_10218066 | Ga0207683_102180661 | 181 |
| 1004 | 3300026121 | Ga0207683_10682986 | Ga0207683_106829862 | 181 |
| 1005 | 3300026121 | Ga0207683_10718741 | Ga0207683_107187412 | 181 |
| 1006 | 3300026142 | Ga0207698_10000830 | Ga0207698_100008307 | 181 |
| 1007 | 3300026142 | Ga0207698_10138597 | Ga0207698_101385972 | 181 |
| 1008 | 3300026142 | Ga0207698_10359489 | Ga0207698_103594892 | 181 |
| 1009 | 3300026142 | Ga0207698_10392394 | Ga0207698_103923942 | 181 |
| 1010 | 3300026142 | Ga0207698_10483843 | Ga0207698_104838431 | 181 |
| 1011 | 3300026142 | Ga0207698_10535157 | Ga0207698_105351571 | 181 |
| 1012 | 3300026142 | Ga0207698_10859186 | Ga0207698_108591861 | 181 |
| 1013 | 3300026142 | Ga0207698_11613923 | Ga0207698_116139231 | 181 |
| 1014 | 3300026142 | Ga0207698_11801735 | Ga0207698_118017351 | 181 |
| 1015 | 3300027543 | Ga0209999_1058914 | Ga0209999_10589142 | 181 |
| 1016 | 3300027876 | Ga0209974_10022087 | Ga0209974_100220873 | 181 |
| 1017 | 3300027907 | Ga0207428_10074787 | Ga0207428_100747873 | 181 |
| 1018 | 3300028379 | Ga0268266_10081492 | Ga0268266_100814922 | 181 |
| 1019 | 3300028380 | Ga0268265_10329942 | Ga0268265_103299422 | 181 |
| 1020 | 3300028381 | Ga0268264_10001210 | Ga0268264_1000121012 | 181 |
| 1021 | 3300028381 | Ga0268264_10002077 | Ga0268264_1000207715 | 181 |
| 1022 | 3300028381 | Ga0268264_10251916 | Ga0268264_102519162 | 181 |
| 1023 | 3300028381 | Ga0268264_10389131 | Ga0268264_103891312 | 181 |
| 1024 | 3300028794 | Ga0307515_10001389 | Ga0307515_100013894 | 181 |
| 1025 | 3300028794 | Ga0307515_10513749 | Ga0307515_105137492 | 181 |
| 1026 | 3300031247 | Ga0265340_10064939 | Ga0265340_100649392 | 181 |
| 1027 | 3300031250 | Ga0265331_10244831 | Ga0265331_102448311 | 181 |
| 1028 | 3300031251 | Ga0265327_10000013 | Ga0265327_10000013412 | 181 |
| 1029 | 3300031456 | Ga0307513_10082237 | Ga0307513_100822375 | 181 |
| 1030 | 3300031456 | Ga0307513_10573527 | Ga0307513_105735271 | 181 |
| 1031 | 3300031456 | Ga0307513_10783611 | Ga0307513_107836111 | 181 |
| 1032 | 3300031616 | Ga0307508_10000111 | Ga0307508_1000011141 | 181 |
| 1033 | 3300031711 | Ga0265314_10058741 | Ga0265314_100587413 | 181 |
| 1034 | 3300032004 | Ga0307414_10183423 | Ga0307414_101834232 | 181 |
| 1035 | 3300032004 | Ga0307414_10473802 | Ga0307414_104738022 | 181 |
| 1036 | 3300033180 | Ga0307510_10001684 | Ga0307510_1000168412 | 181 |
| 1037 | 3300035086 | Ga0373934_0019498 | Ga0373934_0019498_105_656 | 181 |
| 1038 | 3300035111 | Ga0373923_0438285 | Ga0373923_0438285_47_598 | 181 |
| 1039 | 3300035120 | Ga0373957_0110685 | Ga0373957_0110685_509_1060 | 181 |
| 1040 | 3300035410 | Ga0373924_0010674 | Ga0373924_0010674_226_777 | 181 |
| 1041 | 3300035724 | Ga0373933_0270837 | Ga0373933_0270837_128_679 | 181 |
| 1042 | 3300036401 | Ga0373937_0068823 | Ga0373937_0068823_2487_3038 | 181 |
| 1043 | 3300036401 | Ga0373937_0200324 | Ga0373937_0200324_1271_1816 | 181 |
| 1044 | 3300037068 | Ga0373925_0470400 | Ga0373925_0470400_417_962 | 181 |
| 1045 | 3300037312 | Ga0395899_0020958 | Ga0395899_0020958_927_1475 | 181 |
| 1046 | 3300037312 | Ga0395899_0322872 | Ga0395899_0322872_141_689 | 181 |
| 1047 | 3300037418 | Ga0395900_0056510 | Ga0395900_0056510_581_1129 | 181 |
| 1048 | 3300037418 | Ga0395900_0128740 | Ga0395900_0128740_1500_2048 | 181 |
| 1049 | 3300037466 | Ga0395898_0020188 | Ga0395898_0020188_2865_3413 | 181 |
| 1050 | 3300038443 | Ga0395901_0025466 | Ga0395901_0025466_1176_1724 | 181 |
| 1051 | 3300039437 | Ga0436365_0497393 | Ga0436365_0497393_155_700 | 181 |
| 1052 | 3300041404 | Ga0439436_0012141 | Ga0439436_0012141_1661_2206 | 181 |
| 1053 | 3300041406 | Ga0439439_0024462 | Ga0439439_0024462_350_895 | 181 |
| 1054 | 3300041406 | Ga0439439_0054428 | Ga0439439_0054428_40_585 | 181 |
| 1055 | 3300041456 | Ga0451795_0085537 | Ga0451795_0085537_448_993 | 181 |
| 1056 | 3300041491 | Ga0451833_0278687 | Ga0451833_0278687_43_588 | 181 |
| 1057 | 3300041496 | Ga0451839_1215289 | Ga0451839_1215289_46_597 | 181 |
| 1058 | 3300041507 | Ga0451851_0050209 | Ga0451851_0050209_513_1058 | 181 |
| 1059 | 3300041997 | Ga0439431_0194051 | Ga0439431_0194051_23_568 | 181 |
| 1060 | 3300042007 | Ga0439449_0021289 | Ga0439449_0021289_1095_1640 | 181 |
| 1061 | 3300042007 | Ga0439449_0058701 | Ga0439449_0058701_762_1307 | 181 |
| 1062 | 3300042007 | Ga0439449_0105950 | Ga0439449_0105950_250_795 | 181 |
| 1063 | 3300042014 | Ga0439457_013480 | Ga0439457_013480_563_1108 | 181 |
| 1064 | 3300042014 | Ga0439457_035535 | Ga0439457_035535_89_634 | 181 |
| 1065 | 3300042014 | Ga0439457_070358 | Ga0439457_070358_14_559 | 181 |
| 1066 | 3300042014 | Ga0439457_121145 | Ga0439457_121145_37_582 | 181 |
| 1067 | 3300044658 | Ga0466972_0000080 | Ga0466972_0000080_16148_16693 | 181 |
| 1068 | 3300044658 | Ga0466972_0042617 | Ga0466972_0042617_1053_1598 | 181 |
| 1069 | 3300044684 | Ga0466966_0000096 | Ga0466966_0000096_26291_26836 | 181 |
| 1070 | 3300044712 | Ga0453684_0019697 | Ga0453684_0019697_5619_6164 | 181 |
| 1071 | 3300044735 | Ga0466968_0024425 | Ga0466968_0024425_95_640 | 181 |
| 1072 | 3300044735 | Ga0466968_0084148 | Ga0466968_0084148_683_1228 | 181 |
| 1073 | 3300044735 | Ga0466968_0112026 | Ga0466968_0112026_142_687 | 181 |
| 1074 | 3300044765 | Ga0466970_0580314 | Ga0466970_0580314_18_563 | 181 |
| 1075 | 3300044842 | Ga0466957_0001278 | Ga0466957_0001278_6944_7489 | 181 |
| 1076 | 3300044842 | Ga0466957_0147062 | Ga0466957_0147062_842_1387 | 181 |
| 1077 | 3300045049 | Ga0466959_0000014 | Ga0466959_0000014_30489_31034 | 181 |
| 1078 | 3300045051 | Ga0451576_0168670 | Ga0451576_0168670_334_879 | 181 |
| 1079 | 3300045051 | Ga0451576_0493688 | Ga0451576_0493688_358_903 | 181 |
| 1080 | 3300046460 | Ga0495638_0091661 | Ga0495638_0091661_799_1344 | 181 |
| 1081 | 3300046463 | Ga0495653_0046892 | Ga0495653_0046892_2605_3156 | 181 |
| 1082 | 3300046471 | Ga0495650_0014644 | Ga0495650_0014644_1154_1699 | 181 |
| 1083 | 3300046473 | Ga0495582_0317533 | Ga0495582_0317533_81_632 | 181 |
| 1084 | 3300046516 | Ga0495628_0288377 | Ga0495628_0288377_418_969 | 181 |
| 1085 | 3300046517 | Ga0495630_0534010 | Ga0495630_0534010_222_773 | 181 |
| 1086 | 3300046543 | Ga0495645_0232387 | Ga0495645_0232387_163_714 | 181 |
| 1087 | 3300046559 | Ga0495667_0038657 | Ga0495667_0038657_1149_1700 | 181 |
| 1088 | 3300046616 | Ga0495668_0003219 | Ga0495668_0003219_8453_8998 | 181 |
| 1089 | 3300046642 | Ga0495634_0043429 | Ga0495634_0043429_2169_2720 | 181 |
| 1090 | 3300046660 | Ga0495625_0650538 | Ga0495625_0650538_18_563 | 181 |
| 1091 | 3300046663 | Ga0495635_0245531 | Ga0495635_0245531_149_700 | 181 |
| 1092 | 3300046675 | Ga0495657_0173641 | Ga0495657_0173641_765_1316 | 181 |
| 1093 | 3300046678 | Ga0495599_0073930 | Ga0495599_0073930_136_687 | 181 |
| 1094 | 3300046689 | Ga0495613_0212328 | Ga0495613_0212328_758_1309 | 181 |
| 1095 | 3300047315 | Ga0495581_0304871 | Ga0495581_0304871_117_785 | 181 |
| 1096 | 3300047319 | Ga0495674_0035491 | Ga0495674_0035491_151_702 | 181 |
| 1097 | 3300047320 | Ga0495672_0009163 | Ga0495672_0009163_973_1518 | 181 |
| 1098 | 3300047320 | Ga0495672_0014024 | Ga0495672_0014024_2484_3029 | 181 |
| 1099 | 3300047321 | Ga0495676_0144496 | Ga0495676_0144496_102_653 | 181 |
| 1100 | 3300047322 | Ga0495680_0082504 | Ga0495680_0082504_753_1304 | 181 |
| 1101 | 3300047471 | Ga0495684_0150059 | Ga0495684_0150059_162_713 | 181 |
| 1102 | 3300047471 | Ga0495684_0413791 | Ga0495684_0413791_154_699 | 181 |
| 1103 | 3300048903 | Ga0496100_0484399 | Ga0496100_0484399_120_671 | 181 |
| 1104 | 3300048904 | Ga0496101_1150944 | Ga0496101_1150944_32_583 | 181 |
| 1105 | 3300048910 | Ga0496107_0736356 | Ga0496107_0736356_107_658 | 181 |
| 1106 | 3300048913 | Ga0496110_0031968 | Ga0496110_0031968_3748_4323 | 181 |
| 1107 | 3300048915 | Ga0496112_0269226 | Ga0496112_0269226_625_1200 | 181 |
| 1108 | 3300049513 | Ga0501290_001460 | Ga0501290_001460_896_1441 | 181 |
| 1109 | 3300049519 | Ga0501296_024522 | Ga0501296_024522_133_678 | 181 |
| 1110 | 3300049521 | Ga0501298_003874 | Ga0501298_003874_1259_1804 | 181 |
| 1111 | 3300049569 | Ga0501032_0063789 | Ga0501032_0063789_967_1512 | 181 |
| 1112 | 3300049570 | Ga0501033_0201147 | Ga0501033_0201147_26_577 | 181 |
| 1113 | 3300049571 | Ga0501034_0000152 | Ga0501034_0000152_86764_87315 | 181 |
| 1114 | 3300049571 | Ga0501034_0011131 | Ga0501034_0011131_7973_8518 | 181 |
| 1115 | 3300049571 | Ga0501034_0068545 | Ga0501034_0068545_1836_2381 | 181 |
| 1116 | 3300049571 | Ga0501034_0687373 | Ga0501034_0687373_93_638 | 181 |
| 1117 | 3300049572 | Ga0501036_0000845 | Ga0501036_0000845_19467_20012 | 181 |
| 1118 | 3300049572 | Ga0501036_0877770 | Ga0501036_0877770_64_609 | 181 |
| 1119 | 3300049572 | Ga0501036_1185225 | Ga0501036_1185225_68_613 | 181 |
| 1120 | 3300049573 | Ga0501037_0006935 | Ga0501037_0006935_4143_4688 | 181 |
| 1121 | 3300049573 | Ga0501037_0517378 | Ga0501037_0517378_179_724 | 181 |
| 1122 | 3300049574 | Ga0501038_0037776 | Ga0501038_0037776_1302_1847 | 181 |
| 1123 | 3300049575 | Ga0501039_0012691 | Ga0501039_0012691_5327_5872 | 181 |
| 1124 | 3300049579 | Ga0501043_0005938 | Ga0501043_0005938_7973_8518 | 181 |
| 1125 | 3300049579 | Ga0501043_0154073 | Ga0501043_0154073_386_931 | 181 |
| 1126 | 3300049579 | Ga0501043_0292015 | Ga0501043_0292015_10_555 | 181 |
| 1127 | 3300049580 | Ga0501046_0045889 | Ga0501046_0045889_883_1428 | 181 |
| 1128 | 3300049581 | Ga0501047_0061465 | Ga0501047_0061465_1794_2339 | 181 |
| 1129 | 3300049581 | Ga0501047_0099646 | Ga0501047_0099646_132_677 | 181 |
| 1130 | 3300049581 | Ga0501047_0532496 | Ga0501047_0532496_196_741 | 181 |
| 1131 | 3300049582 | Ga0501048_0007829 | Ga0501048_0007829_6029_6574 | 181 |
| 1132 | 3300049584 | Ga0501068_0038801 | Ga0501068_0038801_1288_1833 | 181 |
| 1133 | 3300049586 | Ga0501070_0003721 | Ga0501070_0003721_8178_8723 | 181 |
| 1134 | 3300049589 | Ga0501073_0065635 | Ga0501073_0065635_416_961 | 181 |
| 1135 | 3300049590 | Ga0501074_0000310 | Ga0501074_0000310_22437_22982 | 181 |
| 1136 | 3300049652 | Ga0501202_000352 | Ga0501202_000352_1431_1976 | 181 |
| 1137 | 3300049653 | Ga0501206_002631 | Ga0501206_002631_1649_2194 | 181 |
| 1138 | 3300049654 | Ga0501207_001265 | Ga0501207_001265_1832_2377 | 181 |
| 1139 | 3300049661 | Ga0501217_000979 | Ga0501217_000979_1541_2086 | 181 |
| 1140 | 3300049662 | Ga0501222_001624 | Ga0501222_001624_1099_1644 | 181 |
| 1141 | 3300049663 | Ga0501223_001473 | Ga0501223_001473_1874_2419 | 181 |
| 1142 | 3300049664 | Ga0501224_001055 | Ga0501224_001055_1219_1764 | 181 |
| 1143 | 3300049668 | Ga0501233_002017 | Ga0501233_002017_1161_1706 | 181 |
| 1144 | 3300049669 | Ga0501235_000033 | Ga0501235_000033_1219_1764 | 181 |
| 1145 | 3300049673 | Ga0501240_003815 | Ga0501240_003815_202_747 | 181 |
| 1146 | 3300049674 | Ga0501242_000410 | Ga0501242_000410_1344_1889 | 181 |
| 1147 | 3300049675 | Ga0501243_005195 | Ga0501243_005195_1103_1648 | 181 |
| 1148 | 3300049679 | Ga0501249_066909 | Ga0501249_066909_234_779 | 181 |
| 1149 | 3300049682 | Ga0501252_025281 | Ga0501252_025281_48_593 | 181 |
| 1150 | 3300049686 | Ga0501257_003324 | Ga0501257_003324_1758_2303 | 181 |
| 1151 | 3300049688 | Ga0501259_001910 | Ga0501259_001910_1303_1848 | 181 |
| 1152 | 3300049690 | Ga0501261_001114 | Ga0501261_001114_869_1414 | 181 |
| 1153 | 3300049704 | Ga0501221_000390 | Ga0501221_000390_5002_5547 | 181 |
| 1154 | 3300049705 | Ga0501225_0001669 | Ga0501225_0001669_936_1481 | 181 |
| 1155 | 3300049705 | Ga0501225_0002369 | Ga0501225_0002369_318_863 | 181 |
| 1156 | 3300049706 | Ga0501229_016862 | Ga0501229_016862_141_686 | 181 |
| 1157 | 3300049706 | Ga0501229_033920 | Ga0501229_033920_127_672 | 181 |
| 1158 | 3300049707 | Ga0501234_002103 | Ga0501234_002103_1035_1580 | 181 |
| 1159 | 3300049708 | Ga0501245_001585 | Ga0501245_001585_1104_1649 | 181 |
| 1160 | 3300049741 | Ga0501079_0012410 | Ga0501079_0012410_3960_4505 | 181 |
| 1161 | 3300049742 | Ga0501080_0075085 | Ga0501080_0075085_2184_2729 | 181 |
| 1162 | 3300049742 | Ga0501080_0535982 | Ga0501080_0535982_98_643 | 181 |
| 1163 | 3300049744 | Ga0501083_0059502 | Ga0501083_0059502_557_1102 | 181 |
| 1164 | 3300049757 | Ga0501232_006551 | Ga0501232_006551_337_882 | 181 |
| 1165 | 3300049761 | Ga0501264_001553 | Ga0501264_001553_1576_2121 | 181 |
| 1166 | 3300049765 | Ga0501268_085470 | Ga0501268_085470_46_591 | 181 |
| 1167 | 3300049767 | Ga0501270_054774 | Ga0501270_054774_121_666 | 181 |
| 1168 | 3300049768 | Ga0501271_000833 | Ga0501271_000833_1491_2036 | 181 |
| 1169 | 3300049775 | Ga0501279_003477 | Ga0501279_003477_1496_2041 | 181 |
| 1170 | 3300049776 | Ga0501280_040657 | Ga0501280_040657_134_679 | 181 |
| 1171 | 3300049822 | Ga0501035_0001685 | Ga0501035_0001685_369_914 | 181 |
| 1172 | 3300049822 | Ga0501035_0215869 | Ga0501035_0215869_693_1238 | 181 |
| 1173 | 3300049822 | Ga0501035_0221868 | Ga0501035_0221868_232_777 | 181 |
| 1174 | 3300049823 | Ga0501044_0001606 | Ga0501044_0001606_21420_21965 | 181 |
| 1175 | 3300049823 | Ga0501044_0116978 | Ga0501044_0116978_1061_1606 | 181 |
| 1176 | 3300049823 | Ga0501044_0222518 | Ga0501044_0222518_127_672 | 181 |
| 1177 | 3300049824 | Ga0501045_0015281 | Ga0501045_0015281_865_1410 | 181 |
| 1178 | 3300049851 | Ga0501212_000830 | Ga0501212_000830_1572_2117 | 181 |
| 1179 | 3300050493 | nmdc:mga0k408_147843_c1 | nmdc:mga0k408_147843_c1_31_576 | 181 |
| 1180 | 3300050496 | nmdc:mga07m45_362465_c1 | nmdc:mga07m45_362465_c1_98_643 | 181 |
| 1181 | 3300050507 | nmdc:mga05p37_3268_c1 | nmdc:mga05p37_3268_c1_13807_14352 | 181 |
| 1182 | 3300050511 | nmdc:mga08y16_111150_c1 | nmdc:mga08y16_111150_c1_310_855 | 181 |
| 1183 | 3300050511 | nmdc:mga08y16_415625_c1 | nmdc:mga08y16_415625_c1_82_627 | 181 |
| 1184 | 3300050511 | nmdc:mga08y16_513560_c1 | nmdc:mga08y16_513560_c1_468_1013 | 181 |
| 1185 | 3300050512 | nmdc:mga0n895_1385888_c1 | nmdc:mga0n895_1385888_c1_90_635 | 181 |
| 1186 | 3300050512 | nmdc:mga0n895_351149_c1 | nmdc:mga0n895_351149_c1_223_768 | 181 |
| 1187 | 3300050512 | nmdc:mga0n895_890779_c1 | nmdc:mga0n895_890779_c1_311_862 | 181 |
| 1188 | 3300053086 | Ga0500578_0000325 | Ga0500578_0000325_40912_41457 | 181 |
| 1189 | 3300053086 | Ga0500578_0448195 | Ga0500578_0448195_105_650 | 181 |
| 1190 | 3300053088 | Ga0500644_0028140 | Ga0500644_0028140_1072_1617 | 181 |
| 1191 | 3300053090 | Ga0500646_0258448 | Ga0500646_0258448_54_599 | 181 |
| 1192 | 3300053092 | Ga0500583_0000001 | Ga0500583_0000001_21268_21813 | 181 |
| 1193 | 3300053092 | Ga0500583_0000611 | Ga0500583_0000611_2641_3186 | 181 |
| 1194 | 3300053096 | Ga0500641_0036500 | Ga0500641_0036500_839_1384 | 181 |
| 1195 | 3300053098 | Ga0500650_0064328 | Ga0500650_0064328_494_1039 | 181 |
| 1196 | 3300053098 | Ga0500650_0084187 | Ga0500650_0084187_325_870 | 181 |
| 1197 | 3300053118 | Ga0500594_0028447 | Ga0500594_0028447_266_811 | 181 |
| 1198 | 3300053131 | Ga0500652_106860 | Ga0500652_106860_374_919 | 181 |
| 1199 | 3300053134 | Ga0500658_0099186 | Ga0500658_0099186_381_926 | 181 |
| 1200 | 3300053136 | Ga0500559_0147057 | Ga0500559_0147057_176_721 | 181 |
| 1201 | 3300053139 | Ga0500568_0000380 | Ga0500568_0000380_18378_18923 | 181 |
| 1202 | 3300053146 | Ga0500588_0121823 | Ga0500588_0121823_232_777 | 181 |
| 1203 | 3300053153 | Ga0500616_0092276 | Ga0500616_0092276_865_1410 | 181 |
| 1204 | 3300053156 | Ga0500622_0009755 | Ga0500622_0009755_549_1094 | 181 |
| 1205 | 3300053156 | Ga0500622_0069751 | Ga0500622_0069751_875_1420 | 181 |
| 1206 | 3300053163 | Ga0500639_017671 | Ga0500639_017671_1569_2120 | 181 |
| 1207 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_210432_210977 | 181 |
| 1208 | 3300054114 | Ga0501084_0080337 | Ga0501084_0080337_1302_1847 | 181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar